| Download: |  |
| Mirror Download [FCC.gov] |  |
| Document ID | 330124 |
| Application ID | NzSeCLT39LMT0Hra6Eo2Bw== |
| Document Description | Manual DE1748 |
| Short Term Confidential | No |
| Permanent Confidential | No |
| Supercede | No |
| Document Type | User Manual |
| Display Format | Adobe Acrobat PDF - pdf |
| Filesize | 230.1kB (2876304 bits) |
| Date Submitted | 2003-06-04 00:00:00 |
| Date Available | 2003-06-04 00:00:00 |
| Creation Date | 2003-03-12 11:47:02 |
| Producing Software | Adobe PDF library 5.00 |
| Document Lastmod | 2003-03-12 11:47:09 |
| Document Title | Manual DE1748 |
| Document Creator | Adobe Illustrator 10.0.3 |
Reset Features ,
All user features can be reset to —actory settings
l‘ you have questiors concerning the
operation oithis Whistler product
please call.
CUSTOMER SERVICE
1-800-531-0004
Monday . Fridsy - 803 an . 5 00 pm CT
or visit our website
wwwmlrisflergmupxom
Please keep the receipt in a saie piece Vou
may register your plcduci online
at www.whistleigroiip.comu For warranty
verification purposes, a copy of your
dated store receipt must still accompany
any unit sent in for warranty work. lithe
unit is returned Without 3 dated store receipt
an out oi warranty service crarge applies.
Note: Your warranty period begins at the
time oipurchase. The warranty is validated
only by the dated store receipt! Now is the
time to record the serial number of the unit
in the space provided in the warranty section
of the manual
JsarWristlarOvvirtr,
Formanyo— us aiiehicle is more than ycst transponaticn li
sen be a mobile ciice, coiiiiiviiicetiois o eitcitaiiiriciit
center, or snpy an expresson of cur persorality whister
aroducts are designed to make he time you scene in vcur
vehicle more product rro’e luifliing, selcr, or yust simply
more fun Our mssicn is to provide products tret move
your driving Expc’lc
so
chr rehl Whister lass hedardetatior detec's al racer, laser
aidsafety iada systeiis
Tc idly acaueirt ycuisallvitr he operation of he WhlSter
die /lade'l detector and (3 deiiel ulldElS arc (is dlitelellues
setiveen detccnrg radar laser and Hey redarsgrels iiie
recennene reading this artiic manual or visit our FAc page
an au’ website iinvriwhistlargroup can
Enycyyovr ivhistlerane please d'heseisly
Sincerely,
The thiler Group, in
. Note: an 1748 model the compass must be
alibrated before use. See compass calibration set-up.
. Note Some units may display "P“ instead of ”H'
Both represent highway made.
Feature tisting at 17nd
- All Danaw
electroric Compass
EesyrtD—Urlde'stand Peal
3 city Modes
Quiet Mode
vehicle, Battery Saver
sett rig Sever
Voice® Alerts . Selectable icon Display
- 30)” Total Perimeter Tutorial Mode
Protectionm Stay Alert
. Patented yore
cloakingM Technology
. saloty vyai iiiiig systeinw
INSTALLATION
Mounting Guidelines
- Mount the uni as lcwas possbe nea’ the centeroi the
rviidsri d
. Do not mount yaiir irii behind wipers, nrnamnrrt, mirrored
sunscreers, etc Tress abstructors have metal sun
which can dial raderaro lasersigrals and redut critical
warring tiiiie ihegular iii ed glussciues iiuialtti retepiiuii
t uh rnustb e iorcompass oiunctorpropery
- siiner-niids iieids haieai lisiaolea’ or ticctnclea
coarirg vrhcli eiieci rada'Signals Consult yourd
awrersnaniialripaienivirhyaiirvehicleraneiermineii
you'windshlcdhastllscofltlllg
~ Arcid placing an in direct conteci Ni'hwmdshield
- To leduee the pussiui ll'r cl her, conceal ycui u ii. viiiei io.
in use
vile
r orthe
NS LL
windshield Mounting
- insuiiiiielivc sittiuiicupsaidroirlrcrtoiiiperciitu the
bracket by iitting hen into lhel' ho es
- Piessthe uctiorcupscntothewndsrield at he ocaicn
ynuhave hosen IMPORTANT: Some hewercars havea
plastic mietycnztirrg on the inside atthr vviridsh ld. This
Windshield bracltot may laaye pvrmanent marks on this
tyre oi surface. To find out it your vehicle has this type
a windshield, check the owner's manual or ask your
dealer. We recommend that you do not leave the suction
cup braciet on the window in direct sunlight. ii the
detector is rumored, this may cause blistering at the dash
in some vehicles
- Sid) ‘hc til ctoroliiciil: bracltci untl ii l>d<5 iriil: pldcc
- ii recessa r the uirit may be lsvclcd y bereirg tic
wiiusliieli bathe Press lire bracket roledae bbiiJl
and remove the deter tcr aelore bencing
Power Connection
- Plug the srnal end olihe tiwei cord nothe unit'sotiuei
yeek
- Plug the large end into he renisle‘scigarette ighiel
Fuse Replacement
The lighter socket ouo s eeuioped wth a rep aceable
7am: Aaliselaraien hehirniresilieitp T: replaceire
itise caieiuiyunscrewthetioeithepug
iMPoRTANTs tnscrervalcvily Th cantairaaspnngwhich
iiayliy ubl ivhen disasseirbirg iisait iha nevruseiriti he
string and stray, on the lip
wnh use, screw cap on plug may loosen. Rttighlen otca
sionaiiy
unscrca thr, ripo ihcligh oi snctc: plug . ciuly ivhcn rcplatirg
iheZunio us
NTRODU T ON BLE OF CONTENTS
Topic
Model Foatuns Summary
installation
Mourning Guldcllncs
windshield Mounting
. Power Connection Arid Fuse Replacement
Operation 9 . 13
. Compass Calibration Setup
- Power Orr And Sell Test
- Sell test Mute
. integrated Roai yoieew
- Memory Beep Confirmation
. Auto Quiet/Quiet Modes
. city Modes
. Dim/Dark Modes
- Engaging/Distrlgnglrlg vs 2 Detection
- Stay Alert
. option Select Mode
- Teach/Tutorial Mode
. vehicle Battery Saver Mode
Radar. LaSnr And we: Alerts
- Radar Alere
- Pulse Protectlvilfi)
- Safety Radar Audio/visual Alerts
G 2 Audio/visual Alone
Rea
3.94,
are
1345
are Maintenance
Troubleshootin Guido
Are Detectors egal?
Speed Monitoring Technologies
. Radar Facts
- Loser Facts
- Other Speed Detection Systems
- Radar Definor Detectors
Warra I armetian
spacn‘lgtiana
Accessories
15—16
1arl7
1749
w . 2l
zr . 22
22
OPERAT N
Compass Calibration SetrlJp line. only]
The unir vril reed to be calibrated in order or me
compass —o p'nildeazcuraie 'edclngs Ta calbra etheunit
itflr‘fl’n tie irlllflvrlng p‘nfefl no
i Mo irr he unit level in he rentcro— tnr vehir er
windshield nwiichitvuiiikiausao Makesvrc
there are no other magnetic sources noartho
detector ii t ,speakeil
Salt-L“ r largecear area iparkiig lot in lieidi riithctt
aryp iverines
Wh ie parked press both iclume buttons
similiarieaiisl irtilthercnrsassreadingsstart
iootzte N
w e
Driievehiria tlcwly nruocanpete riirias in
ether direction llcsliaraton dies rlzteuiorndtlcaly
iirish prc:s aeth volume but—one simultarcatrlyi t:
cuiiipeeceliliivtpi Tlieuniiwillbeep nice and
shorvcurreiil compass eadr
Note: iiuni iisuntingisiclcicarodin rohiclc, iii vlsil‘tO
rviiisliielci iiiouiiiiiig ui dash iiiauii iiigl, uril lie uiiiiisii ureu
tc enotherve'ilcle you me re(dllh’a'ethe compass
Power on Arid Sell-Test
Eachtrme yourWhistlerdetector is turned on, an auto—
matic seli—tesi sequence con’lrrls that the speaker and
visual displays are fun~tanal
Self-test Mute
Simply press the Quiet button during the selir'est
seguente to cancel tie stir—test aucio This ivili not
eilett radar/laser =lerts Tu restore ih e- aell—leat audio,
simply press the Quiet button during the next seli—test
FEATURE DESCR PT orirs FEATURE DESCR p orirs 1743/1744
Wris-ler 1743'1 744
12 it ‘ll ts it I7 ya
vvhistisrs ergonomic and user—irlerdlv design provides a R/Rasband indicator - Shot/rs the unit is reeeiv no a R or
new level oi operating convenience Special ieatures R band signal l l
lllululle Note. Not all units have all reatures listed. 14. K—hand Indicator shows the unit is receiving a K—Lerld
1. Bracket Release Button e Provides nuirk and easy signal
release oi the mounting bracket is. Ka-barrd indicator . shows the unit is receiiing a Ra
z. speaker—Provides distinct audio and Reel voiceli band i rial
warnings icr x R, Ra aand radar saiaty radar laser and 16. H , crii iri Highway mode
is 2 17. c . city indicator . Shows that the unii is Dperallriq in
3. Mounting Bracket Location A Slot holds niacin—ind city node t
bracket iiiriily is. signal Strength indicator a shows iiiestierigtii or the
4. Radar Antenna e Compam highreihtrency antenna Signal being rlararrarl Feature Listing of ~ 3cityi Modes
receives radar signals 19.Compass- Pic/idespulntsoidlrectlon 1743/1744‘ - Qu-eiMode
5. Front Laser Antenna e High ga n optical leYl'a provides zu. Real Voicew Alerts Alerts are given teraally throu h ‘ A” EPPP” ' Yehlcle Battery Sever
increased sereiiivity and held oi view for leading—edge the datactorsoyciu do not havototako youreyese the ' 3,40 Tmalfirllmetel ; pelvis: Saver
laser detecion road to lookatthe cispiar , £5323”,sz . 55,3 Alzfifvi
6~ i;535,555,it‘srzsefiggsigi‘z?tsgfs'is? PPPPPPiPocpi - PPiPP
transmitted/from behind ‘ SJ” Wm” ”5m“
7. Cit 1 (it 2 Button . Recuces the and once o . ,
laisye alerts lyplLydll)‘ encountered ii urbaii diiiiiiyg areas WM“ 74“ 11 co ia in to it
a Quiet/Menu Button. Pressing outer heirire a signal i i i i l_| i
is detected engages Auto oliiet Moce which aiitornat— Whistler 1745 it in
really reducesthe audio level after his initial warning to l
v low aiudio lovoi Scttlnq Pressing QUlET during a e
radarrlaserencounier ences audio alerts, while ( 3
allowing visuel a arts to keep you iriormed Pressing ' {3
arid holdiiigitire secoiitisaloivsyoutoer eromiiiii rfl—F 5 i I
Salem Mnria ices page, 17i ‘ le_’__©" 5
9. Power /Volumc Control - Turns unit tun/oil and to H y
adyusts audio leiei , , , . ,
1g_ yoym, UP/Dow" gm“ _ Adjusmrum up a, Feature Llssii'tg or 1740 - PatentedVKCl—Z Feature Llssgtg of 1745 . Patertedvyc 2
“W" ' é" Bimu d i d R i 913“? “mm?” ' Ell Baildu dc r (1 Real scl‘r’caik‘fia Ti“ T1233
. . . ~ as . o ii eis air ea . a e aiiiin s s einm - as n ~r5 an - - riiiii : P
1“ '°°" ”my?“ “511°fjdlel‘e'“°‘"df E , Voisyee AlertSrSelectBble - 30th Modes9 ) Vulge®Alert5—Sslecta:rle s 301»! ModesJ y
PWR‘i P W "m P Ml l PH“ Pd PM A" MW - ekclusiiie Piiioting Display - Quiet Mode - EACluSHe airoting Display - Quiet Mode
“WW rBeitei visibility . Vehicle Battery saver Bcticr visibility - yahicic, cattery Satcr
11- Vfi'Z/LESE' MW“ 7 Shows M W is MEN-”9 - Easy—tDrAccesS rront - Setting Saver - EESy—to—Access Front - Setllrrq Sever
Vuzorlasei Wis Mou , utions ~ loan Displa Mount Buttons . icon Dissley
13. “mid ind for . Shows the m" is rewiring an a door Tcital Perimeter - Stay Alartr s 360" Total Parimoior . stay rtlartw
X—band signal Protectionrn . Tutorial h/ode Protectlorw . Tutoral Mode
ERAT N
integrated Real Voice®
When Selected, Reachice will be used to articuleiethe
iollcwillc
1 Band dentiiication
2 Safety Warning System messages
3 Feature Selection
Memory/Beep Confirmation
All ieetuies selected [except stay Alert and Quiet) are
retained in mRrr'nry Farhrirne a hiltmri is pressed one
bee toniirms feature "on", two beeps conlirn feature
no ,,
Audio Level Adjustment
The audio levels can be adyusted h gh to low, or low to
high, in seven steps
- Press Volume Aupto increase audio level
- Press ‘lolur'levdihwri til dec'ease audio level
As eudro level is adyusted, beeps are provided and the
dapldv llldltstes tullullle leve- Tlle more Lidrs’ illu—
minated, the higher the volume
Auto Quiet Mode
Auto ou et reduces the selected audio love to a level
iii approximately 5 seconds alter a radar cir ~aiery
radar signal is detected The alert lor ary new gnal
wthirr 2L Seconds will resume at level ii) Auto Quiet
does rot eiiect vce2 laser alerts
- Press Ollie! iheinre a Si fiFl is (”Merle/l) to
engage Auto Quiet Urllt wilibeep once
Oriie the Auto Quiet mode is engaged, you may
cancel the audio alarm by pressing Quiet
Press Quiet (when the unit is nrr alarming) tn
cancel Auto Quiet mode Unit will trees twice
PERAT ON
WARNING'
for adequate rest Vou should NOT operate a vehicle if
ycu are (irihwsy During extended periods ofvehii;ie open
ation, you should take lrequent breaks lmnraper reliance
on the Stay Alert lecture may resut n vehcle damage,
persulldl lrlyur or death NEVER OPERATE A VEHIQE
lF VOU ARE RDWSV.
Option Select Mode
Entering Option SelF-ri yinde aliciws yin r to turn on or
oh ya ii detection or Voice ruler-s Note: The urii:
must not be alarming
To tlrri VGrZ detci‘tlihn till/oil
Press and hold the Quiet button drrtrl t'ie urrrt pro—
vides a unique beep then release the Quiet button
Unit will say ’\/E—2’ and the v/L light WIIl illuminate
brielly li verz detection is already on, the unit ivili
proiide a double beep to indicate vsrz detection is
turned off
To turn Voice oHori
Press and Inold the Quiet outrun igreater than 3 Sans
ands) until ycu hear zl double bccp thcr release the
leetbulion Voice alert is now oir livoice alertuas
already till the unit will say "CAUTION'
TeaddTutorial Mode
Provides simulated alerts hr each type oi s gnal
- Press city and Quiet simultaneously and
release
a Press P'rwer (0 exit
Vehicle Battery Saver Mode
The Vehicle Rattory Saver Mode automatically shuts
on yourdotector wi—hin o hours ifyou forgot to turn i—
uli Tire trrier is reset ii the detector is turned oli,
12
EED MON TOR NG
grcup sl vehicles in cmilasi, a laser gun t r large a
sascilic rehisle cut or c line 0: ratio and determine its soeee
The aciisntage cf laser over ‘ada’ in terms of target
iderlilicatitzr is the ‘esul’ cl tie ldae' ours ra‘rcw liearrr A rader
l'ansfllsslori can cover more than t hurling righivar at a dis
tance of moo icet, compared will a laser tiarsnissian when cor
crs about 3 heat at the sun e distance
For best p'o‘etllon keea th e points in mind
- Betause you veh tie s literse pate or neaciichis are the aser
grin‘sprmarr targets, haunting yniirh/his ier de—errcr ar
Me dashboard can rn >ruve laser detection at short range
- Do not oiioiv closey aehindeny vehicle ou sainatsse
ihrouqh lyouraniseepastevehclee cad ciyot, chances
ere your detecizirwari‘t on ie‘
. “he receiving range oi yeti lisai tieieflm ivii not be tire same
as a raoar detector Laser guns are most a ten used at shan
range
whistler user/Radar oei'oliu's reteire all when laser guns vvi ici
cperete at a laser wavelength ci his tr itmni
. PrrLdSFrW iii - HUG—77 . urratyra
Othtr Spnd Dotrction Systems
Seierai isthiiicues uiiier iiiaii racar or laser aroused L1 measure
vehicle speeds when new metrods are oeing used, no detec—
Mrrdn provide awarriny Theiererhrniiesinriide
- raring Apatrol cer drives behind you ane matchesyoui
driniig spseu
- i’azcer/Alrzrdfi ‘he imc it takes a yehicie to travel a kncwn
dis area is measured
Radar Detector Detectors {VG-Ii
Tho interceptor we 2 or simply v6 2, is a mcrswavc rczcvcr
used by pul u to detect signals radiated by l‘le lULd uaL llclo cl
e radar data or Because its ourocse is tc identi y Je'sorli oritr
irig wth radar detectors the yes; is knrwn as a ‘rsder rierectrr
coinclo”
18
RESET FEATURES
CARE E MA NTENANCE
Stay Alert is NOT intended as a substitute
~ ureck use in Whistler pun ’éple(:‘ it necessary inith a 2 aTlL‘
ERAT ON
Quiet Mode
Quiet cancels audio during an alert erd any new alert
vrithin 23 seconds After 23 seconds, approximately 2
beeps ere provided on any new alert and uriit their
remainsouiei
. Press Qriet to cancel the eudui
- Press Quiet a second time during an alert to resto'e
the standard audio alert pattern, or turn the unit o—,
then in
City/City ‘l/City 2 Mode
vyhstlers Three Stage city wide is designed to reduce
the arnayairce oi automatic coo. apeiiers, ii rusioir
alarms Frir‘l other devices whlrh share firemienries vvirh
pihllce redar
- Press city -o cancel Highway mode and engage Lily
Display Will srvilch iroii "H" to ”c”
- Pressing city a second time engages city i Display
wads C I (IN I MODE
. Pressing city a third time engages city 7
Display reeds
II my 2 MODE
Note After 3 seconds, l or ii city Mode indicator turns
oft
- Pressing city a louillt liiire returns to hirghyvey iirotuie
in city Mode, weak speedisafety radar signals give an
initial alarm at two beeps, and then the u’ill remains
quiet unless the sgnal becomes very strong when the
sgnai strength increases, two abdizioiial beeps are prilr
vided in city i Mode, Drly the x band sensitivity is low
Bred in City 2 Mode, Xrberid is not detected
10
PERA ON
unplugged or any button is pressed aoiore the c
hours i ate etpired The detector will alertyou vviih an
audible and visual warning beiore it shutsthli Display
WW Blinking
icy R
,1<
Durlnq this warnirq you can momentarily reset the
unit by pressing any hlittnn This wil reset the tlmPr
iftire unit has euieirraticaily turned itseli o , press the
Power button to turn the unt beck on You can nlzin—
ually engage the Veh (la Battery Sever Made by presc—
ing and holding t’ie city button until one beep is
heeid
RADAR ALERTS
speed Radar Audio/Visual Alerts
when x, K or Re is detected the bend ll’) and signal
strength is displayed The audio alert is continuous
and has a oeiger counter—like pattern The faster the
beep the (laser or Stringer the radar source
Exam le . .
p 21 K/Ka ft if! I II III Nun”,
l eaksignal, ll estrong signal
Pulse Protection”
when a ulse type signal iinstani on strong sgnel) lS
detecte an urgent d second audio warning is Saund—
ed and the display shows
Fsigiiseruic i ii iii g
Blinking BAND ID with 3 Se( zudowarnmg
Arter 3 seconds standard alert pattern cciritinues
13
WARRANTY
The use: is the prii-iary tool used by the to e to
ideniily racer detector sauipaed rarities iicaughr, n a state
detector iiegai [see pege lo), d'lvers risk iosirg their
radar detector arid receiving a irle in atditicn, lrlsic‘fli or racer
is aiinosiaiweys used in combinatiar with eye 1, caving unsus—
pcctingmctoris ruincraalctaiccoinng wotckcu onepatcn
tially inr speeding, the at le’ l;rptissesait,ii ;ld ietetttr
tiarinc a rader de ectcr capable oi detecting he to 2 may alert
you rotha, presence ole speed yea
rcir rioie irlcrnaticin on speed rrlil‘iltcrlrg technologies, please
niiioti rAc sage on uu’mebste
www.whlstlelgroup.com
ii is the ’QSpDHXll’2llliy al the ridividuzl radar detector owner to
kroiv end understand the laws in you erea regardingthe egalty
oi the use cl radar detectors
WARRANTV INFORMATION
Consumer Warranty
This Whisrier tasernader deiecror is warranted to tie
ung nel purchaser lo a peroe oi cnc yea' iron the date ci origir
nal purchase against al ceients in materials and
ivaiknanshp This iimned warranty is void ii the unit is
airvsed, modified, installed improperly, ii the housing has
been removed, or ii the serial numher i ssirlg. There are no
express warranties coienng his aiociucr other than hose set
forth in this warranty All ckprcsr or implied warrantics or th s
r; tiutrareiiiiiiiedtuciieyea whistleriviicitiietiielordaii ,
arsing iron the use,msuse, or operation Di thisprocuct
Servios Under Warranty
During the ivaisiiiy period,
be
repaired without charge to the pircrase» when reiu'ned with a
19
ieieuiiie ur it) Will
TROUBLESHOOT NC GU DE ARE DETEC ORS LEGAL
PROBlE
3 display or aucia
U!
0 ERAT ON
CAUTION. Some towns/small cities may still be using x
band radar if Auto Quiet is eng ch in Cliyl or city 2
modes and the unit receives a string radar signal, the
unit penorms the Auto Qu etieature city lvlodes do not
change the audio alert for laserchG—Z
Dim/Dark Mode
DiriirDark Mihde reduws lire iiiuiiiiiiaiuni oi the
display
- Press and hold Poll/er for 2 seconds to reduce
illumination to a Dim Setting
- Pressii g and holding the power button ior 2
seconds a second time engages Dark Mode The
display illurriirialion is further reduced
Dim or dark rerr be engeged tilirin an alert in Dark
Made, the display oes dark iorers ong as a signal is
being detected an ior zu seconds alter, then the dis
play reluiiis to the iiiinniei setting
- Pressing and holding the power buttonathird
time restores iu l illumination to the display
Engaging/Disengaging VG-Z
See option seiett mode t i turn this leaiure ori
Stay Alert Feature
The Stay Alert Feature is designed to test a driver's
alertness To enga eivvhen unit is my alarm ngl
- Press and hold it, i rr less then 2 seionds The"| l“
or "c“ will iiash indicaiing Stay Alert is actuated
vvithin 30cm secords two beeps are sounded, to show
alertness, the driver must press either the ivoluinei, city or
Quiet button ivitriir 35 seconds ii the button is pressed
Within 2—5 seconds, the cycle is repeated
ll a button was not pressed within 35 seconds aieriii
scurds and the display willflesh all LEDS
. Press Power to i ancei Stey Alert
11
RADAR ALERTSNG 2
Safety Radar Alerts
in communities where transmitters are located, t’ic
Safety Warning System alerzs you vritri on voice mes—
sages when Serety Radar is detected the audio alert
is geiger rriuntorlike
‘ iii
Note: Nntali areas have safetyvvarning system trans
mittors
vet-z Audio/Visual Alerts
Note: you must tiirn this reature on in cp'lcln select
mode before it will detect the vG—z Curr
when a vs 2 signei is detected, the detector "lilacs" its
own radiated signal and becomes undetectable by the
V6 2
Fkample ' t Blinking
Every 30 seconds, the detector checks ioi c W372 sig
nai ii a use? signal is still present, he rnir continues
to hide and repears the VG—Z alert if no signal is
detected, two beeps are provided, indicating an ”all
clear , contiizion During my Alert x, R, and Ra band
signals cannot bc received
Alert Priority
When two or rh'ire signals are renewed at the same
time, the elerl piipri y is
l Laser
3 Speed Radar
txerncle
if x hand is alerting then suddenly V6 2 is detected
the vm warning will nteiride the x hand Fliert
14
2 yerz
ii Scicty Radar
FORMAT ON WARRANTY NFORMA ON
M r' store rereim ioihe padres: helww llniS reiiilnerl wiihnlr'
cateo Sto'e receipt ivili hardied as described n secian
cc ou ol Wal'alliy” Due to tie socialite. eruitiiien
sciv
necessary lo' res-in; a laserrradar receiier tiles are no author
ired ieivire starnns icr Whistler nran'i Tlete'tnm cther than
whistler
vyher retbrrlirl e unit lor setise underwerranypleaseloloy
trese instiurri. i
i shia the unit in the orig nel certori or in e suitaale
surdy equlvdle'lt, ‘iilly insured wizh return reL'e c
requestedtc
Whip—la» Repair Dent
i231 honh Dxi'elerid Pd
Roqela,AR izrsa
Please allow 5 weeks turn-around time.
iMPORrANr- Wl’is‘ler iull rni assume rtsrzrrnsihiity
larlossordrme sincurred in shipaing Therelo'e, peace snip
vpuurlilrlsdiedgwthreiumiecslp' squssted cons will not
beatceptedi
z inciuecrvihycurunitthc alpiving in pimatiar, clearly
triitcd
-roui nameandsiieei address iiorshipgirg via uPsi
eday imereephane number and email ardress, if
applicable
-Adtieiitd descripiiuiio-iheprotiuiiieg, luriii
panorms sel test buidoes rot respondtc radar’)
lA copy of yarn dared rtnrereiripr fr hill or sale
Ee .erleiii your ii iii is returned wti i. serai iiuiiiber
tor reference, olease ivrite your tn seria number in
rlreicllrvving Rowe sln
uiiitswiiliiui seral iiuiitiersaie ioi itiieiec u iicrwariai iy
IMPORTANT: To validate that your unit is Within the
20
Pier '0 the PhyiA regulator ayrs etisted in the slate oi heiy
york .
its and in ihestaie iii lliruis iii trucks tirci 2h 002 iia
rristirrg tne use cii Bflar de . rt in rocks oier i800)
scoops
- Jl-plug PONPerdfiumullll f iriiiksififfihifrhs‘fr'tfifif‘i'is'a’n““E”as“
- =ress and hold Power and Quiet rnoeterwliiiiaisinsvhcnvahiriehrstaiinps
- slug Power Cord inlo uiiit . encouraioosciighie rkcinghiorancaccn
. meru new, . chactcannactanssteatriiassrpeyarccra susaiiu'it
. ?F~lF-allLVJllllq Guide, pledse LdIl Whistler
CiiRtnmer Serum at 1 W—Gi‘rflmd thnrR returning
your vnit ior ccriice
ARE DETEC ORS LEGA
in Most Statesves
as» doctors arecuii peieir legal ir ever state when used ii
a onetiiesoii ht mash/rider illiull ibsl simiariy ivher
used in au'tl’rloh es or light irircles, radar det , rs are l
aiiricsiereysiaie . eptioisaieviigiiiiaaiidivssiiiigtoi o
rvricr ha/e local regulations restricting the use of radar reeeliors
n any vchicio concorring trucks cvcr limo lbs, the Fedora
-ii lwdy Adriiiiisiiaioi iFhvrAi issued a eguiaiiuii
li‘F' dnnrary TM .-.ihirh nmhrhirs rat-er arr laser deter nr
, in has; types of icriclcs rld’lcrlalli
16
FCC ID HSXWi-i03 - m0
FCC ID HSXWHN - 1763/17“
FCC ID HSXWHN . 1745
FCC ID HSXWi-iid - ins
Thistievice iciiipiiaswti can is Jiile FCC Rules Operaiitiri is
sibctrotherroicwingtwnrnrdtions iilThisdsviconarynrr
cause harmiui interference and (2) this deticc must accept any
iiiierlererice received, iiiciudirq interlerenze that not, cause
undesired operarirn
IMPORTANT
rec ’equlrerile'lis state that E'lznges or muciiisa—icins rci
exp‘efily approied uy Whlst cau d vcio the user's authority ta
operate the euuipnieiil
SPEED MONITORING
Radar F305
A radar grin ri'hFrFtF; hy riarsmirtirg redn wins at rerain ll?—
aucncics wh zicct ail cbyects and are her pic
Source Exif Data:
File Type : PDF
File Type Extension : pdf
MIME Type : application/pdf
PDF Version : 1.4
Linearized : No
Modify Date : 2003:03:12 11:47:09-06:00
Create Date : 2003:03:12 11:47:02-06:00
Creator : Adobe Illustrator 10.0.3
Creator Version : 10
Container Version : 9
For : Kimberly Hardcastle, The Whistler Group
Title : Untitled-2
Bounding Box : 27 110 594 3146
Page Count : 1
Creation Date : 2003:03:12 11:47:02-06:00
Mod Date : 2003:03:12 11:47:09-06:00
Producer : Adobe PDF library 5.00
Creator Tool : Adobe Illustrator 10.0.3
Metadata Date : 2003:03:12 11:47:09-06:00
Image Height : 3036
Image Width : 567
Image Size : 567x3036
Megapixels : 1.7
EXIF Metadata provided by EXIF.tools