trs-80-model-4-disk-system-owners-manual directory listing
%3 Technical Reference Manual Part No. 2223216-0001, Rev. A INSTRUMENTS e M i RNl Copyright © 1984 Texas Instruments Incorporated All Rights Reserved -- Printed in USA The information herein and patents which might be granted thereon disclosing or employing the materials, methods, techniques or apparatus described herein are the exclusive property of Texas Instruments Incorporated. No copies of the mformanon or drawmgs shail be made without the pnor copsent qfl'lfe_xq's Instrumeg\;ts o£o 2 IncorporatedEe io o % : Lty ' e " 4 5 o¢I ¥ 5 eB7 K : & . INSERTLATESTCHANGED"PAGE`S`, _bs'smov su}gnseneo PAGES LIST OF EFFECTIVE PAGES Technical Reference Manual - = "PRPraeervtlffsmiNiobn.nar2Ay:2213M52asu1ye6:-" 0fJ09h0r§1i4iat ; e ivin 2x lapar e ie] ol L o A - ; . TM s SeTniby o ?o:-al`n;mhero; Q_-ag`as -ans publlcayonls 540 ,conuslmg ofme followlng 78 Tl s AT Ty Page EL LN O Change I Page No.t . Change ° ° No. Page ' & "INl S Changn No.7 = ®-4 |7 CFErMoentE'vCEéPbearGest 2 : Preface TI oDcaxgIaz E1 --E-6 L 0 Al i o e s ATe 0 = T V1am tX-1V16 ¢ 6b 31 ---G-9 £ 121 --2-61 0" H1--H7 £ 5gragy2ete T "'?) fnaex 1 --Index-9 4-1 --4.76 eive-ginl b éei's Response 5~1_--_5-202; 0 Mailer 2 2| 6f=Z644 * A-1 --A5 «:° )0" Ba5ck Cover ."90 ool 0l 0 0 0 ;ee i e rg g ,._`,'. Len it " - e R N P3 NSt e e i"s fieo asbhulioTe ,8.1 --B2 e 0, S} A-` cni pas - A e I CHANGE NOTICES e - E e Fivnd N x-; ` s ' o SEdens : »am It T i ficin |- Revigomslh "Date p:& el oNTECN B% T . - ur"` B L 5} Nuimbol ¢;| Lever. | fT rix Sv i T2 e3.t1 fia:crlppelDlo2n R Rl T- al i T t = Lo N e o L 2 : ae A 5/3/84 518860 2n eofpitianfiul s . segeo|l-ad.o ~oFo el n:z\_xf,_x..' . ¢ <ezey ' a3lae o `ot ] oy s ity 1 AL . Update Fohe Dmanueal.= L ' Pt it s ] v . L . ~ e xof\sn'y go Si ohelgsnanld T Y Cefbelong PR G e g4 T ! : s pdofuE __.).r.1 MC iy (:l 4 W Address all correspondence regarding orders to: Texas Instruments Incorporated Data Systems Group P.O. Box 1444, M/S 7793 Houston, TX 77251 TECHNICAL REFERENCE - PREFACE PREFACE The Technical -ence design and function of is intended for use by technlcal persons, anuatl contp?ns detailed 1hform§txoh .on the the Texas Instruments Professional Computer and software and hardware des:gnars and other This manual is divided into six major sections: Section 1. Instruments Introduction Professional - Provides Computer a general < Qe?crxpgxon,, 9 the Texas and 1dent1f1e=n L A& Boan vprxous configurations, options, and accessories. This tables listxng environmental requxrements for the section also system, t;m 1nb1udes ! aSciseoncmftpocioroonmdneainnttgi2o.n.taboSflyesTsht,iesmtnrhHeesage-rxcdstswtiyaeosrrntese,mal~saonPidrnocivlnsiucidfgleinusnadlgesa-pdihseanptreadociwuilaterfs,deicapdtreiosogcnrrsaimpamtn$ld"oa.eg.!n'dg7Tantotf?pn r)| faesaucccahh Sosseuppcctehitcoiinofasnis cac3t.oidoinanvsHga,airldtawaibabnlrlteeeesr,fOapctrfeioeorgnisisntfeor-trhsem,Partoivaoinnsdd,yesstsea:mpga.dn.adlethaapirxTldh3evidsaoruetdse.ssceprcritopigptBr\njtaomn|mgiFoBnc- ogonfItaidntahtsea Section 4. Device Service Routines 5 interrupt vecfor lists, and a keyboard scan Cigie Descrxbes the dod;ng table. R ROM, e, .gives | [ Section S. Assembly Drawings detailed drawings for all field List of accompanies Materials, identifying each assembly draving "C' 7 i and. Lists -of-wHatefials«~--- Inmcludes replaceable assemblies and options. A all components- »and""pr!cE""'parts, e R (a "J'fl R 8.étlon 6. schematigs Schemnt:cs for each pnd Loglc Dravans = component - and fiel Texas Instruments Professional Computer.TM Jlogrc S QPiaEqTrY`dasfi atnhde § t The appendixes provide reference intormation, such all /0 addresses, and a complete memory map (covernng all memory connected to the bus). Also included are furnished with the computer between the various options expansion bus, and the complete information on and a breakdown of the and printed wiring boards. as defxnitldns of the motherboard memory expansion the cha}acter sets power 'allocation : : P elne 36D - SA 1ii/iv 3% o bifi£ Tt i " R o E i v Eas ewadpail slpsl pahiwasd Bt T wlidwseps alduinnigay L rayiwans Blaix Das 1591 e % i i A imeD hal PEta i { Yy L H £ s nsgmey fi st dem lmpd e e A TECHNICAL REFERENCE CONTENTS Section Preface 1 1.1 TP 1.1.2 1.1.3 1.2 1.2.1 1.2.2 1.2.3 1.2.4 1*2S, 1.2.6 oot/ 1.3 Table of Contents Title Page iii INTRODUCTION . . o o . . . . . . `Hi=] SYSTEM COMPONENTS . . . . o . . ' . 1-1 Keyboard. o & S n o o o o . . . 1-1 System Unit. 0 . s . o . 6 . & . 1-2 Display Unit . 5 o . . 5 . . . . 1-2 OPTIONAL COMPONENTS. S . o . o . . o 1-2 Diskette Drive s. o)so o.. 1=-3 Hinchester Disk Drive e ea H. . 1-3 Expansion Memory Boards. . . g = a 1=3 Synchronous-Asynchronous Communications Board . . 3 3 . . =3 Internal Modem Boards ) 5 S o . . mls3 Graphics Video Controller Board . . . . 1-4 Color Display Unit o & o 2 3 . T . 1-4 ENVIRONMENTAL CONDITIONS . s . 5 . . . 1-4 2 2.1 2.2 2.2.1 2.2.2 2.2.3 2.2.4 2.2.5 2.2.6 2.2.7 2.3 2.4 2.4.1 2.4.2 2.4.2.1 2.4.2.,2 2.4.2.3 2.4.2.4 2.4.2.5 2.4.3 2.4.3.13 2.4.3.2 2.4.3.3 2.4.3.4 2.4.4 2.4.5 2004 IS VY SYSTEM HARDWARE INTRODUCTION . . e B . . . . . 5 2=l KEYBOARD . a . o o . . S . =, 2-3 Encoding Keystrokes . 5 . . . 2-3¢ Transmission 5 E a o . 2~-3 Receiving and Respond:nq to system o7l Unit Commands . ? 3 g e . 2-4 Implementing a Software- watchable Repeat-Action Function o . s 3 o 2-6 Performing n-Key Rollover . s o . 6 2-6 Locking/Unlocking the Keyboard . 0 o 2-7 Performing a Self-Test . o 4 d s . . 2=7 SYSTEM UNIT BOARD o . o 2 6 . S g . 2~8 SYSTEM SUPPORT . e o . o . s . . . 2-10 Keyboard Port . : g a e . a d o . 2-10 System CPU . . ) AR . . . . . 2-113 Optional Numerlc Coprocessor S e . 21 CPU Clock Generator o . . g z & m2-11 CPU Bus Buffering . . . . . . g . 2-13 CPU Bus Controller. a . o o . e . 2-12 Reset Detection Circuit . o : b 2=12 Motherboard Input/Output System : it o L2212 I/0 Decoding. o o . a o » . 2-15 Parallel Printer Port' S s 0 6 0 . 2-16 Timers. . o a S e a . . . 2-18 Speaker Amplif:er ) a e o o R `H2=18 Motherboard Interrupt 5ystem o n e S . 2-18 Motherboard Memory System . 5 0 . a . 2-20 Motherboard Memory Addressing . o 5 . 2-20 -y - ("` TECHNICAL REFERENCE NNNRNRNRNROWRRONNNRNNNNNND N EA D ARBRAPRELAROELEE LS N N s NEKS b Section b wWwN- WONNNNNNNOITOITOIOOTOIOAOLW ONPA L WN I DO EWN UL WN newN Title Memory Control Logic CAS and Address Multiplexer Sv;tch Parity Generation and Checking. Memory Control State Machine Floppy Disk Controller Floppy Disk Controller IC Sector Buffer Write Precompensation C1rcu1t `Data Separator Diskette Drive Interface. Diskette Drive CRT Controller B oard. Display Characteristics Character Attributes Character Sets Cursor. . . Scrolling. "Video Connecto r. . CRT Controller IC. CRT Screen/CPU Arh;tratlon Logic Subsystem . ° CRT Address Decode Log1c 5 Character Set and Attribute Logzc. Generating a Character ROM B .~ Attribute Interaction. Attribute Hardware. CRT Interrupt Logic Subsystem Diagnostic Loopback g EXPANSION BUS. Expansion Bus'Sagnal Descriptxons Loading and Driving Requzrements. Memory Timing . I/0 Timing . . MNIONRONMRONRBDODRONNMN A y NWNNATM sN BNNANNoANtNN o ; .. CONTENTS Page il ) 2-22 . +o222E5-:222263 2-26 . 2-26 . 2-30 2-30 "2-31 "2.35 .'ziav . 2341 . .2-42 . 2-43 . 2-43 . 2-43 . 2-44 . 2-44 O OVUOAIHMAENNWNON NN N T e T L M w - 1WiIS WR 5L NN T Wwwaewwww NRONRNKRNN NV NE W N ke Wy W | & Wi P TP HARDWARE OPTIONS INTRODUCTION : EXPANSION MEMORY, v siz2/76é8 K BYTES Addressing the Expansion Memory Expansion Memor$ Control Logic. Expansion Memory Refresh Logic CAS and Address MUX Switch Generation. Expansion Memory Parity Generation and Checking -Expansion Memory Control state Machine SYNCHRONOUS -ASYNCHRONOUS COMHUNICATIONS : BOGARD. o TiSystem Interface Badd Rate Genera tion. Addressing Programming. LW oW LWN N 1 3 wwww W W S WN -yi- " TECHNICAL REFERENCE CONTENTS -suction 3.4 3.4.1 3.4.2 3.4.3 3.4.4 3.4.5 3.4.6 3.4.6.1 3.4.6.2 3.4.7 3.5 3.5.1 3.5.2 3.5.3 3,.5.4 L3 3.6.1 3.6.1.1 IT6MIN2 3.6.1.3 ] 3.6.1.4 3.6.1.5 3.6.1.86 3.6.1.7 3.6.2 3.6.2.1 3 %622 3.6.2.3 3.6.2.4 3.6.2.5 3.6.2.6 3¥ETM3 3.6.4 3.6.5 3.6.6 3.6.6.1 3.6.6.2 3.8.6.3 3.6.6.4 3%i6-i6h S 3.6.6.6 366l 7 3.6.6.8 33.66.66..910 3.6.6.11 3.6.6.12 3.6.6.13 3.6.7 3.6.8 3.6.9 3.6.1 3.6.1 - 0 Title Page M INTERNAL MODEMS . o o . . ¥ s . S . 3-14 Architecture SR . oO e G . . 2 »3-18 Zilog 8530--Modem ngnals . il o AT 3~15 Modem Initialization. a e o 5 o .3-18 Command Mode Operation . . q . e & = 3-18 Dialing Procedure. P e s 8 3-18 Time-Outs S o . S o SRR i3-20 Terminal or Softvare Tlme Outs s s . 3-21 Modem Time-Outs . "s . . o . . & 3-21 Modem Software. o -og . 3-22 GRAPHICS VIDEO CONTROLLER BOARD g o S Pixel Addressing . ST o . Color Selectiong . . 5 s . Timing and Synchronization. LR Graphics Logic Array Program WINCHESTER DISK DRIVE Winchester Hardware AND CONTROLLER OPTION Theory of Operation; On-Board EPROM/ROM. . o s 5 .o Commands and Command Testxng S 4 Explanation of Bytes in the Devxce Control Block. . . - k 3-24 -3-26 3-27 3-31 3-33 13-34 ..3-34 3-34 3-35 3-3S5 Control Field Detailed Descr:ptxon < 3-36 Command Completion Status Byte. g 3-37 Logical Address (HIGH, MIDDLE and Low) ' 3-37 Sector Interleav:ng AT e e g L3, 2-37 Register Assignments. = S . . B 3-38 Data Input Port. - 5 . i3 . s 3 3-39 Data Output Port . 7 . o & 3-389 Controller Status- Reglster . T . ' 3-39 Reset Port 4 o . a T S & 3-39 Interrupt Mask . TN ot oy S . s 3-40 Error Status Byte . o - L 3-40 Bit Definitions for Reg:sters and Ports 3-40 Controller Status Bit Combinations . 4 = 3-42 Normal Command Sequence; Operatipn: . o Detailed Description of Commands. o 5 3-43 3-44 TEST DRIVE READY Commangd. S gi o S 3 3-44 RECALIBRATE DRIVE Gopmand, . o 2 . 3-44 REQUEST SENSE STATUS . Command a s S 3-44 FORMAT DRIVE Command.. ... . .., a L 5 3-51 CHECK TRACK FORMAT .Command . .. g . 3-S2 FORMAT TRACK Command s o . ) =T, 3-53 FORMAT BAD TRACK Command. . . s o . ` 3-54 READ Command. 3-5§ SWEREIKTE CoCmommamnadn.d i 3-55 3-56 INITIALIZE DRIVE CHARACTERISTICS Commsnd 3-57 READ ECC BURST ERROR LENGTH Ggommand 3-58 FORMAT ALTERNATE TRACK Command.,. 3-60 Alternate Track Assignment. . eI . . 3-61 Alternate Address Protocol. s . g & S 3-62 WRITE SECTOR BUFFER Command 3-64 READ SECTOR BUFFER Commangd. RAM DIAGNOSTICS Command. o 3-64 3-65 =viie TECHNICAL REFERENCE CONTENTS » > > PR ERDDRREREEDBRARDEBLEPE TR PEEEALLAELLE SRS EdbEEDbA Se;tio n 3.6.12 33..66..1134 3.6.15 33..66..1176 3.6.18 3.6.19 3.6.20 Title DRIVE DIAGNOSTICS Command . . . CONTROLLER INTERNAL DIAGNOSTICS Command READ LONG Command. &oS .o WRITE LONG Command . . a a Execution Order of Rema;ning Diagnostxc Error Correction Philosophy . o Sector Field Description s & Specifications -~ Controller Board Electrical Interface. 5 g S s Page #-65 3-663-66 3-67° 3-68" 3-68 3-69 3-71 3-72" » 1 - N h&hfih&DfiN&N?D hL &W #W &W &W h |h Rb D Do Rt bSW bl W ha O1 a Nr S NrA l N so8 N W D D NWD NRNNVNDRONNN-NF W N NNNNNI N ONAVR Obo h Odod O b UW W D WNRNWNNNDNNOMNNNDNMN DEVICE SERVICE ROUTINES ROM INTERFACE INFORMATION,. . .. WRITING SOFTWARE FOR COMPATIBILITY NITH FUTURE PRODUCTS . a . . o o Compatibility Levels. 8 o o o Operating System .o o S System ROM Interface . o Hardware Interface. o s Areas of Hardware Compatxhility s Alphanumeric CRT . o o a 3 Graphics CRT. .53= !8 Disk Subsystem . . . 3 o 3 Keyboard System. e o S 3 S Interrupt Controller . e 0 3 System Timers and Speaker Parallel Printer Port. 4 b Serial Communications. S . SYSTEM ROM INTERRUPT VECTOR USAGE Hardware Interrupt Service Routines. _Common Interrupt Exit Vector . Timer Interrupts' e o s ROM STRUCTURE. . . S . . o ROM Usage 2 oeSo ROM Format . o . . Option ROM Interrupt Vector Usage RAM Usage by Option ROM. o a Initializing the Option ROM BOOTING UP THE SYSTEM . . . Boot Sequence . 9 . Loading and Calling the Boot Code Booting From an Option Device. SYSTEM CONFIGURATION FUNCTION CALLS System Configuration Function. Extra System Configuration Function. Get Pointer to System Configuration. Get Pointer to Extra System Configuration. GENERAL PURPOSE ROM FUNCTIONS Delay. . 8 . CRC calculation Ss 5 Print ROM Message. s o . Digsplay System Error Code " b W WIN W K hWN R b W -viii .TECHNICAL REFERENCE AL PLLALEDIDRILLRMD = 0WVLVOYWOD®®ODO®D®D Secti on 4.10. 4.10. 4.10. .10 .11 .12 .13 .14 .15 .16 4.10. 17 4.10. 18 4.10. i9 4.11 4.11. 4.11. 4.11. 4.11. 4.11. 4.11. 4.11. 4 N11 4.11. 4.11. 4.11. 4.11. 12 4.11. 13 4.11. 14 = 0 ®NOUVEWN - WN R Vo WN o N e wWwN- - 0 Title SPEAKER DSR . o . o . a a . P d Sound the Speaker - AH = 0. g s o a Get Speaker Status <~ AH = 1. b ? Set Speaker Frequency - AH = 2. . . Speaker ON =~ AH =3 . ., ., ", Speaker OFF - AH = 4 5 o R e TIMENOEMDA YHCLOCKRDS RIS UE N R Set the Date Set the Time - AH = O. - AH = 1. o 5 9 o . . .. Get the Date and Time - AH = 2, s CRT DSR. o o 8 s 5 4 3 & o o Set Cursor Type -~ AH = O1lH. . . . Set Cursor Position - AH = O2H . o S Read Cursor Position - AH = O03H . a £ Scroll Text Block - AH = 06H and 07H . Read Character/Attribute at Curaor Pogition - AH = 08H . . & Write Character/Attribute at Cursor Position - AH = OS9H . S & . o o Write Character at Cursor ¢ WriPtoesitAiSoCnII - TeAHlet=ypeOAH - A. H =a OEGH e. Hrite Block of Characters at Cursor With Attribute - AH=10H . . . o s WriPtoesitBiloonck - ofAH Ch= ar1a1cH ters. O. nl.y a`t0T Cu| rsor Change Screen Attribute(s) - AH = 12H Clear Text Screen and Home the Cursor - AH = 13H , . SR a Clear Graphics Screen(s) - AH = 14H. Set TTY Status Region Beginning - AHE =R H e e A L sl Set Attribute(s) - AH = 16H . . . GetAHE Ph=y1s1i7cHaRl Display- Begln Poxnteer y = Print TTY String - AH = 18H S A il CRT TTY Mode Behavior . i- 3 5 o DISCKustDoSmR Enc. odi. ng of thRe CeRT. _. 0 . . Reset Disk System ~ OOH. O 1O Return Status Code - O1H , . A Read Sectors - 02H . . UL . Hrite Sectors -03H . o o a o S o Verify Sector CRCs - 04H . E e S Null Operation - OSH. Verify Data,-"O06H.-1" a a o B g8 Return Retry Status - 07H g A ' s Set Standard Disk Interface Table ~ 08H Set DIT Address for Drive - O09H b . Return DIT Address for Drive - OAH Turn Off All Diskette Drives - OBH Status Codes . . . . . Disk Interface Tables (DITs) . o G --ix=- s BETH DL DERELL L e t I 1 7 Lot 1 ww WNWIW W WU W W W W W i t v DONNOOSOW U W vW 4 = s O CONTENTS Page 4-18 4-18 4-19 4-19 4-194-19 4-20 4-20 f44--22105"¢ 4-21 4-23 4-24 4-24 4-2S 4-27 4-39° 4-40 44--4400" 4-41" TECHNICAL REFERENCE o5 1y 5 CONTENTS Section 4.12 4.12.1 Title Page- - KEYBOARD DSR . . Initialization Log;c N T S A) 9 s 8 5 5 o . 4-44:;& 4.12.2 4,12.3 4.12.4 4.12.5 4.12.6 4.12.7 4.12.8 4.12.9 4.12.10 4.12.13 4.12.12 4.12.13 4.12.14 4.12.15 4.12.15.1 4.12.15.2 4.12.15.3 4.12.15.4 4.12.15,5 4.12.16 4.12.17 4.13 4.13.1 4.13.2 4.13.3 4.13.4 4.14 4.14.1 4.14.2 4.14.3 4.14.4 4.14.5 4.14.6 4.14.7 4.14.8 4.14.8.1 4.14.8,2 4.14.8.3 4.14.8.4 4.14.8.5 4.14.8.6 4.14.8.7 4.14.8.8 4.14.8.9 Read Keyboard Input - AH = 0 . e o . . 4-44. . 3 Read Keyboard Status - AH = 1 . o o . 4-45;+; Read Keyboard Mode - AH = 2. . . . . 4-45;: Flush Keyboard Buffer - AH = 3. . 5 . 4-46:: - Keyboard Output - AH = 4. 5 S o . 4-46 . Put Character Into Keyboard Buffer - ). AH = §. . General Keyboard Layout. B . . . o . 4-47 o S S o e . 4-48 Character Codes .o . e o e a S . 4-49 Extended Codes. 5 S s 5 S S . . . 4-52 Keyboard Modes. ) o o o S s s 3 . 4-53 Type-Ahead Buffer. S 3 fi s 3 a . . 4-53 Repeat-Action Feature o . . . o o . 4-54 Special Handling . b a S o o o . 4-54 User~-Available Interrupts s 0 5 o g . 4-55 Keyboard Mapping . o o S a . s . 4-55. Program Pause . S 2 = s B s o . 4-SS Program Break . o 0 A 9 s e g . 4-S6 Print Screen. S o . S S . . 8 . 4-56 Keyboard Queueing . S s 5 5 o o . 4-56 Custom Encoding . 5 o g s B 5 . 4-S6 Keyboard Interface Protocol s B . = . 4-57 PARALLEL PRINTER PORT DSR. . . o . S . 4-60 Qutput Character to Printer - 4 AH = 0, DL = 0 . o . S o . . S . 4-60 Initialize Printer =~ AH = 1, DL = 0 . . . 5 4 . D Return Printer Status - . 4-60 AH = 2, DL = 0 . o o . 3 S . Use Under an Operatxng System. . 3 0 . HINCHESTER ROM o . . S . e s . S . Limitations. . . 5 5 5 o 3 b 5 . System Interface . . 5 3 o e 5 s . System RAM Usage . a . . o . o o . Power-up Testing o 5 3 s . Booting from the Hinchester o 2 . é . Error Recovery. . o o s B . S 4 . Error Reporting s . o . S 3 . . Hardware Interface Rout1nea S a . Initialize Winchester Disk System D . Check KWinchester ROM Version . . 3 . Request Controller Error Sense. . a . Send HWinchester Controllier Command . . Gel Data From the Winchester Controller. Write Data to the Hinchester Controller. Get Status From Winchester Controller . Get and Compare Data From the Winchester Controller . s s 5 . Enable Data and Status Interrupt 4-60 4-62 4-63 4-63 4~64 4-64 4-65 4-66 4-66 4-67 4-69 4-70 4-70 4-71 4-71 4-71 4-72 4-72 4-73 from Controller . 5 S s . o s . 4-73 - - *TECHNIGAL REFERENCE CONTENTS Section 4.14.8.10 4.14.8.11 4.14.8.12 47.11485013 4.14.8.14 4.14.8.15 4.14.8.16 4.14.8.17 Title Page Enable Status Interrupt From Controller. Disable Data and Status Interrupt From Controller. : o s 2e . Poll for Controller Request o &e . Format a Track . P 0 5 SRR Format an Alternate Track o e s0 . Format a Track as Bad. e& e yb. Check the Track Format . . . ., 1%, |, Format a Winchester Drive . 5 o. . 4-73 4-74 4-74 427 4-7S 4-75 4-76 4-76 5 "ASSEMBLY DRAWINGS AND LISTS OF MATERIALS . . < 54{ 6 SCHEMATICS AND LOGIC DRAWINGS . . S . . 6=1 APPENDIXES A B C; D E System 1/0 Map. g 3 3 "Wal- 3 . System Memory Map. g 3 3 s o . Character Set . a o . 5 5 i F Current Requirements. Asynchronous COmmunxcatxons gample Program R . ShEnrt o 3 Modem Sample Routlnes s s A Boot Routine and Sample Assembly Code Sample Interrupt Service Routine. . A-1 WB-1 c~-1 D-1 E U F, . G- H T aom - -%i- TECHNICAL REFERENCE R 1LLUSTRAR 1OKS Figure No., List of Illustrations Title 2-¥ 2-2 2-3 2-4 2-5 2-6 2-7 2-8 2-9 2-10 System Block Diagram. oo9o ao0 0 s Motherboard Block Diagram . . . . . . . . Memory System Timing Diagram . 5 o o 5 & o Floppy Disk Timing Diagrams s o Alphanumeric CRT Controller Boerd Block D1agram. Alphanumerics State Machine Timing Diagram . Sample Character Font Definition. . 9 o g . Encoding Examples. . " o " Expansion Bus Memory Interface Timing Dxegram £ Expansion Bus I/0 Interface Timing Diagram E o 3-1 Expansion Memory Timing Diagram . o S 6 o s 3-2 Sync-Async Comm Board Block Diagram. a8 oGt 3-3 Modem Hardware Interface . q » 5 s o 3-4 Zilog 8530--Modem Interface ngnals 5 o b S 3-S Graphics Video Controller Board Block Diagram . 3-6 Color Latch Byte . . s . . 3-% Graphics Video Controller Timlng Dxagram 5 s S 3= - Controller Operational Flowchart. S . . 3-9 Control and Data Cabling for the Winchester stk' Drive. aa= e4og5soSs 5o 4-1 Register AL Drive Byte . 9 " g < s S 4~2 Byte Definition - Set Cursor Type o 5 v 3 . 4-3 Byte Definition - Set Attr:bute(s) L A a W 4-4° DIT Structure . . SR S 4-5 Byte Definition - Keyboard Kodes s o s 4-6 General Keyboard Layout Showing Scan Codes . B 4-7 `Byte Definition - Keycode . g s a . 4-gwiotf Byte Definition - Return Prxnter Status . . . e S O et LTy SR page' 2 H2=2 2-9 2-25 2-29 2-38 2-40 . 2-83° 2-54 . 2-60 2-61 3= 7, BUEED) . 3-18s . 3-16° . 3-25 . 3-29 3=32 . 3-42 o 3~72? a 4-16? . 4-23° 4-32 RS~4 2 . 4-4S . 4-4g' . 4-59 . 4-62 - = vk s i -E EA o oc Daaiy . ' £ T Ik L o -xii=- . TECHNICAL REFERENCE TABLES NMOROMRNNNMNDOMDODODNND b H = OONOUAEWONP I 14 - 3-15 3-16 3-17 H (=HOONOUNEWN List of Tables Title Storage Conditions, Standard System. e s Tin g D Operating Conditions, Standard System . o . Storage Conditions, System with Winchester stk Operating Conditions, System with Winchester e Disk . . B S > e s o o o a o 5 : s . Keyboard Commands and Responses . . . . . {; Map of the Motherboard I/0 Addresses e Input/Output Signals - HAL12L& Integrated C;rcuxt;. Printer Port Pin-Out. g o S o o . o Interrupt Level Assignments s5a oo . Motherhoard Memory Map . o ROM Access Times . . .. Memory Control state Hach1ne Logic - HALl16R4. Programming for the HALIOLS8 Device . . . o Internal Diskette Drive Connector Pin-out. . e External Diskette Drive Connector Pin-Out. o o Diskette Drive Specifications. 9 . . . o qegte VIDEO AC PARAMETERS . . . . . . . S agAeos Color Video Connector Pin-Out. CRTC Programming Values. o a RS . . . . . Alphanumerics State Machine PAL . 5 s o 5 o e CRT System Memory Map . a 6 o a o 5 fy. o : Alphanumeric Decoding PAL . . . . s 5 ok Color Map . . CRIER IO I A ey Expansion Bus Pin-Outs . S e o a S Lt s T At syl Expansion Memory Control State Machine Logic - | . HAL16R4 . . I - TI R =I es Sync-Async Comm Board Baud Rate . . 3 c el atd Sync-Async Comm Board Port Addresses o 0 Channel B Pin-out for Z853¢ S o o Channel B Pin-out for Z8530 Interrupt Enable. RS-232-C Connector Signals. o a a 0 Modem Default Parameters o E o6. .S S Types and Durations of Dlsconnects a a 3 Commands from the Software to the Modem . o Response from the Modem to the Software . Diagnostic Status Indicators . 3 E s S s o 5 Color Combinations .g 5 4s5s6 S = . Bit Correlations . . 1 Aapo 4.. Default Vvalues of Color Latches a E 5 3 S o . Programming for the Graphics State Machine HAL Device Control Block Bit Diagram. s s b 0 o Command Descriptor Byte. S e S S 3 & E 2 33333-----111112334 0, 33333-----2122218344 333333------233233805936 -xiii- WWwwwwwwwww www (bgSPRWSN TECHNICAL REFERENCE Table No. Title 3-24 3-25 3-26 3-27 Winchester Controller 1I/0 Port Assignment. o Bit Definitions for Controller Registers and Ports. S 5 valid Bit COmbxnatlons for cOntroller status Type O Error Codes, Winchester Disk. & e d Type 1 Error Codes, Controller Board Types 2 and 3 Error Codes, Command and Miscellaneous . . . S Error Code Summary 2 . o 5 . . 2 iz 3 Sector Field Format . . o . . o o s S12-Bytes-Per-Sector Format s 5& & Winchester Controller Board Spec1f1catxons 4-13 4-x4 System Interrupt Vector Usage. . . E o e ROM Addresses and Suggested Uses. S . . . Pointer addresses and Descriptions . . . . System Configuration Word-Bit Definition . . Extra System Configuration Word 1 (BX). 0 o CRT DSR Opcodes and Functions. o 3 o . . Disk DSR Opcodes and Functions 0 o 0 ; v Error Codes. . . . S g 0 = Keyboard Commands. s o . 2 5 Standard Keyboard Character Codes . . . Extended Function Codes. e g o . . RAM Segment Pointers. s : s z - z - Hinchester DSR Error Codes. . 3 2 ; ' v Displayed Error Codes 3~-41 3-42 3-46 3-47 o=DLPL OAOED I NLD®ED MR1E ADPLERDL WLD NN-t P R -N 1 -xiv- TS ECHNICe AL REFERENCE _ iINTROIDRLUECTTION < -~ P Section 1 s INTRODUCTION 1.1 SYSTEM COMPONENTS c-L That basic Texas Instruments Professional Computer system consists of three major parts: the keyboard, the system wunit (including rthe diskette drive), and a monochrome display unit. A general description of each is given in this section. The available options are also briefly information, refer described to Section in this section. 2, "System Hardware", For more detajled and to Section B¢ "Hardwvare Options." - 1.1.1 Kéyhoard e « The low-profile keyboard is easy to use. The large, sculptured, paetttahrlhyeceopphsgheerawkvanearmuycimmbrttaeoowebrsaorlisr-ecdligtkhrfdceeoaaunutnapc.sttoXbipekoey~nscToufhoseenkdtegtryhrssoeomalsuasplakelreadeeyrbctohaaoaenlrnrcruduam.tlnehdagreietisdocprmla.aikiynneypAktaehcdryufebrieosvo=oanerr-gdkrteohymueaoprsverecilmgueouhsfsntteted.froustraibdeTetwe:wenXelteeveyoenrsf Other keyboard features include: * A full-length degrees. tilt-bar, adjustable from S degrees to 1S * The sculptured, low-profile European 30-millimeter (mm) Xeys, which comply with the home row height requirements. * Tactile-designed F and J Xkeys, "home" position on the alphanumeric which help keys. to locate the * A raised dot on the numeric keypad S, indicating the key. center * A keyboard microprocessor, 'vhich converts character information and conducts keyboard every power-up. keystrokes into diagnostics on () £ @ A 3 b - P IEQ'!ICAL REFERENCE INTRQDUCTION 1.1.2 System Unit L © The system unit is the heart of the computer. Thd basfc configuration includes the central processing unit (CPU), the floppy disk controller (FDC), a parallel printer port, a power supply, & read-only memory (ROM), and 64K bytes (XK = 1024) dynamic random- access memory (RAM). standard equipment. A cathode-ray tube (CRT) controller boar. ids, Rih y The system unit board is a 361.95 x 21S5.9-millimeter (mm) (14. 25 x 8.5S~inch (in)) printed wiring board (PWB) mounted horizontally on the bottom of the system unit chassis, This board houses thg microprocessor and control logic. It also supports an expansion. bys with five card-edge connectors for option Dboards and another connector for a memory expansion option. The system unit power supply with three output levels. every combination of options. is a It switching-type, will sustain a 110-watt (W) system equipped unit with L The 5 1/4-in diskette drive is a mass storage device for reading or writing data to a removable diskette. The Texas Instruments Professional Computer uses a double-density, modified frequency moduylation (MFM) recording format. This format requires certified double-sided, dual-density, soft-sectored S 1/4-in diskettes. 3 data separation logic uses a phase-lock fieliability. The computer is equipped with one can store approximately 320K bytes of data. loop technique diskette drive, Vhlfib 2 1.1.3 Display Unit ke The display unit Computer is a green phosphor furnished with the Texas Instruments Professional high-resolution (720 x 300 pixels), composite video, monochrome unit. The standard CRT controller contained in the system unit supports eight intensity levels for the djfiplay. The display presents information in a 2S-line x 80-column alphanumeric format, which works well with the bit-mapped graphics aption. The display unit is specially adapted to accomodate the horizontal scan rate of 19 200 lines per second 1.2 OPTIONAL COMPONENTS There are several options Professional Computer. These available for the Texas Instfumedgg options `include additional 320K-§x:e diskette drives, a Winchester disk drive, expansion memory boards (which can expand the system memory to 768K bytes), a synchronous- asynchronous communications board, internal modem boards, a graphics video controller board, and a high-resolution color display unit. A general description of each of these options is given in the 1-2 FECHNICAL REFERENCE `INTRODUCTION P following paragraphs. t% ERSCection 3, Hardware SQE e £.2.1 metr Diskette Drive If more detailed Options. information {s'needed, feféf L YOy £ L=At T one' internal diskette drive is standard equipment for The Tegid Instruments Professional Computer. Enough internal space is available to install either a second diskette drive or a Hinchesten &{sk drive. You can also install two external drives. : Piskettes used Be certified diskettes. with the Texas double-sided, Instruments Professional Computer mdn{ dual- ~density, soft-sectored, S 1/4-in : 1.2.2 MHWinchester Disk Drive The Winchester disk drive and controller option is available 10-megabyte capacities. You can install the Winchester disk the space set aside for the second diskette drive. . L in S-ror drive in ii2.3 Expansion Memory Boards The system unit board contains 64K bytes of dynamic RAM. Adding é'fianuion RA¥ Dboards can increase 788K bytes. First, use the expansion iNtb the memory connector on the the system memory to RAM option boards motherboard. These a total 6{ that plug boards are avajlable in 64K~, 128K-, or 192K-byte capacities. After adding the 192K-byte board (bringing the total to 256K bytes), further expansion requires that you add a 256K-byte board that plugs into the expansion bus. To reach the 768K-byte total, another 256K-byte board attaches (piggybnck style) to the board on the expansion bus. L 1.N 2.4 Y SsSynchronous-Asynchronous Communications Board 1 i Thé'synchronous-anynchronous communications (sync-async comm) Boh(& option `'allows either synchronous or asynchronous commthcarioni through an RS-232~C interface. The sync-async comm board qupfivrr{ asynchronous data rates from S0 bits per second (bps) to 19 200 bps. 1.2.5 Internal Modem Boards Two versions of the internal modem board option are available: a 300-bps board providing Bell 103-compatible communication, and a 300;1200 -bps board providing Bell 212A-compatible communications. O Natedgay & s EA iy ) il . Feoi ] i LB 05 ¥ : : et R TECHNICAL REFERENCE INTRODUCTION 1.2.6 Graphics Video Controller Board The graphics video controller board option is available in either one or three planes. It provides a resolution of 720 horizontal by-300 vertical picture elements (pixels). 1.2.7 Color Display Unit The 13-in color display unit permits the display of high-resolution (720 x 300 pixels) colors. The standard CRT controller located on the system unit board supports eight colors for the unit, vhich presents information in a 25-line x 80-column format. Used with the graphics video controller board option, the color display unit produces high-quality raster and character graphics. 1.3 ENVIRONMENTAL CONDITIONS The next four tables list environmental conditions for the Texas Instruments Professional Computer. Table 1-1 1lists the storage conditions for a standard system. (Storage assumes that the system is enclosed in the shipping container.) Table 1~2 1lists the operating conditions for a standard system. Table 1~-3 1lists the storage conditions for a system that includes a Winchester disk. THaibnlcehes1t-e4r lists disk. the operating conditions for a system that ¢ includes a « Table 1-1 Storage Conditions, Standard System Temperature Relative humidity shock Vibration Altitude ~-30 C to +70 C (50 C maximum for diskette) 10% to 90%, no condensation 30 Gs, half-sinusoidal pulse with 30 ms duration along X and Y axes. 20 68, half-sinusoidal pulse with 30 ms duration along Z axis. Sinusoidal, 5 to 250 Hz linear swveep at 1 octave/minute with 0.50 input. Dwell 15 minutes at resonant points (2X input level.) 45 000 feet maximum TESCOHVNEIICANL REFERENCE INTRODUCTION - Table 1-2 LRC N "Uf Temperature Operating Relative humidity Shock or we GeolE `i !Vibration S Altitude Conditions, Standard System e e +10 C to +40 C with gradient less than 10 C per hour 20% to 80%, no condensation ' S 63, 10 ms three half-sinusoidal pulse duration along any of perpendicular axes. with the . 0.5 Gs peak accelleration in range of S5 to 250 Hz, linear at 1 octave/minute. the Bveep ] 10 000 feet maximum wey n o3 NOTE et ol B us Derate the upper temperature by 1 C first S00 feet. limit of the for every 1000 feet operating above the 2 S Table 1-3 Storage Conditions, Temperature * Relative vy e Shock humidity Vibration LS Altitude System with Hinchester Disk -30 C to +60 less than 10 C with gradient C per hour 20% to 80%, no condensation 30 65, half-sinusocidal 11 ms duration. pulse with 20 68, half-sinusoidal 11 ms duration. pulse with 30 000 feet maximum 10 000 feet unpressurized 1-5 TECHNICAL REFERENCE INTRODUCTION Table 1-4 Operating Conditions, System with WHinchester Disk Temperature Relative humidity Shock Vibration tAltitude +10 C to +40 C with gradient less than 10 C per hour 20% to 80%, no condensation S Gs, 10 ms three half-sinusoidal pulse duration along any of perpendicular axes. wvith the 0.5 Gs peak acceleration in the range of S to 250 Hz, linear swveep at 1 octave/minute. 10 000 feet maximum NOTE Derate the temperature upper by 1 C girst 500 feet. limit of the for every 1000 feet < operating above the TECHNICAL REFERENCE SYSTEM HARDNARE Section 2 SYSTEM HARDWARE 2.1 INTRODUCTION This section describes the design and functions of the hardware in the standard Texas Instruments Professional Computer system. Hardware described in this section includes the keyboard, the system unit Dboard and its two logical subdivisions, and the display unit. Figure 2-1 is a block diagram of the system hardware components, including some options. showing the separate The option hardware is described in Section 3, "Hardware Options." 2-1 '[EQH)I!CAL REFERENCE SYSTEM HARDWARE WNTEIORPNTAILON:MO2D1E2M0R B1O0A3 RD CLOCK AND ANALOG INTERFACE BOARD (OPTIONH GRAPHICS VIDEO CONTROLLER 10PTION) "V / £ 4 7 \ --_-- COLOR DISPLAY UNIT L FOPTIONY PARALLEL PRINTER CABLE (OPTION) & 320¢ DISKETTE DRIVE --" RS WINCHESTER DISKOPTION: ---- 320K DIOSAKIEVTETE QLY MOTHERBOARD ISYSTEM UNIT BOARD) CRT CONTROLLER BOARD e YNC-ASY! 10PTION) EBXOPAARNDSI'OGNPTIROANM 128K 8O4RK 192K B £ ~ e a9 = i SERIAL PRINTER CABLE 1OPTION} MONOCHROME DISPLAY UNIT STANDARD: MODEM CABLE 10PTION: @ 3 yErT , Figure 2-1 System Block Diagram 2222181 N cuyPedi odee A menetd TECHNICAL REFERENCE SYSTEM HARDWARE 2.2 KEYBOARD The electronic functions of the keyhoa?fi include: * Scanning the key matrix and encoding Xeys depressed by the operator * Transmitting data to the system unit * Receiving and responding to commands from the system unit * Implementing a software-switchable repeat-action function * Performing n-key rollover * Locking/unlocking the keyboard * Performing a self-test 2,2.3 Encoding Keystrokes The encoder scans the keyswitch matrix, detects valid keyswitch state changes, looks up the proper key code, and transmits the keycode as part of an 11-bit stream to the system unit. Each key causes either 1 or 2 bytes to be transmitted, based on the status of the SHIFT, ALT, CAPS LOCK, and CTRL keys. For sgpecific details on byte definitions, refer to subsection 4.12. Some wuser-programming application level. See Encoding."" of the function Xxeys the paragraph in Section is possible 2 entitled, at the "Custom 2.2,2 Transmission The Xkeyboard percent. The is met: transmits data to the keyboard transmits when system one of unit at 2440 baud x> 1.50 the following conditions * HKWhen a valid key depression has been detected * HWhen a system command is understood and acted upon When the user presses a key, the keyioard proper Xkeycode byte or bytes across Keycodes are explained in detail in "Keyboard DSR." Pressing some keys transmissions. responds by sending the the keyboard transmit line. subsection 4.12 entitled can signal repeat-action "HTECHNICAL REFERENCE SYSTEM HARDWARE 2.2.3 Receiving and Responding to System Unit Commands The system unit transmits to the keyboard at 30S baud * 1.50 percent. To respond to a system unit command, the keyboard transmits a response code to the system unit, indicating that the required action has been taken. The keyboard responds to every valid command. For certain conditions, such as parity errors, unknown commands, and start bit errors, the keyboard ingores the system unit commands and sends no response. If this happens, the system unit retries the command. System unit commands and keyboard responses are listed, in hexadecimal form, in Table 2-1. Iin column lists the codes sent to the column lists the code returned this table, the "Command Code" keyboard. The "Keyboard Response" by the keyboard microprocessor. Typically, system unit the microprocessor returns (except in the case of a Self-test OK failure during (code 70) to self-test). the NOTE Throughout this manual, the symbol H denotes a hexadecimal address or value. TECHNICAL REFERENCE SYSTEM HARDNWARE Table 2-1 Keyboard Commands and Responses ' `System Unit `Command Command Code (H) Keyboard Response (H) Response Meaning Perform a power-up self-test and install default parameters oox* 70 71 72 Turn repeat action ON Ot* 70 Turn repeat action OFF 02 70 Lock keyboard Unlock keyboard 03 70 O4x 70 Turn keyclick ON Turn keyclick OFF 0S5%*% 70 06k*% 70 Reset (same as 00) o7 70 71 72 Self-test oK Keyboard ROM Keyboard RAM error error Self-test OK Self-test oK Self-test 0K Self-test OK Self-test OK Self-test OK Self-test OK Keyboard ROM Keyfioard RAM error error Return version - o8 (of keyboard ROM). 70,73 * Indicates default values. *%* Keyclick requires a hardware modification. It is not presently supported. Yz-byte code) TECHNICAL REFERENCE SYSTEM HARDWARE 2.2.4 Implementing a Software-sSwitchable Repeat-Action Function A repeat-action key is one that automatically repeats when depressed for one-half second (s) or longer. As long as the xey is held down, repeat-action transmissions from the Xeyboard to the system unit continue at a rate of 15 per second. 2.2.5 Performing n-Key Rollover Repeat-action interacts with n-key rollover in the following manner. Pressing more than one nonmode key does not cause repeat-action. Instead, the most recent ey pressed transmits to the system unit. When repeat-action is enabled and one key is pressed, that key 1is acted upon by the repeat-action function. The following examples clarify the relationship between rollover, repeat-action, and mode byte changes. Example 1: Assume that the following sequence of events occurs: 1. No mode bits are on. < 2. The a key is depressed and held down for more than one-half second. 3. The b key is depressed. 4. The SHIFT key is depressed. (The SHIFT key can be held or released without altering the characters transmitted to the system unit.) S. The b key is released. 6. The a key has not yet been released. The result transmitted to the system unit and displayed is: asaaasaaaaaaaaabaaaaaaaaaas... TECHNICAL REFERENCE SYSTEM HARDWARE C Example 2: Assume that the following sequence of events occurs: 1. No mode bits are on. 2, The a key is depressed and held dowvn for more than one-half second. 3. The SHIFT key is depressed and held. 4, The b key is depressed. (At this point, the SHIFT key can be held or released without altering the characters transmitted to the system unit.) 5. The b key is released. 6. The a key has not yet been released. The result transmitted to the system unit and displayed is: aaaaaaaaaasaaaBAAAAAAAAAAA... 2.2.6 Locking/Unlocking the Keyboard 2 < At certain times during system operation, the keyboard locks. Buring these times, all normal functions of the kxeyboard are sugspended. That is, the keyboard does not scan, encode, or transmit data to the system unit. The keyboard locks if: * The pelf-test is in progress. * The self-test fails. * The keyboard receives the LOCK KEYBOARD command. The keyboard remains locked until one of the following occurs: conditions * The self-test successfully completes. * The keyboard receives the UNLOCK KEYBOARD command. 2.2,7 Performing a Self-Test The keyboard performs a self-test when it receives code 00 from the system unit, interrupting any keyboard operation in progress. The TECHNICAL REFERENCE SYSTEM HARDWARE self-test transmits paragraph Commands. completely checks the Xxeyboard system RAM and ROM, then. the results to the system unit using a code explained in 2.2.3, entitled "Receiving and Responding to System Unit 2.3 SYSTEM UNIT BOARD The system unit board, or motherboard, is the heart of the computer. It is mounted on the bottom of the system unit chassis. The motherboard is divided into two logical function areas, one for system support and one for the expansion bus. Refer to Section 5, drawing 222300S, for logic diagrams of the system unit board. Figure 2-2 is a block diagram of the separate subsystems of the motherboard. 2-8 SYSTEM HARDKWARE zolzETTT m>_H"Ofl_LI,wIhNwNw"O_Dm_n IAHTOOVLNI¥IIILNLLNIXON3DSIA 16n0a4TvYy3vLdNlIN . HQOULYIOIINANIOND LOINNOD Figure 2-2 Motherboard Block Diagram oa u2fl0%6fl61n0fi4w HOYLO8LY2YS9HNEVIW4LJIWSO`IEVVIITLUvGQ169IO1LNIYHM HILNNOD Sulanne -~ NOWLdO L4N2Y1Y9Z01INI YU CFERWYGYLLLIIEED HILVY Ad1d0O4T4LNOSDN AJsIOlNd ONLYoLUvInLaNIaEd e HvIiLvYa1 ANVHOHI3EL0NIYS H1IdTwNIeUO5UY7IL8INNOGD INAVWIV S QSUHV3O4S4AnIaN S3SY1£I4eW128I81L QYYO=BAIN 9N0S71I0 TOAHdIdNOOD --------e (SNOISLJUOOLHIOI4NNSOHDOL$INI3NNNOODISN39V0E3XTAy} 30022031001 $N8 viva QONNAvIHWIO3LW0I0W9NY3Y0 APOWIW WILSAS WYYe L19lY m SNA SSIVOAY AYOWIW NAILibvdNID wvy uD1A9T6L2I]LWIYNW SNE SSIVQOY WALSAS HITIOHINGD sng 80 HOLVYINID AIve0zNsD yOSSD D-I0H8YI0dN80AdN 404 13%008 TECHNICAL REFERENCE EBFHNKCAL REFERENCE SYSTEM HARDHWARE 2.4 SYSTEM SUPPORT That section of the motherboard hardware and logic for the: dedicated to system support contains * Keyboard port * System CPU (including microprocessors, clocks, bus controllers, and buffers) ;, * Motherboard input/output (1/0) system * Motherboard interrupt system 4.;* Motherboard memory system . % © r + * A oz PDC subsystem (including buffers, write precompensation, and diskette drive interface) . CRT controller é;4.1 Keyboard Port s The Intel 82S1A, a wuniversal asynchronous receiver-transmitter KUART), is the port for serial data transmission between the motherboard and the keyboard. Data received by the UART alvays generates an interrupt to the interrupt controller. The transmit ready line does not generate an interrupt unless the transmitter in t¢he UART is enabled. The keyboard port interrupt is ORed with the "interrupt reguest 7" line from the numeric coprocessor. An SN7S5189A line receiver with a slowdown capacitor conditions the receive data signal to protect the signal from transients. The receiver hysteresis is approximately 1 V centered around 1.4 V, which improves the noise immunity. Another SN75189A buffers the transmit data 1line, providing a good voltage swing and drive to the keyboard cable. This buffer consists internally of an output transistor with a 2-kilo ohms (kohms) pullup resistor. fo; improve diagnostics, the data set ready (DSR) 1line on the uwpiversal synchronous/asynchronous receiver transmitter (USART) gppnects to the Xxeyboard connector through a SN75189A buffer. The transmit data line connects to the DSR-line at the xkeyboard, which allows detection of a disconnected or defective keyboard. el The: inrput divides. this input clock clock to frequency for the the transmit section is 19 S31.25 Hz. The 8251 by 64 to generate a baud rate of 305. The receiver is 156 250 Hz. This frequency is TECHNICAL REFERENCE SYSTEM HARDWARE divided by 64 to generate a baud rate of rates are close to the standard 300- and instruments can simulate a keyboard with 2441. Because these 2400-baud rates, system standard eguipment. baud test 2.4.2 System CPU EA The system CPU consists of an Intel 8088 16-bit microprocessor, CPU clock circuits, several CPU bus buffers and latches, a CPU controller, and the reset circuit. A special socket on motherboard makes it easy to add the optional Intel 8087 numeric processor (also called a numeric coprocessor). the bus the data The Intel microprocessors work together appear to be a single chip. Therefore, manual) refers to both devices. and, to attached the term CPU (as components, used in this 2,4.2.1 Optional Numeric Coprocessor. The user can choose to add an 8087 numeric coprocessor to the system unit board at any time. Once the 8087 is inserted into the socket provided, both the 8008 and the 8087 decode the special escape instructions. The 8088 does any memory-access computations required and accesses the first byte of memory according to the instruction. The 9087 decodes the instruction, "catches" the memory address generated by the 8088, requests the bus from the 8088, and completes the required memory access. After finishing with the bus, the coprocessor releases it so that the 8088 can continue with the next instruction. If necessary, the 8088 sends a HWAIT instruction to the 8087, ensuring theil synchronization. « 2.4.2.2 CPU Clock Generator. The CPU clock generator consists of ah Intel-designed 8284, & crystal, and some discrete components. To generate the 5.0 MHz clock frequency, the 9284 divides the crystail frequency (15.0 MHz + 0.01 percent) by 3. The 9284 also contains logic to synchronize the WAIT- line from the expansion bus and memor} subsystems with the RESET- line from the power-good circuit. NOTE i3 Signal names followed by a dash, such as HWAIT-, At are active low signals. B 2.4.2.3 CPU Bus Buffering. The CPU operates in the so-called "maximum" mode of this integrated circuit. (For additional information, see the 1Intel 1literature on the 8088 and 208y microprocessors.) order to reduce The the CPU uses number of a pimnusltirpelqeuxierded address on the and data processor bus" in chip: For this reason, and to provide adequate buffering for the address and data lines on the expansion bus, a set of address latches (U5} U6, U7) and a data bus buffer (UB) are an integral part of the CPUYI" gJ let 3".l`!Cl-ulICAI.. REFERENCE SYSTEM HARDHWARE 2.4.2.4 CPU Bus Controller. The CPU bus controller chip (U3 8288) receives the status information from the processor and converts it into the lines MRDC- (memory read), AMWC- (advanced memory write), IORC- (X/0 read), AIORC- (advanced 1I1/0 write), INTA (interrupt acknowledge), DEN (data buffer enable), and DTR (data buffer direction control). A simple open-loop signature analysis (SA) arrangement is provided to check out the CPU., Connecting pins E17 and E180 (on the motherboard) with a jumper and resetting the system (power up) causes the processor to execute a OBFH opcode. The jumper disables the system data bus buffer Us, and the pullup resistors in U66 pull the bus up to a high state. Transistor Qi pulls down data line AD6 to provide the "0" bit in the opcode. The segmented architecture then causes the processor to cycle from address FFFFOH through address FFFFFH and from 00000H through OFFFOH during the SA loop. The symbol value. NOTE ""H" denotes a hexadecimal address or 2.4.2.5 Reset Detection Circuit. The power-good (reset detection) circuit discovers insufficient power conditions on the motherboard by monitoring the 12-volt (V) power line. Hhen the power drops, but does not shut down completely, this circuit causes an automatic restart. If the voltage falls to approximately 11 Vde, a resistor/capacitor combination and a voltage comparator with transistor inverter hold the RESET 1line true for at least 3 milliseconds (ms). 2.4.3 Motherboard Input/Output System The motherboard input/output (I/0) for all the devices on the board. output latches are also components shows a map of the motherboard I/0 system decodes the 1I/0 addresses The input buffer and the various of the I/0 system. Table 2-2 addresses. The various I/0 devices have available 16 /0 address bits. Only 10 of these bits, a total of 1024 bytes, are decoded. Beginning at address OOOCH, the motherboard uses 48 bytes of this space. This leaves 976 bytes available for the expansion bus. Table 2-2 lists the motherboard devices that are addresses within the CPU 1/0 space. Appendix A map of all system I/O addresses. decoded provides and their a complete TECHNICAL REFERENCE SYSTEM HARDWARE Hex Address Table 2-2 Map of the Motherboard I/0O Addresses Device Bit/Use 00000 00001 00002 00003 00004 U47 Latch U48 Input buffer U49 Latch o USO Latch NOUIWNERO I ~ N NOUNEW M NO NOWUEWNO Speaker timer enable Timer 1 interr upt enable Timer 2 interr upt enable Single-density (FM) enable Track greater than 1/2 (TG43) Diskette side one enable (FSID-) Diskette mode control (Mi) Diskette mode control (MO) Option Option Option Parity Printer Printer Printer Printer jumper E1-E2 jumper E3-E4 jumper ES-E6 interru pt pending port B usy port p aper out port p rinter selected port N O fault Printer port data outputs LED 1 OFF LED 2 OFF LED 3 OFF Parity interru pt enable Printer port n ot autofeed Printer port n ot strobe Printer port n ot initialize Printer ACK in terrupt enabdble *PWNOKFEWON- US1 Latch N O s WNO Diskette Diskette Diskette Diskette Diskette Diskette Diskette Diskette drive drive drive drive drive drive drive drive SELECT SELECT SELECT SELECT MOTOR MOTOR MOTOR MOTOR 2-13 TEGHNICAL REFERENCE SYSTEM HARDWARE Table Hex Address 2-2. Map of the Motherboard Device I/0 Addresses (Concluded) Bit/Use 00005--0000F 60010 00011 00012~-00013 00014 00015 o006 00017 00018 00018 00020 00021 00022 00023 00024--0002F Reserved U44 8251 USART U444 8251 USART Reserved U4S 82S3 timer U4S 82S3 timer U4S 8253 timer U4s B2S53 timer U46 8259A interrupt U46 82S9A interrupt FDC command register FDC track register FDC sector register FDBC data register Reserved controller controller or RAM or RAM reset Data register Control register Counter Counter Counter Control © 1 2 register TECHNICAL REFERENCE SYSTEM HARDWARES dd2f(oee.IuCvc4)rio.cd3ee.drd1o.eecsoHdA$eL/Trt10hh.2eeL6D.eItc/h0oidrdidneTghc.ieos dionAngse.e-cchooanmdlbTfihenaoitfsfiioraanstd7u4oafLIlSC1378its4,hLreSae1w3hh9i,acrihdn-tvaehirigs crrhaaatye-odilsnoeg-aioccfio-rnecei(u-HgioAhtfLts-yb:t:+H Table AND rowv true. ofin2-Et3xerptmrhgseeisvsefserdsoammtehienoneasBreorcoratloyiweoann,lisogtieOcrRtmehsded,evwoiiucttehputptrheoggoerAsaNmDmaicnotfgi.vetermHisfhenftrheotmheresalunologttihcealrvi1sdi00t'03s<c0 IORQ = (XS2 x XS1 x XSO x IORC) + (XS2 x XS1 x XSO X AIOHC) ~1o0t ZLecs £0 2.0 SR Tadble 2-3 Input/Output Signals - HAL12LE Integrated Circuit ALC L0 Xs2 Xso XA9 XA7 XAS IORC- Output Xs1 DEN~ XA® XA6 XA4 ------- P e bt e b b a b e b bt e AIOHC- Comment b e rmrr e e e r e e s e e, e ------ IEN- L L H L L or L H L L L (X3 05 L BS A% PR 4 or . . 0 a o ------- e ee L L L L LL L L A% H N s 6o . S et e b e b . . . . . 3 a1 g, b . L L b be Read 1/0 Hritq`l/o Interrupt acknowledge Inactive term e e Xcs - L' LIRS H R LI T U T 1 ST TR 55 A 1S OB LN HIENL U LR IO LR T, Sy, FEty ------- Pt TCR B B I b -- b r el et m b m el o diie o o o e eb B3 e Read I/0 at 74L3S139 Write I/O at 74LS139 e mmccc e e m--m e Read I/0 ------------ O AL H IS LU o o a o a ------- P FICS- L L et e bbb e b H .LLLLH g b me L . L e e e e . Write I/0 r e e e e, r e c e Read diskette ------ O i L BE HIRN L S TSR ------- Pt et U DN TN LR H e T b et et bbb r . e e Hrite diskette m e m s e s s mcm e m---- e -- - YCs - L LERH orBLENHIN LA ------- Pt XX XX H BT N LI L DU bbbt L OO 1,0 L LN T DR D 2 LT T m b et r e b e r b e e e Read 1/0 at 74LS138 HWrite I/0 at 74LS138 r e e m e d e r e e ------ e ---- - Halt or . L . . . . . . . . . . or . a 'Y i bl @ B B VY w TR or . . I I .... ... ------- P b et e b et e b e e e et r e e b r e e e E R e, rr S ---------------- - ------- Legend L = = Low signal, High signal. TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.3.2 Parallel Printer Port. Printers with Centronics-compatible _interfaces wuse the parallel printer port. This port contains a 25- pin female, D-type connector. The basic signals are the output data 1lines from U444, the PTSTR- . signal that strobes the data into the printer, and the PBUSY and ., PACK- lines, which indicate to the CPU the printer''s readiness to receive a character. In regular printer operation, the PBUSY line goes high wvhen the printer is not ready to receive a character and lov when the printer can accept a character. The PACK- line goes low for a short time wvhen the printer finishes with the current character. The rising edge of this line generates an interrupt when printer interrupts are enabled by the PTEN line. This interrupt is ORed with the ""interrupt request S" line on the expansion bus. The pin-out of the port is given in Table 2-4. Pin numbers for the 36-pin printer connector (at the printer end of the cable) are given in parentheses. The extra lines are used for various control and status functions associjiated with the printer port. = = R TN e e e eB TECHNICAL REFERENCE SYSTEM HARDWARE (- Table 2-4 Printer Port Pin-Out ----------- Pmt r e m e e --a e Source | Signal | ----------- P m e e, --, e _, e e e ---- 4 System | Data is sampled when § | signal is low. ----------- e e e e -- | e System | Data output bit. | ----------- P m e e et e e e, n - ¢ System I I ----------- e e et --m--r e System | ----------- P r st e, e e | m---------- System i ----------- e r e --,---- e, } ------ System | ---------------------- P e et | e, ------------g System { ----------- P e e e M rr cc et e, -- e | e System } | ----------- e e e c e e mc r ee -- System | } ----------- e e e e et e, e -------- Printer | Another character | ___________ | can e e be o o received. B SRR | Printer | No data`can be seant | | when signal is high. | ----------- P - e e e re -- Printer | Printer is out of paper | | when signal is high. | ----------- e e e, r e, ------ e ------------ ¢ | 13 } | | ] sLcT | Printer | Printer is online | | (ON LINE) | | when signal is high. } o -------- o -------- er e~ e ---- - P et e, ee e ------ . | 14 | i - f1s(32) | e -- i { | AUTO FEED~ | | System { | Printer is to line feed | | on carriage return | { | i | when signal is low. } m------mm- e - ---- L e c e e ----r e + § | FAULT- | Printer | Indicates a fault | } | | | vhen signal is low. } e m--m-- e e m e ------ P e et e e + {16(31) I J25(30) } | INIT{ | System | Resets printer when | § | signal is low,. j m-------- - R R i e a - Pm e -- 117(36) |18(33) | SELECTION- | System Pmmm e m - mme e tmmmm e * The numbers in parentheses are the pin P e et --rmr e | Always low. P e e e e numbers for the 36-pin m - - +* } + Centronics-type connector. STECHNICAL REFERENCE SYSTEM HARDWARE "2.4.3.3 Timers. timing wunits. oscillator, and The 8253-5 counter/timer IC provides three separate In this system, one is used as a programmable speaker the other two are programmable interval timers. The speaker timer is clocked by a square wvave of 1.25 MHz. Divisors -up to 6S 536 can generate output frequencies as low as 15 Hz. The "high input frequency creates output tones that are more musically accurate. The speaker timer clock is internally gated with the speaker enable (SPKEN), an output of latch U47. This signal allows the interruption of tones without a reprogramming of the timer. The second timer (Timer A) is used in system-timing applications and as & real-time clock. It generates an interrupt signal on the rising edge of the timer output wvhen the enable line (address O bit 1) is set high. Toggling this line low resets the interrupt; holding this line low disables the interrupt completely. The interrupt level |is 3. The input clock frequency to the timer is 625 kilohertz (kHz). A divisor of 62 S00 generates a pulsewidth of 100 ms, while a divisor of 1S 625 generates a pulsewidth of 25 ms. The third timer (Timer B) is used for special-purpose timing applications. It generates an interrupt on the rising edge of the timer output when the enable line (address ¢ bit 2) is set high. Toggling this line 1low resets the interrupt; holding this line low disables the interrupt completely. This 1line is shared with the expansion interrupt 1line IR2. The interrupt level is 2. The input clock frequency to this timer is 625 kHz. ¢ 2.4.3.4 Speaker Amplifier. The speaker timer output goes to an amplifier (LM 396) that drives the ©6-ohm speaker, providing sufficient volume and allowing mixing of signals from external sources (option expansion cards). To mix other signals with this signal, connect any other signal source (such as the speech option board) to P12, the summing input. 2.4.4 Motherboard Interrupt System The motherboard interrupt system can encode eight separate interrupts and vector the central processor to eight separate interrupt routines. A nonmaskable interrupt (NMI) (which produces the highest- priority interrupts) is also available. The majority of the interrupt logic is contained within the Intel 82S9A interrupt controller chip. The 8259A is programmed for level- sensitive input and is the master (only) interrupt controller. puring the INTA cycle, the decoding logic array always enables the contents of the I/0 data bus onto `the system data bus. This information is the vector from the 8928A chip, and the system, therefore, requires only one controller. The 98289A chip assigns priority to the incoming interrupts, allows masking of interrupts, and provides the vector to the CPU during the TECHNICAL REFERENCE SYSTEM HARDWARE interrupt acknowledge (INTA) flops permit some interrupt be edge-triggered, and cause cycle. levels others A series of OR gates and lip- to be shared, cause some inputs to to be level-triggered. -4 The interrupts that come from the expansion bus are active high LA and are, therefore, terminated ground. All the pulled-down either directly or through the gate input current from with a 4.7-kohm pulldown resistor to inputs are connectied to the 8259A chip, a CMOS OR gate. This connection prevents raising the input voltage above the legal "low" level through the pulldown resistor. CAUTION Even though the system is protected, programmers and designers wusing interrupts on the expansion bus should be sure to "mask off" unused interrupt lines as a matter of good programming practice. The NMI detects parity errors on the motherboard RAM system. To generate this interrupt with software, set the DTR line on the 82S1A USART. The RAM can then be tested without parity-error interruption. i The interrupt levels and their expected uses are given in Table 2-5, B Table 2-5 Interrupt Level Assignments Ifiterrupt NMI IRO IR1 IR2 Bus Line AO1L BO4 B24 B2S IR3 na IR4 B23 IR6 B21 IR7 na Use . System parity error, CRT interrupt Communications port 1 Communications port 2 Communications port 3 System board timer 2 Local area net board buffer full/empty System board timer 1 (clock) Communications port 4 Diskette drive, Winchester disk Keyboard, numeric coprocessor na = Not applicable. 2-19 2 TECHNICAL REFERENCE SYSTEM HARDHARE 2.4.5 Motherboard Memory System The memory system on the motherboard consists of 64K bytes (K = 1024) of dynamic RAM, up to 16K bytes of ROM, decoding logic to establish " the addresses, and timing and refresh logic to operate the system. A connector and the necessary logic permit the addition of one of the expansion RAM boards. These boards are available in 64K-, 128K-, and 192K-byte capacities. After adding the 152K-byte board (bringing the total to 256K bytes), further expansion requires the addition of a 256K-byte board that plugs into the expansion bus. (This board and another memory expansion board are fully described in Section 3.) 2.4.5.1 Hotherdboard Memory Addressing. The memory space of the processor devices used by the motherboard is given in Table 2-6. The balance of the system memory is given in Appendix B. Table 2-6 Motherboard Memory Map Address Device Dynamic RAM: O0000O0-OFFFF 10000-1FFFF 20000-2FFFF 30000-3FFFF ROM Usage: FCOOO-FDFFF FECOO-FFFFF < 64K-bytes motherboard RAM 64K-bytes expansion RAM board bank 1 64K-bytes expansion RAM board bank 2 64K-bytes expansion RAM board bank 3 8K ROM space, one wait state (XU62) 8K system ROM, one wait state (U63) TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.5.2 Memory Control Logic. A Dbidirectional buffer (Us1) separates the main system data bus from the motherboard expansion memory, thereby providing sufficient drive and margin to the data transfers. U288, the memory hard array logic chip HAL16R4, in combination with US3, the 74LS139 decoder, handles decoding and timing for the ROMs. Because ROMs and EPROMs (erasable programmable read-only memories) are generally slow devices, a wvait state is added to all accesses to these devices. The ROM access times are listed in Table 2-7. Table 2-7 Function ROM Access Times Time Required (in Nanoseconds) CS-ROM access 410 ROM address access 577 1/0 Hait States. The HAL chip alsc contains the logic to add a wait state to all 1/0 accesses made by the CPU. The wait state is necessary because many of the I/0 devices operate too slowly when the system buffer and setup and decode times are included. With the wait state, the control lines are active for approximately 600 nanoseconds (ns). Memory Refresh lLogic. The RAM refresh logic operates synchronously with the accesses to the RAM memory. Refresh cycles begin only when a RAM memory cycle is not in progress. This implies that the RAM refresh can occur at the same time as accesses to other system memory (ROMs) or I/O space. Each time a refresh cycle begins, a refresh timer (one-shot U29) starts,. When it times out, it provides the signal to begin another refresh cycle. This timer is set to 15 microseconds (us) maximum, which allows for the worst-case refresh- regquest latency. To maintain the contents of the RAM under worst- case conditions, the refresh must occur at least 128 times within 2 ms. (The average refresh timing is once per 15.625 us). case latency for a refresh request is about 600 ns. The worst- Once a refresh cycle has begun, it must be completed (including the precharge) before the next cycle begins. If a RAM access cycle starts before the refresh cycle completes, the HAL state machine puts the CPU into a wait state until the refresh operation completes. In the worst case, this delay could extend the normal memory access time by four wait states, or 800 ns,. Assuming slowdown a refresh of the timer CPU, value of 14 us and the refresh overhead an average 600-ns is approximately 4.3 TECHNICAL REFERENCE SYSTEM HARDWARE percent average or 5.7 percent wvorst case. 2.4.5.3 CAS and Address Multiplexer Switch. A delay line from the RASI- (row address strobe input) line produces the SWM (the address multiplexer control). SKM ensures an adequate rowv address hold time (40 ns) and s8till operates the RAM guickly enough to finish the access within the system cycle time. The CAS1- (column address strobe input) timing depends on whether the cycle is a read or a vrite. If the cycle is a read, the CASI- signal is taken from the delay line 20 ns after the SHM signal to produce the ACAS- (advance column address strobe). ACAS- ensures an adequate column address setup time to the RAM and still gives fast RAM access,. If the cycle is a write, then the CASI- signal is taken from the falling edge of the system clock, which is about 150 ns after the occurrence of RASI-. This delay allows time for the data from the processor to propagate through the data buffers and the parity generator chip (U31i 74LS280). To control the generation of the CASI- pulse, flip-flop U33 is timed with CLK- (the system clock), samples the delay line (ACAS-), and is reset by MRDC- (the memory read signal). The output of the flip-flop is then logically ANDed (U34) with the ACAS- signal to generate the actual CASI- signal. To prevent the generation of a CASI- pulse during refresh, the refresh row address strobe (RRAS-) line holds flip-flop U33 in the preset state during a refresh. This forces the output of OR gate U34 (CASI-) to a high level. a 2.4.5.4 Parity Generation and Checking. The parity generator/checker chip (74LS280) generates a "1" to the parity RANM bit whenever there is an even number of 1's in the data byte being written, The parity RAM chip has a separate data bus to drive the output 1line. A pullup resistor holds this line high wvhen it is not driving the output (as in a write cycle). The parity data is then taken from the "odd sum" output of the parity generator and used to write to the RANM. . This method of parity checking does not cause a parity error whea the system attempts to read from nonexistent RANM. (To determine the size of system memory, the system software sometimes "feels" for memory not present.) When the RAM is read, all of the data bits and the parity bit are presented to the generator/checker and the parity output is sampled at the end of the read cycle. If parity checking is enabled and discovers a parity error, flip-flop U333 is set to interrupt the CPU. Once set, this flip~flop must be reset by software before additional interrupts can be given. If the enable bit (address 3 bit 3) is held low, then no parity interrupts (PINT) are generated., To distinguish the parity interrupt from other NMIs, the PINT line is fed to U4s (address 1 bit 3) and can be tested by software. TECHNICAL REFPERENCE SYSTEM HARDWARE 2.4.5.5 (HAL16R4 Memory U28), Control State Machine. A set up as a state machine, hard array logic device drives the memory control. This device has four outputs equipped with a set of clocked £lip- flops and four outputs that are direct combinations of the inputs. The AND of the terms on a line ORed with the AND of terms on other lines results in low-going outputs. This occurs either directly, on those outputs without registers, or after the clock on those outputs with registers. The signal RASI- activates RAS- out of the AM2964B RAM address apmTrTithhhdreuneeedoflsrgrttereirwsssesupaiisshcligg.sttenn,sxaaselltrsat.TtahMRteetDMhTseeEhS.eNETs-Lhit-eogAnMTasah2cisslte9gthei6enigl4avneslBaaciRClttPgRseUnAsaSSaXl-YdWaa-dAfctrItchSeTeeeXir-ss-nss(dumsiopo(ecnutudeathsmtsteeouedrlcsbtyitoichniatlpethnreleet.dterehpxnarretanomrRlacOellMemylssoa.ysrytoortortoepsufyTtitrhshnteeetthsoeeohmuHtAHasLAid)LgaRw)ttnAahaSaeiiltncudbrtiuesiscsfftRafraFteetSoreesHf.s.ih-fn Table 2-8 gives the logic for the memory control state A timing diagram of the memory system, shown the major operations of the memory system. in Figure machine. 2-3, indicates TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-8 Memory Control State Machine Logic - HAL1G6R4 Input Output MRD- XAL8 RASI- RFSH- MHR- RMX-~ XWAIT- RRAS- RFRQ IORC- MDEN- sSY- XA18 AIOHC- RMSEL- SX- Comment ------- bbb obobotbrbrmm bbb m b e b o b o b o e w oo > - e> e RASI=guLp. - L oL s - - H H . Memory read or . L BLLILS. g . (' 5 B o d o.d 6 © oo o tdia Lfo - n R LELE T Memory write Refresh (37 o8 a0 o A 4 o e O LALG. s All other OR terms ------- et bafeb b et ob bbb bbb b b E r r mE-- e r e rr r---- ---------------------- - - ----- XHAIT-HLWC UL s o e S IR DI Refresh+read RF1,2,3 Or L R L R el SR - L. Refresh+read RF3,4 O L or 'L, .sLaL g, (P o o o B'Ei% o o Bl LR T o o R LS - LTt Refresh+write RF1,2,3 Refresh+write RF3,4 ROM read/vrite (7 s oron omo ot o (Y7 °F o & oo ol ot R o o] TRl R 1/0 read I1/0 write ------- Potmbrt bbbt b et b b PP ee e e -------------- - - MDEN SIS SR R LYo S H HEF? RAM read/write or L .. HHL . . R B ROM read or . L . HHL . . S SR S or . . . . . .LL SRS .o ROM write All other OR terms ------- e e s e RMSEL- L . . HH L . . SO e ROM read or . L . HHL . . ond o o g o g O ROM write~ or R Ll R R All other OR terms ------- bbb bbbt b e bbb b bt R e r rr r r ,r e, -- e -- - m--- - The following four outputs have flip-flops: ------- bbb bbbt mrm b e bt et m b b e e P E e m e rC S r e e m e -- e - ---- o s RFSH- HHH . . . . . d | onviom o 0Y s Refresh RF1; no memory cycle or . . HH . . . . 8 o & oo b SiHh Refresh RF1i; no RAM cycle P 0% o0 =o o B o Sl R L H Refresh RF2,3 O ------- RRAS- e I . S bbbt b . . . . . 0 -8 b o bt rrm bbb . .. A e ol b r bebe P 1% o B o All other OR terms R, e e e e e e e --m e Refresh RF2,3,4 -- === = O A B W Tl L All other OR terms ------- et b oot r b e bbb e bbb P e E r e, e, et rc e e r e ---- -- - - sSY- B R O e - - - 50 <9 © hdh o CRN . B LT Refresh RF3,4 All other OR terms ------- O S S ok L o e R et L T SX- L. .HHL . . o o 4 . .. ROM read wait cutoff or . L . HHL . . X o Bl ow o g o R I s I TR SR ROM write wait cutoff 1/0 read wvait cutoff O, o L. BT I/0 write wait cutoff or . . s L N R All other OR terms ------- Pobo bbb et b e bbb bbb b P rree e e cm s e --m e -------- L = Low signal. H = High signal. TECHNICAL REFERENCE SYSTEM HARDWARE f £NTXT ; | IIP | ! | | | [ " 1 | | 1 | q].l_.|_.fl_ 1 T [Lye [ I _ o ! I _50¢ oS vioe T | | y 3 ¥ [ L(oy) l B L ---- ! ALtHvd WvH " T g V1vQ _ Wvy | o | | _ ; b 0% 7 T I ! 1 T T ! T 1 T T _ ] | | | T T L D[|J:I|_II|_TJ=.__ ._ 4 T ¥ ! 1 ------+{eT! vivT_ Av T_ | ! g ! ss3s0G[Y WOl 1 _ l T ! ~I_ | el | n-- wmoHdTi -- 1 ---- S et _ ] } " M " _ | .R[!I , I _ I [ I | e TTa|| aT=--1 ]! [ 1 _ i ] | | iT!|;| t |i|| },|| | T -- | T T | [ | ] | ] | | ] | T i f I : | " _ [ " T _Ir" mou_| _ | I == ! | | | [ | | | RI|SS |SRSRS || ] I USRO || S i . S | 1 - N e \]1I® [NI | e| \ NI e\i e|l1 \ ] A! \ e\ | | T "G3033N S1 TYNOIS NIHM S3LvOIaNIXog 3oISN AN ---- { = }-- [ ! | ! I ! _ | | = FIEVIVAVYSITUNDIS -- i _ I | |L | 10--+l ve , | ! | vLv0 ALlyvd , Vivau0ss30ug ) _ T T T 4 `aN393Y 0svo GR e} . 1 I | ! _ I 7 Mo1|[ =.||e I| _|l-U_ | O--|1 -sv--aIS¥2 1T I --5R O|I V _.1! _.l L o i | 1 | I | e | I INWM0Y I -svov H-- }--wuaavwy UT mL ou s \ d : | ~1svy | | | _ ! LIVM ~HS4Y Figure 2-3 Memory System Timing Diagram 2-25 TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.6 Floppy Disk Controller The floppy disk controller (FDC) section contains a floppy disk controller IC (FD1793-02), a floppy disk support logic IC (WD1691), and a pulse delay IC (WD2143), all made by Western Digital. The FDC also has a voltage-controlled oscillator (VCO) and one-half of a 7415221 one-shot. Two 2114 static RAMs, addressed by a CMOS 4040, act as a sector buffer, and a programmable array logic (PAL) IC decodes and controls operations. Miscellaneous logic handles signal timing and buffering. The logic described in this section includes: * Floppy disk controller IC * Sector buffer % Data write precompensation circuit * `Data separator * Diskette drive interface 2.4.6.1 Floppy Disk Controller IC. The Western Digital FD1793-02 chip is the FDC IC. This IC does serial/parallel data conversion, locates sectors on the disk, seeks the diskette drive, and performs other high-level functions. A complete description of the FD1793-02 chip can be found in the literature available from Western Digital. The 1.0-MHz controller input clock provides the correct data rate for standard S 1/4-in diskettes. Because U20 divides the clock down from 15.0 MHz, the duty cycle is 467 ns low, S33 ns high. 2.4.6.2 Sector Buffer. During read or write operations, data must be transmitted at a rate between 23 us per byte and 32 us per byte nominal (for double-density operation). A sector buffer, operating independently of the processor during a read or a write, ensures that the diskette drive performs properly. This buffer consists of: * A 1K x 8 static RAM device * A counter (to address the RAM sequentially) * Control Jlogic and a bus buffer (so that the CPU and the FDC can access the buffer) TECHNICAL REFERENCE SYSTEM HARDHARE Two bits (MO, M1) in latch U47 control the basic operating modes of the sector buffer. These four modes are as follows: Latch U47 Bits MO M1 Mode 1 1 o 1 o o 1 o FDC reads RAM and writes data to diskette. FDC reads diskette and writes data to RAM. CPU reads or writes RAMN sequentially. CPU reads or writes the FDC directly. The counter that addresses the buffer increments automatically each time either the CPU or the FDC accesses the RAM. To set up a fixed starting address wvithin the RAM, the CPU writes to the FDC sector register while the MO, M1 bits are set to O, o. This resets the address counter. The FDC is not affected because the CPU can access the FDC only in mode MO, M1. The PAL provides the control logic for the sector buffer, aided by a flip-flop that provides a 1-us FDC clock-synchronized signal. The PAL uses this signal, derived from the FDC data request (DRQ) line, to generate the read or write command for the FDC when the sector buffer is in modes 1, 1 or 1, 0. The FDC activates the DRQ line when a sector write requires a byte or when a byte is ready in a sactor read. This control logic and the CPU generate other signals to control the RAM and the counter. These signals are given in Table 2-9. The timing diagram` in Figure 2-4 defines the usage of these signals. When the logical AND of terms from one row is ORed with the AND of terms from another row, the output goes lowv when the result is true. TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-9 Programming for the HAL1OLS® Device Input IORQXAL M1 MO IORCAIOHWC~ DEN- Output XAO DRQD FLCS Comment e --m--e e mpr b med YAO LRl et I be b e be P I S almmL e ee . E CERne me Eee ------------ CPU <---> FDC Mode 0,1 or . s 5 S 5 e L LR o (Unused) ------- R LT e R L R e R L e T YAl S L LB . o A8 15 . CPU <---> FDC Mode 0,% or . S B o a o L LY b (Unused) ------- B e it T e R PR DD R Rl et b i FRD- o o w LH . L .L s CPU <-- FDC Mode 0,1 or . . . H L H . . . . FDC =--> RAM Mode 1,0 ------- Prm et FWR- I (I igt ' wo e © e mfr e e b e b LR 1 L L H H H R e eEP EC 2 CPU s FDC - -- e ee--- .- --> FDC ¥ode 0,1 <-- RAM Mode 1,1 ------- Pommbmm b r e ee e m b e e R . ------ S E e - - ------oe RHE- a 85 = LL . . L L o O I R H L H Ol . CPU --> RAM FDC --> RAM Mode 0,0 Mode 1,0 ------- mmbom b r b mm b b m b mpm e e e o e e = e v RCS - LU L& O bR LL . UL . H .H . o4 . CPU <--> RAM FDC <--> RAM Mode 0,0 Mode 1,X ------- b -- bb e m e eb e e e e -- e m e --m oo m e meosoe RRST- . H L LL . . L L o Reset counter Mode 0,0 or . Rt 3 . & 51 5 4 (Unused) ------- Pommpumtmm e FDEN- L L . LI or . . . L mm oo D H . ob me T R L . . .+ L L - ee e CPU <--> RAM CPU <--> FDC - - - Mode 0,0 Hode 0,1 Legend: L = H = Low signal. High signal. TECHNICAL REFERENCE SYSTEM HARDWARE 1 -MHZ CLK DRQ J__\_ --\-- CONTROLLER WRITING TO RAM _\----/__\ | _ --_--__\L__________________ DRQD FRD -, RWE-, RCS- \\ f_` MO - LOW, M1--HIGH RS VALID } READ FOC WRITEIRAM 1--MHZ CLK ~J] DRG DRQD FWR, RCS DATA \ VY ; CONTROLLER READING RAM J \ \\ j_% VALID >--_ READ RAM WRITE [FDC MO --HIGH, M1 - HIGH 2232164 Figure 2-4 Floppy Disk Timing Diagrams TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.6.3 HWrite Precompensation Circuit. Using modified frequency modulation (MPM) to write certain double-density data patterns on magnetic media causes . a "bit shift", requiring disk write precompensation. Compensating for the bit shift prevents the read data transitions from moving outside the detection range of the read circuitry. As track length shortens toward the center of the disk, data bits are stored closer together, so the bit shift problem gets worse. The ideal compensation gradually adjusts the write hardwvare as the track number increases. However, a compromise solution produces nearly the same results. The precompensation is turned off while the head is over the outer half of the disk, then turned on vhen the head is over the inner half of the disk. Disk drives can have either 40 or 80 tracks, so the software checks the type of drive installed, then determines the halfway point. For this reason, U47 (rather than the FDC) controls the TG43 signal. (Halfway point for an 8-in diskette = TG43 - track number greater than 43.) The write precompensation and data separator circuits are controlled by Ui4, R17, R18, and R19 on the motherboard. When the RDDATA- line (pin 11 of Ul4) is high, it forces the PU and PD- outputs from the WD1691 to a tristate condition. R17 adjusts the PUMP line (pins 13/14 of Uia) voltagel*o'lug vde. R18 generates a square wave of 2.0 MHz + S.0 percent from the VCO (pin 16 of Ul4). The pulsewidth (monitored from pin 5 of Ul4) should be 750 ns, giving a write pulse width of 187.5 ns. The waveform is visible only when the computer is writing data to a diskette. R19 controls the write pulsewidth through 15 a (the WD2143 IC), determining the amount of precompensating bit shift. The precompensation pulsewidth (monitored from pin -1 of ULS during a write operation) should be set to approximately 200 ns. The FDC signals EARLY and LATE control the direction of bit shift. These signals cause WD1691 to select the appropriate tap along the WD2143 (adjustable delay line) for the bit pattern being written. If precompensation is not needed on outer tracks, the TG43 signal inhibits the precompensation process. Because single-density frequency modulation (FM) encoded data does not reguire precompensation, the FD1631 also disables the precompensation when the double-density enable signal {DDEN-) is inactive (high). 2.4.6.4 Data Separator. The data separator 1is composed of two parts: clock recovery and separation of the data from the clock. The actual separation of data from clock signals takes place in the FD1793-02 FDC. The HWD1651 contains the digital circuits necessary to implement a phase-locked loop (PLL), the VCO is a 74LSé28 chip, and external components provide the 1loop filter. The one-shot U2¢ shortens and stabilizes the pulsewidth of the incoming read pulses so that the PLL and data recovery operations operate properly during the lockup interval. TECHNICAL REFERENCE SYSTEM HARDWARE TrtthhheeeelathfiiaPogLlnLhls-iohnrgipproelvodwiwgidetehpsuolftsreaathnesofictoRinDtotDhneAisTnAuR-oCuiLnsKsitghsenicagllnoiacnlkc.sohmoiu1nllgdockedbdeatan.eian rlaFyorspectcheiinsftiecrseydsptheams,oen When train the PLL is adjusted correctly, in a frequency range from 217 kHz it locks to an incoming pulse to 294 kHz (+ 15 percent) within to the 150 us. The RDDATA- input pulses should be (P9 pin 30), and low-going, 2 us maximum applied the DDEN- line must be low. Because of governs the regulator the analog nature of the power-supply voltage to prevents digital noise PLL circuits, a the VCO and the on the 5-V supply linear regulator loop filter. The from interfering wvith the PLL operation. The data separator works density (MFM) data. The with either single-density (FM) or double- choice is controlled by the DDEN- line. 2.4.6.5 through cables diskette driven drivers pullup brcyoea nsfniodDstersrheicteirstovikreeesecsstao,ttcnhehetaorfreoaclnocDldnrobesitnuhrvrnfaPeoerf1e3lced(rtlesoIexrnrcc.tobeeneprntattfewnoacedcteTesfnthoh.ererettchhdrteeerheTeiihcvveeeeteiwxS.rvoItsdeDe.ir1rssc-nkoPae9nltnwsteiiLcectgoodthnnwroani-rdlveirs)tecmi.hstpve.seeihsdraavntehAccteleoelmrmmsiuiensnnptiriaaegictrrnbainaabtnatloelgesn oloCs3tnniiho4enda-neetpnpieinnc,dc(taaiaonsns1rd0kceavbteriP(t9edadew-lrmeleiodidvudnegnrtetiebcevyro0def)mc.amaoconneiinnsunesssWciehtdrtea1w)enolli.rlitsneheodtsnhelTa(yhoiinnes3sexy4ocns-teethcdfpeeoortmrindvdrseuiyuecvsnapetitcisotnhehrmoius3cl2huordfaniisbi(tsbbsn,ioeisstndth)eeas.mltoclruaesanbeddptll,iTpeeeshdeckedtre)etthottnahfeteosirshtohheuaSadslslEredwLillaevEectyeCfwtbssTtoe terminated at the drive. If another drive is installed internally, SELECT on pin 12 (drive 1) with only With two drives installed, the terminating on the right-hand drive (drive 1) only. it should the select resistor be strapped for line terminated. must be installed NOTE The floppy disk controller and individual diskette drive logic signals assign drives using the convention of: DRIVE 0, DRIVE and DRIVE 3 (for a four-drive 1, DRIVE 2, system). The diagnostics diskette uses the convention: DRIVE 1, DRIVE 2, DRIVE 3, and DRIVE 4 for a four-drive system. Operating systems may use yet another convention, such as DRIVE A, DRIVE B, DRIVE C, and DRIVE ©D. Be sure to use the correct drive designator. 2-31 TECHNICAL REFERENCE SYSTEM HARDWARE Connector P13 interfaces with a 40-vire ribbon cable ending in a 37- pPin, D-type connector. The user mounts the mate to this connector on the back panel of the system unit chassis. When external drives are installed, all lines used must terminate at the external drive. » - All diskette drives must be of the same type. That is, all must be either 320K-byte drives (double-sided, 48 tracks per inch [tpi]) or all must be 640K-byte drives (double-sided, 96 tpi). A jumper from E1Ll to E2 selects 320K-byte drives; a jumper from E3 to E4 selects 640K-byte drives. The absence of a jumper selects 160K-byte drives. A jumper can be on either Ei1-E2 or E3-E4, but not both. The diskette drives do operation. However, if solenoids, they should be not need head-load solencids for proper the drives are equipped with head-load strapped for head load with the motor on. The signals STEP, DIRC, HG, and WDOUT are buffered by the 74LS244 in order to drive the two standard 7416 loads. This buffer is necessary because the FD1793-02 and the HWD1i691i can drive only one TTL load. The input signals KWRITEPROT-, INDEX-, TRKOO-, and RDDATA- are buffered by the 74L3S244, providing more static protection than the MOS-device inputs, and a small amount of hysteresis. To install external diskette drives, a short cable assembly links the motherboard connector P13 with a 37-pin, d-type connector on the back of the system unit chassis. Section 5 contains the wiring assembly diagrams for this cable. external power source.) (External diskette drives regquire an 2 Table 2-10 gives the pin-outs for the internal diskette drive connector on the motherboard. Table 2-11 gives the pin-outs for the external diskette drive connector on the motherboard. D-type connector pin numbers are given in parentheses. TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-10 Internal Diskette Drive Connector Pin-Out |] 24 | 23 | KRITE GATE~ | System | Enables writing to drive] | } | i | when iignal is low | - P ------- L R e P m - ---- e m e eeme c e, c----------- + | 26 | 25 | TRACK 00- | Drive | 1Indicates head is over | | ] R § | i | track 00 when signal | } | ] ] is low ] tm------------ mmmmm--me -- -- = bmmmme-- e m e e e, e e + | 28 i 27 | HWRITE PROT- | Drive | Indicates diskette } § | | f { i3 write-protected § Fmm------ o ------ Fmmm e m m m - d o m e m e, s cn et e -- e -- e + ] 30 | 29 | READ DATA- | Drive | Serial data from drive | b P tmmmm e mm mmmm-------- e - - +* | 32 | 31 | SIDE 1- | system | sSide select (0,1 = { J 1 -e o | | | ---- e mmm--= mmem -------- e high, low) r e, e e e e m e 1 ------- + | 3 4 B { 3 3U | -- | NC } -- | e fm-------m tPmm e -- e -- e Pmm - ---- e, e, e e e _,_,--, - ---------------- + * NC = Not connected. TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-11 External Diskette Drive Connector Pin-Out B P --------- Prrmcmec--r--------- - - ---- |signal|Return| Signal Name | Source | e -------- R bt e - Pmm-- - Pt b 2 (1)) 1(20)) -- I NCx | b ------ o --------e Fmm--mree e e rme o P I 4 (2)1 3(21)4 S I Nc | R - e m- P ---- P I & (3)] s(22)] s | K¢ ) ---------- b -------- e b mem---- P I 8 (4)) 7(23)] = I NC | m------------ - e ccc s e e b P 110 (S)| 9(24)} s | NC | P ---- o m---- Pem - --m --------- _---- e --m-- - ---- - Function ------------ - - - ------ * | e r e r e, e~ -- . ---------- +* -- e m e et | e ------ - + = I e e --, e -- e e . ---------------- + -- e, et e e | e = - + as r e s se ) ------ - + E | e e e e e e r et e - + {12 (6))11(25S)} INDEX- | Drive | 1Indicates index hole | R R D R mmm---------- Le e * fr14 (7)§13(26)| MOTOR 3~ | System | Drive motor 3 enable | Prmmwo- oo wm- P - mm--m---------- P e rrcrr e r e -- .. -------------- + 16 (8))115(27)} SELECT 4-~ | System | Drive select 4 | mr - o -------- P mmm e ------------ e -------- b, e e ------,r --,--,---------------- + {18 (9)}17(28)) SELECT 3- { System | Drive select 3 | O R btrcmc e rc m ec e ma - P c e mr e c e c e c e e m-- . ------------ + {20(10)}19(29)| MOTOR 4- j System | Drive motor 4 enable { mm-------- m---------- e me re -~ P mm-------- P e, e -- - ---------------- +* 122(11))21(30)] DIRECTION- | System | Step IN/OUT direction | e e ------ R e cmm--- e e e e * |24(12))123(31)} m---------- ---------- STEP- e m e e | System | oo - P Step IN/OUT command mrm e, e et m e r e -- | - = + §26(13))25(32)| WRITE DATA- | System | - e m--mm Pomrm - ---n ------ Pmm e ------ P Serial_data to drive | e ee e e e= - + {28(14)}27(33)| WRITE GATE- | System | Enables write when low | e ------ mm-------- e ---------- - - Pmmmmm---------- e e -- e -- . --------------- + |30(1S)|29(34)| TRACK 00- | Drive | 1Indicates head is over | } } | { | track 00 when low | ------------ tm---------- mmm e e bmmmmm - P e e m s cee e + |132(16)[31(35)| WRITE PROT- | Drive | Indicates diskette { | | | | { is write-protected | Frmm - R brmmem , m ----m ------ P ------------ P rcmr e r e e r e e --c e e - oo---- - §134(17)|33(36)| READ DATA~- | Drive | m------------ b Pmm e -- e -- e cmm--- Pm Serial data from drive | e e, e -------- - + |36(18))35(37)| SIDE 1- | System | Side select (0 = high) | e - Frmr e -- e ------- Frm--mmm-- P e, e e s e e m e --------- +* 13s(19)}37 - ------ R |40 |39 | X3 o mm e rr e .- | -- | NC ] e ---------- P { NC | £= § m e --,--------- ~ -- ----- -- + N | b Pm - bmmm e R et st e r e, -- e m e -- == * TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.6.6 Diskette Drive. The is equipped with one S 1/4-in, self-contained unit consists Texas Instruments Professional Computer double-sided, diskette drive. The of a spindle drive, a head positioner, and a read-write-erase system. Plastic slot. things begins, guides help to position the diskette inside the diskette After you insert the diskette and close the access door, three happen: the diskette clamps to the drive hub; a 500-ms delay and the servo-controlled drive motor starts. The head positioner is a 4-phase stepper-motor and band assembly with some related electronics. to cause a one-track linear diskette. It moves the head movement) to the ] (using one-step proper track rotation of the The following sensor systems are built into the unit. * The track 00 sensor. This switch head/carriage system is at track 00. determines that the * The index sensor. HWhen the phototransistor sees the LED light source through an index hole, it sends out a signal, * The write-protect sensor. When this switch finds a write- protect head. tab applied to a diskette, it disadbles the write The diskette drive reads and write operation records a 0.33-mm writes (0.013 digital dat; using in) data track, MFM. which The is later tunnel-erased to 0.30 mm (0.012 in). .The track-to- track access time is 6 mes. The drive speed is 300 rpm. Table 2-12 gives the specifications for the diskette drive. TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-12 Diskette Drive Specifications Physical Dimensions: Height Width Depth Height 85.85 mm (3.38 in) 143.10 mm (S.87 in) 203,20 mm (8.00 in) 2.04 kg (4.50 1b) Environmental Parameters: Temperature Operating o o 10 C to 40 C o o (S0 F to 104 F) Relative Humidity o (@ 40 F wet-buld temperature, no condensation 20 % to 80 % Altitude Mean sea level to 10 000 £t Power Requirements Voltage +S vde (+/- 0.25 V) +12 Vde (+«/- 0.6 V) Current 600 mA 800 mA Storage o o -40 C to 65 ¢C o ° (-40 F to 149 F) S % to 55 % ¢ Mean sea level to 45 000 ft - TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.7 CRT Controller Board The CRT controller board drives either a monochrome analog or a color TTL display and makes the Texas Instruments Professional Computer a complete alphanumeric and raster graphics system. As a stand-alone option, the controller board provides one page of high-resolution (80 columns x 25 lines) alphanumeric display. This board also supports the optional graphics video controller piggyback board, which is described in Section 3. The system makes no physical distinction between color and monochrome; the board supports output in either eight-level gray scale or eight-color RGB (red, green, blue). Color is determined by the monitor wused. Refer to Section 6, drawing 2223011, for logic diagrams. Figure 2-5 is a block diagram of the alphanumeric CRT controller board. Table 2-13 lists the video ac parameters. Figure 2-6 shows the timing diagram for the Alphanumerics State Machine PAL. Figure 2-S Alphanumeric CRT Controller Board Block Diagram 2-38 SYSTEM HARDWARE 2 21901 LdNYHILNI via SNINWOIILLYYYYLHI)BYYGNY183100NdD14D »IUF(;_ 1DW33INLNSOADS INHO3LHUHIAAINOONDOW N3I9 UVHI = NOL4L03JO -- Q3AH3S3Y 0109 SH1ON0LDI03N0NIGAD 3LN2B1I9H0L1 LY . Sv1OvIaHIV1Y0D0 LI3NNOD SIIHJVHO SIHOLVIONAS MOY 10a SN8 v.v3 18D «mwuuj EEE L93NNOB SJIHJVHO V1vQ HILIVYVYHD ViVGIINBHLLY Wvy SNG HOLV131N8IBLLY 8732 1W033LNSNAOSD HOLYY ¥L1Y W JINBIYLLY 8X#NZ $3HAQY HS3H43Y ISIW ANV MOY 100 | 40y, oo MMW e le==ZZX2il 0 S1O2I3HNJNVOYDO $Ng SS3Y --- LIINNOD WALSAS TECHNICAL REFERENCE TECHNICAL REFERENCE ' SYSTEM HARDWARE Ref* Parameter Table 2-13 Video AC Parameters Value Valuexx Tolerance A Video dot freguency B Video dot pulsewidth c Character block horizontal D Character block vertical E Number of character lines ; F Characters/character line G Number of active scan lines H Total scan lines J Vertical sync width K Vsync front porch L Vsync back porch M Vertical blanking interval il N Active vertical display time Total vertical time Q Vertical rate R Hsync- width s Hsync front porch T Hsync back porch u Horizontal blanking interval v Active horizontal display time W Total horizontal time X Horizontal rate 18.000 MH=z $5.55 ns 9 dots 12 dots 2S rows 80 columns 300 320 0.156 ms 0 ms 0.884 ms 1.040 ms 15.60 ms 16.63 ms 60.10 Hz 4.50 us 2,00 us 5.50 us 12.00 us 39.99 us $1.98 us 19231 Hz oo 1% S 1% -- -- 14 scan lines -- - -~ - - 350 S 385 SIS 0.156 ms 1B 0 ms 1Ry 1.664 ms 1% 1.82 ms 1IB% 18.20 ms 20.02 ms 49 .95 Hz . -- - 5 1% 1% + 2 Hz 1% 13 19 o 1IR% -- 19 S 1P% S 100 Hz * Letters refer to areas on the timing diagram in the next figure. ** These values reflect the vertical timing adjustments for SO0-Hz refresh. CAUTION S0-Hz operation can be used only in run on S0-Hz 1line frequency. operation in any other area can computer. To select SO0-Hz operation, ES-E6 on the motherboard. areas Using damage jumper that SO-Hz your pins TECHNICAL REFERENCE SYSTEN HARDWARE e 210 21N `91N ONY HYHLSIOIY LIIHS 40 LNO 13XId LSHI, ¥s avo1 $SIIIV WYty £ZN 40 100 TAXId 1513 651 40 110 13X14 15H1 | e §5300V WO am . L stn'sin | IvaAv ssagaay TFHILVIVLYVD| OHVHD Ll|fl| . ||u g ' ' ' ' 1 ' 1 i \ 1 77 | -- 1 = 1 ' A H\ | 'V |TCb | __vHv| HD | |1 U|. uH vH) B0V Qvas ' 1 3 s _CHYHO t 1 | v T 1T 1 1 7T1 - L 9vHD 1 ' ' t VIhaMm_T L O0EYHD | S 1 ) ! ' B ¥ o R 4 ' ' 3 ) ' s ' ' i ' : b T T ' + 1 . et I ! ! . | 1 ) 3 ' Tt T T T r i --r ] rf: r0-- +_ @ -- ' -- ' L ' 1 ' 1 ' ' 1 ' ) ) . ) ey 1 | ' | | ' ) ' ' -- ' e nuT l.|.u. ll|.f1 : ' ! g ! ! ! ' v e s ! 1 T = . t ' ' i)A --J i T -- Y ' hNsa3auuadasy L 0 b e'' -- v ! --r T 1 ! T 1 g T T ! --- _ ' 1 T e I | N 1 I % !TL I3' T 1 1 i --------a-- 31 ---- L ] \!-- ! 1 .A' T,F S e t1 ) T ' ) 7 ! ) At1 1 T 1 ' X -- I eN'' L 0 - v | 1 : ! 1 -- T L "e 1 wNGS333uW4do3smLyoata|b n LQvaL unoawoss gh|yo L wNS3awWdIaSw U )!' L L |Yo HNU Sa3IOwnsSmal||aLnLvomsN3Lses'oL 1' HSIUIUNLIINIS L -- L L 3LEM ILNEINLLY 304 10 1v0ndd 1vaivl 1VOuHD vy uwwvm o v ~ N3V -300 =3IMD -3 ] ~wms 2sLY . fn3g o)um -0 so2yx a3LxvLS Figure 2-6 Alphanumerics State Machine Timing Diagram 2-40 TECHNICAL REFERENCE SYSTEM HARDWARE The CRT controller paragraphs include: board features described in the following Display characteristics * o Character attributes Character sets Cursor Scrolling Video connector CRT controller IC CRT screen/CPU arbjitration logic CRT address decode logic Character sets and attribute logic * CRT interrupt logic * Diagnostic loopback 2.4.7.1 follows: Display Characteristics. & The display characteristics are as TM * A 7 x 9 character in a 9 x 12 image cell * Twenty-five lines of 80 characters * A resolution vertically of 720 pixels horizontally x 300 pixels * A horizontal scan rate of 19 200 lines per second * A vertical scan rate of 60 (50 frames per second) * A dot rate of 18.0000 MHZz NOTE The horizontal scan rate is an important consideration. Many monitors available today have a horizontal scan rate of 15 750. Oonly monitor having a horizontal scan rate of 19 200 lines per second can operate with the Texas Instruments Professional Computer, TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.7.2 Character Attridutes. organized as 2K bytes x 16 bits. information. The second 9 bits character basis: The controller's video memory is The first 8 bits convey character select the following attributes on a * Bit 0, intensity level 1 (blue) * Bit 1, intensity level 2 (red) * Bit 2, intensity level 4 (green) * Bit 3, character enable * Bit 4, reverse * Bit S, underline * Bit 6, blink * Bit 7, alternate character set NOTE The three intensity bits (bit 0 through bit 2) determine the gray scale intensity level and. the RGB outputs for .color. Thus, hi/norm video in monochrome is handled by a one-of-eight intensity select instead of a high-intensity bit. ~ To access the attributes, the software writes into an attribute latch. The attribute value is character each time that character is written to screen read is dons). the attribute values then assigned to the the screen (until a When any character on to the attribute latch. latch read operation. the screen is read, its attributes These values are then read by a are copied subsequent Handling the attributes by (moving data from one screen their attributes. this area method ensures that, in block moves to another), the characters retain TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.7.3 Character Sets. The video <controller contains a 4K character generator ROM, which contributes 256 characters. Use the socket provided character set to to add an optional 2K or 4K the maximum Si2 characters. ROM/EPROM and expand the Attribute bit 7 selects the expanded character set. Refer ROM. to subparagrahph 2.4.8.4 for more information on the character 2.4.7.4 Cursor. Programming can change the cursor appearance. The possibilities include blinking, non-blinking, block, underline and reverse-video. Hardware set of registers in software can position the handles the cursor display through a special the controller. Using these registers, the cursor anywhere on the screen (or off the screen if no visible cursor is desired). 2.4.7.5 Scrolling. The hardvare maintains that supports character 1line scrolling in software determines the need for a scroll, a screen start register four directions. The then changes the value of this register by one line. The screen appears to jump by one line. The scrolling operation always affects all of the screen. possible to scroll one region without affecting another. It is not Because the controller contains only 2K bytes scrolling results in a "wrap"; the original of screen memory, top line of screen contents moves to the bottom of the screen. Therefore, the softvare must clear the top line up (or -down) operation. operation, the 2K bytes space. of the screen (or bottom) before the To simplify programming of the 1line of memory is phantomed over a 4K-byte scrollclear address Status lines must be implemented operations, the status line must before writing. The screen start memory correspondence. in software. That is, during scroll be moved to its new memory position register changes the screen-to- TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.7.6 Video Connector. The video connector located on the .edge of the PWB is a standard, 9-pin, female, D-type connector. connector is for a color display unit. The signals available on connector are given in Table 2-1i4. All signals are at standard levels. rear This this TTL Table 2-14 Color Video Connector Pin-Out `-v s VWONOALEWON- Function Ground Logic ground Red video Green video Blue video Logic ground NC (no connection) Horizontal drive (NEGATIVE TRUE) Vertical drive (POSITIVE TRUE) The other video connector, on the lower rear edge of the standard RCA phono jack. This connector is for a monochrome The signal avajilable at this connector is a composite type, to-peak, 7S-ohm load. a PWB, is a display. 1 V peak- 2.4.8 CRT Controller IC The CRTC IC (6S545A-1) contains the logic for: * Generating the horizontal and vertical synchronizing signals * Blanking display during retrace * Addressing screen memory during screen refresh % Cursor coincidence * Starting screen display registers for use in scrolling The CRTC contains eighteen registers that must be appropriately set before board operation begins. To access these registers, the CPU first writes the address of the register to be accessed into the CRTC address register. Then information can be written to that register. When writing to or reading from (where appropriate) the data register, the information is accessebdy the address latched in the address register. TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-15S shows how to program these registers, using the chip select (CS), register select (RS), and read/write Assume the following conditions: signals (R/W-). * A character rate (SWM-) of 2.0 MHz * 12 lines per character block * 25 rows on the display t 24 character times of horizontal blanking (12.0 us) * 20 line times of vertical blanking (1.04 ms) For more detailed programming information, refer to The Synercom Data TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-15 CRTC Programming Values Signal Name Register Address cCsS- RS R/K- H X X - L L L = L L H == L H L 0o L H L 1 L H L 2 L H L 3 L H L 4 L H L S L H L 6 L H L 7 L H L 8 L H L 8 L H L 10 L H L 11 L H L 12 L H L 13 L H X 14 L H X 1S L H H 16 L H H 17 Legend H = L = X = High signal. Low signal. Don't care. Register Name Refresh Rate Value 60 Hz SO Hz No register selected - Set address register - Set status register Cs Horizontal total characters minus one 103 Horizontal displayed characters 80 Horizontal sync position 84 VSYNC width, HSYNC width 39H Vertical total rows minus 1 24 Vertical adjust lines 20 Vertical displayed rows 2S Vertical sync position 2S Mode control OOH Scan lines per row minus 1 11 Cursor start line and BLINK 40H Cursor end line 11 Display start address high O0H Display start address low OCH Cursor position address high O0H Cursor position address low _ OCH Light pen position address high -- Light pen position address low - --- -- 103 80 84 S9H 31 o0 2S 28 00H 11 40H 11 OO0H CO0H OO0H COH - TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.8.1 CRT Screen/CPU Arbitration Logic Subsystenm. The CRT controller arbitration logic gives the programmer free access to the CRT display. There is 1little overhead time caused by arbitration conflicts, because the refresh memory and its control logic allow two complete memory cycles between esach character displayed on the screen. One cycle accesses the character for display; the CPU uses the other cycle for read or write operations. Therefore, the CPU waits less than tvo display-character times for memory access. Because a character time is 500.8 ns and the CPU clock is 200 ns, a synchronization delay can occur. The total time for a worst-case CPU access is 1.0 us. The usual access time is 600 ns (3 to O wait states). The logic that generates this arbitration scheme includes a counter (which also counts the internal registers and gets alphanumerics state machine nine dots per character), a PAL (which has feedback from the outputs), and a small (vhich provides RAM buffer control, control outputs for the RAM, and the vait state control for the CPU). The counter uses cycle of the inputs to the PAL to identify the state machine. The internal PAL state within the display registers define other states used during the CPU read and write cycles. cycle type being executed, the PAL uses the inputs (character select), and ATSEL-(attribute select). To define the CPU RD-, WR-, CSEL- The outputs from the PAL are: * COE-, the RAM output enable * CHE-, the RA{{ vrite enable * AEN-, the attribute bus buffer enable * AOE-~, the attribute latch output enable * ACK-, the attribute latch clock * MIE-, the character bus input buffer enable * SHM-, the. signal that from the CRTC to the CPU switches the RAM address multiplexer * HWAIT-, the CPU wait control line The counter (U24, 8,9,10,11,12,13,14,15,0, a 74LS163) and repeat. goes through states aRLwdAaahvMttiaaccihhlafibsoUlr1ec0loatchvfikesarsoimlCiaPnbUclttlhheeeu)udnetRadiAtilMst.rbiertbchaueatTtuhheseeeerndloausttthohcepfohu,rt wttvh.iecinsldooCwcTPehkUinssa{bwrlhelteeaahdnditschrocenylatcacdoltaecp.htdtuahretweahseTlnhofecraaonrlmdeaAdChbtKuohselddastvb1ayliidnteehoi,esa combination of CSEL- and RD-. TECHNICAL REFERENCE SYSTEM HARDWARE The CRT arbitration PAL programming is given in Table 2-16. In the "comment" column, the states generated by the AND of inputs are listed according to the counter state number. When the logical AND of terms from one row is ORed with the AND of terms from another row, the output goes low when the result is true. Refer to Figure 2-6 for an illustration of the timing produced for typical cycles by the alphanumerics state machine. TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-16 Alphanumerics State Machine PAL Input X3 RD- SHMUX AEN~ X2 WR- MIE- ACK- X4 CSEL~ CWE~ AOE- Output LD- ATSEL- COE- HWAIT~ Comment ------ Rl Ak Bl e e i Ak e P ELLIRY ool g O Nl S T ISR % 8 86 . 4 5.0 LD S 0 & o $8,9,10,11,12 X4 delayed All other terms ------ Rt e e e e el el e e e e R e el Uy MIE- ST LULEHIE. S LY LR Ly OF . - . e . I .I R R LT el s O Il i AR E R S9 RAM write begins S10,11,12 RAM write All other terms continues ------ e o At CHE L, Ly LUH S Y Ly LR A T e e - Aem LWL L T e ee e e S9 RAM write begins . OrRHALBL & H G ONSLEHU LY H RIS or n % 's ------ ot et P COE- d o Ll 579 or ., L L HL LT LEFRRCETE L BT S LS L= [0S LS 65H' o b d 6 b & bt bbb e b e et b SR . R R LT T IS s o6 b be ey DS L S10 RAM write continues S11 RAM write continues All other terms inactive e cm et cmm e --cacccm e mm . ---- S13,14,15,0 screen £9,10 RAM read refresh e e o LEF ori ------ SR L L UENHEL e gio oo % o g g TN eI S10,11,12 RAM read continues All other: terms inactive o-0-o-o-¢-0--0-¢-0-¢-¢-¢-~--+-¢-«------------------~--1--------------------- AEN- L LLH.LL 5 d b 6 obh ik OnMS - <l TR E, SR e (7 a3t iy o e sig a8 4 0 'ty S9 RAM write begins S$10,11,12 RAM write $9,10 RAM read continues ONEF W HELBH L VI S SR SE 1 e $11,12 RAM read O LR URCIRH N L BT U S TR S A ---C ---KP =t SNLeH Bt EePH bStH Se bCb Ybet H r Neb b e All other terms m e cctmc e e m S12 RAM read inactive e e me e e (P 5l o« 5 d 1% LAt B |- (X o o808 5 5 o o T Write attribute All other terms latch inactive ------------ 0-0--0-0-0-0--#-#-0-#-0-~--0-¢-0--§-------------------------------------~--- AOE R L LT LHLIE N LA LR T S HiL S8 RAM write I Cle O VUl © ------ LENEES Or (XY o0' @ B gid M nima 48 46 K g 1B & odb% & Ul 8 Bl o 18 R 555 S N S LW TR ST e L Ol W TL LR TeT Y L P b bt e b e b b b b mbm 67674 8 0 BB 6 6 an e o 5.4 L. WE. SRS L LY R 1)L a0 81V 0 'S 9,00 g 0 g oo B SS9 till not write Read attribute latch S13 till not read S13 till not read e e e e ee eee e RAM write before S9 RAM read before S9 All other terms inactive m e ------ 0-0-0--0-0-0-0-&--0-0-o-v-¢~§-¢-¢-----------------------------~-------~- Legend: L = Low signal. H = High signal. TECHNICAL REFERENCE SYSTEM HARDHARE 2.4.8.2 CRT Address Decode lLogic. The CRT controller board handles both alphanumeric- and graphics- address decode for the CRT subsystem. All of the screen data is mapped into the processor memory address space including the assorted latches and I1/0 ports. The decoding is done with three 74L820, and a 74LS1SS decoder. ICs: a HALiIOL8 The PAL produces PAL, one-half of a the following signals: * ZBEN-, the master expansion bus buffer enable * XBEN-, the secondary bus buffer enable * RD-, a decoded and buffered read control %+ WR-, a buffered and decoded write control * GSEL-, the graphics screen memory select * CSEL-, the alphanumerics screen memory select * CR/AT-, selects one half of the 74LS1iS55 (which decodes the CRTC and the attribute latch) * XSEL-, selects the other half of the 74LS15SS (which decodes the graphics latch and the miscellaneous input buffer) The XBEN- signal develops an enable delaying the signal that provides the 6545a-1 CRTC. The CRTE (CRT greater than 266 ns, satisfying the setup and hold times are easily met. clock for the CRTC by inverting and the required setup time {90 ns) for enable) signal has a pulsewvidth requirement of the CRTC. The other The 74LS155 decodes the following signals: * ATSEL~, the attribute latch select % CRTSEL-, the CRTC chip select * LAT- LAT- combines with H®HR- and clocks the interrupt enable and screen enable latches. The other half of the 74LS15S5 decodes the three graphics board latches and the buffer enable for miscellaneous inputs. The address space that each of these devices occupies is given in Table 2-17. TECHNICAL REFERENCE SYSTEHM HARDWARE The red, blue, and green outputs are buffered by a 74LS244 before being sent to the 9-pin connector. The color outputs and composite sync are buffered by a 74S00, which has an isolated power supply. They are combined by a resistor network and buffered by a transistor to make up the composite video output. The mapping of colors to intensity in the composite video output is given in Table 2-19, Table 2-19 Color Map Code Composite oo 001 010 11 100 101 110 111 sync Color Black Blue Red Magenta Green Cyan Brown White Composite Video Output (in Volts) 0.47 0.70 0.88 0.97 1.07 i1.10 1.28 1.37 1.47 To blank the alphanumerics display to black, set the CRT ENABLE bit in the miscellaneocus output latch to low. The board enters this state on pover-up. < 2.4.8.7 contains CRT Interrupt Logic a logic subsystem Subsystem. The CRT controller board that allows the CRTC to generate an interrupt during the vertical interval. The processor uses this interrupt when doing scrolls with a status line or other operations that must be done during the vertical blanking interval. To enable this interrupt, set the interrupt enable bit in the miscellaneous latch to high. Vertical blanking causes the CPU nonmaskable interrupt, and the interrupt pending bit is set. This Dbit is read from the miscellaneous buffer. To reset the interrupt, set the interrupt enable bit to low. 2.4.9.8 Diagnostic Loopback. One diagnostic requires color outputs be looped back to the miscellaneous input the CPU can read them. Using a program with careful vertical interval, the CPU can check the action of the and the graphics board palette circuits. that the three buffer so that timing from the atribute bits 2.5 EXPANSION BUS The bus. the other logical function area of the motherboard It provides space for the different option boards Texas Instruments Professional Computer. is the expansion available for TECHNICAL REFERENCE SYSTEM HARDWARE 2.4.8.5 Attribute Interaction. The attributes available the character display can be used in any of the combinations. The following paragraphs explain what several attributes are active at once. for use with 128 possible happens when The attributes have a priority in their priority attributes affect all attributes that The order of priority is as follows. effects, and the highest have a lower priority. Highest Lowest Color attributes Reverse video and Character enable Blink Underline - red, cursor blue, green For example, when the wunderline and blink attributes are set, both character and underline blink. When the character enable is set to disable, no character, underline, or blinking activity is present. When reverse video and dlink are set, the character goes on and off, the background is lighted, and the foreground is dark and blinking. When the character enable is set to disable and reverse video is set, the entire cell is lighted (according to the color attributes). The <color attributes define the characteristics of the "light" éortion of the character, that is, either the color (when a color monitor is used) or the intensity (vhen & monochrome monitor is used). When the graphics board is used board, the graphics screen "shows alphanumeric character display. with the through" alphanumerics CRT controller the "dark" portion of the n 2.4.8.6 Attribute Hardware. The attribute logic design is of the "pipeline" type because the activity of the attributes must occur with dot-~timing precision (within 5SS ns). To get data from a latch, through several levels of logic, and set up into the next latch, some SCHOTTKY logic is used. The attribute data from the RAM 1latches is latched again by two 74S17Ss (Ul16, Ul7). This latching allows for the one- character delay through the character ROM and provides tightly timed outputs to the logic. The cursor (CUR) and display enable (DE) lines are also delayed twice to Xeep them synchronous with the other information (U1s). Propagation delay through the logic can cause timing skews greater than a dot time, so the outputs of the first logic level are relatched one dot-time later. After going through the second logic level (MUX U20), the outputs are latched again for presentation to the video outputs (U39 748174). TECHNICAL REFERENCE SYSTEM HARDWARE Two encoding examples are showvn in Figure 2-8 Example 1 character, and binary is the letter =Bty Example 2, meaningless graphic illustrates some specific applications. Both hexadecimal encoding are shown beside each character. Example 1: Example 1: Dot Count 987654321 Bit Count 76543210 Hexadecimal 888FBBBBBBFF070FFFFFFFFFHHHHHHHHHHHH Example 2: 67H A6H C5H E3H E7H 00H 6DH 92H CDH E8H F7H F7H Binary 1 10000000 10111111 1011 101 10000111 10111111 10111111 10111111 10000000 1M1 1111111 0110011 10100110 11000101 11100011 11100111 00000000 01101101 10010010 11001101 11101011 11110111 1111011 LR oE Notes: Column 1 and column 9 must be the same. Column 1 and column 2 must be the same if the high bit is 0. Column 8 and column S must be the same if the high bitis 0. No capability exists for a half-dot shift. Each character must have sixteen bytes; otherwise, strange characters result. 2232168 Figure 2-8 Encoding Examples TECHNICAL REFERENCE SYSTEM HARDWARE Row RR1O RSRRRRR73264 RRRo810 Ril1(Underline) Copied When Bit 7 is Low e e b| t 6543210 I | e e ij 6543210I| n RN .. B B -nEEEEER n ......... P N n - = n n [ 223216-7 Figure 2-7 Sample Character Font Definition 2.4.8.4 Generating a Character ROM. To generate a character ROM (or EPROM), assemble and link the source code, then program the device. The source file for a character ROM is organized into 16 bytes for of the 256 characters (4056 bytes). When assembled and linked, file fits into a 4K ROM. Each character can contain _only 12 rows dots, and the last 4 bytes o; each character must be set to FFH. each this ot Each character on the monitor fits within a 9-column by i12-row block. Each byte corresponds to the 9 columns within one row. For regular characters, the first row is blank (reserved for ascenders), the last two rows are blank (reserved for descenders), and the two outside columns are wusually blank (for intercharacter spacing). Generally, then, a typical character fits within a 7~column by 9-row block. For esach character at the left. block, column i is at the right side and column 9 is Each byte is encoded as follows: * Bit 0 (the low bit) is at the right side of the character block and bit 7 (the high bit) is at the left. * Setting a bit to 0 means to put a dot at that location. * Setting a bit to 1 means do not put a dot at that location. * Setting the high bit to 0 encodes column 1 the same as column 2 and encodes column 9 the same as column 8. * Bit O encodes column 2; bit 1 encodes column 3; and so on. TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-18 Alphanumeric Decoding PAL Input MRDC- A1S16- A8 Als Al12 Output: AMWRC- A19 Al7 Al3 All Comment ------- e m e et b mm b b e mr e c e r e -- e m e ------ ZBEN- L 4 S H H L e o S o or . L s H H L a S P o CRT space read CRT space write ------- P m b mm e e e m b e m b mmd mwanmm > e -- -- -------- XBEN- L . L H H L H H H H or . L L H H L H H H H CRTC/ATT CRTC/ATT read write ------- P mm b m b et m eb eb me mb p o m - -------- RD- L g o H H L s g o B or L L 3 s o . 5 5 o e CRT space read {Inactive term) ------- Prmmb e s m b m b mm-- b e, m--m b m b --m b e md m e ------ St ---- e= - WR~ o L o H H L 5 S 5 o or L L 5 o e g S S S e CRT space write (Inactive term) ------- L e R R R R R T R PR GSEL~ e 3 H H H L e 5 a . or L L s 5 . i o a 5 S Graphic access {Inactive term) ------- et CSEL- . . L or L L o m be e e e e H H L H H L E B . o . s - -- - - .- - o Character access 0 (Inactive term) ------- D R it ittt e e e L ee CR/AT- . o L H H L H H H H CRTCYATT access or L L o B a B 5 . 5 a (Inactive term) ------- e m-- b mm XSEL- . L Y or L o L b mm N I H H b et e b e be eb £ R HR £ m b T L H H H L e m---- e Extra I/O Extra I1/0 -- = write read Legend: L = Low signal. H = High signal,. 2.4.8.3 Character Set and Attribute Logic. Two 74LS374s8 (Ul4, ULlS) latch the RAM output (both character and attribute) at the end of each screen refresh access cycle. This allows a full character cycle time (S00.8 ns) to access the character ROM and EPROM and set up the dot shift register. The required ROM access time is 452.8 ns. So that the character set can include the ability for block graphics, bit 7 out of the ROMs indicates that the leftmost and rightmost character dots are to be copied to the left and right character-cell border dots. The character ROMs should be programmed with active-low data; that is, when a dot is to appear, the ROM should be grogrammed with a zero. Figure 2-7 the cursor appears on only one underline, shows some sample characters. The reverse video block and affect the entire 9 x 12 character cell; the underline row 11. The descenders of lowercase letters should drop dot line below the level of the other characters so that the cursor, and reverse video will appear in an acceptable form. TECHNICAL REFERENCE SYSTEM HARDWARE Table 2-17 CRT System Memory Map Address COO00-C7FFF C8000-CFFFF DOOOO-D7FFF D80CO-DDFFF DEOOO-DE7FF DESOCO-DEFFF BFO0CO Dbit DF000 Dbit DF000 Dbit DF000 Dbit DFOL10 DFO0O20 DF030 DFBOO DF810 DF8i1 DFBe12 DF813 DF820 DFB20 Dbit 7?7 Dbit 6 WN e Device Graphics RAM Bank A Graphics RAM Bank B Graphics RAM Bank C Unusable Active character memory Phantom character memory Misc Misc Misc Misc input input input input buffer, buffer, buffer, buffer, blue feedback, read only red feedback, read only green feedback, read only interrupt pending, read only Graphics Graphics Graphics Attribute blue palette latch, write only green palette latch, write only red palette latch, write only latch CRTC CRTC CRTC CRTC address register, write only status register, read only registers vrite access, write only registers read access, read only Miscellaneous Miscellaneous output output latch, latch, inte;rupt enable alphanumerics screen enable PAL coding is given in Table 2-18. When the logical AND of terms from one row is ORed with the AND of terms from another row, the output goes low vhen the result is true. TECHNICAL REFERENCE SYSTEM HARDWARE The expansion bus interface consists making it easy to add memory-mapped or system. The expansion bus supports devices efficient operation. The system does not hardware required by direct memory access of five card-edge connectors, 1/0-mapped options to the that require interrupts for provide the special-purpose (DMA) devices. The expansion bus pin-outs are given in fable 2-20, Table 2-20 Expansion Bus Pin-Outs Pin AO1L AOD2 AO03 AO4 A0S AO6 AO7 AO8 ACS AiOQ ALl AL2 AlL3 Ald AlS Ale AtLt7 AL® AlS A20 A21 A22 A23 A24 A2S A26 A27 A28 A29 A30 A31 * MSB Signal NMI- DATA 7 DATA 6 DATA S DATA 4 DATA 3 DATA 2 DATA 1 DATA © WAIT- Logic ground ADDRESS 19 (MSB)«* ADDRESS 18 ADDRESS 17 ADDRESS 16 ADDRESS 1S ADDRESS 14 ADDRESS 13 ADDRESS 12 ADDRESS 11 ADDRESS 10 ADDRESS 9 ADDRESS 8 ADDRESS 7 ADDRESS & ADDRESS S ADDRESS 4 ADDRESS 3 ADDRESS 2 ADDRESS 1 ADDRESS o© (LSB)* = Most significant bit; Pin Signal BC1 Ground BO2 RESET BO3 +S V power BO4 IRO (interrupt 0) BOS No connection (bussed) BO6 No connection (bussed) BO7? -12 V power Bo8 Reserved BOS +12 V power BioO Ground Bii B12 AMWC- MRDC- (memory write) (memory read) B13 AIOHC- (I/0 write) Bi4 IORC- (I1/0 read) B1S No connection (bussed) B1i6 No connection (bussed) B17 No connection (bussed) Bis No connection (bussed) Bi9 No connection (bussed) B20 PCLK (S-MHz clock) B21 IRG (interrupt 6) B22 IRS (interrupt S) B23 B24 IR4 (interrupt 4) IR1 (interrupt 1) B2S IR2 (interrupt 2) B26 B27 RNoFSHconn(ercetfiroenshing()bussed) B28 ALE (address latch) B29 +S V powver B30 B31 oscC {15-MHz Ground clock) LSB = Least significant bit. TECHNICAL REFERENCE SYSTEM HARDHWARE 2.5.1 Expansion Bus Signal Descriptions * NMI-. The nonmaskable interrupt signal can be driven by any of the expansion boards to interrupt the system processor. Typically, it is used to alert the processor to a parity error in memory devices residing in the I/0 channel. An open collector device pulls this line low when it is being driven by an expansion board. Othervise, it is held high by a pullup resistor. * DATA 0-7. These lines form the 8-bit system data bus and can be driven by the processor, memory devices, I1/0, or the expansion interface. These bidirectional 1lines are active high. DO is the least-significant bit, (LSB) and D7 is the most-significant bit (MSB). * WAIT-. This signal indicates when a device is holding the system processor, thereby extending the length of a memory refresh or 1/0 cycle. When a slow device is addressed on the expansion bus, the signal asserts this line low, which extends the cycle-completion time. This line should never be held low longer than 10 processor clock cycles. When driven by an expansion board, an open collector device pulls this line low. Otherwise, a pullup resistor helds it high. « * ADDRESS 0-19. These lines form a 20-bit system address bus, which can address up to 1 megabyte of memory. They are normally driven by the system processor to address memory and 1/0 devices within the system. (Only XAO trough XA9 are used for 1/0 addressing.) These lines are active high.XA0 is the LSB and XAl9 is the MSB. * RESET. This line injitializes or resets system logic at power- up or after a power fajilure. It is active high. A power- supply monitoring device generates RESET immediately when the 12-V line drops below 11.1 V. It returns low 3 ms after regulation resumes. No operator intervention is required. * INTERRUPT 0-6. These lines signal the processor that an I/0 device requires attention. When several devices require service at the same time, the device asserting the lowest- numbered 1line gets serviced first. These lines are active high. The interrupt regquest signal must be held high until the interrupt request has been acknowledged. * AMHC~ (or MHRITE-). The memory write signal is usually driven by the system ubdex(AMWC-) processor. It indicates that the information on the data bus should be written to the memory address given on the address bus. This signal is active low. * MRDC- (or MREAD-). The memory read signal is driven by the TECHNICAL REFERENCE SYSTEM HARDWARE system processor. It the address bus should indicates be placed that on the memory the data bus. addressed by This signal is active low. * AIOHC- system by the or (IOWRITE-). The I/O write signal processor. It indicates that the 1/0 address bus should accept the data is driven by the device addressed on the data bus. This signal is active low. * IORC- or (IOREAD-). The I/0 read processor. It indicates that the address bus should place its line is driven by the system I/0 device addressed by the data on the data bus. This signal is active low. * PCLK (processor clock). This is the system clock. It is a one-third division of the 0SC clock and (S.0 MHz). The clock has a duty cycle has a period of of 37.6 percent 200 ns (+ 3.0 percent). * RFSH (refreshing). This line indicates that a memory refresh cycle is taking place. It is positive true. When this is asserted, all expansion bus activity is ignored. signal Do not use this line for any purpose. * ALE (address latch). This line indicates that is placing a valid address on the address bus. valid on the falling edge of this signal. the processor The address is * O0SC (clock). This signal describes a high-speed a 66.7-ns period (15.0 MHz). It has a SO0-percent clock having duty cycle. 2.5.2 Loading and Driving Requirements aDbTssstuhiirusennip.kkvp3eo.err5xs1t6pO24apV enmfnsoiatirnlhmodeAlnciotalhsmeliabepentuqekcsuritineovtsr01cae.al5nrmerAon(umutdpAtratV)tpivuetaa0lostfn.i,d5nfei0stv.wVwe5o.hsioIcuRVTh.rTOecL-xeIpdRarD6inian3vstpeaiumstoAhnobtuuhallsetodabdodb2sau.rbs4rei,dvsoen.aVrbsslhaaennodyuslhEtdooa1ouc5nlhesdombAeulribbcenoaeetaarbadlbo2elf.1e0 can the to to V. mA 2.5.3 Memory Timing The memory bus cycles CLK cycle time (200 ns) timing relationships of can be lengthened in integral multiples of using the WAIT- line. Figure 2-9 shows the expansion bus memory interface. the the SYSTEM HARDWARE Figure 2-9 Expansion Bus Memory Interface Timing Diagram 2-60 sz WYHOVIG ONIWIL 3DV4HILNI AHOWIW SN8 NOISNVYdX3 XVYWSLE NIWOL {3LVLS LIVM LNOHLIM) VW G/E NIW 05 NNt NIW £L XVWSLS NIW 801 XYW 0ZL NIW 05 NIWO NIW Op XYW SE NNNIIIWW G9ZLL21S 3ALLOVYNI MOTIN1Id 0L dNLIS VIVA W ALLIVNI JaYW WOH4 QI0H YLVYG = 1 IALOVYNE -- JQHW 0L ONL3S VIva b OQYN WOYS 3WIL $S3DIV Q3YIND3IY = IALLIVNI -- DMWY Y313V QI0H YIVQ = | ¥3AILDV = DMWY U314V ANVYAYLYG = H dNLIS IAILDOYNL -- LIVM = O QI0H Livm 3 £ dN13S3AILIVY - LIvMm 3 A70d WOYL AVIIA ANYIWWOD = @ ANOVNWVWIOWWDODNOOHL3JAIdLONI1TV3OYSH O$NSSVS3I3¥N¥aWaaOaYDV - 2 a v --_-- |-- W --] L anva X 1= l-- 3 -->} = G-- i I ol 1 QLAoTI S S---- [ N| l T --_--a e/ i) 1 | v i | ' |\ -- `aN3937 ) -- = = S 1avviavya) r i _ e | arvA X o -- " LJ T\ \ i'loT.uTJmTl --- M 1 | J " IJQTI "31 Lvm T | T ' TM| D 1 | 1 N ! L iy 1 1 I ool _ omav =oauw I T T 1 | T ) , ' _/ | $53T|qt90avV aNvA t i _/ je-- v -- m 3 . XC Y T ! T | ; o\ ) ! / y!| _J ss3yaav IV e Je-- o0z -->] 9 }o-- 1 -- TECHNICAL REFERENCE TECHNICAL REFERENCE SYSTEM HARDWARE 2.5.4 1I/0 Timing Figure 2-10 shows the expansion bus timing relationships for standard I/0 cycles. This timing includes the single wait state that the motherboard always inserts in I/O cycles. --+| 67 le-- 133 --sle-- 200 -- 1 ! 1 ALE 'I | ADDRESS | | ld-- A ! X 1 JOR c T : = | Alowe | | | . U vALID ADDRESS T 1 \ I : [ | | | \ { --:1----l [y - olre `W%----p--(__x ! DRAEQTUAIR(ERDEAD) ! i|I t < LEGEND: JK|HGDFEACB - -----= RRADRARADCAEEACEEDDQDAOQTTQQDUDDTMUAIUUIRRRAIMVIIREEERHERAREVSSSEIEOEDANSSSDODDLLDRIDDCDDHSDSAAAOEEADCT-ATLTFTTECAFUDARUALEOTPPOASREMYSSARHSETFTOAETOOTLIATFUTAEDOUIRIPARPRPOOMICCEWMIALTACFTKOOWO-FTPI-OE--TCRWOLRRPIL--IOOHCVLKSCCWIELOIIWOR--KGRONWIRGHCSOCILRINEOOGDRWGICEOERDCGOEF IOORRCIO--RC -- E VALID DATA H 551111708254737658505062M25ZMIMMMMMMMMMIINIIAAIAAINNNNNNXXXX 1 ' | I / I ) 1 1 X I |:) / fe--c | 1I| / --+ --»ILL-- G --»| r 1 1 --HJT | Af_ev--atK o-->| ![ ) O 10MIN 2222216-10 Figure 2-10 Expansion Bus I/0 Interface Timing Diagram 2-61/62 = i TECHNICAL REFERENCE HARDWARE OPTIONS Section 3 HARDWARE OPTIONS 3.1 INTRODUCTION This section describes the Instruments Professional following options: hardware options available Computer. Subsections for the Texas describe the * Expansion Memory * Synchronous-Asynchronous Communications Board * Internal Modems * Graphics Video Controller Board * Hinchester Disk Drive The optional diskette drive is identical to the diskette drive. Therefore, it is not described in Jinformation, refer to subparagraph 2.4.6.6. factory-installed this section. For 3.2 EXPANSION MEMORY, S512/768 K BYTES Section 2 describes the expansion memory boards that connect to the motherboard, increasing the memory to 2S6K bytes (K = 1024). Two additional expansion memory boards (each 256K bytes) are available for the Texas Instruments Professional Computer. One board plugs into the expansion bus, increasing the memory to S12K bytes. The second board mounts on the first (piggyback style so that they use only one of the expansion bus slots), increasing the memory capacity to 768K bytes. This additional memory operates at the same speed as the motherboard memory, so that there is no increase in execution time when the memory is increased. NOTE The 512/768 after the installed. K byte expansi'on boards motherboard 192K-byte are added board is TECHNICAL REFERENCE HARDWARE OPTIONS The first expansion contains thirty-six £ memory card is the controller 64K-biéesdynamic RAM ICs. The * Decoding logic to estadblish the addresses card. This card card - also holds: * Parity check logic for error detection * Timing and system. refresh logic to operate ; the expansion memory Connectors and logic for the addition of the are also part of the controller card. second expansion card The second Becausge the this second card also contains thirty-six controller card contains all the card is smaller. 64K-bit dynamic RAM ICs. logic for both cards, 3.2.1 Addressing the Expansion Memory The expansion memory operates at a fixed address in the computer's memory space. Addresses 040000H through 07FFFH are for the first 256K bytes; addresses O08B0000H through OBFFFFH are for the second 256K bytes. If the second card is not installed, its assigned memory space can be used by other hardware products. $.2.2 Expansion Memory Control Logic The expansion bus contains a bidirectional buffer to separate the data bus from the expansion memory, thereby providing sufficient drive and margins to the data transfers. The hard array logic (HAL) chip HAL1I6R4 (U2) handles address decoding, buffer control, as well as timing and refresh. The refresh timer (U4) is a one-shot, and the delay line (U3) provides the multiplexer timing. 3.2.2.1 Expansion Memory Refresh Logic. The dynamic RAM refresh logic operates synchronously with the accesses to the RAM memory. Refresh cycles begin only when a RAM cycle is not in progress. This means that the RAM refresh can occur at the same time as accesses to other system memory (ROMs or the main system memory) or I/O space. Each time a refresh cycle begins, a refresh timer (U4) starts. When it times out, it provides the signal beginning another refresh cycle. This timer is set to 15 us maximum, which allows for the worst-case refresh request latency. To maintain the contents of the RAM under worst-case conditions, the refresh must occur at 1least 128 times within 2 ms. (The average refresh timing is once per 15.625 us.) The worst-case latency for a refresh request is about 600 ns. Once a refresh cycle has precharge) before the starts before the refresh the CPU into a wait state begun, next cycle until it must be completed (incliluding cycle begins. If a RAM access completes, the HAL state machine the refresh operation completes. the cycle puts In TECHNICAL REFERENCE HARDHARE OPTIONS the worst case, this delay could by three wait states or 600 ns. extend the usual memory e access time Assuming slowdown percent. a refresh time; r of the CPU, The worst case value of 14 wus, and BT an o `average 400-ns the average refresh overhead is about 2.9 is about 4.3 percent. 1 3.2.2.2 CAs and Address MUX Switch Generation. A delay the Column Address Strobe X (CASX-) produces the address 1line from multiplexer control (MSEL). The delay line is set at CASI- 1line, and the RAM buffers are taken after CASX-. This ensures the maintenance hold, and enough column address setup time. quickly enough to finish an access within 40 ns. Ul Dbuffers the from the delay line 60 ns of an adequate row address The RAM still operates the system cycle time. The CASX- timing depends on wvhether the cycle If the cycle is a read, the CASX- signal from equivalent to the RASI- signal. This provides time for the RAM chip to access it's data and expansion bus. The delay line guarantees CASI- to the dynamic RAMs. is a read or a write. the logic array is the maximum available present it to the the timing of MSEL and If the cycle is a write, edge of the first system then the CASX- signal clock during the write follows the cycle. This 130 ns after the occurrence of RASI~. data from the processor to propagate the parity generator chip (74LS280). This delay allows time through the data buffers rising is about for the and Ue, agdewdgwo3tfrheyrruh.eetrnitine2neopvaten.erruemtre2rt"rei.vaaonc3etdt.fridollottroihine/npRsEtec-AupxhhfMmerpoAs"elrfoaC.oc(evnAapskissSaeeodIipure-ioatspni(prnaUTuaSrhaatt)ein1eM<ttlchehyiheminWcioeegofpClvdhrAeeaewynSatrrt-r(arih.co7otenl4PnreoLaulbcSrumiptks2nibahTdsce8eterhuy0ryeirc)otilnofyneruGgot)totfh.eigtmepmnhegueienewtnrern"tgaire1hpTftitaerhal"weiteasri.hoeotinpelsnot-nopryfegatlivirnhaoaceiinpaRrstdnA.1ydMatrhlCitertoihucianssehyeeicTidtpkhshdtiieahhssnteotngutnalaoos.pdtyeasssrpwirrbdttieyraTaltyttvkohiheeeweeevtnniRrtnAipspgtMosaauDtrrbnfaieitrbttitttitoihhnheylymteeeg When the RAM presented to at the end of flop US is set clears on the this board. isnttehhtxeeorteagrideenr,aetndaeedrrarlacultywpocitlrtoeh/f.cthhcetehocerkIrfeCePrdcU,aattaopnapanrabdirittithytseyth,eaNenMrdIrpo-orarriolttnihiyens e.thdoeuiptsaprcTfuiohittvirysestreisdNM,wbIirs-tiatmfepllliiaepnrdt-eeo Using the "odd sum" method of parity error, even vhen the system attempts (To determine the size of system "feels" for memory not present. checking does to read from memory, system not cause a parity nonexistent RAM. software sometimes TECHNICAL REFERENCE HARDWARE OPTIONS 3.2.2.4 Expansion Memory Control State Machine. A hard array 1logic device (HAL16R4), set up as a state machine (U2), drives the memory control. This device has four outputs egquipped with clocked flip- flops and four outputs that are direct combinations of the inputs. Table 3-1 gives the logic for the memory control state machine. The logical AND of the terms on a line ORed with the AND of terms on other lines results in low-going outputs. This occurs either directly, on those outputs without registers, or after the c%ock on those outputs having registers. ! TECHNICAL REFERENCE HARDWARE OPTIONS Table 3-1 Expansion Memory Control State Machine Logic - HAL16R4 Input MRD- XA18 RASI- RFSH- MHR- LGND- XWAIT- RRAS- Output RFRQ XA19 XXXX B2IN- CASX- WCASBUFE- ZzZZ- -------------- ottt bbb b m P -- b m = Comment RASI- L LHL . R IRHEHE or L L IHELL L or L LR HE L NS . C'HEH e . S HEHO0 or L .HLL L o a "W HEHE X2 o's .9 o g g a a LI - - - bb -- b e -- b b bb bbb == XHA'TT o R . e o . L L (3¥ o 1b o B 4 B4 B . .L L - - ot bbb bbb mb b rb 5 . = (AR 4548 b 8'b O SO S H or L LR HE LR o . HH . or L M HELA LT . . o B --_------ - et e b m bbb mc bbb bbb ------ BUFE- LR U 1 R DA o 0 m or or or _______ . L HLL .L L . LHL ., . L . HLL . L Pmr bbb bbb e IR S S . g . . TR -- bbb m kg Memory read low bank Memory read high bank Memory write low bank Memory write high bank Refresh Refresh+memcycle 1, 2 Refreshrmemcycle 2, 3 Write, either bank Read low bank Read high bank Write low bank Write high bank Read low bank Read high bank The _______ Pmd following four outputs e bbb bbb m b e b have flip-flops: m =& RFSH- H H H or HELW LS VR, or . HEH S H ST or W HEHE LS SRS H (P 9 o 00 o ld' o b (12 6 0 o o 8.0 D g . T . . SR S . B H H RS H RS B o W H . LRHET Refresh Refresh Refresh Refresh Refresh Refresh no memcycle motherboard cycle graphic cycle 1; high bank not in 1; illegal cycle RF2,3 CY2e% % o g0 0 b . H. -------e -- - Por bbb m b m b RRAS SO . IR - b bbb b - L == (e 3% 0% 5 & B . . . . ---------- Pebm bbbk WCAS - LR S H N LI bbb e b b m b b e == . HH orE LIS HELEL NS I o SR S HR H O KRN LT S o - o ------ - bbb e bb rm bb b e b - ZZZZ -- S Ul 7 NS 3D . Reset Refresh RF2,3,4 Reset Write low bank Write high bank Reset --_--------- - Pt bbb b -- Legend L = Low signal. e bbb bbb m bbb == ) s H = High signal. 3-5 TECHNICAL REFERENCE HARDWARE OPTIONS Notes for Table 3-1 Ofl..Q_ The signal RASI- activates 'RAS- from the RAM address multiplexer of the 2364. ; The signal XWAIT- puts the processor into a wait state, The signal BUFE- activates the expansion memory system data buffer. The signal CASX- controls the CAS and MSEL generation. The signal RFSH- instructs the 2964 address multiplexer to put out the refresh address. : The signal RRAS~ combines with RFSH- to indicate that a refresh RAS is in progress. The signal WCAS~ delays CASX- during a write cycle. The signal ZZZZ- is not used. A timing diagram of the memory system, shown the major operations of the memory system. in Figure 3-1, indicates HARDWARE OPTIONS -9t zezzr WYHOVIO DNIWIL AHOW3W NOILJO NZLG/95T _ anNvA 38 LS Figure 3-1 Expansion Memory Timing Diagram =X NWNI0J /R R S HS3¥434 + avay -- avay TO T MOY MOy = = XX --DGEC NWANI0D MOY % framwE /e 0% R\ N e e e\ e\ T N e WY £8¢ 0sZ 8E X=X NWNI0D / \ HSIYIIY + JLIHM o--m X OO MOY MOY NANI0D / \ 3119M F--1__ Moy 10H3a/amvoy AXD @ S e v all Bl e e\ e awm \ B 3 0ng /\ ST\ xsw 05t NS N/ [ N Isvy /3 tee e \ S -ZZ22 /s rar e\ SRy llw\ll/ RS S o ------ ==\ R\ L D e r-- \ll(ll . I\ SR e B > --EE--Teee-- T ) -- _-- -SVHY | e --T5------vivad $53¥aQvY =y S --4 \ -J0YW S | 128 1= (e ML ML (e | & ML S [ 1= M| ML L L L / 99, \ S \_ omwy i) Ml Ef| S | S et = [ S ) S M e M | U E:EL L {%Z1H0W4 8) L L L 198 vl ML ML £ L L vi N.-- TECHNICAL REFERENCE TECHNICAL REFERENCE HARDHWARE OPTIONS 3.3 SYNCHRONOUS-ASYNCHRONOUS COMMUNICATIONS BOARD This subsection describes the theory of operation and the functtons of the synchronous-asynchronous communications (sync-async comm) board. Figure 3-2 is a block diagram of the sync-async comm board. Refer to Section 6, drawing 22230986, for logic diagrams. SAECLKECT ADADDDRREESSSS ] SEL--E_--CT INPUT SELEC--T OUTPUT ALODoEDGCRIOECDSES SCEOLMECMT INPUSCTEY/LCOELUCETTPUT SYiSsTteEM BOARD Cj DATA BUS INTERRUPT ACIKNNTLOEOWRGLAICUEPDTGE INT ACK CcLOCK (\SELE10CT CHIP SELECTOR 1/08US > DATA BUS ¥ COMCMOUNNTIROCLALTEIRONS 1 INRTSS-E2:3B2F-ACCE 2 DAvTA BUS Recs.n.`vens +:- } 5 : | |I®j EDXETVEIRCNEA£SL | TRANSMITTERS G INTERRUPT LOGIC 2223216-12 Figure 3-2 Sync-Async Comm Board Block Diagram The sync-async comm board is Communications Controller (SCC). based upon This device the Zilog ZBS30 Serial automatically handles asynchronous protocols. It also services most synchronous protocols, including data link control (HDLC), (both bit-oriented.) (SDLC) Cyclic and high-level data 1link redundancy check (CRC) control is an automatic function and can be included in any transmission. A sample procedures NOTE program, showing general and recommended use of the programming sync-async TECHNICAL REFERENCE HARDHARE OPTIONS comm board, is included in Appendix manual. For more detailed information, the Zilog 8530 Technical Manual. E of this refer to The functions of the sync-async comm board are: * System interface * Baud rate generation * Port addresses 3.3.1 System Interface Most of interface the components on the board are involved in handling between the system bus and the 2Z8530. Of special note the is the logic that generates the interrupt acknowledge (INTACK) signal that the Z8530 requires in response to an interrupt request, The INTACK~ signal is software-generated. It is not part of the system interrupt acknowledge signal because of the setup time because the system expansion bus does not provide for required expanding aad the number of interrupt levels. To generate the the I/0 address (read) from the interrupt vector INTACK- signal, the software does for interrupt acknowledge and same address. The data received from the Z8530. ~ a AIOWC- (write) to then does a IORC- on this read is the The AIOWC- signal clears US5B, activating the INTACK- signal Z8530. Hhen the IORC- occurs, the vector from the Z8530 onto the data bus. The rising edge of IORC- clocks USB inactive state which releases the INTACK-. to the is gated to the Other logic on the system side of the board delays the read and write commands to the SCC so that the address and data setup times and the hold-time requirements of the part can be met. IORQ is connected to the input of a flip-flop 74LS74 (USA). The clock input is connected to the system CLK line. The rising edge of the clock occurs 133 ns after the IORC- or AIOWC- signal occurs. The output of USA, gated with IORC- and AIOWC-, delays the start of the SCCRD- and SCCKR- signals. The clear input to USA is connected to BDCS, allowing the SCCRD- and SCCWR- signals to occur only when the board is selected. Resetting the held active and U6D with lines. Z8530 requires simultaneously. the RESET signal that This from the SCCRD- and the SCCWR- lines be results from the logical OR of U6C the bus and the SCCRD- and SCCHR- U4C inverts and buffers the interrupt output from the SCC. signal then goes to a set of stake pins and is used to determine This the 3-9 TECHNICAL REFERENCE HARDWARE OPTIONS interrupt level at which the board is operated. 3.3.2 Baud Rate Generation The 4.915S2-MHz <c¢rystal provides a clock for the generate a specific baud oscillator on the board, divided by 2, SCCs (internal baud rate generators). To rate, program the values given in Table 3-2. Table 3-2 Sync-Async Comm Board Baud Rate Baud Rate i9 200 9 600 7 200 4 800 3 600 2 400 2 000 1 800 1 200 600 300 200 150 134.5 110 75 SO Sync Value 62 126 169 254 338 S10 612 681 1022 2046 4094 6142 8130 9134 11169 16382 24574 Percentage of Error 6.000 0.000 -0.196 0.000 0.088 0.000 0.065 -0.045 6.000 0.000 0.000 0.000 0.000 0.001 ~0.001- 0.000 0.000 Async Value 2 6 8 14 19 30 36 41 62 26 54 82 10 69 96 1022 1534 Percentage of Error 0.000 0.000 -3.030 0.000 1.587 c.000 1.053 -0.775 0.000 0.000 0.000 0.000 0.090 0.001 0.026 0.000 0.000 TECHNICAL REFERENCE HARDWARE OPTIONS 3.3.3 Addressing A 74LS139 decoder (U3) and several gates (to qualify the address) comprise the address selection logic. The board design preseats a choice of four address locations, permitting the addition of several communications boards to the system. As with other are decoded. 1/0 devices for U3 provides this two bus, only 10 of the address decoded outputs: INTCS-, lines which activates the INTACK logic; and SCCCS-, which activates the Z8530. The logical OR of INTCS~ and SCCCS- creates the board select signal (BDCS). The logical AND of IORC- and AIOWC~ creates IORQ. BDCS and IORQ combined enable the bus buffer U7. 3.3.4 Programming The sync-async comm board port number is jumpers on the board. Five I/0 addresses and level control each port. programmed a distinct by placing interrupt Table 3-3 gives the board addresses is the board connector. for the four possible ports. P60 TECHNICAL REFERENCE HARDWARE OPTIONS Table 3-3 Sync-Async Comm Board Port Addresses Jumper Locations E1-E2 E7-E8 P6C Pin No. 8 (INTO) Port 1 Interrupt Address OOEOC 00E4 00ES O0E6 00E7 Function Interrupt acknowledge CHB command CHB data CHA command CHA data E4-ES E10-Ei1 Port 2 Interrupt SO0 (INTL) OOCES 00EC OO0ED OOEE OOEF Interrupt acknowledge CHB command CHB data CHA command CHA data E2-E3 E8S-E9 Port 3 Interrupt 48 (INT2) OOFO COF 4 COFS OOF6 GCF7 Interrupt acknowledge CHB command CHB data CHA command CHA data ES-E6 E11-E12 Port 4 Interrupt 46 (INT4) OOF8 OOFC O0FD COFE OOFF Interrupt acknowledge CHB command CHB data CHA command CHA data - y TECHNICAL REFERENCE HARDWARE OPTIONS Two channels (A and B) from each port control the Z8530 operations. Channel A, the main communications channel through which data transfer takes place, also monitors or controls some of the RS-232-C signals. Channel B does nothing but control or monitor signals. It is not wused for data transfer. i Each channel can be accessed by two addresses: The command address for either channel is used to read or write registers that control the Z8S30 address for channel A is used to read received transmitted data. The data address for channel B "command" and "data."® access any of the 1§ operations. The data data and to write is not used. Because the 2Z8S30 does not contain pin-outs for the DSR, SCF, and RI signals, unused pins from channel B are used for these signals. Table 3-4 lists the specific pin-out for these signals. Table 3-S5 lists the Channel B pin-out for the Z8530 interrupt enables. Table 3-4 Channel B Pin-Out for Z8S530 Z8530 Signal Channel B Pin-~Out DSR DCD SCA DTR SCF SYNC/HUNT RI CTs Table 3-S5 Channel B Pin-Out for Z8530 Interrupt 28539 Interrupt Channel B Pin-Out Enable DSR DCcp SCA none SCF SYNC/HUNT RI CTS Each port has an I/0 address used to acknowledge the 28530 interrupts. An I/0 write followed by an I/0 read done at this address acknowledges the interrupt. The data written during the I/0 write is irrelevant. After the 1I/0 read, the Z8530 returns the code for the interrupt that occurred. These codes are explained in the Zilog 8530 Technical Manual. : TECHNICAL REFERENCE HARDWARE OPTIONS TthheefMegxmtaeirlnsal a*t contnhiesctorconn`e9c6t9o)r. is an RS-232-C type. Tabl. e,3-6 ident®ifies Table 3-6 RS-232-C Connector Signals e --m------ P -- e, m e, e e ----r e, -- === D et +* { Pin | Signal Name } signal i r------------ e m e et mm e e tmm + 1 i Chassis ground 2 | Transmitted data 3 | Received data 4 | Request to send S | Clear to send 6 | Data set ready 7 } Signal ground 8 | Data carrier detect 9 | Ko connection 10 | No connection | sSecondary request to send i AA 1 i BA | | 8B i i RTS/CA | | CTS/CB | | DSR/CC | | AB | ] DCD/CF | i oo | | - | | sca/cCH § { Secondary clear to send | scF/cCI f 13 | No connection | -- f 14 | No connection 15 | Transmitter clock in 16 | No connection 17 i Receiver clock in 18 | No connection 19 | Xo connection 20 | Data terminal ready 21 | No connection 22 | Ring indicator 23 | Same as pin 11 24 | External transmitter clock 25 | No connection | = | i TXC/DB | | S | i RSC/DD | 1 - | | S | | DTR/CD l | A ) 1 RI/CE i i SCA/CH | i DA | 1 2o | o ---- P m e m e, --,-- e e - - ---------- tmmmm== - 3.4 INTERNAL MODEMS Texas Instruments offers two internal modems for the Professional Computer. One is a Bell 103-compatible type, which operates at 300 baud. The other is Bell 212-compatible and operates at 1200 baud. Both are full-duplex modems, and the Bell 21i2-compatible can operate in full-duplex, synchronous, 1200 baud. These are "smart" modems, and can handle a variety of commands for establishing communications. Both modems have automatic dialing capability using either pulse or tone dialing. The modem also provides status indications for monitoring the progress of the dialing procedure. The following subsections describe the architecture and interface of the modems to the system for those users who want to write their own communication program, and who want to use an internal modenm. TECHNICAL REFERENCE HARDWARE OPTIONS 3.4.1 Architecture . » The interface hardware for the modem board is identical to that created for the sync-async c¢omm board. Therefore, it is easy to adapt software written for the sync-async comm board so that it can operate with either of the modems. Adding code to handle the modem dialing procedure is the major change required. The same port addresses and interrupt levels used by the sync-async comm board are used by the modem bdoards. Figure 3-3 shows a block diagram of modem hardware. : The serial controller (Zilog 8530) sends the modem commands during the modem initialization and dialing procedure. Then the 28530 transfers data between the modem and the remote system. (1 Z8I5L3O0G MICROPROCESSOR (2) MODEM RJ 1 3) RJ Figure 3-3 Modem Hardware Interface 223218-13 3.4.2 Zilog 8530--Modem Signals Two special control signals, (acknowledge control mode), passed by the Z8530. /RNCTL while /ACNTL information is /RNCTL (request control mode) and /ACNTL tell the modem how to handle information information is processed as commands, interpreted as data to be transmitted. The signals that appear at the Zilog 8530--modem interface are shown in Figure 3-4, TECHNICAL REFERENCE HARDWARE OPTIONS Zilog 8530 Modem 15 (/TD) 13 (/RD} ---- BA <------ BB 18 (/CTS) «~-------- /CB 16 (/DTR) 21 (/DSR) ----> /CD <------ /CC 29 (/sbCD) <«-------- /CI 19 (/DCD) 22 {/RI} <------ /CF <«------ /CE 23 (/RTSB} ---- /RCNTL 11 {/SYNCA)} «-------- /ACNTL 12 /RTXCA) <------ /RX CLOCK 22 (/TRXCA} «-------- /TX CLOCK 27121614 Figure 3-4 2Zilog 8530--Modem Interface Signals The following paragraphs give brief descriptions of these signals. NOTE In the following descriptions, "ON" refers to an active~-low TTL voltage level. (/TD) -> BA The Z8S30 sends condition of /RCNTL determines data or command data). BB -> (/RD) The modem sends condition of /RCNTL determines data to the modem on this line. The the type of data (either transmitted data to the Z8530 on this line. The the type of data (either transmitted TECHNICAL REFERENCE HARDWARE OPTIONS data . or command R data). => /CTS .Hhen this signal is on, the modem is ready to receive transmitted Z8530 can data from the 28530. Even when this signal is off, the 9till send command data if /ACNTL is on and /CD (DTR) is off. No transmitted data is sent while this signal is off. {/DTR) -> /CD When this the communication. This command mode, but before start-dial command is "command failed"" status.) signal signal giving given is on, the terminal is ready is turned on while the unit the start-dial command. before /DTR is on, the modem to start is in the (If the returns a /C -> (/DSR) The modem completes dialing, then turns this while waiting for the answer tone and the carrier. indicates three things by turning this electrically connected to the communication signal on: line; that it hook; and that it is ready to start communication activity. signal on The modem that it is is off- /CI_-> (/SDCD) After answering a signal to indicate how fast data terminal, Turning the line on transmitted at high speed. Turning is being transmitted at low speed. signal represents the selected rate call, the modem generates is being transmitted to indicates that data is the line off indicates that During the originate modes, of data transfer. this the being data this [CE _-> (/DCD) data signal begin. When from this the signal is on, communications & the modem line and is receiving communications the can The modem generates indicate the ringing activity. ringing. Between rings, or when off. The software detects the and asserts DTR if the call is to the voltage levels on this line to When the signal is on, the line is there is no ringing, the signal is ringing activity through the zss30, be answered. (/RTSB) -> /RCNTL The software uses this signal to change the mode of data terminal transfer. When this signal wants to enter into the command is on, mode. it indicates that In command mode, the the modem does it uses the not data transmit the data received on the line BA. for command and status information exchange Instead, between the terminal and the modem. During initialization and dialing procedures, the modem uses the command mode commands and to receive status information. to send modenm dialing Once the data transfer mode is initiated, the command mode cannot be invoked again unless the line is disconnected. /ACNTL -> (SYNCA) The modem generates this signal in response to the /RCNTL signal from software. The software does not send any command data on line BA until this signal is turned on. When the /RCNTL signal goes away and the modem enters the data transfer mode, this signal is turned off. The /ACNTL signal is usually pulled high on the RS-232 interface board. When both /RCNTL and /ACNTL are on, the TECHNICAL REFERENCE HARDWARE OPTIONS terminal can exchange commands and information with the modem. The /ACNTL signal combined with the /RCNTL signal can differentiate between the modem board and a sync-async comm board. To check for an installed modem, the software first activates the RCNTL, then waits for the modem to return the /ACNTL signal. If no acknowledge signal returns, then a sync-async comm board is installed, rather than a modem board. RX CLOCK -=> RTXCA This asynchronous communication. is the receive data c¢lock 1line for TX CLOCK -> TRXCA This is the transmit data clock line for asynchronous communication. 3.4.3 Modem Initialization At power-up, the RESET modem, using the operating these same defaults at any signal on the system bus initializes the defaults. The user can reset the modem to time with the software reset command. The default parameters are listed in Table 3-7. Table 3-7 Modem Default Parameters - Parameter Dialing Line termination Modem transmitter Modem mode Data/command mode Communication Default « Setting Pulse dial on hook Squelched Originate Data mode Asynchronous 3.4.4 Command Mode Operation The modem has two modes of operation, data transfer (also called control) mode. The terminal communicates with the processor on the modem board, mode and system either data transfer or the command mode. All data and command passes through the USART. command software for the transfer At power-up, the default setting is for the data transfer mode. For various reasons, such as a software request for diagnostic status information, it is necessary to place the unit in command mode. The terminal and the modem are in master-slave configuration, and the modem cannot initiate the command mode. TECHNICAL REFERENCE HARDWARE OPTIONS To prepare for command mode operation, the Z8530 must be set up 300-baud operation, no parity, 8 bits per character, one stop for bit, and ons start bit. The 2Zilog 8530 Technical Manual contains on setting the Z8530. Also, refer to subsection 3.3 Appendix F contains "RCNTL"", a sample subroutine that of this checks details manual. for an installed modem. Once enter line modem until the appropriate signals are set, the modem and the terminal can into a command status transfer dialogue. The software asserts /RCNTL, requesting the modem to enter the command mode. The responds by asserting the line /ACNTL. The software then waits /ACNTL is turned on by the modem before sending any commands. To find the status "send diagnostic the first byte of the modenm, the computer transmits status" (44H). The modem returns a 2-byte indicating that the "status byte followsTM the code response, and the second byte giving the status, The commands and status codes are Appendix F contains "DIAGST", a dialogue in the command mode. listed sample later in routine this section. for starting a After the modem completes a "command complete" (A=41H) After sending a command, the command, expecting either command code or computer a from the computer, it sends a "command failed" (Z=SAH) code. waits before sending another direct response or a command a complete/failed status. The terminal software a command to the modem against possible modem can insert a fail-safe time-out between and receiving the command status to malfunction. issuing protect After the software the /RCNTL 1line. The system is now completes the command/status dialogue, The modem responds by releasing the in the data transfer mode. it releases /ACNTL line. hThdtahahiseelstceoDbcdnTeonRemenmcatasnnsieddgsntaamlbottldhheieewshheeclniadpnn.henotonhteeanybleilniteniemreeisenDitsTdReirsecditoso nnteubwcerutnnelededs.dsisocffoT,tnhhnee eocnstcoecefdot.mwmtauhreneicTcahottenuirnonenscmtoidooefnmifs 3.4.5 Dialing Procedure Tdiioninasletbtqrhedeugicnttieo(laniesnpcchlaoluonldne,ingthnteuhemabnmeyerttehrsomTedip(na7ar1loaf3t)o-drt8ir9aa5lns-isy0hmm0gib0to1slXs(,sutchsheuT chatserleasqeT upeho(sortn)se P). number -, +, For tone and X is the telephone number terminator. The number maximum of 23 digits long. complete"" status, then "Dialer"", a sample routine The dials for modem the dialing responds with the number. Appendix F a telephone number. to be or @) and example, dialing, can be a "command contains 3-19 TECHNICAL REFERENCE HARDWARE OPTIONS The ( ) and They have - separators are used for no meaning to the modem. number-grouping The modem reads purposes only. the + separator as tandem dialing. Each time the modem finds & +, it waits for another dial tone before continuing. The @ symbol represents blind dialing. When the modem finds the @ separator, it waits 2.0 + 0.1 s after the command is received, then dials the number without waiting for a dial tone. The dialing methods include tone dialing, pulse dialing, and automatic selection. The modem is able to alternate dialing methods during the dialing procedure. Simply insert the proper characters (T for tone dialing, P for pulse dialing) in the telephone number. For example, in the number T8-50-33333344-P(713)-895-0001, the modem dials all the digits to P using the tone mode; all digits after P are dialed using the pulse mode. The modem echoes the number back to the terminal (without separators) as it dials each digit, then sends status to the terminal for full call-progress monitoring. The status can be ringing, busy, no answver, or voice. The terminal screen displays the appropriate message. When the connection attempt is successful, the modem does not a status indicator. Instead, the computer monitors the signal The modem asserts /DCD, indicating a successful connection. return /DCD. The dialing procedure is aborted any time the DTR signal is dropped. The modem sees this as a command to stop dialing, and goes on hook. The modem waits through 10 rings before reporting a no-answer condition. The default time to wait between retries is 11 s, the default number of retries is 0. Ten rings as a no-answer condition is a fixed number; however, the time to wait between retries and the number of retries can be programmed into the terminal software. 3.4.6 Time-Outs Both the terminal and the modem can cauge time-outs are: loss of carrier, long response. The two types of modem time-outs abort timer. time-outs. The terminal space received, and no are: loss of carrier and Table 3-8 summarizes the time-outs. TECHNICAL REFERENCE HARDWARE OPTIONS Table 3-8 Types and Durations of Disconnects Terminal Modem Type Loss of carrier Long space received No response time-out Duration 200 ms 1.5 s 1 s Type Abort timer Loss of carrier Duration 17 s 50 ms The following conditions. paragraphs give brief descriptions of all time-out 3.4.6.1 Terminal or Software Time-Outs. * Loss of Carrier. If safe disconnects vhen before disconnecting. the terminal is programmed for fail- the carrier goes off, it vaits S0 ms * Long Space command to the /ACNTL within 1.5 Received. At the modem, then signal. If the s, the terminal start-up, the terminal sends a waits for the modem to turn on modem fails to return the signal disconnects. ¥ * No Response. then waits disconnects, The terminal for the modem sends a response. command to the modem, After 1 s, the terminal 3.4.6.2 HMHodem Time-Outs. * LstttootuisarmsynerssrecoofogfhonffoCiflazdrefsrotirheerth.SteOhDeCDmlsoDsuDssrCi(Dignnotgafhle1latihnlteeoetnegmcttphatheorrrrueiaZo.erf8ryS.3t0hH,leooswsecvaetuirosfm,ienrg),cifartrhtiehteehre,socfatrmwrotadihereinersm * Abort Timer procedure, tone. The status and - Originate Mode. the modem goes modem waits 17 s, goes on hook. The During the automatic off hook to listen for then sends the "command terminal responds by dialing the dial failed" dropping DTR. The abort timer resets after the complete. If the modem being used is type, the abort timer is set for Bell dialing procedure is a Bell 212A-compatible 212 high-band carrier. * Abort Timer procedure, - Answer Mode. the answver-tone BDuring a abort timer manual is used the dial-tone abort timer. The originating modem dialing instead of looks for 3-21 TECHNICAL A REFEEfiNCB . HARDWARE OPTIONS an answer from the remote modem. The answver depends upon the type of modem installed in the remote system. If the remote is Bell 103-compatible, the modem 1looks for the carrier. If the remote is Bell 212-compatible, the modem looks for the scrambled mark or the unscrambled mark. The modem waits 17 s for the answer tone, then drops DSR. 3.4.7 Modem Software The modem software is very simple. Some commands are only 1 byte long, such as the "Manual Disconnect" command. Field commands, such as "Telephone Number" (an op code followed by a field), are longer. The terminal sends a command to direct response or a status failed). The terminal does not handshake is completed. the modem. The modem byte (command complete send additional commands returns a or command until this Table 3-9 lists the software commands from the terminal to the modem. TECHNICAL REFERENCE HARDWARE OPTIONg Table ,3-9 Commands from .the Software to the Modem B+ HHUICHUIDVDOXIPTQTUMMEBU ASCII Code A B c Command Dial following telephone number, select dialing mode Next byte contains number of retries (ASCII, 0-9) Next 2 bytes contain time (in s) between retries (ASCII, 0-399 s) Request diagnostic status Disconnect on loss of carrier Do not disconnect on loss of carrier Manual answer Select 1200- bps option Select 300~ bps option What modem type? Manual originate Dial following telephone number using pulse dialing Start RDLB test* Synchronous communication mode Dial following telephone number using tone dialing Asynchronous communication mode i Software reset Telephone number terminator Start ALB test*x 5 Tandem dialing (wait for another dial tone) Blind dial (wait 2.0 s, then dial) i * The RDLB compatible lines. received The data (Remote Digital Loopback) test is for a Bell 212- modem. It checks the condition of the communication originating modem makes the answvering modem echo all back to the originating modem. ** The ALB (Analog Loopback) test causes the modem's internal logic to connect the transmitter to the receiver and loopback the data. Table 3-10C lists the possible responses from the modem. TECHNICAL REFERENCE HARDHARE OPTIONS Table 3-10 Response from the Modem to the Software NSTOZITTHOW» ASCII Code Command Command completed Busy tone Diagnostic status follows Phone number terminator Phone number follows Bell 212A option installed Bell 103 option installed No answver Lost call Ringing from ringback Voice reception Command failed One possible modem Immediately after the diagnostic indicators response is D, diagnostic status modem sends this reply, it sends one from Table 3-11. follows. of the Byte Value o0 o1 02 o4 08 i0 20 40 80 Table 3-11 Diagnostic Heanifig Good check ROM error RAM error Processor error Timer error Not used Not used Not used Not used Status Indicators 4 3.5 GRAPHICS VIDEO CONTROLLER BOARD The graphics video controller board operates with the CRT controller board. It is mounted (piggyback fashion) on the CRT controller board, and all its connections are to the CRT controller board. Figure 3-5 is a block diagram of the graphics video controller board. (Refer to Section 6 for logic diagrams.) TECHNICAL REFERENCE HARDWARE OPTIONS ADOcRPEySS. AEFAESH ADURESS PADCESSOR ADDRESS BUS S2MTER a1 8MUx 41 MU i [T RAM ADDRESS BUS PIXEL ATTRIBUTE A &1 Mux 41MUX JL I PiXEL ATTRIBUTEB PIXEL ATTRIBUTEC SHIFT REG|--{SHiFT REG | | sHiFT ReG--{ sHiFT REG| 8R1A6xKM N«B1R6AKM | 16K aRAM A T 16K BRAM LATEW I PALETTE DATA IRED! PALETTE DATA (BLUET RED PIXEL BLUE PIXEL GREEN PIXEL ML81UX M8u1 x M8U1X PALETTE DATA IGREEN? LATCH CON8T0CRATAO0TRLDLER T0CPY HROELADD-LDAATTCAH ATCH OATA 8US TICMOLINONTGGIRCOALND PALETTELATCHES. 2223216-15 Figure 3-5 Graphics Video Controller Board Block Diagram The graphics video controller board uses the same number of pixels (720 horizontal X 300 vertical) on the screen as does the alphanumerics board. Each pixel can contain a maximum of three attribute Dbits (labeled A, B, and C). These attribute bits are converted by a palette look-up table to three colors - red, blue, and green. Aspects section of the graphics include: video controller Dboard described in this TECHNICAL REFERENCE HARDWHARE OPTIONS * Pixel addressing * Color selection * Timing and synchronization. * Graphics logic array program 3.5.1 Pixel Addressing Each dot on the graphics screen is a pixel. Each pixel has a 3-bit value associated with it that selects one of eight palettes (0 - 7). Each palette is assigned one of eight colors, as determined by the contents of the latch. The latch is simply an array of eight 3-bit values. The palette number of each pixel is an index into that array. So, the color of a pixel is the color value of the latch entry that corresponds to the palette number of the pixel. Changing either the palette or the color assigned to the palette changes the color of that pixel. Changing the color assigned to a palette changes the color of every pixel with the same palette number. A plane is a block of memory containing 1 bit for each pixel in the disgsplay. Each of the 3 bits assigned to a pixel is in a different plane. All three planes are formatted identically; only the segment address differs from plane to plane. The segment addresses of the three planes are C000, 800, and DO0OO. For example, it a Dbit assigned to pixel (x, y) is the fifth bit of.memory location C000:mmmm, then the other two bits assigned to that pixel are the fifth bits of locations C8CO:mmmm and DOOOC:mmmm. - In the following explanation, memory addresses refer to offsets into the segment of any of the three graphics planes. The diagram below shows the organization of graphics screen memory into pixels,. Pixels are numbered (x coordinate, y coordinate) and are zero relative. Byte Address 0000-00SB 005C-0087 { Pixels Represented {(8,0) |(8,1) - (15,08)}(0,0) - (15,1)j(0,1) - (7,0)](24,0) - (31,0)}(16,0) - (7,3)}. . . . . - (23,0) Pixel (0,0) is the MSB of location 0001. The LSB of location 0001 is pixel (7,0). Pixel (9,0) is the MSB of location 0000. The LSB of location 0000 is pixel (15,0). Pixel (16,0) is the MSB of location 0003. The bytes are flip-flopped in this way so that if a move instruction ic executed from a word in the graphics plane to a word: register, the TECHNICAL REFERENCE HARDWARE OPTIONS register then contains 16 consecutive pixel bits in order from MSB to LSB. For example, if a MOV AX, ES:0000 is executed (where ES contains the segment address of the desired graphics plane), the MSB of AX is pixel (0,0) and the LSB is pixel (15,0). With this scheme, 4S5 words are necessary to represent the 720 pixels in each row of the display. There is one unused word at the end of each line, so a new row begins every 46 words, or 82 bytes. Line one (zero-relative) begins at byte address 92 decimal, O00SCH. Therefore, pixel (0,1) is the MSB of location 0O0SDH and pixel (8,1) is the MSB of 1location OOSCH (because the bytes are flip-flopped). Example: To find the values of the rightmost 16 pixels on the bottom line of the display, 299 (zero-relative number of last line on display) X 92 (bytes per line) + 88 (first word = 0, second word = 2, so 45th word = 88) = 27596 (6BCC hex) So, MOV AX, ES:6BCC puts the values of the last 16 pixels on the display corner. in AX, with the LSB of AX being the pixel in the lower right The three graphics planes are named A, addresses of the planes A, B, and C recpectively. In determining the palette from the C plane is the most significant, the least significant, and the B plane bit B, and C. The are C000, 800, number of a pixel, the b{t from the A is in the middle. segment and DOOO, the bit plane is Example: To find display, the first color of the pixel in the lower right find the palette number assigned to it. corner of the The MSB of the palette number is the LSB of D00O:6BCC; the middle bit of the palette number is the LSB of 800:6BCC; the LSB of the palette number is the LSB of C000:6BCC Say, for example, respectively. Then color is assigned to in effect, the color that these the color palette 5. of the pixel three bits are 1, o, and 198 of the lower right pixel is whatever If the default color assignments are is cyan. 3.5.2 Color Selection Each of the eight entries in the three primary colors: green, colors are formed by combinations Table 3-12. latch has red, and of those one bit for each of the blue. The eight available three colors, as listed in TECHNICAL REFERENCE HARDWARE OPTIONS Table 3-12 Color Combinations Green Red Blue Color Color i o o o black c o 0 1 blue 1 0 1 0 red 2 o 1 1 magenta 3 i o 0 green 4 1 o 1 cyan s 1 1 o yellow 6 1 1 1 white 7 To access the latch, you must write all eight bits of a particular primary color to the appropriate memory location for that color. You cannot change all three bits corresponding to one palette number in a single write. The latch consists of three memory locations, one for each of the primary colors. These locations are: Blue latch Green latch Red latch DF00:0010 DF00:0020 DF00:0030 - You can write to these locations, but you cannot read from them. For this reason, it is necessary to maintain a memory image of the three color latches ifindividual palettes are to be changed. You are then able to change a single palette by setting the appropriate bits in the memory image to the desired value and updating all three color latches. Each of the three color bits of a palette is in the same bit position in all which three color latches. However, bit in the latch is addressed the scheme for by a pixel is not determining the same as that for determining the palette number. In determining the latch bit addressed by the three-bit value assigned value is the most significant and the C plane to a pixel, value is in the the B plane middle. The and the A plane value bit 0 is the LSB correspondence is still of the between the color the least significant. Bit 7 is the MSB latch byte. Table 3-13 displays bits assigned to a pixel and the bit positions in any of the three color latches, and shows the comparison of these bit positions to the palette numbers. TECHNICAL REFERENCE Table 3-13 Bit Correlations HARDWARE OPTIONS B Plane Bit c o 0 0 1 1 1 1 Plane Bit o o 1 1 o o 1 1 A Plane Bit o 1 o 1 o 1 o 1 Latch 8it Addressed C 1 2 3 4 S 6 7 Palette Number o 1 4 S 2 3 3 7 Figure 3-6 shows this correspondence horizontally, latch byte appears as a byte register. so that the color 8 plane bit C plane bit A plane bit 1 1 1 1 0 0 1 1 0 0 1 1 0 0 1 0 1 0 1 " 0 Latch bit addressed 7, 6 5 4 3 2 1 0 Palette number 7 6 5 4 3 2 Figure 3-6 Color Latch Byte 1 0 222321618 Example This example of the three shows color how to create latches. a memory image of the default values Combining information from Table 3-12 with information from Table 3-13 (thé the information necessary to construct (the Color Combinations Bit Correlations table), Table 3-14. table), yields TECHNICAL REFERENCE HARDWARE OPTIONS Table 3-~14 Default Values of Color Latches Latch Palette Number Green Red Bit (= Color Number) Bit Bit 7 7 (white) 6 6 {(yellow) S 3 (magenta) 4 2 (red) 3 S (cyan) 2 4 (green) 1 1 (blue) 0 0 (black) 1 k9 1 1 0 1 0o 1 1 1] 1 [ o o 0 o Blue Bit 1 0 £ 0 1 o 1 o The default condition is palette number = color number; the color latches are set as follows: therefore, Green latch = 11001100 binary = CC hexadecimal at DF00:0020 Red latch = 1111000 binary = FO hexadecimal at DF00:0030 Blue latch = 10101010 binary = AA hexadecimal at DF00:00l10 Example: # This example lists the s;eps necessary to <change palette three to yellow from the default condition (magenta). TM~ 1. Find find the desired palette number (three) the associated latch bit (five). in Table 3-14, then 2. Find the desired color (yellow) in Table 3-14, the bit settings (red = 1, green = 1, blue = 0). then find 3. Set bit five in each of the color latches to the values determined in the previous step. This change creates the new values: Green latch = 11101100 binary = EC hexadecimal Red latch = 11110000 binary = FO hexadecimal Blue latch = 10001010 binary = 8A hexadecimal. 4, Write the new values (from the previous step) to the three color latch addresses. {In- this example, it is not necessary to change the red latch, because the value did not change.) TECHNICAL REFERENCE HARDWARE OPTIONS 3.5.3 Timing and Synchronization The same `at clock that generates internal timing for the CRT controller ©board <clocks the graphics video controller board. Monitoring the display enable (DE) signal from the CRT controller board helps to synchronize the pixel outputs from the two boards. If the DE signal has been low for a long period, the graphics board assumes that the scan is in the vertical interval. When DE goes high again, the graphics board resets the graphic memory and scan counters to zero. When DE is low for a short period (horizontal retrace, for example), the scan counters are stopped. This places the last pixel on a line adjacent to the first pixel on the following line. The graphics video controller board gives the CPU essentially free access to the screen memory. During a single screen display cycle, the hardware can access the refresh memory twice -- once to read the data for screen display, and once for the CPU to read or write data if needed. To provide enough time for this access, a display cycle accesses 16 adjacent pixels of 3 attribute bits each. These are read in parallel and loaded into three 16-bit shift registers for display. After the memory has been read for screen display, the CPU access cycle starts when a read or write cycle is requested. The accessed memory is broken up into one of six separate bytes by properly decoding memory. the enabling of bus buffers and write enable signals to the Dynamic memory is used on the graphics video board because of the large amount of memory required. The memory chips are organized into 16k x 4 bits and are packaged in an 18-pin, dual inline package (DIP). The 8 address lines are multiplexed into 256 row addresses and 64 column addresses to get to the 16 K locations in the memory. The addresses to the RAM also need to be multiplexed between the CPU and the refresh counter. Performing this four-way multiplexing are four 74LS153 dual 4-to-~1 multiplexers (U33 through U36). Figure 3-7 is a timing diagram for the graphics video controller board. A 74LS163 4-bit counter (U39) and a HAL16RBA-1 logic array (U41) generate the timing. A 74LS163 counter connected as a one-shot (U40), a 75LS00 gate (U44), and a 74LS04 gate (U45) provide the stop, start, and reset logic for the refresh counter. HARDWARE OPTIONS Figure 3-7 Graphics Video Controller Timing Diagram 32 sz ONDINYIE TVIILE3A 40 GN3 =t LI TPl _ -- 1 1 S Sl o SL ONIHNTAVGAHLINLON-IINTIYLIILLOEHISA-3NO e o B - (=s _ ' 1-- e e ! v 1 ' _ T T v 7 | i ! STTC1'y ICCECCE7vi CTI ! ' ! . : - _ " eT1 Te! =i ] | 4 e:; R eB P | e L [ P 1 --1 ----------1 -- = e % v M!7 | | ! R ! 1 : n i 1 1 ; v : 9NINYIE H 40 aN3 = Ll N -- e e 1 + e L )= o S 03QIA JALLOV 40 GN3 - --/T w0TANNOD ----_ -- 1 S eyt e B o----B S oW LSSTBXYD) 1371Vd £¢N 934 14IHS i 40 40 40 LNO LNO LN0 T 1133XXIIdd TaxId 18¥14 LSHId 1syls 3 -- ~| ~--= 0 = : ! - | _ ' ! !--; T ) ) " ! r---- CCCII.,CCICITIM 'iL TITI. ; ! . ; I el S ; : fro=--il: (ol : B | r s . T 1 ! ' : v 7 L ! ! | T, ' ----1 ----------1 ------ : . < v - T M L s 1 " 1SYX --a03q 13a . -- LIVMD --304v1 --N3LY1 --FCNr3end)4ng _gvwy -13s9 ----qYyM [N TECHNICAL REFERENCE . 1 y AVF110dASDIG | ; ANSB33NIFOdLUYIWIES3M WT! 31040 Avidsia ! + L AV3ITd0SAIDa ! ! 310AD ! AV1dSIa ANOD3S Waw ; 3NMT30 | ONDINVISH 'SANY33II3NYNIJDS' IFTOAD AVIdSIQ ONIHNG ITIAD ' NIFYIS LSV 1SHId TECHNICAL REFERENCE HARDWARE OPTIONS 3.5.4 Graphics Logic Array Program Programming for the logic array is given in Table 3-15. Table 3-15 Programming for the Graphics State Machine HAL Input RD~ X1 LATEN- BUFEN- Ooutput WR- GSELDE X2 ROWGRCLK LATOE- SRLD- RAS- GHAIT- CAS- DED- ------- et b b et m bt m bbb b=t b m LATEN- L . L . . . HL or g 15150 o oo B L T R or . LL TR L - L - or L L . R % 0.0 D @ o W o -------------- P bmb b m e bt m b b m bt m bbb LATOE- L . L HHHL T L R CF holh'8 48 8 o O N LS LR N &M s plb & d slo o b g'vewo ------- Poebmbmb et mb et bbb m b= RAS -~ . . LHLH VIR or R LBLIE SN R Y N L or 'L, ¢L L HLL o L HES R or . . or TRIECR . HH L . L H . L DRI Rl %o 0o O 0 or NI L HiH O Vi L L PSSO I o R L - DAF- S-S da. @ ols. b 1D et b m bbb m bb bb bb == U TR H B8 s o lF o9 or 85 6 8.0 o3 B ERRE L T ------- otttk m bbb m b BUFEN T N TSI A v b -- bbb== o 2 D o 4ot Or NLBLOE MHSLSLR L O R eL I or L LR e | oo oy o dBeo OR L L - I - - G- il ------- Por bbb b et bbbt SRLD- . . . LHHH e R IL- AR O N LN L .S e T CRE I N T ------- ot b m btt -- t b m bbb --r = CHA'IT NI RTINS N e HEUHI . TM e or o 5% d b 6 b w Ll g 9.8 d o o 4 (e & 3h-05 o 4 doay o R - = ------- DED- or Fobb m bb bm m bbb b m -- b -- b b = 5 5 00l b e Y ] - PR Li'e o.g o Tl -------------- Pttt Legend: m bb b b b bb --r == L = Low signal. H = High signal. Comment Read S85,6,7,8 Hrite S3 Hrite S4 till All other ORs not write inactive Read s8 Read S9 till not read All other ORs inactive Refresh screen Sil1 Write sS3 Read S3 CPU sS4, :refresh s12 CPU 85,6, refresh .S13,14 CPU S7, refresh s15 (Inactive term) $13,14,15,0,5,6,7,8 All other ORs. Read $4,5,6,7,8 Write s2 Write 83,4,5,6,7,8 All other ORs inactive S1is All other ORs inactive Delayed DE All other ORs. TECHNICAL REFERENCE HARDHARE OPTIONS When the logical the AND of terms result is true. AND of terms from another from row, one row of Table 3-15 is ORed the output goes low when with the 3.6 WINCHESTER DISK DRIVE AND CONTROLLER OPTION The Winchester disk drive and controller board option consists of a controller board, cable and hardware, and a S- or 10-megabyte Hinchester drive. Aspects of this option described in the followving paragraphs include: * HWinchester hardvare theory of operations * Register assignments * Bit definitions for registers and ports * Controller status bit combinations * Normal command sequence operation 3.6.1 Winchester Hardware Theory of Operation 4 The Winchester controller is addressed by the 8088 as a block of four I1/0 ports: 0030H through O0033H. 1/0 reads are indicated by the bus signal IORC, and I/O writes are indicated by the bus signal AIOWC-. The controller can generate an interrupt following conditions: to the host under one of the * When data controller is ready to be read from or written to the * When the operation is completed, and the controller is requesting a status read (C/D- = 1, [/0 = 1) Both of the interrupt conditions can be individually disabled. the interrupt is active, the computer's interrupt line 6 is held until it is cleared by a read to the controller status register. When high 3.6.1.1 On-Board EPROM/ROM. A 4K x 8-bit EPROM/ROM driver routines for the controller. Addressing this the output to drive the data bus through a tristate EPROM/ROM is at memory address OFB8O0O00H. Access time EPROM or the ROM is less than 350 ns. contains the device causes Dbuffer. The to either the TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.1.2 Commands and Command Testing. block to the'controller to specify the device control block (DCB). the DCB. Table 3-16 The computer sends a 6-byte operation. This block is the gives the bit definition for hi Table 3-16 Device Control Block Bit Diagram B Yrm----m-------- SEESS +~B I T N UMBER --+-~nw-u-o S S +* t} 7 § 6 { S { 4 | 3 | 2 | 1 | 0 Q-g0-=======0=======¢=======¢=======4-=======0=======¢=======0=======0 |0] COMMAND CLASS | OP CODE | e ------------ e = - ----- e ----------- P ------------- O ------ - *m---------- b ------ - +* j1} LOGICAL UNIT NUMBER I b mmm----- Fmm--m------ - -------- P m - HIGH ADDRESS ( See Note 1 ) | b ---- o ---- tmmem---- e ------ + {24 MIDDLE ADDRESS ( See Note 1 ) | R 13} F------------ o --m---------- ------------ b m-------------- P m---------- LOW ADDRESS - - -------- +* ( See Note 1 ) | et mm e -- - e --------- o -------- o m-------- - R e - ---- o ---------- + jai INTERLEAVE OR NUMBER OF BLOCKS ( See Note 2 ) | P - - = - e ------- P ------------ - - e -------- -------------- P -------------- * |s| b e m------- CONTROL FIELD bmm------ e = o -------- e - e ------ P | m-------- +* Notes: 1. Refer to paragraph 3.6.1.6. 2. Interleave factor for FORMAT, CHECK TRACK, and READ ID commands. - 3.6.1.3 bytes that Explanation of Bytes in the Device Control comprise the device control block are defined Block. The as follows: § Byte Definition o Bits 7, 6, and 5 identify the class of the command. Bits 4 through 0 contain the opcode of the command. 1 Bits 7, 6, and S identify the logical unit number (LUN). Bits 4 through O contain logical disk address 2. 2 Bits 7 through 0 contain logical disk address 1. 3 Bits 7 through 0 contain logical disk address 0. 4 Bits 7 through 0 specify the interleave or block count. 5 Bits 7 through O contain the control field. TECHNICAL REFERENCE ' HARDHARE OPTIOKNS 3.6.1.4 Control Field Detailed Description. Byte S5, the field of the DCB, allows the user to choose options for different types and makes of disk drives. The following defines the Dbits of the control byte. The step options are in control byte S of the command descriptor. The encoding with bits 0 through 3 as given in Table 3-17. control several listing encoded is done Table 3-17 Command Descriptor Byte Description Default 3-ms step rate Seagate STS06 (MLC2) Tandon fast-step Texas Instruments fast-step 200-us buffered-step 70-us buffered-step 30-us buffered-step 15~-us buffered-step Olivetti 2 ms/step (561) Olivetti (S62) fast-step (1.1 ms typical) Spare (for future use) Bit No. 3 2 1 0 o o o o o o o 1 o o 1 o o o i 1 0o 1 o o 0 1 0 1 0 1 1 o o 1 1 1 1 o o o 1 o o 1 1 1 1 1 4 To configure a drive for fast-step or buftered-step; refer to the manufacturer'''s manual for instructions. If the drive is hardware- configured for fast-step, all commands requiring the seek option selection must use the fast-step option for that drive. NOTE The step option bits exclusive. Select configuration. (3 through 0) are only one option mutually for any Bits 4 and S are reserved for future use. Set bit 6 to O for regular operation. When this bit is set to during a read sector command, any failing sectors are not reread on the next revolution. Set bit 7 to 0 for regular operation. `Setting this bit to 1 disables the four retries by the controller on all disk-access commands. Set bit 7 to 1 only during the performance evaluation of a disk drive,. B.E`-CHNeICAL REFER".E. NCE HARDHARE OPTIONS 3.6.1.5 Command Completion .Status Byte. the controller feturns a completion status This Dbyte indicates whether or not an command execution. (If the error bit is set, wvhat caused command.) the error, you must send At byte error and the the end of a command, to the computer. has occurred during you want., to know REQUEST SENSE STATUS The format of the completion status byte is 1/0 Port (MSB) b 7 6 | '0:: T+===S e Bit Number (LsB) | 4 | 3} 2 | 1] e | R TR R4S SR ST+ S S S S S 4SS SIS eSS SIS Address||Don't 0030 J|care (read) || {Don't |care { |Dri |No. j |pon't {Don't |Don't {(Error|Don't | jcare |care |care | bit jcare { | i | § 1 | I§======§======0======0======0======0====:=0=====0======0' 3.6.1.6 Logical Address of the drive is computed (HIGH, MIDDLE and LOK). The logical by using the following equation: address Logical Address = (CYADR x HDCYL « HDADR) x SETRK + SEADR Where: CYADR HDCYL HDADR SETRK SEADR = Cylinder address = Number of heads per = Head address cylinder = Number of sectors per track = Sector address 3 < maWv3shaade.elxjc6nutiu.eoms1rut.m7etcdraanniisnnStfoettbeeceertrraorllcprieehanaaisgvveseivIenendgmt.uevlramitllnauiexepaibWlvmyheiutenmiensg.daa4stthyaesfotfoTerhnsmemuetamchtbetpdeoierrsrsdckfe,oovmorimfcmcaoeatnhnndsetcercecot.oiilosnnlrttsereriorgllspseeusareubvdple,optcorkraaftcnaskc(tDioCmnrBitv)neau.rrcsliaenaabTvlhbee1e.e poTFssnohheerecyctstooionerrce.xpsaarlmarpceoltfveIiot,scledeucadtttoaioaenorsnof.frnioonimtstienrmatleeteargrnaliavveneeastnvfhieantrfgtrarecadftcikovrieansvoonstleotovfcheetsonroSnsneaxmtdamofpejapalnicodsnegagntitacallthopaghatirycecsoainlcteaivltnercuraooynnsustesficentfruoidrrofaseutt.dsha csilIfeooncgnctitrtocerhraaoelslelseirnoftseetrchheltadosearatsvayetso tfermdwfo'auam'ircstitnogrootnhpeeeirstahfteudtilionlosgk.serloceswtvp,oeoerlId-u.nitthcniertoeenarCslPiUibneegafcvoaernentohtteimreeitanrdatainevnsragflieelraavbelthete.hefacnfteuToxlhrtle Tisthaniektneegrlolepfe-ueaslrvleaecttiaondrgfvaacntstoytarsrsgtaeenmsifsoefrshpso,rtuohlebdabtlhcpyeeornftnorodrtoimlflfneemorrut'elisntccieepaslbieln-ets.eienrclteosarpveiendgdatbaetfwetearetanunrsef.vearrsiousItno TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.2 Register Assignments The register assignments for ¢t he controller are given in Table 3-18. 1/0 ports of D the Hinchester Table 3-18 HWinchester Controller 1/0 Port Assignment P -------- P e e i Address } + Pt m e e dd e e mm e m e -- e --mm------m o + Functions | ---------------- P rrc et -- e, e ---- = + | } | | P m-------------------- e In r e ---- e, e | | -- - out { | e e, m e e e c---- .- + | 0030H f Data IN port } Data OUT port | e m e~ - R R et e e e ------, ---- - - * | 0031H { Status register { RESET o m-- e ---- e -- e r e --r e, r e -------- e mr et _--r---- e -------------- + | 0032H § Not used | Not usead | mr v, -- - -- P e, r e e ------,-------- e e m e, ------, - -------- + | 0033H | Kot used § Interrupt mask { et e mme et e, e, e, ------ + An IN function gets data from the Winchester controller board and puts it on the compute r's 1/0 expansion bus. Conversely, an ouT function sets data from the computer's /0 expansion bus onto the Hinchester disk contro ller board. ~ For byte definitions of the registers, refer to the 1I1/0 memory map given in Table 2-1. For pin-outs of the Electrical Interface. Hinchester cable, refer to paragraph 3.6. 20, TECHNICAL REFERENCE i HARDWARE OPTIONS 3.6.2.1 Data Input Port.: Disk read data and controller sense Dbytes . pass through this register to the computer. The data is held for each handshake cycle. The format is as follows: 1/0 Port (MSB) Bit Number (LsB) Il 7 1 6 | s | 4 | 3 | 2 | 1| c | |¢======0======o======0======¢======0======¢======¢======b Address|| i ! 1 i | | | | 0030 J IDATA 7|DATA 6|{DATA S|DATA 4|DATA 3|DATA 2|DATA 1|DATA 0} H I ] J | | 1 | | l0======#======0======0======0======§======*======#======0 3.6.2.2 Data Output Port. Command this register to the controller. the CPU. The bit arrangement is as bytes and disk data pass through Data is latched until updated by follows: MSB BIT NUMBER LSB 1/0 Port i1 7 | 6 | 5 | 4 | 3 | 2 | 1 0 i '¢======¢======0======0======§======o======0======¢ Zz===+ Address|| ] ) } | ] | | i 0030 ||DATA 7|DATA 6|DATA S|DATA 4|DATA 3|DATA 2|DATA 1|DATA O} (write) | 1 f | | } | i l#======Q======0======0======0======0======0======#======0~ 3.6.2.3 Controller Status Register. controller status. It enables the CPU and to monitor the controller operation. is defined as follows: This register stores the to read the controller status The controller status byte MSB BIT NUMBER LSB 1/0 Port 1l 7 | |+===a==+ 6 | s | 4! = 3 | 2 | = 1 f = o | Address||Don't 0031 |J|care (read) |} |Don't |care | |Don't |jcare } |Don't IDon't |care |care | | | COMMAND| INPUT/| DATA | |/DATA |OUTPUT{REQUEST) | | | | "======Q-======§======0======0======O=======0======#=======0~ 3.6.2.4 Reset Port. This byte resets the controller. Any write to port 0031 causes a reset. Reset clears each error status, aborts all operations, and places the Winchester controller in the command receive mode. The byte definition follows: 1/0 Port MSB BIT NUMBER LSB i 7 | s | s | AP 3 | 2| 1 o l¢======¢======0======0======¢======0======0=====#======+ Address||{Don''t |Don't |Don't |Don't |Don''t |Bon't {Don't|Don't | 0031 |jcare |care |care |care |care |care |care |care | (write)|| ) i } ! § ! | | l*======5======`======#======0======0======0====="======Q TECHNICAL REFERENCE HARDHARE OPTIONS 3.6.2.5 Interrupt Mask. interrupts are to be definition follows: This is a serviced by 2-bit field that determines which the CPU. The interrupt mask byte MSB8 BIT NUMBER LsB 1/0 Port b ZH s | s | 4 | 3 | 2 | 1 o | '¢======0======0~======¢==:===4-======0======¢======¢=======9 Address|}Don't |Don't |Don''t |Don't {Don't {Don't |DATA |STATUS | 0033 |}|care Hi |care § jcare | |care } |care | |care § {INTR. |JINTR. } JENA|BELNAE BLE | "0-======§======#======§======Q======§======0-======Q=======& 3.6.2.6 Error Status Byte. This special byte 1is available only after the completion of a command. The controller sets the I/0 and C/D bits with DRQ to indicate that this byte is available. A definition of the error status byte follows: MSB BIT NUMBER LSB 1/0 N 7 Port i 6| s| zez====2= Address||Don't |Don't |Drive |Don't |Don't 0030 ||care |care |No. jcare |Jcare (read) || § | | | l0======0======§======`======#======#======#=====#======Q` 3.6.3 Bit Definitions for Registers and Ports Table 3-19 gives the definitions controller registers and ports. of bits - for the Winchester TECHNICAL RE FERENCE . b H}RDHARE OPTIONS . i » Teble 3-1 8 Bit Definitions for Controller Registers and Ports {DATA 0-7 { READ or | WRITE || DARTEAQUEST | INPUT/ | OUTPUT| COMMAND/ | DATA| I ] | § Logical sState | Pt M e e e e m e e m e e mcc e e cccmmrm----mm---- - = + | Data true ; data high ; | Data false ; data low § | logical one »= 2.4 V ] logical zero <= 0.7 V §============================*============================é | } bata bit = 1 | i i Data bit = © § | R R e e kR 1 P R R | e +* | Commands, status, or data | No command, status, or } | ready to be transferred | data transfers to or from | | to or from controller. | controller. R Y et ] P m et e e c et e --cr e -- e m e - + | The CPU reads data or | The CPU writes data or | status from the controller.| commands to the controller.| e | When R R INPUT/OUTPUT- is ] high,| e When e, e St e mr-------- .. - ------ - INPUT/OUTPUT- is high,| | status PR R is sent to the CPU. | data is sent to the KR KRR KKK KRR KRIRRRKK | kAR AR KKK KRR KRR AR CPU. ] RRRRAR | When INPUT/OUTPUT- is low, | When INPUT/OUTPUT~ is low, | commands are sent to the | data is sent to the controller. { controller. ¢ - | Controller interrupts the | || STATUS | CPU after the CPU completes| | the current command and is | . | | | | INTERRUPT { ready to return the status No status interrupt | | ENABLE | byte. permitted. i ||| DIAENTNTAAEBRLREUPT | | | Controller interrupts the CPU when data needs to be read from or written to | | | No data interrupt | | i § | the controller. | permitted. i TECHNICAL REFERENCE HARDHARE OPTIONS 3.6:2 g # CSntroller'status Bit Combinations Table 3-20 gives all valid controller status bit combinations. Table 3-20 Valid Bit Combinations for Controller Status ____________________________________________________________________ o { COMMA|NINDPU/T/ | DATA i { DATA | OUTPUT|REQUEST|| Meaning of Pattern | Q-========§=======Q======="Q============================:============0 j | | 1 i 0 } o f 0 | } } Not valid § ! 0========§=======0=======Q{-::=======================================' § | { {§{ A data byte may be sent from the CPU | o { 0 § 1 || to the Winchester controller. The | | § § {{ controller waits for data to be written.} 0========#=======#=======#Q=========================================f ! i ] i 0 { 1 i o | | i Not valid | § J §========0=======4:======00=========================================' § j | {{ A data byte may be sentfto the CPU { 0 } 1 ¢ 1 {| from the Winchester controller. The | { } | |{ controller waits until data is read. | § i |{ Command bytes may be sent to the | 1 | o | 1 | Winchester controller from the CPU. | | ) | i § | 0========#=======#=======00=========================================1- } | | 1 § 1 { 1 { 0 Naot valid | { | | | i } ¢========Q-=======§=======§0=========================================Q~ | § § |} A status byte may be sent from the | i 1 | 1 | 1 j1 Winchester controller to the CPU. { i | f i | 0========0=======0=======0¢=========================================Q TECHNICAL REFERENCE 2 6.5 Normal Command Sequence Figure 3~B8 depicts the logical C o) Operation flow of the HARDWARE OPTIONS controller J functions --_-- WAIT1 RESET THE WINCHESTER CONTROLLER WRITE TO PORT 31 READ STATUS PORT 0031 WRITE OR READ CONTROLLER DATA {READ/WRITE TO PORT - 0030) 1S RAECQTUIEVSE T OUTCPOU(PBNOTWYTRRTTRIECOTSOLE00TLMT3OE0MO)RAND WAIT1 READ STAT us FROM PORT 0030 HAFRADUWLATRE ANOCCDEIURDRR?OR WISk DO REQUEST STATUSANCDOMMAND DECODE ERROR END Figure 3-8 Controller Operational Flowchart 2223216-20 TECHNICAF REFERENCE " HARDHARE OPTIONS 3.6.6 Detailed Descrifiiibn of Commands The commands fall into eight classes -- 0 through classes O and 7 are used. Classes i through 6 are commands are data, non-data transfer, and status commands perform diagnostics. 7; however, only reserved. commands. Class O Class 7 Each command description are shown as is described in the following includes class, opcode, and "unused." paragraphs. The command format. "Don't care" bits 3.6.6.1 TEST DRIVE READY Command. This command selects a particular drive and verifies that the drive is ready. The following diagram shows the format of the device control block for this command: B Y R e| 7 e et 6 | Bit Number--------ec~-eecmcccceca + S | 4 | 3 |2 b1 | o | O'-V-O======0======0======Q======0======0======0======0======0 | o o Pomm e | o |o ] o I o ] o I o I o - -------- m----------m m---------- tm---------- ----------- m-------- m---------- + IRl o 0 | DRIVE|unused|unusedjunusedfunused|unused]| e mm---------- m--mm------ mmm------ m------------ e ---------- m---------- e ------ rm-------- + | 2 junusedfunused|unusedjunusedjunusedjunusedjunused|/unused]j tmmmb mm----= tm---------- ------------ b e = pmm----- e -------- +* | 3 |unusedfunused|unused|unusedjunusedfunused|unused|unused| P - om - tmm-------- $------------ - b rm---------- + | 4 junusedfunused|unusedfunused|unusedjunused|unusediunused]j b mm b ---------- b ---------- - mm-------- ------------ m------------ - o -------- + { § |unused|unusedjunused|{unusedjunusedfunusedjunusedfunused| mmmb--m---- == tmm-------- rm---- - - r------------ m------------ - R + To determine that a drive has completed seeking before issuing the next command, use the TEST DRIVE READY command with overlapped seeks. (Refer to the paragraph entitled "SEEK Command" in this section.) If the drive is still seeking, the end-of-command status byte indicates an error, and the sense status indicates "drive still seeking." This is a type O error, code 8. Sequential TEST DRIVE READY commands determine when the drive is ready to accept another command. TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.8.2 RECALIBRATE read/write (R/W) arm are as follows:- DRIVE Mommand. at tratk 000. Bit This command 'pléces the definitions for this command YB b e e BIT NUMBER=------c-coeooomoceoo . t 7 |} Bit 6| Bit 5| Bit 4| Bit 3| Bit 2| Bit 1] Bit o Q--e--0-======Q======0======0======0======0======Q======Q=====30 o | o | o Pmm--pm--m------ P | o i o o --.------- R | o i o i o i1 § Pmm-------- o --------- b -------- o -------- + f 1| o | 0 | DRIVE|unusedjunused|unused|unusedjunused] b = Fmm---------- tm--mmeaa m--------a o ---- e tmmw----e temmee o + } 2 |unusedfunusedfunusedjunusedjunusedfunusedfunused|unused] boemmmm-- L rmm--mae b D Fmmm-------- t--------ea Pm---------- +* } 3 lunusedjunusedfunused|unusedjunusedjunusedjunusedjunused] e m e tm----e--e bm---------- e m---- - tm------ - t---------- o ---- - + | 4 |unused|unused|unusedjunused|unusedjunusedjunusedjunused} tm--m e m e | 5 |RETRY?{ o tmmm mmm rem-------- L m-------- - rm------------ + | o | 0 [STEP 3|STEP 2|STEP 1|STEP 0} e~ Pm--------- e ---------- mrmmm--- P ------- P ------ - Pmcmm---- o m--- +* 3.6.6.3 command returns these follow. REQUEST SENSE STATUS Command. The computer sends. this immediately after it detects an error. The controller then 4 bytes of drive and the controller status. The formats for 4 Dbytes are shown after the DCB. Definitions of these bytes B < Y 4o t 7 mmm e | Bit 6] Bit S| BIT Bit 4}NUMBBitER-3~|~--B-it---2-|= e Bit 1] Bit . 0} 0--e--0======0'======#==`====0======'======0~======Q======`======Q ] o| o | e ------ o |o ] o i o | o I 1 o1 i - - rm---------- o m------ m--mmm- m------------ rm-------- rm---------- + f 1 o | 0 | DRIVE|unusediunusedjunusedjunused|unused| R e - tmm-------- P ------ Fmmm - ---------- o -------- P * | 2 junusedjunusedjunused|unusedfunused|unused|unused|unusedj e m b m---------- bm---------- tmm-------- o -------- mm-------- tm------------ e ------ m---------- + f 3 junused|unusedfunused|unusedjunused|unused|unused|unused]| tmmmb e ------ Fm---------- o ------ tmmmmme remm-- o m-------- o -- torm-------- + | 4 {unused|unusedjunusedjunused|unused|unused|unused|unusedj} Pm b m- o b b Pmmm------ tmm-- - ------------ o ---- +* | S |lunused|unusedjunused{unusedfunused|unused|junused|unused]| R e tom e --m---- Fmmme- Pmm-------- e -------- tmmm------ tmmmm- + Bit 7, the address valid bit in the error code byte, is relevant only vhen the previous command required a logical block address. In this case, it is always returned as a 1; otherwise, it is set to 0. For instance, assume that a RECALIBRATE command is followed immediately by a REQUEST SENSE STATUS command. The address valid bit could be returned as 0 because the command does not require a 1logical block address to be passed in its DCB. TECHNICAL REFERENCE HARDHWARE OPTIONS The format for the sense bytes returned is as follows: B yty 7 | e § S | 4 § 3 § 2 { 1+ 4 o e o NOTE: Refer to paragraph 3.6.1.6. Hhen an error occurs on a multiple-sector data transfer (read or write), the REQUEST SENSE STATUS command returns the logical address of the failing sector in bytes 1, 2, and 3. If the REQUEST SENSE STATUS command is issued after any of the format commands or the CHECK TRACK FORMAT command, and if no error exists, the logical address returned by the controller points to one sector beyond ' the last track formatted or checked. If an error does exist, the logical address returned points to the track in error. Table 3-21i, Table 3- 22, and Table 3-23 list the types 0, 1, 2, and 3 error codes. Table 3-24 summarizes the error codes returned by the REQUEST SENSE STATUS command. " < Code OH 1H 2H 3H 4H SH 6H Table 3-21 Type O Error Codes, Hinchester Disk Definition The controller detected no error of the previous operation. during the execution The controller did not detect an index signral from the drive. The controller did the drive after not get a SEEK COMPLETE seek operation. signal from The controller detected last operation. a write fault from drive during After the controller selected the drive, not respond with READY signal. the drive did Not used. After stepping maximum number of cylinders, controller did not receive track 00 signal from the drive. TECHNICAL REFERENCE HARDWARE OPTIONS Hex Code OH 1H 2H 3H 4H SH 6H 7H B8H SH AH Table 3-22 Type 1 Error Codes, Controller Board Message ID Read Error Data Error Address Mark Not used. Sector Not Found Seek Error Not used. Not used. Correctable Data Error Bad Track Format Error Definition The controller detected an ECC error in the target ID field on the disk. The controller detected ECC error in the target during a read operation. an uncorrectable sector The controller did not detect the target address mark (AM) on the disk. The controller found the correct cylinder and head, but not the target sector. The controller detected an incorrect cylinder or track, or both. The controller detected a correctable ECC error in the target data field. The controller detected the bad flag during the last operation. track During a CHECK TRACK FORMAT command, the controller detected one of the following: * Track not formatted * HWrong interleave * ID ECC error on at least one sector 3-47 TECHNICAL REFERENCE HARDWARE OPTIONS Table 3-23 Types 2 and 3 Error Codes, Command and Miscellaneous Code OH 1H OH Type Message Invalid Command tllegal Address Disk RAM Error iH Program Memory Checksum Error 2H ECC Polynominal Error Definition The controller received an invalid command from the host. The controller detected an address beyond the maximum range. The controller detected a data error during the RAM sector buffer diagnostic. During its internal diagnostics, the controller detected a program memory checksum error. During the controller''s internal diagnostics, the hardware ECC generator failed its test. TECHNICAL REFERENCE HARDWARE OPTIONS Error Code Table 3-24 Meaning Error Code Summary Illegal (direct) access to an alternate track. TECHNICAL REFERENCE HARDWARE OPTIONS Error Code 1DH 1EH 1FH Table 3-24 Error Code Summary Meaning (Concluded) f"._ X4t,', On a FORMAT ALTERNATE TRACK command, the track is already assigned or is flagged as a bad track. When the controller attempted to access an alternate track from a spared track, the alternate track was not flagged as an alternate. On a FORMAT ALTERNATE TRACK command, the bad track equaled the alternate track. Note: The Address Valid bit (bit ?) may or may not be set and is not included here. = TECHNICAL REFERENCE HARDWARE OPTIONS f!%.s.c FORMAT DRIVE Command. This command uses the selected -interleave factor to format all `sectors having ID and data fields, and writes 6CH into data fields. -The controller formats from the starting address, which is passed in the command, to the end of the disk. Setting FORMAT pattern bit S (from control byte DRIVE command causes the written on the disk data S of the command block) with sector buffer to be used as the fields. the data To initialize the sector buffer, command before the FORMAT DRIVE follows: issue the WRITE SECTOR command. Byte definitions BUFFER are as Notes: ¥ Refer to paragraph 3.6.1.6. 24 Factor is number of sectors per track minus one. TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.6.5 on the does not CHECK TRACK FORMAT Command. This command checks the format specified track for correct ID and interleave. The command read the data field. The byte configuration is as follows: B Y atam S e S RS TIT +-B I T t] 7 | 6 | S t NUMDBER 4 | 3 -4------- o } 2 § -------- tm--m-------- * 1 | o 030-=======§=======Q=======0~=======0=======+=======0=======#=======Q' lof o - I o | o bmmmem---- - } o | o ------------ - ] 1 | o | i { e m------------ m---------- Fmmmmm == +- t1) o § o |DRIVE | HIGH ADDRESS (See note 1)/} - ---------- bm--em------ em e e mm---- mm--mm- e ------ o m------ - + |2} MIDDLE ADDRESS (See note 1) } tmb - tme m rm-- e ---- tm--mmm---- mm mm---------- b-- - m----------- + 13} b mmmm= 141 o mmmm------ | o b m - L |S| RETRY?) o b -------------- P m--------- LOK ADDRESS (See note 1) rm-------------- mmme------ e m------ Pm - | o i INTERLEAVE FACTOR b m - - m----m.---- Am-------------- m-------------- § 0 { o | STEP 3] STEP 2| e ---- m----m-------- R o ------------ § ------------ -------------- + (See note 2) mm---------- trmm-------- * STEP 1| STEP 0| -------------- m------------ + Notes: 1. Refer to paragraph 3.6.1.6. 2. Factor is number of sectors per track minus one. s TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.6.6 FORMAT TRACK Command. The FORMAT TRACK command reformats the track, eliminating all references to bad and alternate tracks. Setting bit S from control byte S of the command block causes the sector buffer to be used as the data pattern in the data fields. Otherwise, the command writes 6CH in the data fields. The byte definitions are as follows: 141 0 | o } o } INTERLEAVE FACTOR (See note 2) | L e -------- e {s] RETRY?| o | o - - --------- P ---------- e ---- - P + ] o | STEP 3| STEP 2| STEP 1] STEP 0] P Notes: ------ - P ------ P --------- b -------- Cmm .- b m-------------- P ---------- - +* 1. Refer to paragraph 3.6.1.6. 2. Factor is number of sectors per track minus one. TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.6.7 FORMAT BAB TRACK Command. This track, setting the bad sector flag in the are written. The byte definitions are as command fdrmats a specified ID fields. No data fields follows: B VRt el Bl GoooEccts +-B I T NREUNMEBNERRES S So st e SESS e + t 7 |6 |s }4 !3 |2!1 }o | e P jol P 11} T S S L S+ S S I T S C R e R IT I S d T T o Jo ]o ! ---------- P -------- Fmmm-------- b o { o |DRIVE | T T S R A S S ST S S S 4SS S S S SS 4SS S S E SR 4SS SR EEE S o !o )1 !1 )1 } -------- o m------ Fmmmmmm--== m---------- e mm - + HIGH ADDRESS (See note 1) | e 12) e ------------ e rm e ------ b= -------- mm = MIDDLE ADDRESS (See note 1) e mm-------- P-- - - +* | mbmmmm === tmmm - *------------ - e mm--- - .- e 134 LOW ADDRESS (See note 1) - -------- + | et m e -- - e m - P ---------- m------------ mmmm - tmmmm-- Pmm--m-------- T +* ja] o | o | [} | INTERLEAVE FACTOR (See note 2) | P -------------- P ---------- e - P P e ----- T ------ + |5} RETRY?{ o | o { 0 { STEP 3} STEP 2| STEP 1} STEP O} e m e ---- - mmmm-- tmmm-------- m------------ e e - P mm - P ---------- + NOTES : 1. Refer to paragraph 3.6.1.6. 2. Factor is number of sectors per track minus one. TECHNICAL REFERENCE HARDWARE OPTIONS 3.86.6.8 READ Command. Starting this command, the controller reads a The byte definitions are as follows: with the sector address specified number of given in sectors. Notes: 1. Refer to paragraph 3.6.1.6. 2. If this bit is set in the READ command and an ECC error is found, retry the command. 3.6.6.9 HRITE Command. This command writes the sectors, starting with the initial sector address DCB. Byte definitions are as follows: specified number of contained in the ) S |S| RETRY?| o J 0 1 o | STEP 3| STEP 2| STEP 1} STEP 0| Note: Refer to paragraph 3.6.1.6. TECHNICAL REFERENCE e b ; HARDHARE OPTIONS » 3.5.6.10.',SEEK Command. This command initiates a seeklto the track " specifieidn the DCB. The drive must be formatted. The byte definitions are as follows: Note: Refer HUMBER -+4------~ e tm------------ . | 3 i 2 } 1 | o e mccma T USR SSISRII S S LIS | 1 | o | 1 i 1 om - e mr e -- - rm---------- e m------- + HIGH ADDRESS (See note)] P tm----m------ tmm---------- = S T + MIDDLE ADDRESS (See note) i P -- e~ ------ o ------------ e m-------- Fmm---------- + LOW ADDRESS (See note) | S --------- mm--m-- Fmmmm = mmm= ---- + | P -------- tm--m--m------ tmmm----- mmm------ + | STEP 3| STEP 2| STEP 1| STEP 0| mm---------- o o ---------- mm--m-- + to paragraph 3.6.1.6. For drives using buffered seeks, SEEK commands can be overlapped. After the controller issues a SEEK to the drive, it does not wait for the drive to complete the SEEK, but returns a completion status. If the return status shows no error, then the SEEK was issued correctly. If there is an error, then the SEEK was not fssued. After transferring the status, another command `can be issued to either drive. If a drive with an outstanding SEEK receives a new command, the controller waits (holding BUSY active) until the SEEK completes before executing the new command. (See the section entitled "TEST DRIVE READY Command" for a special case.) There is no time-out condition in the controller waiting for the buffered-step SEEK to complete. TECHNICAL REFERENCE . . HARDWARE OPTIONS 3.§.6.11 INITIALIZE DRIVE CHARACTERISTICS Command. This command 'enables the controller to work with drives thfi} have different capacities and characteristics. However, both Winchéster drives must " be of the same manufacturer and model number. b After the computer sends the command (pcB) to the controller, it sends an B-byte block of data containing the drive parameters. Some of the parameters occupy 2 bytes; all 2-byte parameters are transferred are: with the most significant byte (MSB) first. The 8 bytes 9T mAa o o Maximum Maximum Maximum Starting Starting number of cylinders (2 bytes) ECC data burst length (1 byte) number of heads (1 byte) write precompensation cylinder reduced write current cylinder (2 bytes) (2 bytes) When the controller values are set: is powered up or reset, the following default Maximum Maximum Maximum Starting Starting number of cylinders (C)= 153 ECC data burst length (E)= 11 bits number of heads (H)= 4 write precompensation cylinder (P)=64 reduced write current cylinder (W)= 129 The parameter for the maximum ECC burst length defifes the length of a burst error in the data field that the controller is`to correct. The burst length is defined as the number of bits from the first error bit to the last error bit. For example, if the controlier detects a S-bit ECC error and the erroneous data appears (before correction) as S (1100 0101), it could appear as D4 (1101 0100) after the correction. However, if the CPU has set the maximum ECC burst length at 4 Dbits, the controller might flag this data as uncorrectable. This is a type i1, code 1 error. TECHNI CAL REFERENCE - WARDWARE OPTIONS : - 9 ' £ `Byte d efinitions for the INITIALIZE DRIVE CHARACTERISTICS command are as fol lows: . i 7 | Bit 6| Bit S| Bit 4] Bit 3] Bit 2§ Bit 1} Bit 0| Byte d efinitions for the drive parameter Dbytes {passed to the contro ller after the INITIALIZE DRIVE CHARACTERISTICS command has been i ssued) are as follows: ------- +--===m=-+=-B I T 7 } 6 } S i NS URMEBRENRE - & 4 i 3 | + ee = - 2 | e S oS oo s s = -- 1 | o § EEE SSE 4 SS SSE 4 TS I TS 4 S S TS S S 4SS IR ST SIS SRS S SASNIRISSS SIS SRS MAXIMUM NUMBER OF CYLINDERS: MSB i ------- e ee e, m el r e e e- ee o ------ MAXIMUM NUMBER OF CYLINDERS: LSB ------- ee m e et mm e e c e dec e mc e b e m e m f - o | 0o i ] | o | MAXIMUM NUMBER OF HEADS | ------- e m e ee e mmmm e m e m e dmmcm b m-------- b m e b STARTING REDUCED WRITE CURRENT -------------- e m e, --c e e --, e, e b CYLINDER: --, e b e rm----, MSB i e ---- ------ b ----------- STARTING REDUCED WRITE CURRENT CYLINDER: LSB ------- e m---- e, e, b e, m b e m, e ----m b, --,-- ---- b ------ STARTING HRITE PRECOMPENSATION CYLINDER: Msa ------- W = e e e i - ---------- § STARTING HRITE PRECOMPENSATION CYLINDER: LsSB ------- e et e r ee b m e --c b -- i e ---------- o ] o ------- o m f 0 i e e b 0 | MAXIMUM ECC DATA BURST LENGTH | -- b e e e r ---- fm e r b ---- - - ---- TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.6.12 READ ECC transfers 1 byte to burst length that command. This byte type 1, code B. Byte BURST ERROR LENGTH Command. the CPU. This byte contains the the controller detected during is valid only after a correctable definitions are as follows: This command value of the EcCC the last READ ECC data error, e e 6] Bit S| BiBtIT 4]NUMBiBtER=3-| -=Bcict--c2]omeBiotocc1o| mmBointn. . 0| S+=Z=SaTTe=e =S I===S T 4 Fmm et m e - ----------a e m------ tm--mm-- L Pm--m e e ---- re-------- + P m e bmm P mm - tem--m - - Pem e tmmm e r------me * be | mm4 mb]m unmm uese --edlb P unumems--em--detjtuo--nm--mmum--s----e----dlm P umn--u-- semmd-- ]rL u--n--u--sm--e--dlP o unumsme----d--lut tmnmmu-- ms--m--em --d--lurnmmu--m--s----e----d----l + + e m e ---- - b----em-- e mm--- t------mm-- e ---- r------m---- m--mmm---- Po--mm- + TECHNICAL REFERENCE e > . HARDWARE OPTIONS 3.6.6.13 =FORMAT ALTERNATE TRACK Command. The FORMAT ALTERNATE TRACK command formats the header fields of the "bad track" with the. alternate track information (assigned by the CPU). The alternate,. track is formatted to identify it as an alternate. The command byte definitions for FORMAT ALTERNATE TRACK are as follows: IS} RETRY?| 0 f(Note 3) 0 | STEP 3| STEP 2| STEP 1| STEP 0} Notes: 1. Refer to paragraph 3.6.1.6. 2. Factor is number of sectors per track minus one. - 3. If this bit is set, the data in the existing sector buffer is used to fill the data field. If this bit is cleared, the data field is written with 6CH. - The interleave command, and is byte (S) is set, the data field. byte (4) is programmed the same as in the FORMAT used on the alternate track. If bit S of the control the data in the existing sector buffer is written to If not, the data field is written with 6CH. After issuing the Alternate Address assigned alternate ignored. command, data logical the controller block. These 3 address. Again asks for the Assigned bytes point to the CPU- the sector address is TECHNICAL REFERENCE . HARDWARE OPTIONS The byte definitions are as follows: ' for the Assigned b Alf!}nate Address Data Block > Note: Refer to paragraph 3.6.1.6. 3.6.7 Alternate Track Assignment The computer both assigns alternate tracks and locks out bad tracks. Bad areas on the disk are labeled defective on a track basis by issuing a FORMAT BAD TRACK command (command code 07). One procedure for assignment and handling of alternate tracks is given below. 1. Give the FORMAT DISK command (command code 04). formats the entire disk drive starting at logical 00, This track a. If any errors occur, give the command . REQUEST SENSE STATUS b. If a format error is indicated, bytes 1, 2, and 3 of the returned status give the address of the bad track. . Give a FORMAT BAD TRACK command (command code 07) to the track. d. Reissue the FORMAT DISK command. e. If any other errors occur during the subsequent formatting, reissue the REQUEST SENSE STATUS, FORMAT BAD TRACK, and FORMAT DISK commands until the entire disk is formatted. 2. Give the RECALIBRATE command (command code 01) to the heads over track 000. position All sectors on the disk errors occurred in the data. are read to see if any uncorrectable ECC The FORMAT command places a 6CH pattern in the data fields of all sectors, and the computer program can verify this data pattern after the data is read into memory . However, verifying the data byte for byte is not usually necessary, because the error detection and correction circuitry flags all TECHNICAL REFERENCE HARDWARE OPTIONS ' uncorrectable errors. multiple sector reads e £ If a la;gé block of host memory is can be issued to speed up the verify o available, process,. When an wuncorrectable error is found, issuing a FORMAT BAD TRACK command (command code 07) to the failing track writes a bad track flag into all identifier fields. Later accessing of this track results in an error, causing the sense status that follows to show an error code 15H. NOTE WHhenever a user program accesses the disk, be sure that the operating system does not allow the program to issue a READ or WRITE command to the alternate tracks. The disk controller has no way of knowing when an alternate track is being read. The alternate tracks are sometimes assigned at the end of the disk (highest track numbers), but they can be assigned to any tracks so long as the track label is maintained by the computer. Given the error correction capability of the controller, four tracks reserved as alternates should be adequate for all disk drives currently available. However, the system programmer should consult the disk drive manual for the hard-defect specifications. 3.6.8 Alternate Address Protocol s After receiving the FORMAT ALTERNATE TRACK command and the assigned alternate, the controller performs the following steps: 1. Seeks to the "alternate assigned track" and verifies that it is not already an assigned alternate or a flagged bad track. NOTE If the track has already been assigned as an alternate or is flagged "bad", then error code 1DH is given and the command is aborted. This usually implies that the computer is attempting to assign two bad tracks to the same alternate track. 2., Formats the track as an assigned alternate track. 3. Seeks to the bad track and formats the header as a spare TECHNICAL REFERENCE E . » o . v track pointing to the assigned altq;nate. 4. Destroys - data fields on both the bad-»'track track. : HARDWARE OPTIONS and alternate The procedure follows: for wusing the FORMAT ALTERNATE TRACK command is as 1. Format the entire disk, including spare tracks. 2. Verify the disk. 3. Assign each media defect an alternate track. 4. Assign alternate tracks list. for drive manufacturer's defect The wvhen controller automatically seeks an access is made to a flagged to the assigned alternate track defective track. Consecutive accessing controller does not result in reseeking to the alternate maintains position on the alternate track. track. The NOTE When using the FORMAT ALTERNATE TRACK command, be sure to < include (in the controller initialization) cylinder and head ranges for the alternate tracks. 7 Generally, the actual disk space is greater the system software. This extra space tracks as needed. The alternate tracks are than the amount fixed by can be used for alternate invisible to the host. The number of spare tracks depends on the drive of defects allowed by the drive manufacturer. track is allotted for each S0 to 100 tracks. size and the number Generally, one spare Direct access track results (attempted data transfers or seeks) in an error code 1CH, and no transfer to an alternate takes place. TECHNICAL REFERENCE HARDWARE OPTIONS _,,_.,_. > s M 3.6.9 HWRITE SECTOR BUFFER Command - This command pattern. No The command buffer. The is used to f£fill the sector buffer with a host-given data data is transfered between the drive and the controller. accepts S12 bytes of data and stores them in the sector byte definitions are as follows: Ao 6] Bit S| BiBtIT 4|NUMBiBtER-3-| -=B-i=t=---2§==mBoit=-=1~{ =--B--i--to--© + 3.6.10 READ SECTOR BUFFER Command This command sends 512 bytes of data from the CPU. The byte definitions are as follows: ~ sector buffer 0 to the 8 y t e +| emm7mmm|mmBmitmmm6]mmBmimt mmSe|ooo BIT Bit 4]NUMBBitER-3-§--=Bi--t=--2=| -=-Bi--t------1|=meBoiot----0}+ v o TECHNICAL REFERENCE HARDHARE OPTIONS . - 20 3.6.11 RAM DIAGNOSTICS Command This command performs a data pattern test on the RAM buffer. The byte definitions are as follows: B Y t +omcm e v o e Bit e e S| BIT Bit NUMBER-~=-------c-meccace--ao 4| Bit 3| Bit 2| Bit 1| Bit 0| + (i 3.6.12 DRIVE DIAGNOSTICS Command * B This command tests both the drive and the`~ drive-to-controller interface. The controller sends RECALIBRATE and SEEK commands to the selected drive and verifies sector 0 of all the tracks on the disk. The controller does not perform any write operations during the command; it assumes the disk has been previously formatted. The byte definitions for the command are as follows: B y P 4 mrmmmcec e ee BIT NUMBER--~--~----=-- s * e | 7 | Bit 6| Bit S| Bit 4) Bit 3} Bit 2§ Bit 1] Bit of 0--v--`-======fi-======0======§======§======§======0'======0`======0 | o | 1} LIRSl B 1 e m b -- oo b D | o | o j o ] £ 13 2 | Fm------ tommm-- mme e tommmm m--m - + TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.13 CONTROLLER INTERNAL DIAGNOSTICS Command This command causes the controller to perform a controller checks its internal processor, data circuitry, and the checksum of the program memory. does not access the disk drive. The byte definitions self-test. The buffers, ECC The controller are as follows: o mmm7 o | Bit o 6§ Bit S| BiBtIT 4]NUMBiBtER-3-| ==B-i-t=-2-|--cBi-t-om1o| --oBoimtooO}* 3.6.14 READ LONG Command i, This command transfers the target sector and 4 bytes of data ECC to the CPU. If an ECC error occurs during the read, the controller does not attempt to correct the data field. This command is useful for recovering data from a sector with an uncorrectable ECC error and for diagnostic operations. The byte definitions are as follows: B Yt S Commoona +-B I T NUMBER -+------- Soooooo) Sl + t] 7 } 6 | s | 4 § 3 § 2 | 1 f o § + B+ S S S S S E S+ I ST T 104 1 ) 1 b= |2 o e ---------- | c b --= o ---------- eSE S SS ] 1 r-------------- |DRIVE L 4 S S E S T E S+ S S ESS TS 4SS SESSS4ASSSSSRSEISSSSSS | 0 | o l 1 i o j 1 R e Y e e ------ - o m------ + | HIGH ADDRESS (See note)| e -- - ---- o ------ e e e + j214 MIDDLE ADDRESS (See note) | b -- -- m------------ e ------ mm---------- Pm--m-------- e ---------- o ---------- e ------ + 13) LOW ADDRESS (See note) | P 14} ---------- e b ---------- *mmm-------- e BLOCK COUNT ---- m------------ mmmmm= b m-------- + (See note) ot -- = m---- e e -------- e -------- mmm-------- - - - e + |S| RETRY?{ c § 0 | o | STEP 3} STEP 2} STEP 1| STEP 0} e R -------- e -------- rm------------ b mmm - m--------------- o e + Note: Refer to paragraph 3.6.1.6. TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.15 WRITE LONG Command This command transfers a sector to the disk drive. During supplies the 4 ECC bytes instead bytes. This command is useful byte definitions are as follows: of data and four appended ECC Dbytes this write operation, the computer of using the hardware-generated EgCC only for diagnostic operations. The Note: Refer T NUMBER -+------- S SESS + | 4 | 3 | 2 I 1 | o | ===0=:=====0=======0=======O=======0=======0 | o | o ------- Pt et e -- |{DRIVE | | 1 | i | o | b mm--rrm e m b e e b e m----------¢ HIGH ADDRESS (see Note)] ------- e Mt e e me e meb e mr--r -- e ------ MIDDLE ADDRESS (see Note)} ------- P e e pee e e, e b r e m---- e b e ---- e ---- g LOW ADDRESS (see Note)| ------- P r et et e et e rbe e e -- e ------g BLOCK COUNT } ------- P e et eee e r e e mr e et e ------ § 0 | STEP 3| STEP 2| STEP i} STEP 0} ------- e e e e e to paragraph 3.6.1.6. bt r e bt -- e --------d a &4 TECHNICAL REFERENCE HARDHWARE OPTIONS 3.6.16 Execution Order of Remaining Diagnostics Kot all of the diagnostics are executed The remaining diagnostics should be following order. by the computer on powver-up. <called by the CPU in the 1. CONTROLLER INTERNAL DIAGNOSTICS (command code E4). This command tests all the logical and decision-making capabilities of the controller, the program memory checksum, and the error detection and correction circuits (ECC). Executing this diagnostic ensures that the controller can communicate with the computer. 2. RAM DIAGNOSTICS {(command code EO0O). This command verifies that the sector buffer is operational by writing, reading, and verifying various data patterns to and from all locations. 3. INITIALIZE DRIVE CHARACTERISTICS (command code O0C). This command sends the new drive configuration to the controller when the parameters of the connected drives differ from the defaults. The INITIALIZE DRIVE CHARACTERISTICS command must be igssued before executing the DRIVE DIAGNOSTIC command. 4. TEST DRIVE READY (command code 00). This command, issued before the DRIVE DIAGNOSTIC is executed, finds out when the drive is ready to accept a command. S. DRIVE DIAGNOSTIC (command code E3). This command issues a RECALIBRATE to the disk drive and then steps though all tracks, verifying the ECC on the identifier fields of the first sector of each track. If this diagnostic passes, it implies that the disk has been formatted and that the first ID field of each track is good. 3.6.17 Error Correction Philosophy The typical error-correction time of the controller is approximately S0 ms, which is greater than the time for one revolution of the disk. The sector in error can be reread (if bit 6 is not set in byte S of the READ command DCB) on the next revolution during a READ command. In most cases, the error is soft and does not reappear on the reread. This initial reread of the failing sector is in addition to the retry count passed in the DCB (bit 7, byte 5),. The controller presets the error retry count to 4 each time a sector is read succegsfully. Sometimes, an error labeled uncorrectable is later found to be correctable. If this happens during a multiple- sector transfer, the controller resets the retry count to 4 Dbefore another sector is read. TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.18 Sector Field Table 3-25 describes Description the sector information fields. Table 3-2S5 Sector Field Format Field AM GAP1L SYNC GAP2 coM CYLH CYLL HEAD SEC FLAG ZER ECC GAP3 SYNC2 GAP4 DATA ECC2 GAPS £WE -nANNM -OAKMMEELEBENEO Kumber of Bytes A Field Description Address mark Zero byte gap ID sync byte ID zero byte gap ID compare byte Cylinder high (MsB) Cylinder low (LSB) Head number Sector number Flag byte Zero byte ID ECC bytes Zero byte gap 5 Data field sync byte Data field zero byte gap Data field -~ Data field ECC bytes Inter-record zero gap Notes: 1., Cylinder (track) numbering is O-based. 2. Sector numbering is i-based. 3. Disk surface numbering is O-based The track layout for the Si12 bytes/sector, 17 sectors/track is given in Table 3-26. TECHNICAL REFERENCE e», HARDWARE OPTIONS - Table 3-26 S12-Bytes-Per-Sector Format BYTE MSB LSB dmmmemmmeeeem BIT NUMBER--~-=we-wmcomacoooo--o + T Z0 6 S S T SR AR | 3 | S 2 S e L | JE R0 EEEEEEREE 1-4 -------- s-13 -------- A R EEE A R R AR R | ADDRESS et e e, e r e e b e §o {o |o | e m e, e, et 22 A MARK b o } b s R RS e e e b e ------ b e o }o {o e e be b me RSEE TR EY | -- == §o | m b m-- == 4 14 i -------- b m 1s-16 | © ID SYNC BYTE | e e e e ee e bree {4 o } o }j o b e m e mm------fmmmm e -- === & | o J o } o |} o | -------- P e e m e b e e r e b m e -- b m e -- b m---- ==} 17 | -------- P m e ID COMPARE BYTE --mr e b e mr e b rr e e b e e e b i cc e b m e -- e -- = -------- i8 § -------- e e CYLINDER NUMBER ( MSB ) { e e e ee e e, m e m e -- b m e m b m-------- i85 § -------- P 20 | -------- m vm b et m CYLINDER NUMBER ( LSB ) m e b HEAD NUMBER b e mbe e r e, e mm e e m e bee ce { == ---- - | e ------ 21 -------- 22 ] e f e e, SECTOR NUMBER b, e, e e b e, b r FLAG BYTE e b e § b e -- - -------- } -------- 23 FE -------- A e e, c e, e e b e b m,r 08 | N0 SN I 0 S RO SN 8 O e e e e e e o e e ey v e e e b m e-- be -- b ---------- [R Ol .0 14 o | e m e e e o e e e ee 24-27 -------- 28-43 -------- | ID ERROR CORRECTION CODE BYTES § &-----~-¢----~----¢--------+--~------¢---------¢--------0--:--0---------+ | o | © § o |} o f o | o t o | o | Fmmmmc e m e c-- e mmm---- e m b -- b ---- === & 44 -------- 45-46 § DATA FIELD Fmm e m b e mm e |© }o mc b |o | SYNC BYTE mcm b e mmc b e m e o |} o § o m b e m e 4 © i m == & |o } ---------------- Prmmmm b e et e m b c b eme e -- b mm------ bk ---- == 4 47-558 | -------- e, et e 512 BYTES DATA e b r e, --r e b e, r e b e m e rm e b { m -- - -------- $59-562 | DATA FIELD ERROR CORRECTION CODE BYTES § -------- e et e, e r e rr e b cm e e me --- - s63-605 §j o § o | o } o | o } o | o | o | ---------------- P e e e e bt e e e et m = -------- 60S bytes/sector including ID and overhead Track Capacity = 10416 10285 +131 = 17 sectors of 605 bytes/sector = Speed tolerance gap 10416 TECHNICAL REFERENCE HARDWARE OPTIONS 3.6.19 Specifications ~ Controller Board Table 3-27 gives the Winchester controller board specifications. Table 3-27 HWinchester Controller Board Specifications Environmental Paramsters: Temperature Relative Humidity o (@ 40 F wet-bulb temperature, no condensation) Altitude Operating o o 10 C to 40 ¢ ° o (32 F to 131 F) 10% to 950% Mean sea level to 10 000 ft Storage [} o -~10 C to 60 C o o (-40 F to 167 F) 10% to 90% Mean sea level to 4S5 000 £t Power Reguirements: Voltage Range +5.0 vade 4.75 to S§.25 vdc -12.0 vde -10.8 to -13.2 vde Current 2.5 A maximum 2.0 A typical 66.0 mA maximum 48.0 mA typical 3-71 TECHNICAL REFERENCE HARDKWARE OPTIONS 3.6.20 Electrical Interface This paragraph specifies the electrical interface requirements for the S 1/4-in Winchester disk drive. All Winchester controller boards use header interchangeable with the AMP type 87215-7 for the 20-pin (to J2/P2), and type 1-87215-7 for the 34-pin connector Section S5 contains assembly drawings showing the pin-outs connectors. The connector layout is shown in Figure 3-9. assemblies connectors (to J1/P1). for these WINCHESTER CONTROLLER BOARD TAAYMSPPSEEMH8BE7LA21YD5E7R OR EQUIVALENT AMP HEADER TAYSPSEEM1B-L87Y215-7 OR EQUIVALENT RIBBON CABLE TO WINCHESTER DRIVE ATCRYMEOPPCNEENPET8CA8T3CO7L7RE-4 OR EQUIV. ATRCYMIOPBPNEBNOEN8C8T37O3R-6| 5, OR EQUIV. 20-PIN RIBBON CABLE RIBBON CABLETO WINCHESTER DRIVE oARCMEOPCNENPETCATCOLRE 88377-6 OR EQUIV. oARCMIO5BPNBNOENCTOR 883733 OR EQUIV. J WINCHESTER DISK DRIVE 34-PIN RIBBON CABLE 223216-21 Figure 3-9 Control and Data Cabling for the Winchester Disk Drive TECHNICAL REFERENCE DEVICE SERVICE ROUTINES Section 4 DEVICE SERVICE ROUTINES 4.1 ROM INTERFACE INFORMATION ahdTicnheanodivrtmsidepcwraeaftRraiOescMbeceicoltniitotiorfunynosflagoer.tmhpowaefirttoihvotihTTndeheeexsfausisttnuacsrnlyedusIiadtnnreesfdsmtoprrrumoRIimadO/netMu0tnicetotrdcssnreouvnpittcaPaeinrsondnovsfeecitsnoiosnnwrirsstoiht,netraiiulnnctssgteyyirssottfnCeeaosmmcmsiponufmugftoneetrimwrtov..arrhwyeiatrhdmwaapTfrtshohe,ere Tadcuhnsiaedesrkefoftufhulunoscpttehtireoaosarneetasivnoagsivaddmaeeisslcycarsafbituulbesneemicdntgit(ooDanOraseSn.a)yllicmisopunlsefeirlmnsiescntttasoelfdledwt.ihwetihthsyHsocttwhoeeedmever,roinpeegrattarhhtdee ilneugsssysesrteosmfmyusstwtehRmiO'cMbs,he paTTafiosnoyundipntnicertctrekairpeeloulyxtlnpaboesytcoc,eaurtthmdoiefe,anlcgtlhhauaesnseadDoienrSrisR-smwp.pIlraNafairTruytten,tceE(tanaoiifccnohctaneenacsdsromsrdaDeuejS.dpoRtad,rri)esbkyd,jueisvpnatilsccacthecerapsisuansctgsetceadihrovanuinnttcihheeqrooufopeucrigoonthduthveeteeirctnrthaeiuoenpprp.tlBi0r(cBeDa8SgvIbRieil)scne,sttdoeoifrrvtitwdysaupuraecAe.tlhHo For specific microprocessor, Manual. information read the on the architecture IAPX 88 Book or the of the Intel 8088 IAPX 86,88 User's 4.2 HWRITING SOFTWARE FOR COMPATIBILITY WITH FUTURE PRODUCTS Tserlhaoxeerfplgteeewnaasssriioevnfegit,nwvtaehrasaettnnmdeewcnatysnohuoubvleeodfrdseuisvboeeeyndlosouaprvwoiitofhdfoetridm.feustthouifrstTaewnhadiprsrTeoexdmgauouscnitiedsye.InusnwwitudlsroluuuMambaletlkhnyeietdnlslgpydipyofrcrufoheidapcunrtucgeotlesstse.cnrtesaaatnnedda 4.2.1 Compatibility Levels In order for the software to work compatibility must exist at some level, the system ROM interface level. on more level: level, than one hardware product, either the operating system or the hardware interface TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.2.1.1 Opefgring System. system level is compatible system, including products Software that interfaces at the with all products using the samé of other manufacturers. operating operating 4.2.1.2 System ROM Interface. Software that interfaces with the Texas Instruments-supplied system ROMs through the interface vectors is compatible with other hardware products having the same functional characteristics. These products can differ in physical or electrical characteristics from the standard Texas Instruments product. Programs compatible at this level or at the DOS level are more likely to be compatible with future products. 4.,2,1.3 Hardware Interface. Programs that use directly (for example, input or output to hardware least likely to be usable in another computer system. the hardware addresses) are 4.2.2 Areas of Hardware Compatidbility Texas Instruments recognizes that the system ROM interface is not sufficient for all applications. Products wusing the advanced capabilities of the hardware cannot be restricted to wusage of this interface. The following paragraphs descridbe the hardware compatibility that can be expected in future subsystems or subsystems accessed from ROM only. 4,2.2.1 Alphanumeric CRT. The alphanumeric CRT is wéfil--supported by the system ROM. Accessing the screen directly can speed processing, lets you use "windowing", and lets you use horizontal scrolling. You should restrict direct access to the alphanumeric CRT screen to the attribute latch and to address ODEOOOH, the actual memory buffer for the screen. (The "H" represents hexadecimal.) Before using the screen directly, these programs should issue a Clear Screen function call to ensure that the hardware is set up for direct access. Refer to paragraph 2.4.7 for information about the CRT hardware. Using the ROM functions to put data on the screen while accessing the screen directly can cause undesirable hardware actions. It is possible, for instance, that the screen can be hardware-scrolled, so that the logical upper left position is no longer the physical upper left position. All operations on the cursor should use the ROM interface calls. This will ensure that possible redesigning of the cursor logic does not prevent the program from running. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.2.2.2 Graphics CRT. The graphics screen is not system ROM; therefore, all graphics screen functions to the hardware. The graphics screen size is 720 by supported by the must go directly 300. To simplify modification, all routines hardware should be arranged in a modular constants should be given symbolic names. for more information. that access the graphics fashion. Hardware-specific Refer to subsection 3.5 Texas Instruments will endeavor to keep future graphics hardware fully compatible with the current hardwvare. 4.2.2.3 Disk Subsystem. The disk subsystem is fully supported in the ogystem AROM, with the exception of the -ability to format diskettes. For normal operations, direct access to any of the disk hardware should not be necessary. Upon request, Texas Instruments will supply a format routine to gqualified software vendors. 4.2.2.4 Keyboard System. The keyboard the system ROM. Direct access to necessary for normal operations. system is fully supported in the keyboard interface is not 4.2.2.5 Interrupt Controller. The interrupt controller system is used by the system ROM, but it is not supported in a fashion usable by software writers. In future products, Texas Instruments will attempt to Xkeep the same interrupt levels, usage, and hardware addresses for accessing the device. However, the constants uged to access this hardware should be symbolic to facilitate modification. 4.2.2.6 System Timers and Speaker. The system that allow other software to intercept the interrupts. The extra timer is reserved for use software products. ROMs contain vectors 2S-ms system timer by Texas Instruments The speaker access is not (or bell) necessary. is well-supported by the system ROM. Direct 4.2.2.7 Parallel Printer fully supported in the for normal operation. Port. system The parallel RONM. Direct printer port system is access is not necessary 4.2.2.8 Serial Communications. is not directly supported by compatibility, Texas Instruments hardwvare. The serial communications hardwvare the system ROM. To ensure future does not intend to change this TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.3 SYSTEM ROM INTERRUPT VECTOR USAGE The system ROM uses interrupt vector locations in the first 1K bytes of memory. These vector locations are used for hardware interrupts, as interfaces to the ROM functions, and other uses as given in Table 4-1, ROM. The vectors marked with an asterisk are actually used by the The other vector locations cause a "wild"" interrupt if vectored to, and the usual display is: "*% SYSTEM ERROR ** - 1042" To patch in replacement routines for those in the ROM, any of these vectors can be changed by the disk operating system (DOS) or by applications software. Table 4-1 gives vector usage in terms of "interrupt type," which is the number used in an INT instruction. To calculate the absolute address of the vector, multiply the interrupt type by four. For example, the keyboard print screen interrupt vector (type SEH) would be a double word at location 0:0178H {(SE x 4 = 178H). NOTE The symbol "H"" denotes a hexadecimal value. * TECHNICAL REFERENCE DEVICE SERVICE ROUTINES Table 4~1 System Interrupt Vector Usage. Yector Descri ion Re oc 01 02% 03 04 0S5-1F 20-3F 40 41 42 43% 44 4s 46% 47 % 48% 49% 4A% 4B% 4ac 4Dx* 4E% 4F % S0 Six%x S52% S3% S4% 55-56 S7% S8% S9% SAx SB* SC* SDx* SE* SF* Divide~-by-zero trap Single-step trap Non-maskable interrupt Break (single-byte) software interrupt Overflow trap (Reserved by Intel) (Reserved for MS-DOS) 8259 interrupt ¢ 8259 interrupt 1 8259 interrupt 2 8259 interrupt 3 (Timer 1) 8259 interrupt 4 8259 interrupt S 8259 interrupt 6 (Disk controller) 8259 interrupt 7 (Keyboard UART) Speaker DSR interface CRT DSR interface Keyboard DSR interface Parallel port DSR interface (Reserved for future use) Disk DSR interface Time-of~day clock DSR interface System configuration call Fatal software erfror trap Restart timing event Cancel timing event SVC interface subroutine Activate task subroutine (Reserved for future use) CRT mapping vector System timing, 25 ms (time slicing) Common interrupt exit vector (ROM) System timing, 100 ms (timing serv.) Keyboard mapping vector Keyboard program pause key vector Keyboard program break key vector Keyboard print screen vector Keyboard queueing vector IAPX 88 Book ! IAPX 88 Book ! IAPX 88 Book ! IAPX 88 Book ! IAPX 88 Book ! IAPX 88 Book ! MS~-DOS Operating System @ Component Data Catalog ! Component Data Catalog ! Component Data Catalog ! Component Data Catalog ! Component Data Catalog ! Component Data Catalog ! Component Data Catalog ! Component Data Catalog ! Section 3 !! Section 3 !! Section 3 !! Section 3 !! *k Section 3 !! Section 3 !! Section 3 ! * & keR * % * & * % *x Section 3 !! Section 3 !! Section 3 !! Section 3 !! Section 3 !! Section 3 !! Section 3 !! Section 3 !! Section 3 !! Notes: * Vector actually used by ROM. ** Texas Instruments use only - not to be changed. Texas Instruments Incorporated pubfication ! Intel Incorporated publication ! This manual TECHNICAL REFERENCE DEVICE SERVICE ROUTINES Table 4-1 System Interrupt Vector Usage (Concluded) Vector Description Reference 60* 61% 62% 63% 64% 6S5* 66% 67% 68-9F AC-DF EO-E3 System ROM DS pointer (F400:A000) DS size in bytes Factory ROM DS pointer (F400:0000) DS size in bytes Option ROM DS pointer (F400:2000) DS size in bytes Option ROM DS pointer (F400:4000) DS size in bytes Option ROM DS pointer (F400:6000) Option ROM DS size in bytes DS pointer (F400:8000) DS size in bytes Memory size in paragraphs Outstanding interrupt count Installed drive types Extra system configuration (word 1) Extra system configuration (word 2) Reserved for Texas Instruments User interrupt vectors Reserved for CP/M {tm] (180H) (182H) (184H) (186H) (188H) (18BAH) (18CH) (18EH) {190H) (152H) (194H) (196H) (198H) (word) (19AH)(byte) (19BH) (byte) Section Section Section Section Section Section Section Section Section Section Section Section Section Section Section 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! 3 !! {19CH) Section 3 !! (19EH) Section 3 ! CP/M 86 Progpammer's Guide @ E4-FF « Reserved for Texas `Instruments Notes: * Vector actually * % Texas Instruments e Texas Instruments f Intel Incoporated 1! This manual used by RONM. use only - not to be changed. Incorporated publication publication 4.3.1 Hardware Interrupt Service Routines All standard interrupt service routines (ISR) have limited internal stacks. They provide four levels (B bytes), which is the amount required by any application program or subroutine that runs with interrupts enabled. An ISR needs 8 bytes of the wuser's stack; 2 bytes to push the wuser's code segment (CS), 2 bytes for the instruction pointer (IP), 2 bytes for flags, and 2 bytes to push the data segment (DS). The ISR saves the user's stack segment and stack pointer in the RAM data area of the system ROM. The ISR then changes the stack segment and stack pointer so that they point to the internal stack of the interrupt routine. W®hen the ISR is complete, it executes a long jump to the common interrupt exit vector. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.3.2 Common Interrupt Exit Vector All ISRs (in the ROM and in Texas Instruments applications programs) use a common interrupt exit vector. The ISR executes a long jump (LONG JMP) to the routine pointed out by the common interrupt exit vector. The common interrupt exit routine restores the stack and commonly used registers, decrements the outstanding interrupt counter (INTCTR), sends the end-of-interrupt (EOI) command to the interrupt controller, and returns to the interrupted code with a return-from- interrupt instruction (IRET). A real-time operating system (0S), communication programs, uses the outstanding interrupts. Be sure to creating an ISR. such as the O0S kernel of TI INTCTR to keep track of the include the appropriate code when A sample interrupt service routine, with installation and removal instructions, is included in Appendix G. The common interrupt exit routine is contained in ROM, but an OS can patch it so that all interrupt service routines exit through the operating system. Because the interrupt structure is complex (due to interaction between the shared interrupts and the requiremenfotr a common exit point), the potential wuser should read the following paragraphs, carefully studying the examples given. 4.3.3 « Timer Interrupts * The system timer ticks every 25 ms. The ISR for this timer is located in the ROM, and it processes events such as disk motor time- outs and date/time-keeping. Software interrupts are performed at two points during this interrupt service routine, allowing access to the timing services. One interrupt occurs every count (every 25 ms), and the other occurs every four counts (100-ms intervals). UYsually, these interrupt vectors point to an IRET instruction in the ROM. The user can patch one or both of the vectors to point to his own routines. These routines are free to use the AX, BX, DI, and ES registers, but they must preserve any other registers used. The stack used is the internal stack of the .timer interrupt service routine and it is limited in depth. If the user does not re-enable interrupts (the INT instruction disabled them), there are 8 levels (16 bytes) of stack available. If the interrupts are re-enabled, the user has only four levels (8 bytes) available. If more stack size is required, the user should switch to an internal stack of the required size (allotting 8 bytes for higher priority interrupts). It is important to remember that the routines installed in this manner are executing at the interrubt level. Interrupts must not be disabled for any significant length of time, because any time spent in these routines directly affects system efficiency. The user must also understand how some other mechanism (such as a timing event in the handler routine of the OS) can patch the timing vectors ang install itz own routines. Instead of using the IRET instruction to TECHNICAL REFERENCE DEVICE SERVICE ROUTINES end the routine, make a long jump to the original (which was saved when the routine was installed.) vector address 4.4 ROM STRUCTURE The following paragraphs describe sequences for optional ROMs. the wuse, format, and calling 4.4.1 ROM Usage Optional ROMs provide an interface between the hardware and the system software. With this interface installed, modification of the hardware requires changing only the ROM software, not all of the applications programs. The system system ROM. board) for which can be defines locations for six ROMs. One of these is the Texas Instruments has reserved another (on the main future use. The four remaining are the optional ROMs, used by any of the available operating systems. Table 4-2 shows the ROM addresses and suggestions for their use. Table 4-2 ROM Addresses and Suggested Uses é. Absolute Address Cs:Offset F4000H F400:0000H F6000H F400:2000H FB80O0O0H FAOOOH FCCOOH F400:4000H F400:6000H F400:8000H FEOOOH F400:ACO00H Use Miscellaneous I1/0 option Local area network Mass storage Oopen System ROM expansion System ROM Comments Reserved for Texas Instruments Reserved for Texas Instruments Texas Instruments Winchester card Oopen Reserved Reserved for Texas for Texas Instruments Instruments 4.4.2 ROM Format The ROM format must be known to: * Identify the ROM * Use a standard calling sequence * Use the diagnostics . "TECHNICAL - REFERENCE DEVICE SERVICE ROUTINES e ROMs can be one of the following sizes: * 256 bytes . * 512 bytes * 1024 bytes L * 2048 bytes * 40896 bytes * B192 bytes The ROM size, word value is convention. in binary, stored low is stored in the first word in the ROM. The byte first, following the INTEL Corporation The second word in the option ROM is the power-up initialization address. The system ROM uses a NEAR call to this address during the power-up process, The user must ensure that the initialization address is calculated as an offset from the segment address F400. The next location ROM. The first (1 byte). This displayed. in the ROM stores a text string identifying the entry in this string is the length of the string information determines how much material is The rest of the string consists of a five-character version number, a space character, a six-character name, and any descriptive text (copyright, for example) that the vendor requires: The option ROM code and fixed data (in a format determined by the vendor) follows the text string. The last word in the ROM stores the cyclic redundancy check (CRC-16) remainder from all the previous bytes in the RONM. Both the power-up test and the advanced diagnostics test read this word to see if the ROM is working properly. The CRC-16 routine, available in the system ROM, calculates this remainder. When the CRC remainder is correctly placed, running the CRC~16 routine through the entire length of the ROM (including the CRC) results in a zero remainder. The CRC-16 routine available in the system ROM calculates the remainder. 4.4.3 Option ROM Interrupt Vector Usage The system ROM uses interrupt vector locations in the first 1K bytes of RAM for hardware interrupts, interface to the ROM functions, and other ISRs. See paragraph 4.3.1 for more information. Interrupt vectors access the option ROM entry points. The option software can use the vectors above 80H (vector address 200H). TECHNICAL REFERENCE - ¥ DEVICE SERVICE ROUTINES NOTE Conflicting chtor assignments can loss or data errors. Be extremely making these assignments. cause careful data when 4.4.4 RAM Usage by Option ROM Each ROM has a separate RAfi.data area' assigned to it. These data areas float; therefore, the ROM does not require a dedicated area in RAHM. Copying the data area and updating the pointer moves the data area. The ROM accesses these data areas using the pointers and sizes in the interrupt vector area, so that moving the data area does not affect the ROM. The ROM initializes the pointers and data areas at boot~up time, so the system ROM data area pointer is the only one used. All option ROMs are addressed at absolute segment addresses F400H, with an offset from 0000 to AOOOH. The ROM code is linked so that its code segment is F400H. This code segment was chosen so `that option ROMs can be addressed with the same code segment as the system ROM. This enables the option ROM to access the ROM powverup entry routines as NEAR instead of FAR. The first location of the system ROM, described in segment:offset notation, is F400:A090. There is another advantage to linking the ROMs . this way. The interrupt vector area at location 0000:0000 is now also accessable as F400:C000. This simplifies slightly the code sequence used to assign a local data area. 4.4.5 Initializing the Option ROM The power-up sequence executed by the main ROM tests each option ROM address in sequence. Address OF400:0000H is tested first and address OF400:8000H (the main board option ROM) is tested last. When a ROM is found, the diagnostics performs a CRC-16 calculation. The system displays an error message if the ROM is bad. If the ROM is good, the system initializes the option ROM. The initialization code saves the BX, DX. SI, SP, CS, Ss, and DS registers so that using a NEAR return instruction returns control to the system ROM. 4.5 BOOTING UP THE SYSTEM . Most system software is contained in some mass-storage system (diskette, Winchester disk, or local network server). The user must be able to find and load the system software from these devices. The Texas Instruments Professional Computer loads a single sector of program information from a known point on the specified device. The TECHNICAL REFERENCE DEVICE SERVICE ROUTINES . 't system then calls the code that was loaded, which rest of the programs. i The location loaded at available. For diskettes cylinder (track) 0, surface start at 1.) power-up is the 1lowest and Winchester disks, (side) 0, and sector 1. "bootstraps" the logical sector this location is (Sector numbers 4.5.1 Boot Sequence The options installed in the system determine the boot sequence, The sequence proceeds starts at the highest-priority option address (OGF400:0000H), to the lowest (OF400:8000H), then boots the diskette system. The boot sequence is: 1. Local Area Network (LAN) 2. Winchester disk subsystem 3. Diskette drive A 4. Diskette drive B S. Diskette drive C 6. Diskette drive D 5 « EkobPssttSeonhhyryCyoeecssetettseeskob"mmieonmwnyocohpgtevireticcsteooowlsrinnoeticttwqhffteaeaeurlyriieoa.snnmnsmEsschSoe"CvttehhseeeibEaktoteoapythcpLbtheheAoortNaohdtreusttrhiaadeinnmonsenweeagnxqcLLftrAuAitNNoerhttssneohatscevaoernaEtdiShdptCelihoataesowabkeWkWlereiiWett-ynnoittupccnhepehhc,oieehspossefttstsipeefetoriqrrentreu,hr.sese,tsndecidess,cwpFkorhrd,rieei(lessitenskhmp)eieerxmntaeegtmsdpespsir.ycliaeshenttstah,geesenlmigyneEgsIitSffhlCeoawfetEkttttreSehhhhsryeCeee 4.5.2 Loading and Calling the Boot Code apbrTcsstI(fhdyhrteyhTeetdaesmeaerctsxarstkeeaeiahsssmnnceysDcdtssbeooeeetofprcroeehs0tmIre0inbtcanGyhsoktgCetftpsi"eOesraNs:susOClsm"Ooadte.eOwdehabs)inOedvreentHserislcsteceoobeswroTas(rthbFlehesAobdctRegyiht0l)nitis,o0.tstsceka0,hysasde0slsst:aeeCdTtitmihdhhnustFeeersdhetCeeeiceHstdtcshslssoate.yoybrstnsgso,feotitosotecrenrlmamluoAliyntafactsdtohgeeedeTdcgdreneraeftxielonhbalvrreeyaassetatttrhteaeCestRasnpdtIeChdauonse-tdmws7c1abre4toa6eerHndrbrs-euoasusmontpaetteno.re(ndsrr60tit,oas0sesrg0re6e0rc91oI:oHt,fvmlCsroeeoOyrcrsa0so2(tsd0t,nhteaOeeitmacdHgm)aleo,.e.3ilds).CnesRdaCifg-sTTer5ttk1hh1.hhoa.6Iee2eetfm TECHNICAL REFERENCE i ;? DEVICE SERVICE ROUTINES which the system boots is placed in register BL. Before loading the operating required initializations such as (single or double sided, 40 or Winchester drive. {(The DSR must for further loading.) system, the boot code performs other setting up the type of floppy disk 80 track), or setting up the type of be able to recognize the disk format The boot code then loads any system files needed by the 0S and jumps to the O0S code. If the OS requires RAM where the system ROMs are using it, the RAM data areas used by the ROM can be moved. The pointers to the RAM segments must be modified accordingly. If a ROM is not using a RAM data area, its pointer is 0000. This pointer must remain zero even if the area is moved. Table 4-3 gives the addresses of these pointers. Table 4-3 Pointer addresses and Descriptions Address Pointer Description ROM Address 00600:0180 0000:0182 System System ROM data ROM data segment pointer length in bytes 0000:0184 0000:0186 Option ROM data segment pointer Option ROM data length in bytes 0000:0188 0000:018A Option ROM data segment pointer Option ROM data length in bytes 0000:018C 0000:018E Option ROM data segment pointer Option ROM data length in bytes 0000:0190 00600:0192 Option ROM data segment pointer Option ROM data length in bytes 0000:0194 0000:0196 Option ROM data segment pointer Option ROM data length in bytes F400:A000 F4oo:gooo 3 F400:2000 F400:4000 F400:6000 F400:8000 If any errors occur during the loading and initializing of the Os, the Dboot code returns to the caller. The registers BX, ES, CS, and the stack must be preserved. unless the ROM data areas The register DS must bDe preserved are moved. If the data areas are moved, adjust the DS register by the amount of difference Dbetween the original position and the new position. A DSR error code returns to the caller displayed as & system error message. This code is presented in register AH. Appendix H gives boot sector. a sample source program that could be used in the TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.5.3 Booting From an Option Device When an option device is to be booted up, it maust be the 1last one called called in and the power-up seguence. Otherwise, othér options must be initialized during the boot sequence. Appendix G contains a sample assembly code showing the boot seguence. If more than one bootable option must have the DX register set is present to OFFFFH. in the system, each The bootable option one then calls all lower priority ROMs in the system. Any ROM called in this manner performs all reguired initialization except for booting. Because the system ROM sets the DX register to 0OCO0OH when it calls the option ROMs, an option device will boot if called by the system ROM, but not if called by another ROM. If booting appropriate BX, DX, SI, options. Floppy Disk from an option device fails, error messages and returns to and DS intact. The system ROM If none of the options boot, system. the ROM displays the the caller with registers then calls the other the system ROM boots the This procedure can causgse multiple initializations of the However, no harm results, Entering the warm boot (CTRL/ALT/DEL) from the keyboard also causes initializations. options. seguence multiple 4.6 SYSTEM CONFIGURATION FUNCTION CALLS « The following paragraphs describe the types of system configuration information, function calls which are: for the two * Function calls that return the information (System Configuration Function) in a register * Function calls that return the address of the information (Extra System Configuration Function) The first type, System Configuration Function, returns most of the information required for application programs. Extra System Configuration Function, the second type, is intended for use at the system level. This method contains additional information usable for changing the configuration of devices set by software. 4.6.1 System Configuration Function This function is used to determine the installation status of certain system options. It is invoked by executing an INT 4FH instruction. Upon return, register BX contains the size of (starting at 00000H) in paragraphs (16-byte blocks). system, for example, would return 2000H in BX. «contiguous RAM A 128K-byte TECHNICAfi L REFERENCE DEVICE SERVICE ROUTINES Register AX contains the system the installation status of various word are defined in Table 4-4. configuration word, which system options. The bits reflects of the Table 4-4 System Configuration Word-Bit Definition Bit Definition ox Diskette drive 0 (internal) installed 1 Diskette drive 1 (internal) installed 2 Diskette drive 2 (external) installed 3 Diskette drive 3 (external) installed 4 E1-E2 jumper (O indicates Drive A is double-sided) S E3-E4 jumper (0 indicates Drive A has 80 tracks) 6 ES-E6 jumper (0 indicates a SO0-Hz system) 7 Winchester disk controller installed 8 Serial port 1 installed ] Serial port 2 installed 10 Serial port 3 installed 11 Serial port 4 installed 12 Graphics RAM bank A installed 13 Graphics RAM bank B installed 14 Graphics RAM bank C installed is Reserved * Bit O is the least-significant bit. Unless othetwise stated, a statement is true when its corresponding bit is a 1. < Y 4.6.2 Extra System Configuration Function This function determines the installation status of system options that are not covered in the standard system configuration call. Hhereas the standard system configuration call returns a word containing the information necessary for most applications, the extra system configuration function is used primarily for systems programming purposes. The extra system configuration function is invoked by placing a O0BH in register AH and executing an INTerrupt 48H. Upon return, register AL contains the drive-type byte (AH is undefined). BX contains extra system configuration word 1% and CX contains extra system configuration word 2. The bits of extra system configuration word 1 are defined in Table 4-5. - TECHNICAL REFERENCE : DEVICE SERVICE ROUTINES Table 4-5 Bit Extra System pefinftion Configuration Word 1 (BX) ox 8087 numeric coprocessor is installed 1 \ 2 | 3 | 4 > Reserved s | 6 i 7 / 8 300/1200 baud modem in port 1 9 300/1200 baud modem in port 2 10 300/1200 baud modem in port 3 11 300/1200 baud modem in port 4 12 300 baud modem in port 1 13 300 baud modem in port 2 14 300 baud modem in port 3 1s 300 baud modem in port 4 Bit ©0 stated, 1. is the least-significant bit, Unless a statement is true when its corresponding s otherwise bit is a Word 2 of the Extra System Configuration function call is contained in CX. This word is currently undefined, and is being reserved for later expansion. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES The drive-type byte defines the types of the installed diskette drives. This information, combined with the "installed drive" bits in the standard system configuration word, yields complete information about the drives in the system. At power-up, the drive A definition jumpers (Ei - E2 and E3 - E4) are read. The information is stored in memory as a byte of four identical, 2-bit fields. This byte is read during the extra configuration function «call and returned in register AL. The drive byte (in AL) is the 2-bit " configuration code for all four of the diskette drives, which is shown in Figure 4-1. 7 6 Drive D 5 4 Drive C 3 2 Drive B 1 0 Drive A Each 2-bit field is defined as: MSB* LSB Definition *MSB 0 0 = Single-sided 0 1 = Double-sided 1 0 = Single-sided 1 1 = Double-sided = Most significant bit; LSB = Least significant bit. . -~ 40 track 40 track 80 track 80 track zrnen Figure 4-1 Register AL Drive Byte The operating diskette files. system uses this drive byte It is possible to mix drive to format, copy, and use types in one system (for example, one single-sided and one double-sided drive) by setting the drive-type byte with the pertinent information; but, this is not recommended. Mixed-drive type systems are confusing. Users frequently insert the wrong diskettes, thereby losing data. 4.6.3 Get Pointer to System Configuration This function is invoked by placing a O09H in register AH and executing an BX contains (hereafter, interrupt 48H. on return, ES contains the offset of the standard system the notation for this is ES:BX). This the segment, configuration function is and word wused by system software that has a need information. Although an application to change the configuration program can access the information in this manner, the configuration must not be changed. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.6.4 g:t Pointer to Extra System Configuration This function 1is invoked by placing a OAH in register executing an INTerrupt 48H. On return, ES:BX points to the system configuration information, formatted as follows: AH and extra ES:[BX-3}=(word) ES:{BX+0]=(byte) ES:{BX+1]}=(word) ES:[BX+3]=(word) Size of memory in 16-byte blocks Drive-type byte Extra system configuration word 1 Extra system configuration word 2 This function is wused by system software the configuration information. Although an access the information in this manner, the changed. that has a need to change application program can configuration must not be 4.7 GENERAL-PURPOSE ROM FUNCTIONS The following paragraphs describe some summarize the ROM interface interrupts, the ROM. general-purpose functions, and explain how the RAM uses 4.7.1 Delay s This function causes a delay, in milliseconds, of the value placed in register CX. To invoke the function, place the delay value in CX, OSH in AH, and execute an INT 48H. The delay is approximate, but can be wused wherever an inexact software delay is acceptable. All registers except CX are preserved. 4.7.2 CRC Calculation This function calculates the cyclic redundancy check (CRC~16) value for a specified block of memory. It is invoked by placing the address of the memory block in ES:BX, the size of the block in BP, and the value O06H in AH, then executing an INT 48H. On return, DX contains the CRC value; if DX=0000, the Z-flag is set. For memory blocks that follow the convention of the CRC being the last word in the block, this routine allows easy CRC checking. First, the CRC of the memory block is calculated, with the size of the block set to the actual size minus two. The CRC word is then written to the last word of the block. Subsequently, the CRC of this block can be checked by calling this function with the actual size of the memory Dblock (including the previously calculated CRC). By definition, the CRC result of this block is zero (if the CRC matches the data) and the z- flag is set; otherwise, the CRC fails and the Z-flag is reset. All registers are used except DI, SI, and DS. ES remains unchanged. 4-17 TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.7.3 Print ROM Message This function displays a ROM CS-relative message. placing the offset of the zero-terminated message in and executing an INT 48H. This function is used by because all the ROMs share a common CS. It is not a routine. it is invoked by SI, 07H in AH, the option ROMs, general-purpose 4.7.4 Display System Error Code This function format: is used to display a system error in the standard *% System Error*kx - xxxXx It is invoked by placing the error displayed message above) in BX, executing an INT 4BH. code {(the xxxx value in the placing the value 08H in AH, and 4.8 SPEAKER DSR The following paragraphs describe the speaker DSR and the functions it provides to the system or application programs that use it. The functions are: ) * Sound the Speaker * Get Speaker Status TM * Set Speaker Frequency * Speaker ON * Speaker OFF The speaker DSR functions are located in the system ROM and are accessed through the software interrupt mechanism of the 8088 microprocessor. The desired function is chosen by placing an opcode in register AH and executing an INT 48H instruction. All registers are preserved except AX. 4.8.1 Sound the Speaker - AH = O This function turns the speaker on (at the current frequency) for the length of time specified in register AL. Time is measured in 2S-ms increments. For example, a value of 40 in AL causes the speaker to sound for 1 second. Timing is handled in the ROM with the result that the reguest turns on the speaker, starts the timer, and immediately returns to the user. The sound continues until timed out by the ROM code. Because this function <c¢all occurs asynchronously TECHNICAL REFERENCE DEVICE SERVICE ROUTINES with the 25-ms system timer, the time can be "off"" by as much as 25 ms. For example, specifying a single 25-ms unit of time can cause the speaker to sound for a period of 0 to 25 ms. If there is need to synchronize with the sound or simply to know when sound is turned off, use the Get Speaker Status (AH=1i) function. 4.8.2 Get Speaker Status - AH = 1 This function returns the status of the speaker in the Z-flag. If the speaker is currently enabled (sound), the Z-flag is set at 0. If the speaker is currently disabled (no sound), the Z-flag is set at 1. This function can be used to find out when a sound requested with the Sound the Speaker (AH=0) function has been completed. 4.8.3 Set Speaker Freguency =~ AH = 2 This function sets the frequency of the speaker. Usually this function is called only when the speaker is disabled. The value ir CX sets the frequency of the timer that drives the speaker. The input frequency of the timer is 1.25 MHz, and the value in CX becomes a divider for this frequency. For example, the system beep routine (800 Hz) uses a value of 1563 (1 250 000 Hz / 1563 = 800 Hz). 4.8.4 Speaker ON - AH = 3 This function enables the speaker (turns on remains on until it is turned off by either (1) the Speaker OFF (AH=4) function or s the sound). - The speaker (2) by the ROM timing routine, which results from either the Speaker (AH=0) function or a normal system beep. the Sound 4.8.5 Speaker OFF - AH = 4 This function performs the reverse of the Speaker ON (AH=3) function by disabling the speaker (turning off the sound). TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.9 TIME-OF-DAY CLOCK DSR The following paragraphs describe the time-of-day clock DSR and the functions it provides to the system or application programs that use it. The functions are: * Set the date * Set the time * Get the date and time The clock DSR consists of routines to set and read the time of day and date information kept by the timing services of the system ROM. At power-up, the time is set to 00:00:00.00, and the date is set to 0000. These can be reset by system or user programs. Once set with a valid time, the clock keeps the correct time with a 1/10-s resolution. The time is Xxept in 24-hour format and the date is simply a cumulative count of days since matter of convenience (for MS-DOS), the clock was started. As a the date is specified as the number of days since January 1, 1880. For example, the date value for September 10, 1982, is 983. The three clock functions are 1located in the system ROM and are accessed through the software interrupt mechanism `of the 8088 microprocessor. The desired function is chosen by placing an opcode in register AH and executing an INT 4EH instruction. All registers are preserved except AX and any other registers in which information is returned. 4.9.1 Set the Date =~ AH = 0O This function sets the date to the value in the BX register. The date is simply a count of days since the clock was started. 8y convention, this is the number of days since 1-1-80. The count is incremented when the hour rolls over from 23 to 00. 4.9.2 Set the Time - AH = 1 To set the time, the registers must be initialized as follows: CH = Hours (00 - 23) CL = Minutes (00 - S3) DH = Seconds (00 - S9) DL = Hundredths of seconds . (00 - 99) It is the wuser's responsibility to make sure the values passed are within the ranges specified. These values are not checked for range and can be set to represent a meaningless time. The time, however, TECHNICAL REFERENCE DEVICE SERVICE ROUTINES eventually - 4.9.3 Get counts . into the normal seguence. the Date and Time - AH = 2 This time function returns the current date in registers CX/DX in the formats in register AX and the described previously. current 4.10 CRT DSR The following paragraphs describe the CRT provides to the system or application major functions are (1) video mode handling. DSR and the programs that control and functions it use it. The (2) character For information about 2.4.7, and to subsection the system ROM and are the CRT graphics hardware, refer 3.5. The CRT DSR functions are accessed through the use of the to paragraph located in 8088 software interrupt mechanism call). A typical interface code (the (essentially an address-independent subroutine wuser of this DSR is the OS-dependent sygstem BIOS), which resides on a particular O0S disk and is loaded into RAM during disk boot up. chosen by placing an opcode in register AH. The desired function is The CRT opcodes and DpAcDfafXuaunt.rrneiacrntmegiexotenecsrrtuhestigesisattroaieennrtbeeIrNgrTipAuHvapegt4ns9,eHadndailnailnntdheTrsaepbgeptlicaheesirftaiemcress4t-pe6er.carireefgriieVesgapdtirresierotssueefsrrusvnecdCiatnRriTeonexafc`dusedneptictitts iiuoopAnn,Xsp,ertfhoCrteXroe,mgeqauuqsiaAderHn..red TECHNICAL REFERENCE DEVICE SERVICE ROUTINES Table 4-6 CRT DSR Opcodes and Functions Function (Null function) Set cursor type Set cursor position Read cursor position (Null function) (Null function) Scroll text block Scroll text block Read character and attribute at current cursor position Write character and attribute at current cursor position Write character only at current cursor position (Kull function) {Null function) (Null function) Write ASCII teletype {Null function) Write block of characters at current cursor with attribute Hrite block of characters only at current cursor Set entire screen to specified attribute(s) Clear text screen and home the cursor Clear graphics screen T Set TTY status line beginning : Set attribute latch to specified attribute(s) Read physical display begin pointer _ Print TTY string TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.10.1 Set Cursor Type - AH = OlH This function allows an application to define the scan line for the cursor and its characteristics no cursor). Required input for this function is 4-2, starting (either described and ending blinking or in Figure CH = 7 6 5 4 3 2 1 0 Byte1 Start scan line of cursor Cursor type: 00 = no blink 01 = no cursor 10 = fast blink 11 = slow blink Not used CL = 7 6 5 4 3 2 1 0 Byte2 * End scan line of cursor Bits 7 through 5 not used (Valid values for scan line are 0 through 11 decimal.) 223216-23 Figure 4-2 Byte Definition - Set Cursor Type TECHNICAL REFERENCE.: DEVICE SERVICE ROUTINES 4.10.2 Set Cursor Position - AH = O2H NOTE The user should be aware that screen coordinates use the 0,0 coordinate as the wupper left-hand corner of the display. All routines that require a coordinate parameter use this convention. The screen should look to the user as though he were working with the absolute value of fourth- guadrant coordinates of a tvo-dimensional coordinate system, This function causes the cursor (of the current type) to be set at the specified x,y (column/row) coordinate of the display. Required input for this function is as follows: DH = x Column coordinate (valid values are 0 through 79 decimal.) DL = y Row coordinate . {Valid values are 0 through 24 decimal.) + 4.10.3 Read Cursor Position - AH = O3H o This function returns the current position and type of the Output from the read cursor position routine is as follows: cursor. DH, DL = x, y f{column/row) location of the cursor CH, CL = current cursor type Refer CL. to paragraph 4.10.1 for an explanation of the values for CH and The "phantom"" position of the cursor in column Bl creates a special situation in reading the cursor postion. If a character is written in the last column of the screen by a TTY write, it can be read, even though it is not visible. This position, column 81 of the last line, becomes visible after another character is written and the screen scrolls. The position returns as column 0, rov 25. This is invalid input to the Set Cursor Position (AH=02H) routine. See paragraph 4.10.18 for additional information on the cursor. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.10.4 Scroll Text Block - AH = 06H and O7H The ROM contains only one general-purpose scroll routine, which handles both upward and coordinates are less and to the left; when the source coordinates, downward scrolling. When the destination than the source coordinates, the scroll is up the destination coordinates are greater than the scroll is down and to the right. The scrolling functions allow block of text, then move or copy the screen. Specifying a scroll an application program to specify a that block to another location on with blanking causes the source text bllsctttohlhoopheeacceanaacrkttiadbeiifceadsooitt.onneeau..drr.bclbeaeinisTnkhTTgeihhadrsienesndamdopvrmaesoeddtvthetiheosodtdeiitsonracahstaafiirsotcotraionecspmtfipmaeieoordervsnleaoodrcn.yadbittesehiesotrnrepsrDrugrueecireqwtsisuraitneiirvgeretrervteeemdnetthhmneiotasvnedsitnoaptmrhieaonitcti,iesttatsssnhsde,inlodbdecvleesteaasshcntenttrtikiiooinnlnsnaalogtituniitrhgooca,nneiitss Required input for this function is as follows: " nouwon o AL 0 (Blank out source text. This is a move block.) or AL = >0 (Don't blank source text. This is;a copy block.) (fiH,DL) (BH,BL) Source begin column/row location - = Destination begin column/row location CH Column length of block (valid values are 1 through 80 decimal.) CL = Line length of block (Valid values are 1 through 25 decimal.) The source text block boundaries in (x,y) coordinates are as follows: Upper Upper Lower Lower left right left right (DH,DL) (BH + CH , BL) (DH , DL + CL) (DH +«+ CH , DL + CL) TECHNICAL REFERENCE DEVICE SERVICE ROUTINES The following items further describe explain the segquence of operation. the scrolling routines and * A sentence is considered the smallest logical block of text. Therefore, with this scrolling capability, the wuser can specify a block to be a sentence. This may (or may not) wrap to a new line and "unwrap" as it is moved (or copied) to its destination (that is, the column length parameter would bypass line boundaries and pick up characters from the next line). The wuser should note that this is quite effective wvhen the 1line length is equal to one but might cause unwanted block movement if the line length is greater than one. * Boundary checking for the scrolling routine is done on a character basis as the characters are being moved. When a scroll down is in progress, the =croll copies the last character in the source block to the last character position in the destination block. The processing is backwvard through the Dblocks while checking character positions for out-of-bound characters. This means that in the scroll-down action, no scroll takes place if any destination position lies beyond the end of the screen. Asymmetrically, when a scroll up is in progress, the scroll copies the first character in the source block to the first character position in the destination block. The scroll proceeds forward, through the blocks, while checking character positions for out-of-bound characters. In the scroll-up action, the scroll takes place until it reaches a source character position that lies beyond the end of the screen. * When the user requests scrolling with blanking, the status of the attribute latch at entry is preserved. The character attributes follow the character as it is moved on the screen, and the blanked area is written with the default attributes (that is, high intensity for a monochrome monitor, and white for a color monitor). * HWhen the wuser requests scrolling without blanking, the attribute latch is set to the same status as the attribute of the last character that was scrolled (that is, the attribute of the first character of the source block when scrolling down, or the attribute of the 1last character of the source block vhen scrolling up). TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.10.5 Read Character/Attribute at Cursor Position ~ AH = O8H This function returns a character and its associated the current cursor position on the screen as follows. 4.10.15 for attribute values and a description of supported. attribute from See paragraph the attributes AH n Attribute value AL = Character read NOTE The attribute latch remains set to the that is returned. attribute 4.10.6 Write Character/Attribute at Cursor Position - AH = 09H This function enables the writing of a character with the given attribute at the current cursor position. (The attribute 1latch remains set to the attridbute specified in register BL.) The user can specify a count and cause the character to be writtenca given number of times starting at the cursor's current position. This function does not increment the cursor automatically, and the cursor remains at its current position while the characters are written in succession from that location. If an application uses this method of writing characters, it is assumed that the application also handles the cursor positioning. Therefore, no cursor movement is implemented. Control characters (CR,LF, and so on) are not executed as such when using this function; their symbols are printed on the display. For more information, refer to paragraph 4.10.15, The required input for this function is as follows: AL = Character to write BL = Attribute of character(s) CX = Number of times to write the character TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.10.7 MWrite Character at Cursor Position - AH = OAH This function is similar is that the character being in the attribute latch from refer to paragraph 4.10.6. to the preceding function. The difference written takes on the attributes remaining the last CRT call. For more information, The required input for this function is as follows: AL Character to write cX 1 Number of times to write the character 4.10.8 HKHrite ASCII Teletype - AH = OEH This function allows TTY output to the screen from application programs. Writing begins at the current cursor position, and the cursor is advanced automatically to its next position on the screen. For more information, refer to paragraph 4.10.18. The screen is scrolled automatically when needed (such as writing past the end of the screen). The control characters CR, LF, BS, and BEL are executed rather than written. NOTE = : If a status region is currently in use, the scroll starts one line before the beginning of the status region, exactly as if that line were the end of the screen. Because the contents of the attribute latch remain character written with this function assumes the previously written character. - unchanged, attributes each of the The required input for this function is as follows: AL = Character to write TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.10.9 Hrite Block of Characters at Cursor With Attribute - AH=10H This function writes a given block of data with a specified attribute to the screen, starting at the current cursor position. This function reqguires less screen I/0 overhead if an application program has a ""known" block of data to be written to the screen. "Known" means that the block is of a given 1length, and is in a given contiguous area of memory. As with the Write/Character Attridbute at Cursor Position function, the cursor is not automatically incremented. For more information, see paragraph 4.10.1S. The required input for this function is as follows: AL = Attribute(s) of characters * DX = Segment location of character block BX = Offset location of character block CX = Block length *x* 4.10.10 Hrite Block of Characters Only at Cursor Position - AH=s11lH This function is similar to the preceding difference that the attribute parameter is characters assume the attribute(s) remaining from the last CRT call. funqgtion, with not specified. in the attribute * the The latch The required input for this function is as follows: AL = Don't care . DX Segment location of character block BX = Offset location of character block CX = Block length *x % The attribute(s) specified is in effect for the entire block and the attribute latch remains set to the attribute specified in register AL. *x This routine "clips" any characters that do not fit on the screen, Characters are written to the end of the screen, then all other characters are lost/not written. To prevent losing characters, the user should place the cursor so that the number of character positions from the cursor to the end of the screen is greater than or equal to the block length. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.10.11 Change Screen Attribute(s) - AH = 12H This function specifies attribute(s) that affect all of the characters on the display. The attribute latch is set to the attribute specified in register AL on exit. This routine does not change the position of any characters on the screen. Two examples are blinking of the entire screen and reverse video of the entire screen. For more information, see paragraph 4.10.1S. The required input for this function is as follows: AL = Attribute(s) to use 4.10.12 C(Clear Text Screen and Home the Cursor - AH = 13H This routine clears the text screen and sends the cursor to the home position (0,0 coordinates). NOTE This function ""erases"" any data contained status region but leaves the status implementation in effect. in the region < » The required input for this function is as follows: AH = 13H (function number) 4.10.13 Clear Graphics Screen(s) - AH = 14H This function clears the graphics screen. Required input for this function is as follows: XH = 14H (function number) 4.10.14 Set TTY Status Region Beginning - AH = 1SH This function specifies a beginning line on the screen. The text from this beginning line to the end of the screen is considered the status region. This fucnction can define a status region of one or more lines. This region remains in effect until it is reset. During TTY writes, this area remains intact and everything above this line TECHNICAL REFERENCE DEVICE SERVICE ROUTINES scrolls should: 1. as necessary. '@ . . i Read and save In order A the current to write to this cursor position. area, the wuser 2. Locate the cursor within the status region. 3. Use one of the write). write character functions (not the TTY 4. Restore the cursor to its original position. Required input for this function is as follows: CH i 0 (must always be zero) cL " Start line of status region (valid values are 0 through 24.) A value of zero (0) for the start implementation. The start line must be cursor position, or no status region is line resets the a line after implemented. status region the current 4.10.15 Set Attridute(s) - AH = 1i6H This function provides an alternate method with which to control the following attribute(s). * Intensity levels 1, 2, and 3 (blue, red, and green) * Character enable/disable * Reverse/normal video * Underline * Blink * Alternate character set aTCbletohaluftitorftsccesrthkcoih,trebfuuotrnaPectoaa(tstnsssidri)iotin.nibgoutlhntseeue)sbeCtsoH(semraAsqtibHputi=eeten0chnCi9eiutnHfr)CgisheoadsrrpcftaehhuiccnaPisictrnoftaesiicrirfeott/eundeiAgn.roticsntstrtiaieotTrnb(htAwuerHrti=iewBbOtLia.AutttHetht)ne(re(iiasbt)ftuhouHteWnerrcittthiieenblotlanootCscchckhraerhteaahoncserrteemarsasiatisnthnuegts(mlreeeii)btsuhatstemehearetet Although more than not make sense. one attribute For instance, can be used, certain combinations if the character enable attribute do is 4-31 TECHNICAL REFERENCE DEVICE SERVICE ROUTINES set to a zero, then the character will not appear nor will any of the other attributes except for reverse video. The required input for this function is shown in Figure 4-3. BL = Attribute(s) to set (BL is used to distinguish this function from the change screen attributes function). |--> L----» L L % » Intensity level 1 (biue} intensity level 2 {red) Intensity level 3 (green) Character enable (second dominant)* Reverse video (first dominant)* Underline Blink . Alternate character set * The user can specify more than one attribute. For instance, it is possible to have reverse video with an underlined, blinking, red character. The user can mix the intensity (color) bits for different intensities or colors for a given character. 223216-24 Figure 4-3 Byte Definition - Set Attribute(s) TECHNICAL REFERENCE DEVICE SERVICE ROUTIKES 4.10.16 Get Physical Display-Begin Pointer - AH = 17H This function is used to return the physical display-begin pointer to an application. Logically, the display-begin pointer is alwvays at 0,0, but there is a physical address (offset) associated with the beginning of the display that changes from time to time as the screen is scrolled, cleared, or otherwise changed. This routine returns that offset address relative to the CRT memory area whose segment address is DEOCH. The screen memory is a 2K-byte contiguous block of RAM. Once the starting location of this block is known to the application, any character on the screen can be accessed. For example, the 1last character on the screen is located at (DEOOH: display-begin +2000) and the eightieth character on the screen (top line, (DEOOH:display-begin as follows: last character on the line)is located at + 80). This returns the display-begin pointer DX = 16-bit display-begin pointer (offset) Example: DX = 0 implies that the first character on the display resides in memory location DEOO:0000H DX 1S0H implies that the first character on the display resides in memory location DE0OG:01SO0H 4.10.17 Print TTY String - AH = 18H HWith this function, the user can have a contiguous string of characters, of a given length, 1located in a code segment to be printed (starting at the current cursor position) in a TTY fashion. As with the Hrite TTY function, this routine executes the control characters CR, LF, BS, and BEL and scrolls the screen if necessary. Reguired input for this function is as follows: BX = Address (offset) of the string* Where: (BX) byte © (BX) byte 1 " length of the string first character of the string * The user's code segment address is obtained from the stack and therefore does not need to be passed as a parameter. 4.10.18 CRT TTY Mode Behavior e The following used in the "mixed"" modes. especially if is a brief description of the behavior of the CRT when TTY mode as well as its behavior when being used in The user should read this information carefully, the user mixes non-TTY functions with TTY functions. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES Internally, the CRT DSR implements a "phantom" column 81 on each ?'line, which is actually column 1 of the following line. This "phantom" column occurs vwvhen a TTY write puts a character in the eightieth column of the current line. If a carriage return (<CR>) command is issued at this point, the cursor moves from the column 81 of the current line back to column 1 of the current 1line. However, if the cursor is in column B8l, reading the cursor position returns (current line + 1, column 0), instead of (current line, <column 81). The user must be aware of this before attempting to restore a cursor position which logically came from column 81, because the Set Cursor Position function has no concept of a column 81. This concept disturbs the TTY mode and it restores the cursor to a new logical position, that is, to column I of the next line. Although the column 1 position has only one physical location, it can be interpreted as two different logical locations, depending on the current CRT action {mode). 4.10.19 Custom Encoding of the CRT It is possible for the user to custom encode the characters displayed on the CRT, wusing the CRT "mapping" function. This mapping allows the applications first to intercept characters (and CRT actions if necessary) then to encode them. : Upon entry to the CRT DSR, a software interrupt is executed, which points to an IRET instruction. An application program can reprogram the IRET to intercept calls to the CRT DSR. The program can thereby "take over" the CRT. This is the typical method used to remap characters to the screen. For instance, this feature can be used to scan through a table, converting English characters to characters in some other language. Another use is intercepting "function calls" (such as scroll or attribute handling) so that the application program can custom encode CRT functions. The user must be careful when performing this operation, however, because it is possible to disturb the data structures of the CRT DSR. NOTE After finishing with this function, the user must restore the vector to its original value. Otherwise, the system could "go away." After the user enters his mapping routine, he can use all registers except ES, bs, and BP. To use these registers, he must save them, then restore them upon exit. Before using this mapping feature, the user must look at the opcode in register AH to determine if it is a write character request. If so, he must also preserve register AH and any registers associated with the write function contained therein. For example, to map all dollar sign symbols ($§) to the percent sign (%), the routine monitors register AH on each call to TECHNICAL REFERENCE DEVICE SERVICE ROUTINES the CRT DSR. If AH contains a write character opcode, the routine then looks at register AL. If register AL contains 24H (the ASCII code for "$"), the user changes that register to 25H (the ASCII code for "%"), then executes an IRET instruction, returning to the screen with the new character. (The currency symbol returned depends on the internation keyboard being used.) All registers are preserved, but register AL has been changed. 4.1t DISK DSR Table 4-7 describes the disk device service routines (disk DSR) supported by the Texas Instruments Professional Computer. To access a function, place the proper opcode in register AH, then execute an INT 4DH. On return, all registers are preserved except where stated. Table 4-7 Disk DSR Opcodes and Functions Aldb Code Description OO0H 01iH 02H O3H 04H OSH O6H* O7H* OBH* O9H* OAH*® OBH* Reset disk system Return status code (for last operation) Read sectors Hrite sectors ¢ Verify sector CRCs Null operation Verify data o Return retry status Set standard disk interface Set DIT address for unit table (DIT) for unit Return DIT address for unit Turn off diskette drive motors * These functions are primarily for the use of syatem-level software and utilitiss, 4,11,1 BReset Disk System - OOH Input: AH = QOH Quiputlt! AH = OOH This function causes state. The actions the requirements of general, the function the disk system to restore itself performed for each supported device the device and the device~-dependent causes the disk controller(s) to to a known varies with software. In reinitialize before their next use. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.11.2 Return Status CodeS - OlH 3 : Input: AH = 0O1H Output: AH = OOH AL = Status code for last CF = 0 (Ko change) disk I/O operation Not all disk DSR instance). A status status of the last (via this function), functions are I/0 operations (this one, for is returned in AH for each function, but the /0 request is always retained for later access if desired. 4,11.3 Read Sectors - O2H Input: AH 02H AL = Number of sectors CH = Cylinder number CL = Sector number DH = Track (surface or DL = Drive number ES:BX = Segment:offset to transfer side) number of buffer Qutput: AH = I/0 status code (For more information, AL = Number of unprocessed ES:BX = Segment:offset of refer to sectors the last i paragraph 4.11.13.) sector processed* This function reads data from the disk. transferred subject to memory boundary boundary and disk boundaries cannot be Any number limitations crossed.) of sectors can be (The segment''s 64K * "Last sector processed" means exactly that. Even if the read was in error, the data is transferred to memory. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.11.4 Write Sectors -03H Input: AH O3H AL = Number of sectors CH = Cylinder number CL = Sector number DH = Track (surface or DL = Drive number ES:BX = Segment:offset to transfer side) number of buffer Output: AH = I1/0 status code (For more AL = Number information, refer to paragraph of unprocessed sectors 4.11.13.) ES:BX = segment:offset of the last sector processed* This function writes transfered subject to 64K boundary and disk data to the disk. Any number of sectors can be memory boundary limitations. (The segment's boundaries cannot be crossed. ) * "Last sector error, ES:BX to transfer. processed" means exactly points to the data which that. the If DSR the write is in is attempting 4.11.5 Verify Sector CRCs - 04H 4 Input: AH O4H . non AL Number of sectors to transfer CH = Cylinder number CL = Sector number DH = Track (surface or side) number DL = Drive number ES:BX = Segment:offset of buffer Qutput: AH = I/0 status code (For more information, see paragraph 4.11.13.) AL = Number of unprocessed sectors ES:BX = Segment:offset of the last sector processedx This function verifies the this function is handled like though a transfer is to transferred. Any number of memory boundary limitations. boundaries cannot be crossed.) CRCs of the specified sectors. Because an I/0 function, ES:BX must be set as take place although no data is actually sectors can be processed subject to (The segment''s 64K boundary and disk : * "Last sector processed"" has little meaning this function does not actually transfer in this data. case because TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.11.6 Null Operation - OSH LFre This function is not currently gupported. . 4.11.7 Verify Data - O6H ; Input: AH O6H = AL = Number of sectors CH = Cylinder number CL = Sector number DH = Track (surface or DL = Drive number ES:BX = Segment:offset to process ¥ side) number of buffer Output: AH = (For AL = ES:BX I[/0 status code more information, see paragraph Number of unprocessed sectors = On error, segment:offset of 4.11.13.) WORD in error This function of sectors can (The segment's crossed.) verifies disk data against data be processed subject to memory 64K boundary and the disk in memory. Any number boundary limitations. boundaries cannot be 4.11.8 Return Retry Status -~ O7H £ < Iinput: AH = O7H Output: AH = OOH AL = Soft error status of last [/0 operation This function returns the refers to an retried. is similar to "soft" error error that did the Return Status Code function. It status of the last operation. Soft error not recur when the last operation was TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.11.9 Set Standard Disk Interface Table - O8H Input: AH O8H AL Standard DIT number (valid values are 0 through 3.) DL = Diskette drive number (valid values are 0 through 3.) Qutput: AH = Error status (For more information, see paragraph 4.11.13.) (Note: This function is used by the operating system software.) Disk interface tables {DITs) are information that the device-dependent interface with the device-dependent code data part for a structures containing of the DSR wuses to specific disk device. With this function, the user can set a diskette standard configurations by setting the drives''s DIT numbers are defined as follows: drive DIT. to one of four The standard Number Description o Single sided, 48 tpi, 1 Double sided, 48 tpi, 2 Siqgle sided, 986 tpi, 3 Double sided, 86 tpi, sectors/track, sectors/track, sectors/track, sectors/track, S1i2-byte Si2-byte Si2-byte S12-byte sectors sectors sectors sectors uon ® OO 4.11.10 Set DIT Address for Drive - 038H Input: AH 0SH bL Disk drive number (valid value is 0 through 7.) ES:BX = Segment:offset of DIT for drive Qutput: AH = Error status (For more information, see paragraph 4.11.13.) (Note: This function is used by the operating system software.) Disk interface tables (DITs) are information that the device-dependent interface with the device-dependent code data part for a structures containing of the DSR uses to specific disk device. With this function, the user can set any configuration. The disk drives are dynamically by this mechanism. disk to a linked to nonstandard the system TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.11.11 Return DIT Address for Drive - OAH - input: AH DL OAH Disk drive number {valid value is 0 through 7.) Output: AH ES:BX = Error status (For more information, see paragraph = Segment:offset of DIT for drive 4.11.13.) (Note: This function is used by the operating system software.) Disk interface tables (DITs) are information that the device-independent interface with the device-dependent code data part for a structures containing of the DSR uses to specific disk device. Hith this function, the user can access a drive's DIT for information and verification purposes. 4.11.12 Turn Off All Diskette Drives - OBH Input: AH = OBH OQutput: AH = 0 s ES:BX = not preserved (Note: This function is used by the operating system software.) During regular operation, the diskette drive motors are left ON for a short period following a read or write operation, thereby saving the time the motor would use to come up to speed. notably diagnostics, require assurance that Some applications, the motors are not running. 4.11.13 Status Codes All functions return a status code in register AH and an error flag in CF. If the carry condition is set (CF = 1), then an error has occurred and AH contains the error code. If the no-carry condition is set (CF = 0), no error has occurred and AH contains a zero. The error codes are given in Table 4-8. TECHNICAL REFERENCE now W DEVICE SERVICE RéUTINBS Value OOH 80H 40H 20H 10H 08H 04H O2H O1H O3H OSH 09H Table 4-8 Error Codes Description No error Time-out - drive not ready or hardware Seek failed - track not found Controller hardware failed CRC error Data request error - controller failure Record (sector) not found No data - bad disk format Command error - bad opcode or parameter Disk write protected Data did not verify I/0 transfer crosses 64K byte boundary failed 4.11.14 Disk Interface Tables (DITs) The Disk Interface Table (DIT) structure interfaces code with the generalized disk driver code. device-specific Because in ROM. DITs contain read-only data exclusively, The gtructure of a DIT is shown in Figure 4-4. they can be placed s TECHNICAL REF*kE:REZNCE DEVICE SERV&CE ROUTINES <---- 16 bits ----> 00H DITDIR 02H 04H DITSEC 06H DITTRK DITCYL 08H DITDSK DITERR Long pointer to disk interface routine Sector size in bytes Track size in sectors; cyclinder size in tracks Disk size in cylinders; error retry limit All other fields depend on the code requirements of the specific device. A. General DIT Structure \ <4--16 bits ----> 00H FLPDIR 02H Long pointer to diskette interface routine 04H DITSEC Sector size in bytes 06H DITTRK DITCYL Track size in sectors; cyclinder size in tracks 08H DITDSK DITERR 0AH PRCOMP Disk size in cylinders; error retry limit Threshold track number for changing write precompensation B. Diskette Drive DIT Structure 223216-25 Figure 4-4 DIT 'Structure e ; -, Tscu_n,x.&pfnk%&aucz = o DEVICE SERVICE ROUTINES The following procedure shows how to set up the disk DSR in access a 'flexible disk (floppyii with a "nonstandard" ("Nonstandard" is a®format that usudlly is not supported by Instruments Professional Computer.) order to format. the Texas MOV AH, OAH ; Set "return DIT address"" opcode MOV DL, <unit number> ; Any floppy disk unit (0 - 3) INT 4DH ; Call disk DSR LES BX, ES:(DWORD PTR [BX] ; ES:BX := address of floppy code MoV <your DIT>+0,BX ; Put address of floppy-specific MoV <your DIT>+2,ES 8 code in your own DIT <initialize your DIT> ; Do whatever else you need to your BDIT MOV ES,SEG<your DIT> MOV BX, OFFSET<your DIT> MOV AH,9 MOV DL, <unit INT 4DH number> ; EX:BX = address of your DIT Set Unit Call "SET DIT ADDRESS" number disk DSR opcode - NOTE - The floppy-specific code comprehends only double- density (MFM) recording format. it does not know how to access single-density (FN) recording format diskettes. -~ _TECHNICAL REFERENCE . DEVICE SERVICE ROUTINES 4.12 KEYBOARD DSR This subsection describes the Xxeyboard DBSR and the functions it provides to the system or application programs that use it. It also shows the various codes returned by the DSR for the standard configuration of the keyboard. The keyboard DSR functions are located in the system ROM and are accessed through the 8088 software interrupt mechanism (essentially an address-independent subroutine call). The typical wuser of the keyboard DSR is the system interface code (the BIOS). Each operating-system~-dependent BIOS resides on a particular operating system diskette and is loaded into RAM during disk boot. The functions described in this subsection access a buffer that is controlled by the keyboard interrupt service routine. All encoding and any special handling (described in subsequent paragraphs) occurs in the interrupt service routine. All discussions of keyboard mapping vectors refer to actions occurring during the servicing of the keyboard hardware (not software) interrupt. Placing an opcode desired function. functions of the paragraphs. in register AH and executing an INT 4AH chooses the All registers except AX are preserved. The keyboard DSR are described in the following . < 4.12.1 Initialization Logic - The code for this function is automatically executed during power-up or reboot and is not directly. available to the user. It performs diagnostics on the Xxeyboard hardware, sends to it the required initialization sequences, and initializes the DSR internal data areas. 4.12.2 Read Keyboard Input - AH = O This function reads and removes the current character (if any) from the keyboard buffer. The character value is returned in register AX. I1f no character is ready, the DSR waits until one is received before it returns to the caller. This character has already been fully encoded (Table 4-10 lists the ASCII codes.) Typically, the encoded ASCII character is returned in register AL, and register AH contains 00. If AL = 0, then the coded value in AH corresponds to one of the various function keys. (Table 4-11 lists the non-ASCII codes for the function keys.) Yihr ety - NICAL REFERENCE - 4.12.3 » Read Keyboard Status - AH = 1 DEVICE SERVICE ROUTINES This "function determines that a character is ready at the keyboard but does not actually read it. If no character is waiting, it returns with the 2Z-flag set (ZF = 1). It the 2-flag is reset (ZF = 0), a character is available to be read. The character is returned in AX, but is not removed from the keyboard buffer. value 4.12.4 Read Keyboard Mode - AH = 2 This function determines the current mode value is returned in register AL in the The definition of the byte is as follows. of the format keyboard. The shown in Figure mode 4-5. 7 6 5 4 3 2 1 0 Reg AL Figure 4-S l--» 1 = CTRL key depressed `-------- `------------ `------------------& 1 = ALT key depressed 1 = SHIFT key depressed 1 = Last key was result of repeat-action sequence 000 (always zero) --» 1=CAPS LOCK key depressed Byte Definition - Keyboard Modes 282 -~ - TECHNICAL REFERENCE S DEVYICE SERVICE ROUTINES fecause the "mode"" applies -to the 1last character typed and not necessarily to the one at the front of the queue, this function returns valid information ,only, ,_di.fl ti'ie_ '&b&)'board buPfer contains one or less characters. In order to use this function., read the key normally, then make a status check to ensure that the buffer is empty. When the buffer is empty, the mode reading will be valid. Use this mode when "Custom remapping function only if it';s necessary the last character was;/'typed. See Encoding of the CRT" in Section the keyboard. to know the 4 for the state of the section entitled an explanation of 4.12.5 Flush Keyboard Buffer - AH = 3 This function is used buffer. It simply empties the buffer. to "flush" resets the (empty) the Xkeyboard type-ahead queue pointers, which effectively 4.12.6 Keyboard Output -~ AH = 4 This function sends the keyboard command in AL directly to the keyboard, with appropriate handshaking. On return, the Z-flag has the status of the operation. If the 2Z-flag is set (ZF=1), the command was performed correctly; otherwise (ZF=0), an error was made. The keyboard commands sent by the CPU are given in Table 4-9. Table 4-9 @eyboard Commands < Register AL Function Performed [sX¢] o1% 02 03 04% oS 06%* 07 os Performs a power-up reset and installs default parameters Turns repeat-action feature ON Turns repeat-action feature OFF Locks the keyboard Unlocks the keyboard Turns keyclick ON#*%x Turns keyclick OFF«x%t Resets Returns keyboard ROM version * Indicates the default value. ** Keyclick requires a hardware modification. (It is not presently supported.) TECHNLCAL REFERENCE DEVICE SERVICE AOUTINES These Eommands are intended for "one-shot" mode at power-up. Although they may be sent use, to set the keyboard at any other time, the overhead of receinng several commands can cause the keyboard to miss fast A CRT Xkeystrokes. There are emulator program may be other ways to implement these commands. required to turn repeat-action on and off in response application needs lock/unlock the programmed into a to escape sequences to set/reset Xkeyboard in real keyboard mapping from a host. For example, if an the repeat-action mode, or to time, these functions can be routine. Refer to paragraph 4.10.19. 4.12,7 Put Character Into Keyboard Buffer - AH = § kgpakfZBkicTctieleX~phuehhvy.-aiypnyaa)sfescbclbrrlneotioaaaidaigacccsrorattdAinodfetennsurriissnroiucnebncbttmetthcahusoieeilofewwnlotfmaaugtnesmsshRkreeaee.rtdnt(ayhe.ZpddtebtFlhenpoa=raodluatt1icanKOr)eecnedTb,ddvehyeuestebrfhsptrofsehlheiiaetaatantfrrtavcuo,dbnteterruhhmddntmiefehs,asfeaotbIennenbrislepuncb"1iyntuf"6huft-osfawttbrtfrahhdpresaeairfausrttctenunthttsgenlhabeeeseecnumr"e(stdfp.tdsvitafth,haco2ryeeilhn-cdrsua.fh.erlaaataatrhAcbigceansuhRtcyfeaet(itafrnhTredteeahshurriecesss1te6KseBr-Xetrciubsaysshfwrirburaaettsoaosrh,dtlmaeaahgirtsecerdtnevfcteecahuaasrsertllnsaoIl(aludemmnZetyee)pF.eru=kedt0emaaeti)saynxhn,cdibatpabI(ntonoylfAsaiHrtc=hdtitttt0ah,hhhhtnb)iteeeeeeon To place a normal ASCII character call with the character value in function keys into the buffer, extended function Table 4-11.) value in 8H, and @ into the buffer; make the function BL and zero in BH. To place make the ~function call with the zero in BL. (See Table 4-10 and This though function they had is useful when been typed. a Two program needs characters examples follow. to appear as * aAci"nnehnocaithrtaohaip"ecaprtlleiirzckfaaeettyaiitoo(unanCrn.TedRLcatnubyrNTnhsedifiosnorafsofbeplreetrMtiaShnte-giDntOhgeSec)htoh.eosypisenttraoeapmtpirnogtphsreeieastsyebsutftefhmeir*s"echaposrdiunrojtifuenfsrg"t * pMfisttahrnuieenovnmryogcumkrtilkeainaeomoatypntibeaenorsgaa,srttede«iccraanonmfgnilbdnuutasfypshtfprpyeeeorssrdvot,,tieghdmreesaamcn,oktdmhelemyaoabcnptnkeoeho.dareprfreadoerrbamyitnsbcIituhmnofamg"fiectendhhriaia,stntiahygntesietncltegohym"embf"nmueafatnftappbdeuklerrreafo.escog,e(rrweahoimvcceshaaHhr)nha,d.erpnarcocrtgoeetruahrtaldihsmdsse ' TECHNICAL REFERENCE DEVICE SERVfCE'ROQTIHES 4.12.8 General Keyboard Layout The outline of the kXeyboard and the key-position numbers associated with each of the keys are shown in Figure 4-6. The numbers in the upper right-hand corner of the keys are the scan codes sent from the keyboard. These codes are used internally by the xeyboard DSR to encode a key when pressed. The mode keys (marked **t) do not generate a scan code. =) I () @ © G & ) & & ) ® @ & ) & ) & B B &@) OEBAeEEEEe6M0 L@@@ 2®@o@9Bm2nBB©@S&&&ETM%%2A8G))iE)0@08SSa5a8@5g0@oB (@a00&00000m60)0n)| 23218-27 Figure 4-6 General Keyboard Layout Showing Scan Codes TECHNICAL REFERENCE . DEVICE SERVICE ROUTINES 4.12.9 Character Codes Table 4-10 lists by the keyboard keyboard DSR, and this table, the character DsSR. The the returned and extended function codes returned modes are handled internally by the code reflects the mapping shown in Table 4-10 sStandard Keyboard Character Codes | ] £S { I 02 03 ] 04 { £f6 | £7 | £8 i 0S | £s § o6 ] 07 | £10 | £f11 i os | 69 | £12 | 1 | 10 | {1 T S {f1122 RN || s4 | 14 | 1s | 6 | 7 | 16 | 8 {| f1s17 180 0208 | j 9 ol 1) = 98- j 2¢ |} BS 1|2 322 |4 R =TS o Py } 25 | 26 ||2 278 ) B | sPp | HT || -=1= ] 29 | 30 I3 T {03 2 1S 3N { o | CR 01 il £ |L 9 § 34 f 3s | = | 2 3F*|sfS 4401xx||ssff7é 42%|sfs 43%|sfo 44%|sf10 4Sx|sfil 46x|sf12 31} ¢ 32 | e 33 | # 34| $§ 3s | g 36 | A 37 | & 38 | * 39 aglh | [ BN, ( 2D | _ 3D | 08 | BS D6T0 || ~(= 28 |+ 20| sp 05 |Bktad =R=l | ==gk= 30 | 0 oD | CR 34 | 4 3 5T s 39 | 9 2D = 32001102 S8x|cfS S9tjcte SA%|cf7 SBt|cf8 SCx|cfo SB*{cfl10 08x|cfll 09%|cf12 21 | --~ 40 | Fnul 23 24| | ------ 25 | --- SE | RS 26 | --- 2A | === 2298 | | -----~~ SF | US 28 | -== 08 | DEL 3ZE0 R | e= T 2B | + 208 | sp OF*| HT 3=1 {N1== 30 | 0 OB | CR 34 | 4 35 } § 39 | 9 2D | = 3201 o> 62%|afs 63%|afe 64%|af7 65+|afs 66%|afs 67xjaflo OA*|afil oOBx|afi2 -- | altl 03%} alt2 ---- || aalltts3 -- | alts 1E | alté ~-- | alt? -~ | alts ---- | | aalltto9 1F | alt- -- | alt= 7F | =-- 3D | pR fi 2B 20 | pf2 | pf3 09 | pfe -31 || ---=~=~ 30 | ~--- OD | =--- 34 | --35 | -~~~ 39 | --~ 2D | --- 82 | -~~~ 6Cx| 6D*} GE%x| 6F%| 70%} 71%{ O0C*| 0D*| 78x| 79x| 77BAxr|| 7cCx| 7P| 7E%| 7F*j s81oixy| B2%| B3%} -~ | 8C*| | 8D*| B8E*| 8F*| --- || -~ | -- | -~ | =-- | =-- | -- | -- | FsS i F6 F7 F8 | } | F9 { F10 F11 | | Fi12 { i | i J { } ) | | § | | Back space | Numeric = ) | Numeric Numeric + SPACE] i Numeric TAB | N(uumneursiecd) 1 i | Numeric 0 | Kumeric Kumeric Numeric ENTER| 4 | § } Numeric 9 | Numeric - Numeric 2 | } TECHNICAL REFERENCE - DEVICE SERVICE ROUTINES Table 4-10. Standard Keyboard Character Codes (Continued) ______________________________________ e -- e | Key #| Normal | SHIFT | CTRL | ALT | Comments f j 36 | 37 | 38 § 39 { 40 } 41 L2 | -== } -== | --- | 7 | 8 | 6 | ==} === ==} === --j -=-- 378 | R" 7. 38| 8 36 |} 6 'l b == | === == | === --{ --- 37N 7 38 | 8 3¢ | 6 2 |, -- | #-~- | === ~-- | =--- 37 | --- 38 | --- 36 | --- 2¢ | --- -- | (Unused) =-- | (Unused) -- | (Unused) == -~ | Kumeric | Numeric 7 8 =-- | Numeric 6 -- | Numeric , | 1 | i | { | { 43 | 3 33 | 3 33 | 3 33 } --- ~-- | Numeric 3 } {| 4454 || ==s= 2=E= || ==o= 2=E= || === 2=E= || -=-=-= ---~ || N(uUmneursiecd) . } i | 46 | C-rt 4Dx}sC-rt B8A%*|cC-rt 74%jaC-rt 4Ex| Right Arrow } ] 47 | Ins 5S2x| sIns 28%] cIns 29%| aIns 2A%| INS ] j 48 | Del S53%| sDel 38+%| cDel 39%| aDel 3A*| DEL ] § 49 ] so { s1 | s2 j s3 i s4 | ss { HT | g | w | e { r | t | y ©09 71 |Bktab ] @ OF«| S1 | HT DC1 7?7 | W 57 | ETB 65 | E 72 | R 74 | T 45 | ENQ S2 | DC2 54 | DC4 79 ] ¥ S8 | EM ©09 11 | --- } altQ -- | TaAB 10%] 17 | altW 11| 05 | altE 12%] 12 | altR 13%| 14 | altT 14x| 195 | altY 15%]| i | f } | | | 56 i u 75 | U S5 | NAK 15 | altU 16} } | S7 | se i i | o 69 | 6F | I O 49 | 4F | HT SI ©08 OF | altl | alto 17x| 1ex| 4 } } | S8 ] 60 IS 100 | P | I | ER] 70 | P SB | { sp | } S0 | DLE 7B | ESC 7D} 68 10 | altP 19%*} 1B | --- -- | 1D | --- -- | =~ § - | } | 82 | 63 | LF } =-- OA | LF OA | cLF --} br =-- | -==- 75%| aLF == ] === 4F*| Line Feed -~ | (Unused) i | | 64 | 65 | C-up | ESC 41B8%|s| 5CE-SCup 18B8%|| cCE-SuCp 84%|aC-up 1B | --- 49%| Up Arrow =-- | ESC § | | 66 { a 61 | A 41 | SOH 01 | altA 1Ex| | { 67 | 68 | s | 4 73 | S 64 | D s3 | bBC3 44 | EOT 13 04 | alts | altD 1iFx| 20%| | I | 69 ] 70 i £ | g 66 | F 67 | 6 46 | ACK 47 | BEL 06 07 | altF } altG 21x} 22%*| { | TECHNICAL REFERENCE DEVICE SERVICE ROUTINES Table 4-10. Standard Keyboard Character Codes (Concluded) | Key #] Normal | SHIFT | CTRL | ALT | Comments i ]| 77+2 || h§ 8A || JH 448A || LBFS O08A || aallttHJ 2234%%|| { | 73 | X 6B | K 4B | VT 0B | altK 25| § 74 f 1 6C | L 4C | FF 0C | altlL 26%| { fo7s | 38 | Xy |} (o oall] aoe o | )] R7R7ZE N || M CR O2D7581 | C8=R O2D2 I | sCR OsB ok || -T -- A=R-l |{ Return | | 78 SC.l | 7C §{ FS 1C | === == } | 79 | C-1f 4Bx|sC-1f 8B*|cC-1f 73*|acC-1f 4C*| Left Arrow j | 80 | Home 47*|sHome 86*|cHome 77*}jaHome 8S5*| HOME { f 81 | sP 20| SP 20| SP 20 | SP 20 | Space bar | | 82 | =z JA | Z SA | SUB 1A | altZ 2C*| | | 83 | x 78 | X S8 | CAN 18 | altX 2Dx| § 84 |l 8 § c | v 63 | c 76 | V 43 | ETX 56 | SYN 03 | altC 2Ex| 16 | altVv 2F«| } 86 | b 62 | B 42 | STX 02 | altB 30| { | 87 § n 6E | N 4E | SO OE | altN 31x| § |] 88 | m 6D § M 4D | CR OD | altM 32«| § || 8990 ||Pto,gl 27c2%| | *k<k S%C%I | =-~S- S-- | =~==~= Sl ~- s || PRINT { JI|ES 18E2R ||I/ 228E || ?> I3FE S| im-i==== == l | ===--== -=- | | S S Bl el e S Sl e L= | B (Uu n 3'e d1) | e ) iseseed ] e co oo ae ) o B | (Unused) I 1RO S I B | e e | =S = == =~ R |l (Unused) | ] 96 | C-dn SO*|{sC-dn 89%|cC-dn 76%]|aC-dn Si%*} Down Arrow | IS 7 | =-- o = R --ss Re B R (Unused) i 1RO 0 R e et |l = = = |B = N | R=C N -- R (Unused) | 1S S { 100 | 101 s st | Ppau | £1 dt) s ** | Pbrk 3Bx{sf1 el | == N 30-- S ** | --- Sdx|cfl -S-E*||afi--- = R M (Un'used)) 6-8~%x| | FB1RK/PAUS | | | | 102 | £2 3Cx|sf2 SSktjcf2 SFxjaf2 69%| F2 { 103 | £3 3Dx|sf3 S6x|c£3 60%jaf3 6A%} F3 ] 104 | £4 3Ex|sf4 S7tjcfa 61%jafs 6B%x| F4 Notes to Table 4-10: 1. Key # is shown in Figure 4-6. 2. In the "Normal","SHIFT", "GTRL", and "ALT"" columns, both the "graphic" and the hexadecimal values of the character are given in the form: GGG HH. Mnemonics are used for the "graphic" descriptions of the function keys. These are generally self-explanatory: a leading a, s, or c indicates ALT, SHIFT, or CTRL, respectively. For example, f1 4is the F1 function key:; afl is the F1 key pressed while TECHNICAL REFERENCE DEVICE SERVICE ROUTINES holding down the ALT key. C-rt means cursor right (right arrow), and cLF = CTRL linefeed. ? . ~ » 3. Entries consisting of "--- --" " indicate that the combination is suppressed within the kxeyboard DSR. 4. Entries consisting of "xxx **" indicate special handling in the form of direct action by the xeyboard DSR. (For details, see paragraph 4.12.14.) B0 Normal (ASCII) characters are returned in register AL with the scan code key number in AH. 6. Entries consisting of "xxx yy" are returned with AL=0 and the indicated value (yy) in AH. 78 An asterisk after 2 number means extended codes, listed in Table 4.12.10 Extended Codes The "extended"" codes are non-ASCII codes. They represent special function keys on the keyboard. To distinguish these codes, register AL contains 00 upon returning from a Read Keyboard (AH=1 or AH=2) function «c¢all, and the extended code is in register AH. The code range (OOH through FFH) includes normal ASCII codes. The extended codes are given in Table 4-11. Use the mnemonics to cross-reference with Table 4-10. < Table 4-11 Extended Function Lt Codes Tresl - S I S DR eo e } © |Pbrk JaltQ j 1 {Ppau jaltW P2 faltE | 3 | 4 |Fnul | |altR |altT JI . Jalty f6 | 1 7 faltU lalty { 8 |}(sfil |alto } 9 { A | B |{sfi2 jecfii jcfi2 jaltP | | I ¢ lafiyr | | D |afi2 | JIRSEIRE faltAa { F {Bktablalts s e e |altp jaltF jaltG jaltH falts |altK jaltL f |sIns jcins jains j laltz faltXx |altc jaltv e |altB jaltN |altM | | } | | |sDel {cDel |aDel | £1 | £2 | £3 | f£f4 | £S e nlye L2 el R e e e | £6 | C-dnf c£3 | af9 jalt9 | | £7 Jac-dn| cf4 Jaflio |alto | | £8 | Ins | cfS jPtogllalt- | { £9 | £10 | Del | sf1 | cf6 | cf7 |cC-1fjalt= | jeC-rtjeC-up]| | £11 | sf2 |} cf8 | cLF }aHome| | £f12 | s£f3 | c£9 |cC-dn}sHome| | Home| sf4 | cf£10|cHomej i | C-up| sfS | afi |Jaltl |sC-up] jaC-up} sf6 | | s£7 | c-1£} sfs | af2 } af3 | af4 {alt2 |alt3 jalt4 jsC-dnj |sC-rtf |sC-1f} Jac-1f} 'sf5 | af5 lalts | pfi | | C-rt{ sfio] afé jalte | pf2 | lac-rt| cfl | af7 Jjalt7 | pf3 | { aLF | cf2 | afg jalts | pfa | * MSD = most significant digit; LSD = least significant digit TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.12.11 Keyboard Modes In the standard keyboard, the mode keys have the effect shown in Table 4-11. The latching (push-push) CAPS LOCK key affects the alphabetic keys (S0-S9, 66-74, and 82-88 on the standard keyboard) by forcing the SHIFT mode. Normally the alphabetic keys produce lowercase characters, and the SHIFT key temporarily causes them to be uppercase. When the CAPS LOCK mode is invoked (the CAPS LOCK key is latched down and the LED in the CAPS LOCK key lights), the alphabetic keys produce uppercase and the SHIFT key has no further effect (on the alphabetic keys). In the standard encoding, the CTRL/ALT/DEL, which is wused only for valid combination system reset. of mode keys is Simultaneously pressing the CTRL, ALT, and DEL keys results in the keyboard DSR initiating the equivalent of a system pover-up reboot. The action is handled internally by the DSR and does not return a code. This function is "hardwired" and cannot be disabled. In any other cage, when two or more mode keys are pressed simultaneously, only one is recognized. The order of precedence, beginning with the highest, is as follows: fAdLeTd CTRL, SHIFT, and CAPS LOCK The ALT key has a special use, letting s the user enter any character code (COH-OFFH) from the keyboard. When the ALT key is held down and knackI(teeephnhfxepyyraptuopsrltmataidcrcndtoaoeek(tncrAeit-iHh,swoAme=inaL0t)lThwebfreikafersceuvtsyanahtulcratsuteheseeietnoronourn.zcemekotkarfheolecysosIttrfehXcrenehzoydeaf,ksrreedtoawwseecos,ttrtihheeerkr1eiesdtyhnctasehudnxetrisctrrrihoeematkncprhkvetltaerasyllycel)yyetu.eeprraatecdhscir"Iiisugfsospeimuldtgua~sthtlchyreaepesteteetdunhdkafdrereisnereoespnARdteeLraT"ittd/thyosNepnUeeaKMtdnoen,dyunorbmovoeraaarmldtttraiudwhhldcseoee nothing to the ALT/NUM value. Pressing the accumulated value and starts a new more than three keys three-keystroke seguence. sends Example: ALT 003 places the value for an ETX in the keyboard buffer. ALT 3, followed by any non-ALT key performs the same function. 4.12.12 Type-Ahead Buffer The DSR implements a circular type-ahead queue, to 1S keystrokes. (Each keystroke is 2 bytes.) filled, entering further characters from the which can If the keyboard buffer queue sounds up is the TECHNICAL REFERENCE DEVICE SERVICE ROUTINES system beeper. queue pointers, The Flush Keyboard Buffer (AH=3) effectively emptying the buffer. function resets the e 4.12.13 Repeat-Action Feature If the repeat-action feature (the default) is enabled, th;re is a half-second delay and all keys become repeat-action at a 1S-cps rate. Repeat-action characters are ignored when the queue currently contains more than one pending character. This means that the application does not have to worry about the repeat-action "coasting"" problem. That is, if the application does not or cannot read the keyboard input faster than the repeat-action rate, the undesired repeat-action characters are not queued and the keyboard does not get ahead of the application. 4.12.14 Special Handling These paragraphs describe functions handled by the Xkeyboard DSR. Several of these require immediate reaction (for example, pausing the output routine so a fast-scrolling screen can be read). Most of the keyboard DSR functions are implemented with the software interrupt facility of the 8088 microprocessor. Fach of the defined interrupt vectors points to some default piece of code that either does nothing (for example, a single IRET instruction) or performs some system function. fAn application program can change these interrupt `vectors in order to gain direct access to a function. However, the application must preserve the original contents of the vector and restore it before terminating and returning to the system. If the application routine is used, it must end with an IRET or the equivalent (FAR) RET 2, which allows flags to be passed. The stack used is the internal stack of the keyboard interrupt service routine and only 10 levels (20 bytes) of stack are available to the user's routine. Interrupts are disabled when the user routine is entered (by the INT instruction). Interrupts should be re-enabled immediately wunless it is necessary for Registers AX, BX, CX, DI, and BES can be used them to remain disabled. (information is passed in AX); any others must be preserved. Hhen the available stack is too small, the routine must switch to an internal stack of sufficient size (including © bytes for possible interrupts). Also, the routine is executed as a part of the keyboard interrupt service routine, which means that routine finishes no other keystrokes are and returns. The normal accepted until the user way to communicate with the outside world watch for it in (outside the service the application. This, routine) is to set a flag and for example, is how the BREAK function is implemented in MS-DOS. Control should not be retained by the user's routine unless a complete system initialization is to be performed. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.12.15 User-Available Interrupts The following is a summary of the software interrupts (performed by the keyboard DSR) that can be used by application programs. The interrupts are presented in their order of execution. The number in parentheses, instruction. the "interrupt type," is used in an interrupt The absolute address of the corresponding vector.is the interrupt type times 4. As an example, the address of the keyboard mapping vector is SBH x 4 = 16CH. Any of the special key interrupt functions can be Dbypassed by re-encoding the key code. For more information on the key code, refer to paragraph 4.10.19. The keyboard DSR interrupts and their mapping vectors are: * Keyboard mapping (SBH) * Program pause (SCH) x * Program break (SDH) * * Print screen (SEH) * * Keyboard queueing (SFH) * » These interrupts occur after internal encoding. OrFk4titoneethh.ryefeh1nee2rtr.hiw1esmqki5oeust.yreoepg1.euq,reuepessuaserKWieahendttgeyhhfanreebnoadorbpamukDhtrtaeShdtyRepie4bor.enceMuf1fosnao0odecpr.erropo,1emdin9sen.sge.nucitcsaiouttndshhigeieesTsnhgiketsehnXtyikch,seeotiydhnbeeotkcdiaeeh,nryret,drcekkureasprylttublhqpoeoutfaweoriirusdDniSgtpnRogethreprqftlehuoeamers(acupSmpeiFeeusnHcsdg)ietarhlteheeaiitcoknknhetetkyeyeesyrbr,etrorniuaumcprpceootdatddn.,.eeda fr4isoct4reh-aean.te1sust11stte2)re~ro.ess-rr1otpsui5urcpnt.roortg2ntgoharlatatlhvamisieteoPncfrgkttteohbcoyewgeairarsflraolPscemreAcoeirUdrnrSeeeP.iesanonitupfr.tkesodeereeynrm.drsrieIiuntssbpaiAetlttrnoqerieuePndetr.gasnune.uafcdrspopenrsppsoilarnilAtcrgctlaeaaonumtwseaissemyosetbshnpxeetattreuehaimsennedpgs(ercuudorsnpfegesuotrerhnwhcnaeiceomftrdtite-ohooueornpdli,)cpdgae,(nirornffetaofhwlBreehRcimritKhsc/avhnPevatgAcnoeoeUtcwSsonttar,oocTrptasibabktolnuehnietdyesa Tncfihrohneotatmhreiracnrcagutrpetrhtryeelsfsieslovaafgltaeuwnxedaedrceeutsiteniermdimp,nAilXtyneersitrsheuexpitptt.lhcseaa.creradycItfIiffiolnntathtgoeheofcitshaceratrrhryreeqysueekftulefeayl.gabagonadrisdBisetfhsoeerrteDe,sSeeRxtt,ttehhneeodntehDdseSonRfrtewtdcauootrrehdensee TECHNICAL REFERENCE DEVICE SERVICE ROUTINES for the program pause function is placed in AX. Therefore, if an IRET instruction is used to return instead of the default ROM pause routine, the DSR returns the program pause function code to the application. Because the carry flag is usgsed to pass information, the IRET instruction must be simulated with a (FAR) RET 2 if the user needs to return with the carry flag set. (The IRET instruction restores flags to their pre-interrupt state.) 4,12.15.3 Program Break. Pressing the (shifted) BRK/PAUS key causes a software interrupt and allows the user to perform an action or return a key code. It can be set to return an extended code (see Table 4-11) to the caller, if desired. Buring powver-up initialization, this interrupt vector is set to point to an IRET instruction so that the BRK key sequence is ignored other than returning the break code. An application program can change the interrupt vector in order to support a break function of its own. However, the program is responsible for preserving the original contents of the vector and restoring it before terminating. For more information on the encoding/software~interrupt technigue, see paragraph 4.12.1S5. 4.12.15.4 Print Screen. Pressing another software interrupt. The user a key code. This interrupt normally within the ROM. The DSR checks described in paragraph 4.12.1S. the SHIFT and PRNT keys causes can perform an action or return vectors to an IRET instruction the carry flag upon return, as The carry flag is set before the interrupt is executed,*so that when the routine consists only of an IRET, the key is effectively ignored. This can be (and is, by the MS-DOS BIOS) patched so that it vectors to an actual print screen routine. This routine executes as a part of the keyboard interrupt service routine and, therefore, cannot be interrupted by another keystroke. The preferred way to handle the Print Screen function is to use this interrupt to start the Print Routine (in the background) then return immediately, thereby reenabling the keyboard. 4.12.15.5 Keyboard Queueing. This software interrupt occurs every time a character, whether encoded by the DSR or by the user, is placed in the type-ahead buffer. This interrupt lets the real-time 0S know when there is a character to read. The user can choose to ignore the Xkxey (not queueing the keycode). Refer to paragraph 4.12.15 for keyboard queuing interrupt conditions. 4.12.16 Custom Encoding An application program can encode the keyboard using this function. Each time a key is pressed on the keyboard, the keyboard sends one or two Xey codes to the DSR. The mode Xeys are handled internally. (For more information, refer to paragraph 4.12.17.) The DSR performs a software interrupt each time it receives a key code (not including the mode keys). Normally the interrupt vector points to an IRET instruction. An application program can reprogram the vector to TECHNICAL REFERENCE : : DEVICE SERVICE ROUTINES kkvrieeeenyysctsete,torrc,ceoctpdhoteemstnbheinetaxhatteepyiscppoeulinticeacslakl(teyCiyaToRnLs(/cFcAaAocRnLda)senTs/,DREttEahLTkr)eo.u.2ngEehocinanTthussretsodmrgeugrcé8tyUitetaofribnnyl.eetevsheirnygtttohhaticenongmceoisdbneuttetrhictrtesohpeutgsshpseycstithtaeihlmse NOTE It is essential that the application restore the vector to its original value after completion. Otherwise, the system will crash when the special encoding routine is later written over. akkArWItLhehheen,eeeyystanbtbudoeorctaanahadretrerh,bdddreu.yfmfosetdhorffseelr.fcaoatgmnwvbaayrtlTeiteuhshceieossdsiiesenittniisnetirne((rrACoiurLnFAnpue=Hctp1lat)un,.w(ddatiiyhsneAgtHhpIteofemnoratdrfhcteeeohhtreahmnepbregylecdetaapsecreteraatd(ytnhfied-sraaodfrcmlisdstarthigeoaotcwnhnentdenilascyrodbkidnierityei,nsbnegeotnftoaciirogfiddus(irCstenFhebgIe=tyS)0Rp))ao)s5fitssywephadtteenh.hi-ndeen abrsIttnfhuohedeemfpefeeakritttnwhe.foe-yuasntctchitretscioiaTokorhmmnenrioosyrdeedisibciarabftneyclictacgegtenbilseosysraiiessudibsnalencebsddileettun,dtdwteiooh3dreeasnenholdfiyisn,ntohAtteHhpt.eaheranstnepvdieeaTsdcclhcueuialeannaltoorutscoehfohsridearnennoAgdLudctalainsiinnseaigs.t.hrcrehecoothpuoualhtsrraiiencagneehceddtebwrih.patsieicrnhfOoofFrFTmtHhhAso,eeLf If the scan code is the user must strip instruction is AND the IRET instruction pass flags back. used in a table look~up off the (possible) AL, 7FH). Because this must be simulated with a or a direct repeat-action is a software (FAR) RET 2 comparison, bit (the interrupt, in order to 4.12.17 Keyboard Interface Protocol kApfPtLheoorTeslye,lis-otspmwiiooCeondsAdngeiPStibkoayenLtyoOksCe.tKyhb,teyhteoenkTahnekedyeit-syhepbmCoooTpasdRrkeriLeed)tcyiebbodoynhDeataSdersRd.bybcityshseae.Innfangdesevbdteyhrteeasissnetscnahbtetoyetweiatnlhogeof nre.elttahhpeesrtesmcIetoundrketrewieiynnlsktglterysoaskltetwah,(ateSyuHssIFktTehb,oyeef The mode byte is never because it is sent only if transmission. The mode function, sent the cannot during a mode has change repeat-action transmission, changed since the last during the repeat-action 4-57 TECHNICAL REFERENCE DEVICE SERVICE ROUTINES The 7). second This byte bit (key position) contains a repeat-action key bit (bit is set to 1 during a repeat-action key transmission, and reset to O during a non-repeat-action transmission. If the Xkey is still this time pressed with bit after 7 set a half-second delay, the code to 1. The keyboard remapping is sent again, routine wuses this bit to suppress the repeat-action key function when necessary. All communication with the keyboard is: * Asynchronous * Serial * 8 data bit % 1 stop bit * Even parity. The keyboard at 30S bps. transmits its data at 2440 bps and receives its commands Both bits bytes have similar formats, as shown 3 through 6 of the mode key status byte in Figure 4-7. are all set to However, 1. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 8 7 6 5 4 3 2 1 0 e L FIRST BYTE (Not always sent) Control Alternate Shift = 1111 (denotes first byte) Caps lock {uppercase) Parity 8 7 6 5 4 2 1 SECOND BYTE Scan code Repeated character {repeat-acstion keys) Parity « 22321628 Figure 4-7 Byte Definition - Keycode TECHNICAL REFERENCE DEVICE SERVICE ROUTINES The keyboard understands Keyboard OCutput (AH=4) acknowledges each command. several commands, function, and `as the, 5 explained in. the keyboard generally The codes sent by the keyboard (refer to Tables 4-10 and 4-11) range from scan code 01 through scan code 104 (OlH through 68H). The spare scan codes (from 69H through 6FH) will possibly be assigned in the future. If 3o, the size of the standard encoding tables will also be increased. Codes 70H through 73H are status codes returned by the keyboard in response to commands. Codes 74H through 77H are unused but reserved, and codes 78H through 7FH are for encoding the mode key status byte. For more specific information, refer to the paragraph entitled "Receiving and responding to commands from the system unit" in Section 2. 4.13 PARALLEL PRINTER PORT DSR The following printer port use it. paragraphs describe the functions that DSR provides to the system or application the parallel programs that The printer compatible characters, DSR provides routines to implement a Centronics~ parallel port interface. The wuser is able to output get printer status, and initialize the printer. The printer DSR functions, located in the system ROM, `*are accessed through the software interrupt mechanism of the 8088 microprocessor. To choose a function, place the opcode in register AH, place zeros in register DL, and execute an INT 4BH instruction. (For an explanation of register DL, see paragraph 4.13.4.) All registers are preserved except AH, which always returns with the printer status. (See paragraph 4.13.3.) The functions available are: Output Character to Printer (AH=0, Initialize Printer (AH=1, DL=0) Return Printer Status (AH=2, DL=0) DL=0) 4.13.1 Output Character to Printer -~ AH = 0, DL = 0O This function sends the character in AL to the printer port. The BUSY signal from the printer is checked before sending the character. If the printer is still busy after approximately 0.33 s, the DSR sets the time-out Dbit in the status byte (in AH) and returns. If the printer is not busy, the DSR returns with the time-out bDbit reset. Any unusual conditions on the status signals from the printer cause the printer to go BUSY. Time-out also occurs if the printer sets FAULT, PAPER OUT, or NOT SELECT. The printer can also set BUSY, causing a time-out. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES It generally is not advisable output routine during regular to rely on the time-out of the use, especially if one is using printer the DSR from the printer task of a real-time OS. This time-out is a software loop and causes the application The preferred method has the through the printer status call to "hang" during the time-out period. application watching the BUSY signal so that the application can implement and control a time-out. The standard sequence used to print a character is: REPEAT Interrupt 4BH with AH = 2 and "Return Printer Status." UNTIL STATUS = NOT BUSY END DL = 0 (see paragraph 4.13.3, INTerrupt 4BH with AH = IF STATUS THEN = (time-out) <handle the error> END 0, DL = 0 (FAULT or and AL = <character> PAPER OUT or (NOT SELECTED) ) Note: Refer to Figure 4-8 for byte definition of the Return Printer Status function. 5 4.13.2 Initialize Printer - AH = 1, DL = © ~ maaTphcacritntisuuinaaotlnle)rf.unstcyatkstietonoeTnmhpeeirspafocowtpsreirymrvsi-atnutetpetmehser-(dnesteohqopteufetinwvodIaanNerlIneeTtnstysstia(egcromnfteaiflevarraetspeoenosttowetrChtt-eThhueiRpsLi/nAtarsLeepiTrsgp/efnrDtaaoE.lcpLer)i.oanTctlhaeyeusiosnnppgcreeic,nitfteiharcet 4.13.3 Return Printer Status - AH = 2, DL = 0 This function reads the information in register returned after the Output and the Initialize Printer printer status port and returns the AH. This is the same information as that Character to Printer (AH=0, DL=0) function, (AH=1, DL=0) function. The bits of AH are encoded as shown in Figure 4-8. TECHNICAL REFERENCE ) DEVICE SERVICE ROUTINES Figure 4-8 -- Time Out {on busy) {not used) ---- Busy Paper Qut Selected (online) Fault 22321829 Byte Definition - Return Printer Status 4.13.4 VUse Under an Operating System When the software interrupt technique interfaces with ROM routines, a DSR can be enhanced or replaced by patching its interface interrupt vector. Ynder MS-DOS, for example, the serial printer support emulates the parallel printer functions of the ROM. s The printer interface is implemented by patching a small routine in front of the printer interrupt vector. This" routine 1looks at register DL to determine the desired printer. If DL=0, a jump to the ROM routine is made, and the user is unaware of the patch. If BDL=1, AH is decoded to perform the appropriate function on the serial printer. If DL = FFH, then the desired function is performed on the default (currently configured) printer. Because the serial support emulates the status returned by the parallel routines of the ROM, the user knows of the operation only because he set register DL. Some operating systems do not require that register DL be set. In the case of MS-DOS, however, the DSR is extended in a manner that requires the setting of DL. Refer to the documentation appropriate for the operating system in use. TECHNICAL REFERENCE DEVICE SERVICE ROUTIKES 4.14 HWINCHESTER ROM & The Winchester ROM, on the Winchester controller board, interfaces with the system ROM software, specifically the system disk DSR. The Winchester ROM is addressed by the system processor. Iits address, as determined by the hardware, is OF8000H. The convention 1locates the ROM at the address (as seen by the software) of OF400:4000H. In addition to the disk DSR software, the Winchester ROM contains the software necegsary to drive the Winchester controller, to boot up the system from the Winchester disk, to format the disk, and to run diagnostics (both power-up and advanced) on the controller and disk. After initialization, all regular operations of the Winchester (read, write, verify, and so on) are done through the disk DSR. subsection 4.11.) ROM (see 4.14.1 Limitations The DSR and other utilities provided by the system ROM limit the types of Winchester drives that can be used by the system. The limits are as follows: * X x Y cylinders per drive where 1 < X < 256 ard 1 < Y < 1§ i *+ 16 surfaces per drive * 17 sectors per track * 512 bytes per sector * 2SS error retries * 11-bit error-burst length Most of the that describe the following routines within the type of drive. drive parameters: the ROM are driven by data structures The system is powered up assuming 1S3 cylinders 4 surfaces 125 first track of 64 first track of 1 error retry 131-bit error-burst 3-ms step option reduced write current write precompensation length If the use, an install default parameters are not correct for Initialize Winchester Disk System option the correct parameters. The system can the call boot type of drive in must be made to the first sector TECHNICAL REFERENCE DEVICE SERVICE ROUTINES with the default parameters. % 4.14.2 System Interface The Winchester controller board ROM is initialized to the system when it is called by the system ROM following the power-up self-test. The system ROM tests the Winchester disk controller ROM to make certain the controller is functioning properly before calling it. To allow the system ROM to test and call it, the HWinchester disk controller ROM contains a header defining the ROM size, the entry point of the ROM, a version number for the ROM, and an identification message preceded by the message length. The entry point called by the system ROM is required to device- dependent initialization and, optionally, to boot the from the device that the called ROM serves. For the Winchester the operations are as follows: do any system disk, * Set the RAM area of the ROM in the system. Set the device- installed bit in the system configuration word. This second step permits the system unit to "sense" that the controller is installed, and, under the diagnostics diskette Display System Configuration test, to display all options installed- in the system unit. * If the caller has passed the "do not boot flag" (OFFFFH in register DX), return control to the caller. Othegwise (with 0 in register DX), the initialization segquence continues. . * If the user has pressed the ESC key, control gxeturns to the system ROM and the system boots from the diskette. * oOtherwise, display the Hinchester disk controller ROM sign- on message and execute the controller's power-up tests. * Test all ROMs that have a lower priority than the Winchester disk controller ROM and then call them. The "do not boot"" flag (DX = OFFFFH) must be set so that the ROM can do any regquired initialization of associated hardware. * Read in the boot sector from the disk, check usability, and jump to the code in the boot sector. it for * If any errors occur in the above area, control is returned to the system ROM. 4.14.3 System RAM Usage . The HWinchester disk ROM uses 30 bytes of RAM in the system This RAM is allocated as a contiguous block of memory previously called ROMs have been allocated their RAM space. block is pointed to by a word in the system vector area. RAM area. only after This RAM The data 4-64 TECHNICAL REFERENCE DEVICE SERVICE ROUTINES structure of this vector area is given in Table 4-12. Address User Table 4-12 RAM Segment Pointers- Value Address 0000:0180 0000:0182 0000:0184 0000:0186 0000:0188 0000:018A 0000:018C C000:018E 0000:0184 0000:0186 0000:0184 0000:0186 System ROM U663 System ROM U63 F400:0000 ROM ¥F400:0000 ROM F400:2000 ROM F400:2000 ROM MHindisk ROM Windisk ROM F400:6000 ROM F400:6000 ROM Option ROM U62 Option ROM U62 RAM segment address for ROM Length of RAM segment in bytes RAM segment address for ROM Length of RAM segment in bytes RAM segment address for ROM Length of RAM segment in bytes RAM segment address for ROM Length of RAM segment in bytes RAM segment address for ROM Length of RAM segment in bytes RAM segment address for ROM Length of RAM segment in bytes F400:A000 F400:0000 F400:2000 F400:4000 (30H) F400:6000 F400:8000 All accesses to the Winchester disk controller RAM area are through the segment pointer at 0000:018CH. Because the :Winchester adisk controller ROM is located at segment OF400H, the segment painter location can also be reached from the code segment at address OF400:C18CH. . The segment pointer allows the Winchester disk controller RAM area to be located anywhere, but care must be taken if the area is moved after the system is initialized. If this is done, the HWinchester disk system must be reinitialized with the Winchester disk option call "0" (Initialize System) after the RAM area is moved and the vectors are set to the new values. To do this, pass the nev segment address in DS and 00O0CH as the pointer to the initialization data. (See paragraph 4.14.318.1.) 4.14.4 Power-up Testing To determine that the Winchester disk controller is working properly, it is tested by its own Fajlures are reported internal diagnostics and the as system errors 1lixx, where RAM diagnostics. xx indicates the error received. If an error occurs, control is returned to the system ROM, F TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.14.5 Booting from the Winchester After the power-up testing of the controller completes, the Winchester goes through the boot sequence. Only drive 4 (E: for MS~- DOS) can be booted. I£ drive S5 is connected to the controller, it can be used for data only. First, the If the drive on), the ROM condition. wait, control conducts the boot procedure polls the drive for the is not ready (as would be true after the routines wait approximately 30 seconds If the user presses the ESC key at any is returned to the system ROM, and the initialization boot. ready condition. power is turned for the ready time during this diskette drive 4.14.6 Error Recovery The error recovery procedures depend on the controller errors (time-outs), the controller retries are attempted. A hardware error code disk DSR. error. For is reset, is returned hardware and no from the For disk retries code. drive errors (seek incomplete, write fault, and so on), no are reported, and the disk DSR returns the hardware error Read Data operations have two types of errors: uncorrectable. 1f the data is correctable, it is error is reportgd directly. A DSR Read Soft Retry this error. correctable and corrected, and no Status reports - For uncorrectable errors, a "restore" is done before each retry. If the retry does not succeed, the data buffer is filled; with CCH when the data cannot be read at all, or with the uncorrected data if the data can be read but contains an ECC error. For other operation errors, a "restore" is placed before each retry. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.14.7 Error Reporting The disk boot can reported DSR is report by the capable of reporting only a few errors. The power-up more but not all. Table 4-13 is a listing of errors digk controller and the codes reported by the DSR. Table 4-13 Winchester DSR Error Codes Reported Error 20H Hardware failure 20H Hardware failure 20H Hardware failure 20H Hardware failure 20H Hardware failure 10H CRC error 10H CRC error O02H Disk format error 04H Record not found 40H Seek error O0H No error (on RETURN) 10H CRC error (soft stat) 01H Command error 02H Disk format error C1H Command error OiH Command errorx* O02H Disk format error GiH Command error* CiH Command errort% 0iH Command errorx 20H Hardware failurex 20H Hardware failurex 20H Hardware failurex Controllier Error O01lH No index detected O02H No seek complete O3H HWrite fault O04H DRIVE NOT READY during operation 06H Track 00 not found 10H ID field read error 1iH VUncorrectable data error 12H Address mark not found 14H Record not found 1SH Seek error 18H Correctable data error 18H Correctable data error 19H Bad track flag detected 1AH Format error 1CH Illegal access'to alternate track 1DH Illegal alternate track for format 1EH Expected alternate track, isn`'t 1FH Alternate track = bad track 20H 1Invalid command 2iH Illegal disk address 30H RAM diagnostic failure 31H Program memory checksum error 32H ECC diagnostic failure * This error should never be encountered by the DSR. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES The errors that can be reported during given in Table 4-13 and Table 4-14. boot are the controller errors Table 4-14 Displayed Error Codes All errors have the following message displayed: *% SYSTEM ERROR -~ 1llxx *%* Where xx = the extended error Extended Error Explanation 33H Status error on REQUEST SENSE STATUS command 40H Time-out wvhile waiting for WRITE DATA mode 41H READ MODE while waiting for WRITE DATA mode 42H COMMAND MODE while waiting for WRITE DATA mode 43H STATUS MODE while waiting for WRITE DATA mode 44H HWHRITE MODE while waiting for READ DATA mode 4SH Time-out while waiting for READ DATA mode 46H COMMAND MODE while waiting for READ DATA mode 47H STATUS MODE while waiting for READ DATA mode 48H WRITE MODE while waiting for COMMAND mode 48H READ MODE while waiting for COMMAND mode 4AH Time-out while waiting for COMMAND mode 4BH STATUS MODE vhile waiting for COMMAND mode 4CH WRITE MODE while waiting for STATUS mode 4DH READ MOBE while waiting for STATUS mode 4AEH COMMAND MODE while waiting for STATUS mode 4FH Time-out while waiting for STATUS mode S1H Disk not ready S2H CRC error S3H Seek error S4H Sector-not-found error SS5H Disk (unknown) error (controller failure) S6H Not a TI-system disk S7H Disk format error S8H Bad boot sector CRC or bad controller S9H System ROM version doesn't support Winchester TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.14.8 Hardwvare Interface Routines This interface to the Winchester disk system implements additional functions in a straightforward way. The calls provide a method of interfacing with the hardware that is almost hardvare-independent. To use this interface, do a long call through the RAM area of the Winchester disk controller for the operation in register AH. Other explained with each operation. the first doubleword in ROM. Place the opcode register wusages are For more information, refer to paragraph 4.4.4 and to the table in paragraph 4.5.2, The programming steps required to do the long call are given below. WINROM DD 00000000 :LOCAL PLACE TO STORE VECTOR ;TO ROM. ; The next steps get the entry vector for the Winchester ROM ; code from the ROM data area and put it into local storage PUSH ES XOR AX,AX MOV ES,AX " MOV ES,ES:WORD PTR 18CH LES AX,ES:DWORD PTR 0000 MOV WORD PTR WINROM+2,ES MOV WORD PTR WINROM,AX POP ES ;SAVE ES ;SET ES TO 000QH ;GET WINCH RAM SEGMENT INTO ES ;GET VECTOR FOR WINCH ROM ;SAVE IN OUR DATA AREA B ;RESTORE ES ; The following steps access the Winchester ROM functions ; after the above initialization is completed MOV AH,OPCODE CALL WINROM {SET OPCODE INTO AH ;GO DO THE OPERATION The following entry point. paragraphs explain the operations available from this TECHNICAL REFERENCE DEVICE SERVICE ROUTINES . 4.14.8.1 Initialize Winchester Disk System. = opcode: AH = OOH b Entry: PS:SI = POINTER TO DATA BLOCK offset Value/Use OOH (Word) Sector size in bytes 02H (Byte) Track size in sectors O3H (Byte) Number of surfaces 04H (Byte) Number of cylinders on disk OSH (Byte) Number of error retries C6H (Word) Reduced write current cylinder 08H (Word) Write precomp start cylinder OAH (Byte) Step option OBH (Byte) Error-burst corrected length Exit: Used: AL = Error code AX, BX This operation being used. tells the disk subsystem the type of Hinchester drive It sets the hardware and software data structures so that a user can simply call the DSR to use the drive. 4.14.8.2 Check WHinchester ROM Version. Opcode: AH = Ol1H Entry: None Exit: AX = BCD ROM version number . Used: AX Example: If ROM is V1.23, then AX returns O123H This operation returns the Winchester ROM version often useful for software-compatibility checks. number. This is TECHNICAL REFERENCE DEVICE SERVICE ROUTINES, 4.14.8.3 Request Controller Error Sense. Opcode: Entry: Exit: Used: AH = O2H DsS:SI = Address of AL = Error code Z = Set if no error Data block contains AX,CX,81,DI 6-byte what data block controller returned. This operation gets error information an error code. If the controller error codes are returned. from the hardware controller is broken, and returns appropriate 4.14.8.4 Send Winchester Controller Command. Opcode: Entry: Exit: Used: AH = O3H DS:SI = Address of 6-byte data block containing command and other data (see hardware spec) AL = Error code if Carry flag is set Z = Set, C = Reset if no error Z = Set, C = Set if time-out Z = Reset, C = Set if improper controller mode AX,CX,sI This operation sends a command for a response. to the controller. It does not wait 4.14.8.5 Get Data From the Winchester Controller. Opcode: Entry: Exit: Used: AH = O4H ES:DI = Address of buffer to receive data CX = Number of bytes of data to get AL = Error code if Carry flag is set Z = Set, C = Reset if no error Z = Set, C = Set if time-out Z = Reset, AX,CX,DI C = sSet if improper controller mode This operation waits for the controller to provide data and then puts it into the user's buffer. The operation waits about 1 second before returning a state or the time-out error. If the controller is in the command status state, an appropriate error code is returned. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.14.8.6 Hrite Data to the Winchester Controller. Opcode: Entry: Exit: Used: AH = O0SH ES:DI = Address of data buffer to transmit CX = Number of bytes of data to put AL = Error code if Carry flag is set Z = Set, = Reset if no error Z = Set, C = Set if time-out Z = Reset, C = Set if improper controller AX,CX,DI mode This operation waits for the controller to ask for data and then writes from the user's buffer to the controller. The operation waits about 1 second before returning a time-out error. If the controller is in the command state or the status state, an appropriate error code is returned. & 4.14.8.7 Get Status From Winchester Controller. Opcode: Entry: Exit: Used: AH = O6H None AL = Error code if Carry flag is set Z = Set, C = Reset if no error 2 = Set, C = set if time-out Z = Reset, C = Set if controller mode is Z = Reset, C = Reset if status indicates has an error « AX,CX Sy not status controller This operation waits for the status return from the controller. The operation waits about 1 second before returning a time-out error. If the controller is in the command state or the data-transfer state, an appropriate error code is returned. TECHNICAL REFERENCE y DEVICE SERVICE ROUTINES 4.14.8.8 Get and Compare Data From the Winchester Controller. Opcode: Entry: Exit: Used: AH = O7H ES:DI = Address of buffer to receive data X = Number of bytes of data to get AL = Error code if C flag is set Z = Set, C = Reset if no error Z = Set, C = Set if time-out Z = Reget, Z = Reset, C = Set if improper controller mode C = Reset if data does not compare; if no compare, DI to the miscompared data AX,CX,DI This operation waits for compares it with the data compare, the data pointer the controller to provide in the user's buffer. If (DS:DI) is set to point at data and then the data does not the data address that does not compare. After a wait of about returns a time-out error. If the controller is in or the status state, an appropriate error code is 1 s, the controller the command state returned. 4.14.98.9 Enable Data and Status Interrupt From Controller. Opcode: AH = O08H Entry: None Exit: None Used: AX + This operation enables the Winchester controller interrupts to the system bus, However, this operation does not enable the system interrupts from the interrupt controller or from the processor interrupt. 4.14.8.10 Enable Status Interrupt From Controller. Opcode: Entry: Exity: Used: AH = OSH None None AX This operation system Dbus. interrupts from interrupt,. enables the Winchester controller However, this operation does the interrupt controller or interrupts to the not enable the system from the processor TECHNICAL REFERENCE DEVICE SERVICE ROUTIKES 4.14.8.11 Disable Opcode: Entry: Exity: Used: Data and Status AH = OAH None None AX Interrupt From- Controller. c e This operation disables the Winchester controller interrupts to the system bus. However, this operation does not disable the system interrupts from the interrupt controller or from the processor interrupt. 4.14.8.12 Poll for Controller Request. Opcode: Entry: Exit: Used: AH = OBH None Z = Set if request is not active Z = Reset if request is active AX This operation determines when the controller is ready for command, status, data in, or data out. 4.14.8.13 Format a Track. Opcode: AH = OCH Entry: DL = Drive number (4,5) PH = Interleave factor TM~ CX = Logical track number to format The drive parameters must have been set using operation O. Exit: AL = Error code, 0 if OK CX = Track number of error, if there is an error Used: AX,BX,CX,DX,s1,DI This operation formats a track on the Winchester disk. The drive parameters must be set up by a call to operation 0. Multiplying the cylinder number by the number of surfaces, then adding in the surface number yields the Jlogical track number. The interleave factor is typically 12 or 13 for optimum use of the DSR in reading sequential sectors. The error code returned is the controller error code with extentions for such conditions as time-outs. This operation always does a RESTORE operation before the track format, so it is slow to format a disk. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.14,8,14 Farmat an Alternate Track. Opcode: AH = ODH Entry: DL = Drive number (4,S5) DH = Interleave factor CX = Logical track number to format BX = Logical track number of alternate The drive parameters must have been set using operation 0 Exit: | AL = Error code, 0 if OK CX = Track number of error, if there is an error Used: AX,BX,CX,DX,SI,DI Formatting routines use this operation to map a bad track to an alternate track. The drive parameters must be set up by a call to operation 0. Multiplying the cylinder number by the number of surfaces, then adding the surface number yields the logical track number. The interleave factor is typically 12 or 13 for optimum use of the DSR in reading sequential sectors. The error code returned is the controller error code with extensions for such conditions as time-outs. 4.14.8.15S Format a Track as Bad. Opcode: AH = OEH Entry: DL = Drive number (4,S) DH = Interleave factor ', CX = Logical track number to format s The drive parameters must have been set using operation © Exit: AL = Error code, 0 if OK ~ CX = Track number of error, if there is an error Used: AX,BX,CX,DX,S%,DI This operation formats a defective track so that read operations do not miss the defect. The drive parameters must be set up by a call to operation 0. Multiplying the cylinder number by the number of surfaces, then adding the surface number yields the logical track number. The factor is typically 12 or 13 for optimum use of the DSR in reading sequential sectors. The error code returned is the controller error code with extentions for such conditions as time- outs. This operation always does a RESTORE operation before the track format. TECHNICAL REFERENCE DEVICE SERVICE ROUTINES 4.14.8.16 Check the Track Format. Opcode: AH = OFH Entry: DL = Drive number (4,5) DH = Interleave factor CX = Logical track number to check The drive parameters must have been set using operation 0. Exit: AL = Error code, O if OK Used: CX = Track number AX,BX,CX,DX,sI,BI of error, if there is an error This operation checks a track for proper format. This routine does not report errors for tracks that have been formatted as bad tracks or alternate tracks unless the ID fields are incorrect. The drive parameters must be set up by a call to operation 0. Multiplying the cylinder number by the number of surfaces, then adding the surface number, yields the 1logical track number. The interleave factor is typically 12 or 13 for optimum use of the DSR in reading sequential sectors. The error code returned is the controller error code with extentions for such conditions as time-outs. 4.14.8.17 Format a Winchester Drive. Opcode: AH = 10H Entry: DL = Drive number (4,S) DH = Interleave factor a CX = Logical track number to begin format The drive parameters must have been set using operation 0. Exit: AL = Error code, 0 if OK n CX = Track number of error, if there is an error Used: AX,BX,CX,DX,sI,DI This operation formats a Winchester drive. The drive parameters must be set by a call to operation 0. Multiplying the cylinder number by the number of surfaces, then adding the surface number, yields the logical track number. The interleave factor is typically 12 or 13 for optimum use of the DSR in reading sequential sectors. The error code returned is the controller error code with extentions for such conditions as time-outs. If an error occurs during the drive formatting operation, register CX returns the track in error. If the formatting operation must be completed, increment the track number and call the routine again. This could be necessary, for instance, .if a drive defect falls directly on an address mark or ID field. TECHNICAL REFERENCE ASSEMBLY DRAWINGS AND LISTS OF MATERIJIALS Section S ASSEMBLY DRAWINGS AND LISTS OF MATERIALS This section contains applicable to the Texas assembly drawings and Instruments Professional lists of Computer. materials Title TI Drawing No. Page No. Motherbeoard Assembly Alphanumeric CRT Controller Board Option RAM Board IC, Numeric Coprocessor Power Supply Assembly Main Enclosure Keyboard (Domestic) System Assy,Domestic System Assy,International Graphics Video Controller Electrical Pin Configuration Communication Card Cable Assembly (motherboard to Floppy disk) o Option Kit, RAM Chips Video CRT Controller Cable, Video Monochrome Cable, Parallel Printer Wire List, Parallel Printer Color Display Unit Winchester Disk Controller Outline Specification, Option Soard Configuration, Power Cord AC Diskette Drive Cable Assembly, Daisy Chain Cable Assembly, Radial Cable Assembly, (motherboard to external floppy) Cable Assy, External Drive Speech Electronics Telephone Electronics 256/512 RAM Expansion 256 RAM Expansion Speech/Telephone Assembly . Keyboard, Low Profile Communications Loopback Plug 2223003 2223009 2223015 2221021 2223037 2223038 2223038 2223050 2223051 2223061 223082 2223094 ¢ 2223087 : 2223088 2223100 2223105 2223106 2223107 2223219 2223220 2223231 2223278 0986289 2232326 2232327 2232329 2232332 2232373 2232403 2234243 2234246 2234261 2230528 2207885 5-3 S5-17 5-28 S$-35 S~-41 S-47 S-51 5-53 S-61 5-67 5-80 5-84 5-89 5-93 5-384 S-10S 5-107 S-116 S-118 S-127 5-133 §-141 $~143 $-150 5-154 s-158 §-160 $5-162 S~169 S-180 S-184 5-186 S-188 5-201 S-1/2 . i} s: me£0 EqLr22]2 -- 2 189] 9900 Sl=ISvYoO5sdd - UQY Y08; vOsdHIOn v [IIBLI= N-IS[ LS, A0 \ o] T T, = ST > 1 - etWO iviiaismvere s e = wesvesaow= i LDyCIIIVCREIPBITTISTANT) B oy S= Ty EresAonTs o IYIY[R[ ST S(3S[0[R 7[ Se[ | Y] ixo--savszzz] smeoms. 7o0=00s0oo6ez2zz | iRwI§sdSV) W4 1000 -012E222 |08 15)4] m_fl AW FyXrHoVrSesF1 OuN1KH9mK 1|[10o00o ||| 127000~--22s20316i | |T8v00a70n5s] |3 = = 1o 1=, = =] 2l de I 2vaeA[5vIl2{vl]Seov*Ii]aalOv{ilvVaivaavfTiswvTaailv<[f|¥W][a¥a3A|]3l]W¢f TaavJs[[aflv]a]f[aaca[[[A0Raf]lw3[3]ln]3ea3[{x[a]Wa]]x[0F[n{]][VWdx]}D]]]]%¥]|To101o0t000o00000-00--:to5Gvor¥0O0pzo0E2tTtsEzR2L2ZZ22ZZz2_A _wA3aw0N8wa4Id, svIs1iSyag0,] & sTC oR"A%sLL<zZ590 v$20 LEVHI NOISYMNOI [ \ 5-3 |L75r QUIN S S PEAVNIOUI5L 4--V1OCS3T7N9 I5GI3O7T0IRI NdIYIOOW 710A00I0500t0--n§cN0o0ots12232z0ZZ8 is-0) zus v M3IA 10 INOZ'T HS NO L NOT ATY syws 2 G5 > z a it i D18 Te 227D N 161= XOOTL 718 37 W TIATS SE]833 GUVGAN ]K73[VL(80e t1I)3NA145eGQ1TRIA)7z -YSLV3VTiwVMANANETtD WA]40N](]Di|3U1|S0VI{0¥Qw01&TWoAGSU1VOG 1#L1IM ATW8QQT3I1v0T2t5A0NoN0I1BH710I0L1WIoO1-5sy0NYT1#0O9%N3Oi0vI (N90IWG0W2SNS00)03V0UtA1V00-M110M1V29W0y11,10VOSi106V)A I003140vA0G1~90~TG31oWTW-1mRAIYN0rTwYgrMMLGooa1eOSt0eWI fP nTwy-(g3AGAaAMV72O(G@IQN33Sw3eIT3kr1vO0},GNTYA6uPro001irM V7 (T00G)Ispt12I)Z1TRsCOWAw01aLT1DWOaE000IIaO066e89IM1WLR5aDv500NNc0nS VT5 E9VIL0093TlTa3eISwVYIti66091WIer0IV-ItN000%ApS0%AotOROw8w5LSWGIoH BisWaAva01Y14lTMuC34dynQB33(0MSIsNYHY0GOI0DIwI[[[00T0[aM:-VaST]5TIWsuv,TVyWWIhY]]S | IS TSNSNSUILSI07I2N¢7U0X ON2(1F@) 2B913641120005oNH(#WD1I[KT1Tt ] 3O - T _GOY () ) WY 5OI 1T 0CO=-Ta0DnJuv151v5T21003R0)w(8())(aZS(vT0oo7aWesc77er9o-s/0Jn200i2ns550msw5dpyoa43mn2n2ocIn3y[[][g75]|1T]]]] TSes'Ngv J2_S3WMwe1WiDr21 W]11M 1[o)YOAT--SE2y6T2 l01I1)M1O1L7202 0(A@eLYNI8dDRWI2SSIIYVCFIMM2EVeAA0Ne2A99DDNdW1L1[11|4K1T~)[HV ] THIS SN x:euul.ij oS AY = B Yo [MOIS2oV3LMnNAOwUvS*ITNiYEWTT4O-IaAE13ILSW0T0t1#VIvWI3V02TIAT1I0JNoNFYSR00RI0NWmS-FG4IUTD0MHTT$91L¥NIA6MIF20SN0SMYO0ITU5S8TYIM8MN2HISYLGHT2IWNTIMBLN2IGTSMTrY30R'OmBM1Y§OOe aW)IKASNnMA0LL1iYIaW00IELdLvA06VLeT-A1IS"YsTO0YO1WLGW53AA'63SITV00OL)f0RHV1wIYR62Y0eI1M2SN28d2TV0o42O3I%A0VNaT8Ae II1LS34NW30S4Q)FYVVWXTLGTIaVNM21HnII5QOIAHvoLMwRISOe3IImwAIBAnTaTyTedXMIYsOTWuSRMl T¥WBIT(QSUIMWLWYTDALVLI2`T9SA00WXNNNVMII0EMNS20OISU00L1I0V-VSI0LVO-AETN»YN9RIMOM01 LTHL3 E2QBIACAI20IT2DW0V0 0NAI0IvLS0E-0NMT001I-WLLV2Gl6I02bS2E2T4ULT0YK)61TN10 NO 6"N4S0)"I0IS32ob4-N1-2StO- 22WS6vVNW1NlIi0dD3tN?Y0 YILNIOY I(fiLNOVNIVVIS6 JLCIWL3XLDI0T)JO #iNf OIOWNL3TYLIIWWMIIASNNNDeISY 3 [ 2 `44 [§] [F] [T TM SINW NA m USBI6LTVWIV0L2LO7 OIONJVOuW0'81NL2AAN(O0TI2MN3IQTATLSy11 ALSDS) T9M39V6 AWNAyLL +32°T2I3VWAoSwA1sI0 ILLVNIISOJNNAOOALNNIL1OIIN2SODH9DI0SL2NNIIIWWVIOAILLYHIWSTL7NSTDTF"OBONOEOMYINNIULYNNARGIOS1GNIUUNDIVLSSIIS§FH31YYSIOIGSSM1iLIM1NOs"A3YIIIONINIYGNONWSSLGNIIISOJ0VINoSTOVv OC M MTIGVOHOVNINT3OSO OWWLt 30U0I3d WTI[ L/V$I5lI7O2N0S 80IsIaVovEWsS t s I 9 ' . [3) SRV . NOFISSIINIZYI0O8WSV S¥ 3N0 OILHYSNIION ZUWVIIdSIOSdWow71T4o3w7s [) TIVHE GO0 IL NOIN IGIOVOR 13PHLL 51F0R2OVY NNONN: VHLIsLNNTITN.e OSSITQNUOLD25SI 0M6°CTo1IK4m7v1d3 =2 [T) ORAOIAS FEMEIUO SSTN SUON [ . i ° k- M0 IAIT AZ¥ QLGN 2e |sosral| .wS13ZVL1OJ7N{N£)H5.0°01N'3I0 3Nw9Or0Ig3SyI311A3Zr%Yva.onrys2 QiAnM3a2yyt) [9¢ TITIVLN SPAGIQITISHEENT XI® VIAIT ATy O 04N (§) 2B dwe.--WT :|73ol "SEgOMYr0Dw8701»80"0-38-ESwa (`10)8 2 #S3 tWO av| T AT L1 240N AFSIATY (1) =AJ (G) ¥EFLRIN)] NA7g2TwISaISNTIIWYIUEIo N)ONT5 01ITnr0uLTaOPiNdD [y N\12}; 59128 oQoSUtSR0Iw Ton Ve v.S a1nB0YKS16r53e10n6c00ysv8o0Va1n81) a1 5 > i) ¥ 7302 7horns WIGOaoHav TI1A9T0I0 AwTY2yQLvv auaEUn iyl RN TS b o S CE N AP T TI e -- > e et 1L ) 311} [eser | 25 - GV 5OT MG (6 B0LLWU TRTUSTTRNV of4T1AEt&u.v1,QOe0_I0mS,S5u:I~Nn_TT"E%.Ys"1%aW143So"am=&e3(fn5BA1F1CAT6O"w8NSQCnUTIIUW1URIaIETGLTnNDESEsORQLeIUFaV1DT0iTo20n0IyTNI o] B=t b b62177 G > s whits e ev % 4 %2 y-3|ealsees e -- -s | o | a5a©#50£eI11`B321:4&08T2S3u9Te.Wo4YOOssT(It1NDYO0E1AIO5dB4IIS8IRILT0VYyT19dDeHGRS3S1ITS0MMOwE,WTW02STvJVWLILOLNs "g set d a SvnTe«alegmc4g| 7 13040321060440012D£219¥WS1hesmen101u10Ws73n010))0 1 T FuG|i+sAly [eJ<o0ceee T m-- 0 7628 :` \ | W B ' BN () nil 7 ! i " 3 T = * \_. _ TM oo " o = R & e = . : i P S wif1i:X eneld:s ' et E q X ¥y - - 7 ¥{6M9} 1 3H3S§ v ¥ S T fléfil---------- i cIh fi-ap iflgfa:efad{tmaj B 5 4 {g&o20z'29nx) SO SOL STIMOL MIFTS AIIYNOITWISAO0CTWYOLHLiVitGh U gammser 39 aew 1y onv'orn (0351 91) 11y S104 9 (so10-me2t6 z\.» YOLSISTY WLk SYM b1y ANV (00122206 M10)Y00t sm LWtyY'Ly 3iT1a5w33507an0e MQv WIALRIy SAOSSYSHiwd0 [T ML SSOVIN(1000-L92L6 NI)5E WILI ONV L1y (000~ @¥Eu2Md) M WAL TIVISK ¥3a¥T @iy IV TIBTNLAVSINIOVSTGE1I0W6A WQDTN§1TT10H0D S1010 %0 NOILISOS NI 1A1WTMYOGIAw0sIsHvaeNwnTso [T) 5] ® TS *i0d e 0D 4op /@ T oT-1sn e15on 1 nnes A T - LTU"VH1SUI0VT}NESVOT1I7H0A4WNWT0150Q3IUSWNAOG4II0SULILNSLTTEUBWYSIB1NM2UIEV0DGMSTT-D)SNwBOU1AS3ETNHtGy TGV TEM AWIN iMaOwMnEr S150 INA2WI7S1E4Y 11 »1 16 S0 9 z T e 12714783 PART NUMBER PEV 2223003-0051 AG 1TEM, QUANTITY, 0002 REF ooacs n"09l .000 00974A 00040 0004C 0009 00001, 090 00094 0013 0C005, 030 00134 0014 0000t .000 00144 0024 00001, 000 00244 00240 0024C 0026 00001, 0230 0026A 0032 09001. 000 00324 0034 00000, 000 00344 00348 0034C 00340 0034E 0034F 00335 00002. 000 00354 00358 0035C 0041 0C001.900 List of Materials DESCPIPTINN.veaseavoscscesssacscccssssne MOTHERADARD - PFGASUS COMPONTNT.. DESCRIPTINMNesecocscsscscanssscccocssscns UM 2223005-0001 DTAGRAM,LAGIC, MOTHFRPOARD EA 22101R8-0018 2210R35-0010 2211342-0016 0996166-0005 0972811-0001 SNoC DIPK 440E -PINT S,LOW PROFILE EA SEE T -T DRAWING xu2 SFF T -1 DRAWING *T1-CRB40-41 SOCKEY 1S AN SEE T -1 DRAWING ®*ACCEPTARLE SUBSTITUTF SEE T -1 DRAWING CRYSTAL+15.00 MHZ,HC~-1R/U MND CASF EA SEE T1- DRAWING Yl SEF TI1- DRAWING CONM,CARD-EDGF,31 DUAL PNS,NO FARS EA SEE TT- NRAWING J1¢32933404,J5 SEE T1- DRAWIMG HEADER, SOCKFT, SHORT SOLNER T 6 CIRCUITS EA AMP - 350827-1 Jé AMP - 350827-1 NFTHORK-SNT4LS280N A U3l ITFM 136 (PN 2210704-0001} IS AN ACCEPTABLE SUBSTITUTE 2210293-0003 DELAY MODULE, TAPPED, 3NS RISF TIME MAX EA SEE Tl- DRAWING u3o SEE T1- DRAWING » 2211342-C01S CNNN,CARD-FDGE,22 NUAL POS,NO FARS EA SEE TI- DRAWING J1o SEE TI- DRAWING 2223064~0005 ROM, SYSTEMS EA 0000-0000-000 us3 0000-0000-000 ITEM 118 (2223031-0005) IN 0000-0000-000 CONJUNCTION WITH ITEM 119 0000-0000-000 12223031-00061 COMSTITUTF 0000-0000-000 AM ACCEPTABLE SUBSTITUTE 0000-0000-000 FOR ITEM 34, 0000-0000-000 2210188-0016 SOCKET,01P¢24~PIN,LOW PROFILE A SEE T -1 DRAWING XU62, XUS63 SEE Y -1 DRAWING *T1-C0824-41 SNCKET IS AN SEE T -1 NRAWING *ACCEPTABLE SUBSTITUTE SEE T -1 DRAWING 0996151-0005 HFADER,17 PINS PER ROW,STPAIGHT ,NBL ROW A 5935-0900-000 56 12/14/83 PART HUMBER REV 2223093-2001 AG 1TEM, QUANTITY, 00414 0042 0C001.000 00424 0043 07°001.00C 0043A 0044 00444 00004.000 0054 oco0d1.00C 00544 0058 0000t .000 00584 0059 00001.000 00574 0060 00604 0079 0¢001.000 0co001.000 00794 0080 0080A oos3 00834 00001.000 0Cco0Cc1.000 0090 00904 0093 00934 0093R 00001.000 0Cc002.000 0093¢C 0095 0C002.%500 0096 0097 0098 00002.000 ccool.000 00007.000 List of Materials DESCRIPTION.ccsccesssovasecscacscsaccncns MOTHFRADAPD - PEGASUS COMPONFNT.. DESCRIPTION.ccccoocesosssscocccercsssscse UM 0996151-0002 0996151-0008 2211348-0002 2211079-0006 222049 5-0001 2220488-0003 0972537-0003 0972227-0013 0972227-0009 0972927-0025 2211700-0002 2211873-0002 0532348-0400 00R5936-0064 22231036-0001 09724870001 J9 5$935-0900-000 HEADER,20 PINS,STRATGHT,NNUBLE ROW EA 22526--65611-140 J13 22576--65611-140 HEADER,PIN,3 PINS, STR, DOUBLF ROW A 022526-65611-106 1-F6 022526-65611-106 HEADE1 R-R,OW 2-PNS,100 CENTER GOLD A SEE TI- DRAWING 17-18,F19-F20,J11-J12 SFE TI- DRAWING 1C, +5 VOLT REGULATOR,RURN-TN FA SEF TI~ DRAWING u22 SEE T1- NPAWING CNNNyPCR-MTG,5 FFMALF CONTACTS,RT ANGLE FA SFE Tl- NRAWING Ja SEF TU- DRAWING COMMECTNR,RFCEPTACLE,PCR,25-PINS EA SEE Ti- DRAWING Jr SEE TI- DRAWING DINNE,LED RED RT ANGLE EA 072619-550-0406 CR1 a 072619-550-0406 RESISTOR, SO000 OHM, 22-TURN TRIMMER EA SEE TI- MRAWING R18 SEE TI- DRAWING RES,VAR, 5000 OHMS,1/2 WATT, CERMET EA 032997-3292W-1-502 rR19 032997-3292W-1-502 CAPACITOR,B2PF 500V S% FIX,MICA DIELECTR EA mIL ~CMROSER20-J0N cs MIL -CMPOSER20-J0D CAP, 220UF, 6.3V, 20% A SEE Ti- DRAWING c12 SEE TI- NPAWING TRAMS MPS 6602, NPN,COMPLEMENTRY DR VER FA SEE TI- DRAWING Q1,02 SEE TI- DRAWING *1TEM 140 IS AN ACCEPTABLE SEE TI- DRAWING *SURSTITUTE SEF TI- DRAWING STUD, EXTENSION-CRFS #4-40 X .188 EA EYFLET-ROLLED FLANGE,. 116 0.0.4.219 L A PLATE,KEYBOARD PLUG EA 1678-3036-033 JUMPER PLUG,CONNECTNR BLACK EA 5935-0900-000 5-6 12/714/83 PART NUMBER REV 2223003-~0001 AG ITEM. QUANTITY, 0100 0103 0103A 0104 0104A 0109 01094 REF 00001.000 00001.000 00001.000 0110 ol1t o113 REF 00002,000 00000.002 0114 o116 0116A o117 01174 olts 01184 a1188 otisc o118p oti9 01194 01198 o119c 01190 0136 01364 01368 AR 00002.000 00001.000 00001.000 00001.000 00000.000 List of Materials DESC . ccR evavI seoP cccsT escsI nsosO ccsN cscsse MOTHFRBOARD - PEGASUS COMPONENT.. OFSCRIPTIONcasccececovecscscoccnscncsces UM 0994396-0001 PROC.+ SITE/ODATE CODE AND SERTALTZATION EA 0972537-C004 LED, YELLOWsRT ANG PCB MTGe2.3V,5.0VR EA SEE TI- DRAWING CR2 SEE TI- DRAWING 0972537-0002 DINDE,LED GREEN RT ANGLE EA 072619-550-0206 CR3 072619-550-0206 0972934-0011 DIODE,IN7S6A 8.2 V S% SIL VOLT REG EA QPL - INT56A CRS QPL = INT56A 2223270-0001 SPECIFICATION,UNIT TEST-MOTHERBOARD EA 0411104-0135 WASHER, LOCK-SPRING, HELICAL, #4 EA QPL - M535338-135 0411435-0408 TAPE, INSULATION,ELECT1/.4 IN RL MMM ~ S56-1/4& 0415804-0005 SFAL COMP,A*ROBIC-BLUE,GD C,10CC BOTTLE EA 2211348-0003 HEA 1 -D ROW E ,3-R P0S,,.,100 CENTERS,GOLD EA SEE TI- DRAWING E13-15,R17 SEE T~ DRAWING ?2232425-0001 HEADER,2 X 2,MODIFIED EA 1254-2425-000 E10-12 2 1254-2425-000 2223031-0005 EPROM, SYSTEM ROM, U62 FA 0000-~0000-000 u62 = 0000~-0000-000 ITEM 118 USED WITH ITEM 119 0000-0000-000 IS AN ACCEPTABLE SUBSTITUTE 0000-0000-000 FOR ITEM 34, 0000-0000-000 2223031-0006 EPROM, SYSTEM ROM, U63 EA 0000-0000-000 us3 0000-0000-000 ITEN 119 USED WITH ITEM 118 0000-0000-000 IS AN ACCEPTABLE SUBSTITUTE 0000~0000~000 FOR ITEM 34, 0000-0000-000 2210704-0001 1C,LS280,9-BIT ODD/EVEN PARITY GEN/CHK EA V-L1ST-1$280 BURN-TN U3l V-LIST-LS280 BURN-IN SUBSTITUTE FOR ITEM 24 V-L1ST-LS280 BURN-IN 57 T 12714783 PART NUMBER REV 2223003-0001 AG 1TEM, QUANTITY. 0137 00000.100 0138 REF 0140 00000.000 0140A 01408 0999 00001.000 9999 00001.000 List of Materials DESCRIPTIONccooccrososcacase MOTHERBOARD - PEGASUS COMPONENT,. DESCRIPTIONcccscsovavsesossscscccassscae 0535978-0058 WIRE ELEC. +SOLTD,"KYNARTM INSUL #30 AWG 2232440-0001 SPECIFICATION, TIPC MOTHERBOARD 2211415-0001 TRANSISTOR NPM *ITEM 140 IS AN ACCEPTABLE *SUBSTITUTE FOR ITEM 93 2223003-5001 0239999-9999 MOTHERBOARD -~ PEGASUS 1254-3004-069 CNST, SHRINKAGE = AUTD INSERT UM FT A EA EA EA 12/14/83 PART NUMBER REV 2223003-5001 AG ITEM. QUANTITY. 0001 00001.000 0003 00001.000 00034 0005 06001.000 00054 0006 00001.000 00064A 0007 00003.000 00074 00078 0007C 0008 00003.000 0008A 00080 0008¢C 0010 00001.000 0010A 0011 00001.000 DESCRIPTIONcccosccosscccoosasssvsssvsssse MOTHERBNARD ~ PEGASUS = AUTO INSERT COMPONENT..« 2223004-0001 2220419-0001 2220424-0001 2220414-0001 0996420-0001 0996029-0001 2220435-0001 2220412-0001 DESCRIPTIONccecrssenssccscssvesoccccccee UM SP11ECW6yEB69M-TMI0IO-C0T0RH0EOD-RRP0BA0ROW0AIORNCDGESSCOPRU EA EA USS11CEEl,EE MITTIC~-ROPDDRRROAACWWEIISNNGSGOR BUS CONTROLLER 5 EA u0UTUS000SSII11IIsSEEECS0CT000C3,EE,EE1.111,M¢2U222STA9b9N99NTTTTS5,5I15IT5LN1~U-----42-,7A~TS1CLSS4CSSNLSNNLNCNDDDTD27TSTETRRR4(C7A434P4AAAPLKL3TLLTNLWWWSSN3SSAIIISI3N33BNNN2T7G2GGGLTTT33E2EOI33IIN1CNNNNNE0TRA7SLA2UT0BO-SRD0T-0IT0TY1APUN)ETDE DRTVER FLIP/FLOP EA EA EA TUTT11IlISC4T,ETM4APUNR4O192G~~A~,2RSCSSUANCNN5MTETT1(M4PA4PATLNLLBASSSLB2222ELTTT2EI331NNN0I7NS0TU2EB-RS0RT0UI0PT1TU)TECONTROLLER uSS1CsEEyEsE TI- DRAWING USTIA-RT,DPRRAOWGI.NGCOMMUNICATION INTERFERENCE A EA SEE TI- DRAWING 5-8 12714783 PART NUMBER REV 2223003~5001 AG ITEM. QUANTITY, 0011A 0012 00001.000 00124 0015 00001.000 0015A 00158 0015C 0016 00001.000 00164 00168 oore6c 0017 00001.000 0017A oole £0000.000 00184 0019 000601.000 00194 0020 00002.000 0020A 0021 00001.000 0021A 0022 00001 .000 0022A 0023 00000.000 0023a 0025 00001.000 0025A pozse 0025C 0027 90001.000 00274 List of Materials DMOETSHCERRIBPOTAIRODNcc- esPsEsGcAcSUrSocs-csAsUsTsOsccINaScEcRoTscans COMPONENT.. 2220626-0001 0972900-7138 0972900-7139 2223052-0002 2211984-0007 2211102-0001 0972141-0057 2220445-0001 2223053-0001 2211984-0011 0972810-0001 ODESCRIPTION.. seccsevessessssncsscvssas UM TTUTTuTTUSSuTTSII1I1t111IIIesSSEssEENRNTTIs3EssEEEEEEOCTTMMM,AWAW,MNNOOTTTS0IRRII1Y11SK-K-2-2S-------AA,43T~SSSCSSSS1CESNNN6CNNNNCDDDMN-TTTETTTTERRRSS([TR4SP44444PAAAPNPN4ILTNLLLNLTLLWWWTTLDTSASSSSIIA7SIS4ESB41NNLL1NB111LC122LLGG3G333L333OS322SPE889E9889D91111RNNN8NNNEN303G0869M6NSS5NR5U4UHL3=BAB--SLS001TT0I02II0N0LTTT116UUE))TTREEV_AL TIMER . EA £A £a A US4 I1C,DMPAL12L6NC EA SEE TI- DRAWING *US4,ALTERNATE FOR ITEM 17 SEE TI- DRAWING 4 1C4F40T1BPCOR,QUAD, 2-TNPUT , 5071 -BURN-IN FA SEE TI-DRAWING us8 - SEE TI-DRAWING NETWORK4RES. 4.7 K OHM 2 X 14 PIN DIP EA BFC = 899-1-R4,7K U60,U66 BEC ~ B99-1-R4,7K : IC,OYNAMIC MEMORY CONTROLLER EA SEF TI- DRAWING urr SEF TI- DRAWING ROM,MEMORY CONTROL, HALI6R4A EA 1669-0000-000 u2s 1669-0000-000 1C+ DMPAL 16RANC EA SEE TI- ORAWING *U28,ALTERNATE FOR ITEM 22 SEE TI- DRAWING NETHORK-SNT4LS221N EA u29 ITEM 125 (PN 2210689-0001} 1s AN.ACCEPTABLE SUBSTITUTE 0219402-7410 ICy, SNT4S10N EA ue 5-9 12/16/83 PART NUMBER REV 2223003-5001 AG ITEM, QUANTITY., 0028 00001.000 0028A 00288 0028C 0029 00001.000 00294 00298 0029C 0030 00003.000 00304 00308 0030C 0031 00009.000 00314 00318 0031C 0033 00334 00004,000 00338 0033¢C 0036 00001.000 00364 0037 00001.000 00374 0038 00001.000 00384 0039 00001.000 00394 0040 00404 00000,.000 0045 00001.000 List of Materials DESCRIPTION :ccecscvecccocsosscsssscsvases MOTHERBOARD - PEGASUS = AUTO INSERT COMPONENT.. DESCRIPTION:ccooossvseococcasccccccccnss UM 0972900-7420 NETWORK SN74LS20N EA u32 ITEM 126 (PN 2210614-0001) IS AN ACCEPTABLE SUBSTTITUTE 0972900-T432 NETWORK SNT4LS32N EA TI ~SNT4LS32N U3 T =SN74L S32N ITEM 127 (PN 2210621-0001} T =SNT4LS32N 1S AN ACCEPTABLE SURSTITUTE T1 =SNT4ALS32N 0972900-74T74 NETHNRK SN74LST74N A U21,U33,U68 1TEM 128 (PN 2210631-0001) 2211118-0005 IS AN ACCEPTABLE SUBSTITUTE IC4 64K X 1-BIT RAM,350 NSEC,READ CY TIME EA U35,u36,U3T,U38,uU39 U40,U41,U42,U43 ITEM 120. IS AN ALTERNATE 0996755-0001 IC,SN74LS245N BUS XCVR TRANSITION EA 001295-SNT4L S245N - ug,Ul12,U52,U61 001295-SNT4LS245N ITEM 129 (PN 2210695-0001) 001295~-SNT74L S245N IS AN ACCEPTARLE SUBSTITUTE 001295-SNT4L S245N 2220415-0001 IC+FLOPPY DISX CONTROLLER,PLASTIC EA SEE TI- DRAWING u13 SEE TI- DRAWING 2220421-0001 I1CFLOPPY DISK SUPPORT LOGIC FA = © -000 uls4 -- o =000 2220418-0001 IC+FOUR PHASE CLOCK GENERATNR EA SEE TI- DRAWING u1s SEE TI- DRAWING 2223054-0002 ROM FLOPPY SYSTEM CONTROL EA u1l9 2211984~0006 2211771-0001 1CeBLANK PROGRAMMABLE ARRAY OF GATES EA SEE TI- DRAWING *U19, ALTER FOR ITEM 39 SEE TI- DRAWING 1C, SNT4LS620N,EXTERNAL, TEMPERATURE COMP EA SEE TI- DRAWING 5-10 12/14/83 PART NUMBER REV 2223003-5001 AG ITEM. 00454 QUANTITY, 0046 00002.000 00464 0047 00001.000 004TA 0048 00001.000 0048A 00480 0048C 0049 00002.000 00494 0050 00001.000 00504 00508 0050C 0051 00002.000 0051A 00518 0051C 0052 00001.000 0052A 00528 0052C 0053 00001.000 0053A 00538 0053C 0055 00001.000 List of Materials DESCRIPTIOMccaosvcasscccccsse MDTHERADARD - PEGASUS - AUTD COMPDONENT.,. 2211126-0001 0972999-4040 0972669-0001 DESCRIPTIONcceccscsoncacecccsanscecasass ulé SEE TI- DRAWING IC, 1K X & BIT STATIC RAM = o =000 ut7,uLs = o =000 NETHWORK 4040 =SEE TI DRAWING ull -SEF I DRAWING NETWORK ,SNT4LS163N UM EA EA EA u20 ITEM 130 (PN 2210667-0001) IS AN ACCEPTABLE SUBSTITUTE 0222222-7416 NETWORK SNT416N EA =SN7416N U23,U24 ~SNT416N 0222222-7407 NETWORK-SNT4OTN FA TI- -SNT4OTN u2e6 TI- -SN7407N ITEM 131 (PN 2211059-0001) Ti- =SNT40TN IS AN ACCEPTABLE SUBSTITUTF TI=- ~SNT40TN - 0996 089-0004 IC+SNT4LS244N LINE ORIVER A =SNT4LS244N U25,U48 =SNT4LS2644N > ITEM 132 (PN 2210694-0001}) ~SN74L S244N IS AN ACCEPTABLE SUBSTTITUTE ~SNT4LS264N 0972900-7404 NETWORK SN74LSO4N EA uto TTEM 133 {PN 2210604-0001) 1S AN ACCEPTABLE SUBSTITUTF 0996%508-0001 IC,T4LS393N DUAL BINARY COUNTER EA 0D1295-74LS393N uUsé6 001295-T4LS 393N ITEM 134 (PN 2210727-00011 001 295-74L5393N 3 1S AN ACCEPTABLE SUBSTITUTE 001295-74LS393N 0222225-2311 . NETWNRK,COMPARATORSE,F DRAWING A SEE - T1 DRAWING 12/14/83 PART NUMBER REV 2223003-5001 AG ITEM., QUANTITY, 00554 0056 00001.000 0056A 0057 00001.000 00574 0061 00004.000 0061A 0062 00005, 000 00624 0063 00003,.000 00634 0064 00003.000 0064A 0065 00004,000 0065A 0066 00001.000 00664 0067 00001.000 006TA 0068 00001.000 0068A 0069 00001.000 0069A 0070 00002.000 00704 0071 00001.0C0 00TLA 0072 00008.000 0072A 00728 0073 00002.000 List of Materials DESCRIPTION.ccsossscccanscoencnscocccanses MOTHERBOARD - PEGASUS - AUTD INSERT COMPONENT.. DESCRIPTIONcccecsoenscacscaccscsccoscccs 2211349-0001 0996304-0001 U6% SEE = T1 DRAWING IC,SNTS5189AN3, QUAD LINE SEE TI1- DRAWING us7 SEE TI- DRAWING IC+LM386,AMPPWLR,,A uon10 RECEIVERS us9 0972946-0089 0972946-0081 0972946-0085 0972946-0057 0972946-0065 972496-0001 RES FIX 10K OHM 5% «25 W CARBON FILN 1658~ ~000 R104R11+R34¢R6 1658- =000 RES FIX #.7K OHM 5 2 .;5 W CARBON FILM ROH - R-2% RT,R8,R405R41,RIT ROH = R-25 RES FIX 6.8K DHM 5 % 25 W CARBON FILMW ROH - R=25 R26,R27,R28 ROH - R-25 RES FIX 470 OHM S % .25 W CARBON FILM ROH - R-25 R23,R24,R25 ROH ~ R=25 RES FIX 1.0K OHM S% «25 W CARBON FILM ROH - R-25 R&yR214R3IBR44S ROH - R=2% NETHORK, SNT4273N uso 0972946=-0017 0972946-0105 0972946~0037 0972946-0072 0539370-0364 0972946-0045 0972946-0058 RES FIX 10.0 DHM® 5 % .25 W.CARBON FTLM ROH = R~25 R22 ROH = R=25 RES FIX &7 X OHM 5 T 25 W CAPBON FILM ROH = R-25 R13 ROH - R=2% RES FIX 68.0 OHM S % +25 W.CARBON FILNM ROH - R-25 R15 ROH - R-25 RES FIX 2.0K OHM 5 % .25 W CARBON FILM ROH - R=-25 R3,R39 ROH - R=25 RES FIX FILM 604 OHM 1% .25 WATT COR ~ NASS R12 COR - NASS RES FIX 150 OHM 5 T .25 W CARBON FILM SEE TI- DRAWING R29,R30,R31,R32 SEE TI- DRAWING R43yR444R464R4T SEE TI- DRAWING RES FIX 510 OHM 5 £ .25 W CARBON FILM ROH - R=25 UM EA EA EA EA FA EA EA EA A EA EA EA EA EA 5-12 12/14/83 PART NUMBER REV 2223003-5001 AG ITEM, QUANTITY, 0073a 0074 00744 0075 0075A 00001 .000 00001.000 0076 00764 0077 0077A 0081 00814 0082 0082A 0084 00844 0085 00854 0086 00864 0087 00874 0088 0088A 00001.000 00001.000 00001.000 00001.000 00001.000 00001.000 00001.000 00001.000 00012.000 00888 0089 00894 00001.000 0091 00914 00918 0091¢C 0027.000 List of Materials DESCRIPTIONccocevcvsococcssecossssocance MOTHERBOARD - PEGASUS - AUTO INSERT COMPONENT.. DESCRIPTION.ccescosencscvncsasccasrasnee UM 0972946-0049 13972934-0010 0539370-0465 0539370-0430 0972757-0019 0972924-0038 0972757-0009 0972924-0021 0972757-0043 0972763~0013 0972763-0025 0972763-0021 0972763-0001 R1,R2 ROH - R-25 RES FIX 220 DNHM S5 % .25 W CARBON FILM EA ROH - R=-25 R33 ROH ~ R-25 DIODE, INTS5A 7.5 V 5% SIL VOLY REG FA QpPL - IN755A CR4& QPL - IN755A RES FIX FILM 6.81K OHM 1% .25 WATT EA COR = NASS R3S COR - NASS RES FIX FILM 2.94K OMM 1% .25 WATT Ea COR =NASSD-100PPM/C R36 COR -NA5SD-100PPM/C CAPoFIXED CER 3300PF 10% S0V FA c3 CAPACITOR, FIXED,TANT SOLID,35V,10% A ca CAP FIX CER 4TOPF 10% SOV A ca 4 CAP FIX TANT SOLID 1.0 MFD 10 % 50 VOLT EA QPL ~M39003/1-2356 c2 » QPL -M39003/1-2356 CAPACITOR, 15PF 4 10%,50WVDC,CERAMIC EA SEE TI- DRAWING c1 SEE TI1- DRAWING CAP+FIXED .010UF SO WOLTS EA 004222-MC10SE1037 c9 004222-MC1051032 CAPACITOR, .10UF 50V FX,CERAMIC DIEL EA COR CA-CO3Z5U104Z050A C7+C10+C4%6,4C4T7,C48,C49 CO5R0+CC5A1-C,OC35Z25,VCU5130,4C7504S,0AC55 COR CA-CO325U104Z050A CAP . ,FIXED AXTAL LEAD, 047 UF,+80%,-20% EA 1632-0000~000 c1 1632-0000-000 CAPACITOR, L00L1UF SOV FX CERAMIC DIFL EA COR CA-C0225U1022100A 6,C13,C14,15,C16,C17,C18 COR CA-CO2ZISUL102Z100A C19,020,C21,C22,C23,C24,C25 COR CA-C02Z5U1022100A 26,C27,£28+C29,C30,C31,C32 COR CA-C02Z5U102Z100A 5-13 12/146/83 PART NUMBER REV 2223003-5001 AG 1TEM, QUANTITY, 0091D 0092 00008.000 00924 00928 0094 00001.000 00944 0102 00001.000 01024 01028 o102¢C 0105 % N1054 0106 00001.000 00002.000 0106A 0107 00001.000 0107A « 0108 00001.000 0108A 0112 00001.000 01124 o11s 00001.000 0115A 0120 00000.000 0120A 01208 0120C 0121 00000.000 01214 01218 List of Materials DESCRIPTION svececossocosscccsasanacanns MOTHERBOARD ~ PEGASUS - AUTO INSERT COMPONENT.. DESCRIPTION:cosescccaasccsnccsscosscscce UM 0972924-0018 0972946-0053 0972900-7400 0972946-0035 0972757-0001 0972946-C083 0972946~0047 0972946-0093 0972946-0127 2211118-0004 2210720-0001 33,034,4(35,C36,037,C57 COR CA-CQ2Z5U1027100A CAP FIX TANT SOLID 6.8 MFD 10 % 35 VOLT EA QPL -M39003/1-2304 C38,C39,C40,C41,C42, QPL -M39003/1-2304 C43,044,C45 QPL -M39003/1-2304 RES FIX 330 OHM S % .25 W CARBON FILM A ROH - R-25 RS ROH - R-25 NETHORK SNT4LSOON EA 1233-7564-000 usT 1233-7564-000 1TEM 135 {PN 2210600-0001} 1233-7564-000 IS AN ACCEPTABLE SUBSTITUTE 1233-7564~-000 RES FIX 56.0 OHM S % .25 W.CARBON FILM EA ROH ~ R-25 R42 ROH - R=25 CAP,FIXED CERAMIC 100 PF 10% S0V EA uc -C51C101K 56,C58 uc -C51C101K RES FIX 5.6K OHM 5 X .25 W CARBON EILM EFA ROH - R-25 s R48 ROH = R=25 RES FIX 180 OHM 5 % .25 W CARBON FILM EA ROH - R-25 R16 ROH - R=-25 RES FIX 15K OHM S% .25 W CARBON FILM EA ROH - R=25 R9 ROH - R-25 RES FIX 390K OHM S % .25 W CARBON FILM EA ROH - R=25 R20 ROH - R-2% 1C,64K-BTT DYNAMIC RAM,150NS TA/ROW EA THMS416-4-15NL U3s,U36,U37,U38,U3U94,0 TMS416~4-15NL U41,U42,143 TMS416-4-15NL ALTERNATE FOR ITEM 31 TMS416~4-15NL 1C,LS373,0CTAL D-TYPE LATCHES EA V-LIST~LS373 BURN-IN US, U6, U7 | V-LTIST-L5373 BURN-IN SUBSTITUTE FOR ITEM 7 V-LIST-LS373" BURN-IN 5-14 12/14/83 PART NUMBFR RFY 2223003-5001 AG ITEM, 0122 ni22a QUANTITY, 00000.000 o122n 0123 00000.000 0123a 01238 0124 01244 00000.000 0124n 0125 0125a 9¢000.0C0O 01258 0126 00000.000 01264 01268 0127 000092.000 01274 01270 o128 01284 0C000.000 01288 0129 00000.000 01294 01290 0130 01304 0000.000 ot3o08 0131 00000.000 o114 o13in List of Materials DESCR e ceI conP scsT sonI cascO savN once ncnne HOTHEPRNARD - PFEGASUS - AUTD INSFRT COMPONFMT.. DFSCRIPTINN.ccceeuccccscccsansrocsssnsas UM 2210702-0001 T1C+LS27340CTAL,O-FLTP-FLOP W/COM CLOCK FA V=LIST-LS273 AURN-IN UeT,1069,US1 V-LTST-LS273 RURMN-TN SURSTITUTE FOR ITEM 8 V=-LIST-15273 BURN-IN 2210653-0001 1C,LS138,3-T0-8 LINE DFCODFR A V-LIST-tS138 BURN-IN Uss V-LIST-LS138 BAURN-IN SUBSTITUTE FOR ITEM 001S V-LIST-15138 BAURN-IN 2210654-0001 1C,LS139,0UAL 2-T0D~4 LINF DFCODER FA V-LIST-LS139 BURN-IN us3 V=LIST-LS139 BURN-IN SURSTITUTE FOR TTEM 16 V=LIST-LS139 BURN-IN 2219689-0091 1C¢LS221,DUAL ONE-SHOT FA V-LIST-15221 uze BURN-IN V-LIST-1S221 BURN-IN SUBSTITUTE FOR ITEM 25 V-LIST-1 5221 BURN-IN 27210614-0001 IC,yDLUAS L »24~0IN, PUT NAND EA V-L1ST-LS520 BURN-IN u32 V-L15T-LS20 BURN-TN SUBSTITUTE FOR ITEM 28 V-LIST-LS20 BURN-IN 2210621-0001 1C,LS32, QUAN,2-INPUT DR A V-LIST-LS32 RURN-TN U3s V-LIST-LS32 BURNM-~IN SUBSTIYUTE FOR ITEM 29 V-LIST-LS32 BURN-TN 2210631-0001 IC,LST74,UAL D FLIP-FLOP H/PSET E CLR FA V-LIST-LS74 BURN-IN u21,U33,U65 V-LIST-LS74 RURM-TN SURSTITUTE FOR ITEM 30 V-LIST-LST4 BURN-TN 2210695-C001 IC,LS245,0CTAL BUS, XCIV 35TF, R NUT,PUT FaA V-LIST-LS245 BURN-IN U8, U12,U52,U61 V-LTST-L 5245 BURN-IN SUBSTITUTE FOR ITFM 33 V-LIST-L5245 BURN-IN 2210667-0001 IC+LS163,SYNC 4-RIT RINARY CNT,SYNC CLR EA V-LIST-LS163 BURN-IN u20 V-LIST-L5163 BURN-IN SURSTITUTE FOR 1ITEM 4R V-LIST-15163 BURN-IN 2211059-0001 1Co 740TN3, HEX/BUF /DVR yBURN-TN FA SFE TI- NRAWING u2e SEE TI- DRAWING SUBSTITUTF FOR ITFM 50 SEF TI- DRAWING 5-15 12/14/83 PART NUMBER REV 2223003-5001 AG ITER. ot32 01324 01328 0133 01334 01338 o134 01344 01348 0135 01354 01358 0139 01394 QUANTITY, 00000.000 00000.000 00000.000 00000.900 00001.000 List of Materials DESCRIPTION.eecccoscosnsvsaccscsoasncssscsns MOTHERBDARD - PEGASUS - AUTO INSFRT COMPONENT. 2210694-0001 2210604-0001 2210727-0001 22106000001 0977946-0098 DESCRIPTINN seeocoeosscencosccsssscsnssss UY VVuUVVVSVSVuVVVuRRSVVRRS1s--s2EO-=-11OUU1--o--U--U110e?SH4H5LLCCLLLRBLLLLLBLLBCC,,,ITS1TISIIIS1IISI,,ULLTSSSSTSSSTSSSTSSL1F5sSITTITTTTTITITTTTSSI0n2TT------T-T-----X3044--UULLLL1LU1ULLLLL90,4TTSSSS5STTSSS$S3S,H,EE0020RR22EE23303E0,OQ04--444444X990D900UC2246433U3AT55FADFFAKFOOOLO,TLRRRR,2NBBOR4-VHUBUBUB-1MEBBBRURRUABBURIIIIBNURUUUNRNUUNPRTUTTTRRIRPTRRR---ENNNFEEENNNTN§UNNEMIIMT--=MM/------TRNNNTTILIITTTISN§NNINNNNNN5SBN512t3IE0N.2N2A5ANDRDYRW IVCCEOARUR/NBRTOFENRCFIFIVLEMR FA A £A A FA 4 i 12/14/83 PART NUMRER REY 2223003-8001 AG ITEM, QUANTITY. 0001 00001.000 " DESCRIPTION.esvcsane MOTHERRBOARD, PEGASUS essceosvoscscscnna SPA COMPNNFNT.. DESCRIPTIOM.ceesossocsvosccssvossscncveee UM 2222003-0001 MOTHFRBOARD - PEGASUS EA 1254-3003-069 5-16 TE v e 22(w3] 6ooe2zz,, == z | [peos&olap e 5772 JI0M X I YITIOUINOD LHD OILIWIS, o i=== B[ % VHAI TV B bP7~ R60I=r97 GQ225WT5i5wN{7 JArugged] ey LI<25W06o6riv|aivtoeseovyceead] $ s | ° ¥ CI =] Jwummewems | TR == 548 ROtee [} Taiw{ v[|v[irz|~]o]7]o9[Tse]vTiev3il Viv[R[A[F1<1 o] 2| ¥ 100103 -2¢. T DA3TW5eYNYI1So5Sm3YaL]| 32a097,8 N e y32a70857an2vowt || o1o0 , kE NOIIGIE3T FELTLY, FIVIQGINGD 18D whdlr | KOO~ 006222 LIIENI_OINV TITIONINGS L83 wha W | KOS-6006222] |h||"d BT o T -- 5 . votw)-0;}awM.5«mnw\ }» o0z U= = et UL oo L Do) 2 nole £ X £ ¢. A DR LS LUarm ' _M = e o nn F U eyDD-S1WW UL W U = e rermertTR UL o= ¢ 0 0, L LoD L. Hollellos. £ i SnEnEqen Ny iz ent B d0 B0 et gh1 e RlehVoIsVoefioor06oo--1s2t002s6 s2r(2ef20--2710| 0 o 2_0A93v5g3w0I7is85s2e4l 37770075 2 AIF] [ /@ ' e~ 5-17 MIBYE_TIAN =T[5 5 A8 Q1iva4AN -= ox W1 G(I)SIASTTSMG WHD~--fNNutaIArSoIsONeTaeWn[ioda | LA e0? _ ! I(S3oNDIhT2I.FT0273)WTGXET1INVL0GVWIwRTT?Sp S110TW=0AI00LN0~TG?oSFeNIA"WNH&sT g()eQDv0O1IVwIvToNrFNSeTJneS:m.TI[D.oflW o123 H0O3Zy ' 2 WYV)LT Vg3CI31gVkT2waL01SS0N0AW1LHGDL06MI)A40NGS 7Y3MOWINTS0SI OVZLGTSLnM01sOWwI 0W oILNT121 150Livt01 SnI4N111I0v1AlT = ----- s A1 N ILON AY DOV ML ILOK C A Lo [ |m 7] O g T ouNMn e f GO Sty 3 [T e i 30009 77477 A35_GISINCaNI1q I$IOu NNTae FOsNPTayAn T 1Wi IIIEThoe nHiw (37] 032 02:9320077 ((33)) 1SSOOLLZ2= FIMOIOID70e 999545P8964 s s£IeHC ? 9A2 T wSetatAIssvStBCNEgGIs OTTeLT8gAE3oSs Wba:LeT dIss43ET 3S . r47ovG5sI1IQ0|Y0e0002D)])] 22 560B 029503 [N $s 4 PS5 S.us e27.30 29- 2 21w0SL(Zg (2R) UO£4N20/24O0ON5V& 10w41l3315)8 | oK`ImsOGumW3yIs(oSAsAsSTNYIYMoaAv1O39iL30n50NnnZe1NO5a8N)I3I1z110202010F00)2Q9oN00¥v¥O7WviMWIIsO0iLLSiakYITaW0TANI7TOI9JIVo6avAnWva3SO1NsIASlTIMLNIoT2HVsY.3WLSl1EAaI3NadYO7TvSF NOILAD QFWLOVBISITNoIS5 Sp 96 (N68ILUWILQ)YL ILavNi3de ' [TnaTALTY 800edZz T ] < [ v E = - - --- - sflg&sleku\»hn\m.\)(.unh\"\u"!?\" (ws) OF 1 a1 01 I VY IS BIGWAC §6 Lt OTISA (31) OF11 Q4 D217 300908N 14 B4POE I§6HOWDIII 1DVIgSA (NL) o ey o o2 g b oo (P07 MO2) IO 1 J4CIIC 0T 30 FN AOF N IO4P (ML) [ (3(8] (8] WPGo0LOsJOOIGMHL§3Fd3IaDH1WdIwLI9O4NaNLO3Io5LNG)M0OOION3LFF0DI0L8QLNOYDI2WM1ONL0ONAINNMUINNIOZ2Md!U2SNWG13TOO(NI9EILI6FSTIo 1YSIAVNMPW1SISDI(1SVL3SFD1NI0W3.I2.)1Ho(`0oT52wN1O3.S-IlW9'W0sMFJnO1OOIaOM5NIl2WPSvSEN.VOI8lOL1JAI(3BW()V)5DNI8O6116.MsI1I1SIO!NWNMMIZNW£Wi_WiggOO,W3NWdOIyVAVLSLIALtN1I6g)WNI)6OSwL30OOIT2io321&DIONSIOrA0NNNZ0DOI8E37OO0VSN3S930N0NW2ODOL3Y81OF (OL) (IL) (3L (Ol (2} ((V9LL) 1 s o ol J. . DGt st oo in Loy S1700ME7 3 goyaosonmwd (I95S W31W1M)OMSAr SV 0IOI5A OWLOuSHOVFLIIMY [3) I ONIV0WuMa§L3V3HOlL1TI0NS£$EN1NM0I5LZID3OVaI3LID$ 7Y7SSS0M8FOOL8 34NNTITuViOGIdINLY2iINr®L°IA2SviYU63 3NAIniAIIIGAOSTIWMZOO3NGG3GNLE"0 H0N9VWIDLA1I02IQNN:IE9DOSIIDNF3TL°0 S?IIBi1IVNPY2Iiv3VF3I9OV4uHiVIaIN0VOQS8 dOrEvSINoW73Ne|oIVV1IoDIMuSIwdOLN5d aH2DId#2SdHM1VIv3wwL5OvIINDOloSa5LNJOVPVaIwVoOLAQLwEiYuAL¥uSViWiInWOevex3AvSvOoVoveH©NwOaDweDWLwN8I S (3] (8] [E) (T} e VALOISE FIMBUO ST SION. | L e (-9) tHS V MaAA 5-18 ' ¢ L 600222 i OWG NO C2223009 |s,, 1| + METRIC CONVERSION CHART 0.25 MM | IN CRT CONTROLLER -- oW ToxwOsATA IngFuents SYSTEMS GROUP s DT e SIZE | FSCM NG T A[06668 scae NONE | 8755 09 l sheer 1 I8"j,! TH-25910A * 5-19 12/14/83 PART NUMBER REV 2223009-0001 R ITEM. DUANTITY,. 0002 REF 0015 00001,000 00154 0025 00091.000 00254 00258 0025C 0027 00001.000 0027A 0028 00001.000 0028A 0038 00001.000 001384 0041 00001.000 0041A 0043 00001.000 0043A 0044 0045 REF 00001.000 0045A 0046 00002.000 0052 00001.000 0052A 0053 00001.000 0056 00001.000 0057 00001.000 0095 00001.000 0096 00000.002 0097 00001.000 0098 AR 0099 00000.002 List of Materials DESC e ssR occI essoP oncT csesI csaC cacoM scses ALPHA CRT CONTROLLER CNMPONENT.. DESCRIPTION.ccecvsssecacascsscacsvscsecss UM 2223011-0001 2223065-0001 0996508-0001 2210835-0004 2211878~0002 0972924-0014 2220688-0001 2210970-0005 0994396-9901 221104 7-0002 0972446-0012 0996193-0001 2223033-0003 2220629-0001 0935170-3499 0535978-0058 0411435-0408 0411100-0074 0996069-0003 0411435-0416 LOG DT AI GRAC M, , ALPHA CRT CONTROLLER 4 ROM,CHARACTER GEMNERATOR EA - - -000 u2s o = -000 1C,74LS393N DUAL BINARY COUNTER EA 001295-74LS393N u3s 001295-74L S393N I1TEM 105 (PN 2210727-0001) 001295-T74LS392N 1S AN ACCEPTABLE SUBSTITUTE 001295-74LS393N CRYSTAL,18 MHZ,HC-18/1} WITH GND LEAD EA SEE TI- DRAWING Yt SFE TI- DRAWING TRANSsMPS6602, NPN,COMPLEMFNTRY DRIVFR EA SEE TI- DRAWING Q1 SEE TI- DRAWING CAP FIX TANT SOLID 15 UFD 10% 20 VOLT EA QPL -M39003/1-2289 c2 QPL -M39003/1-2289 CONMECTNR,RECEPTACLE, PCB,9-PINS EA SEE TI- DRAWING J40 SEE TI- DRAWING * CONN, 22-P0S.,PC BD, SINGLE ROHW,.100 CNT EA SEE TI- DRAWING J41 SEE TI- DRAWING PROCEDURF,SITE & DATE CODF -~ SERTALIZATION EA CSEOENNETCIT-OR,DRARWEICNEGPTACLE ,2-ROW,11-POSITIOM EA J&2 SEE Ti- DRAWING RIVET,.116 DIA 3/16 LG DOMF HD ALUMW EA -75021-0406 HEADER ,STMGLE ROW RIGHT 1 POSITION EA BER - 65521-116 El BER - 65521-116 PLATE,OPTION BDARD,9-POSITION EA 1678-3333-013 AUDIO JACK,PANEL MNTNG,ROUND BASF,.185% EA 1254~ WIRF,UL =000 1629519 STRD,22AWG,WHT/YEL FT 1650-0000-000 WIRF ELEC.»SOLID,"KYNAR®TM TINSUL #30 AWG FT TAPF, MMM INSULATION,ELECT.1/4 - 56-1/4 1IN LOCKWASHER 174 INTERNAL TOOTH CRES RL FA QPL - MS35333-74 ADH,SOLTD, THRMPLSTC 25# BAG ANAEROBIC EA 1280-4506-000 INSUL TAPE, ELEC, 1/2"W RL -SEE T1 OWG 5-20 12/14/83 PART NUMBER REV 2223009-0001 R ITEM. QUANTITY. 0100 00002.000 o101l 00002,000 0102 REF 0103 AR 0104 0105 00001.000 00000,000 01054 01058 0999 00001.000 List of Materials DESCo R cccI eossP vosT ssccI sscO sccvN ancon ALPHA CRT CONTROLLER COMPONENTee DESCRIPTIONcccocsccccescsccsoscscccsscse 0532348-0400 STUD, EXTENSION-CRES #4~40 X .188 0411100-0070 2223271-0001 041 5804-0005 QLPOLCKWAS-HERM$35#34 33-I7N0TERNAL TOOTH CRES SPECIFICATION,UNIT TEST-ALPHA CRT SEAL COMP,A'ROBIC-BLUE,GD C,10CC BOTTLE 2232367-0001 2210727-0001 2223009-5001 SPACER V1-CL,I1S5T3-93L,SD3U9A3L,4B=U-RBNI-TIN BINARY COUNTER u3s V-LIST-15393 BURN-IN SUBSTITUTE FOR ITEM 25 V-L1ST=-LS393 RURN-IN ALPHA CRT CONTROLLER = AUTO INSERT 1254-3010-029 UM EA EA EA A EA EA EA 12/714/83 PART NUMBER 2223009-5001 REV R ITEM, ocot 0003 00034 0004 00044 0005 00054 0006 00064 0007 0007A 00078 0007C 0008 0008A 00088 0008¢ 0009 QUANTITY. 00001.000 00001.000 00002.000 00001.000 00001.000 00001.000 00003.000 . 00004.000 DALEPSHCARIPCRTTIONCcOeNsTcROcLsLsEoRscc-s~ cAaUsTcOoseINcScEnRcTcssccs COMPONENT.. 2223010-0001 2220443-0002 0996952-0005 2223060-0001 2223058-0001 0972900-7155 0996755-0001 0996420-0002 DESCRIPTION.ceesocoscscsascsscsscssscccs UM UuS1IISSLSU1uTT1u1Tl1IP0T1EuE0zECE4C06s0tLOt1Ié11N6S66TEE6WEES7,,O04ITG0600E6E66BG,6U2C1E,ICT911M9I,199K9M3RC2U,W-A2C2A-ATT-~STTT-9OS8N20N99LIII0I0N0R50N,-0--P951-50K70~010TXUA0HA0~~=--~00A450040CA96RAR0S7SSSSS0CSLL000OC-RDDDR-NOBNNNNNC-SSN---NCRRAR-AR0TSTTTTET023TS000TE(AABAYCAY04(444PA4047N4PN000PIRWWRWP,W,0LLLN5TL0L4LTTLT0N0T0OIIIITHHSNSSASN45SSANNLNNAAI411B1L222GGBGLGLL22S55LC25S444LLSE1412SB5SEO215T55E3R5S06U1NNNN1ASNNNN,NSLR0TT052®86IRN6SSC6O9UXU0L5BCB-ML-VSHS0RER0TZT0RA0II0M0TT1Ts1UCU1R)1TLTAOE5ENC0KSNIEST,RIPAOLTNEASTIC « FA EA EA A EA A EA A 5962-0100-000 5-21 12/14/83 PART NUMBER REV 2223009-5001 R ITEM. QUANTITY, 00094 00098 0009C 0010 00003.000 0010A 00108 0010C 0011 00002.000 00114 00118 0o11cC 0012 00001.,000 00124 00128 oo12¢C 0013 00003.000 00134 00138 0013cC 0014 00001.000 00144 0014B 0014C 0016 00002.000 00164 00168 0016C 0017 00001.000 0017A 00178 0017C List of Materials DESCRIPTIONGsocecoevvcovenccccncsncscocs ALPHA CRT CONTROLLER - AUTO INSERT COMPONEN.To DESCRIPTION acecssossccscncsee 0219402-T175 U10,Ut1,Ul4,U15 5962-0100-000 ITEM 108 (PN 2210721-0001) 5962-0100-000 1S AN ACCEPTABLE SUBSTITUTE 5962-0100-000 NETH , SN NT4RS1KTSN U16,ULT,U27 ITEM 107 (PN 2210764-0001) IS AN ACCEPTABLE SUBSTITUTF 0996089-0004 2220521-0001 IC,SNT4LS244N LINE DRIVER =SNT4LS244N utz,u13 ~-SNT4LS244N ITEM 110 (PN 2210694~0001) ~SNT4LS244N IS AN ACCEPTABLE SUBSTITUTE ~SNT&L S244N 1C, TTL SHIFT REGISTERS u19 ITEM 111 (PN 2210669-0001) 0972686-0001 IS AN ACCFPTABLE SUBSTITUTE * NETWORK-QUAD MULTIPLEXFR, SNT4LS1STN u21,U22,023 ~ ITEM 112 (PN 2210662-0001} IS AN ACCEPTABLE SUBSTITUTE 0219402-7163 METHWORK, SNT4S163N U24 ITEM 113 (PN 2210761-0001) IS AN ACCEPTABLE SUBSTITUTE 0972900-T474 NETHORK SNT74LST4N u28,u29 ITEM 114 (PN 2210631-0001) IS AN ACCEPTABLE SUBSTITUTE 0996422~0001 1C, SHT4LS125N 001295-SN74LS125N u3o 001295~SNT4LS125N ITEM 115 (PN 2210649-0001) 001295~SN74LS125N TS AN ACCEPTABLE SUBSTITUTE 001295-SNT4LS125N UM EA EA EA A EA EA EA 12/14/83 PART NUMBER REV 22237%09-5001 R ITEM, QUANTITY, 0018 00001.000 0018A 00188 00l18C 0019 0019A 00198 0019¢C 00001.000 0020 0020A 00001,000 00200 0020C 002t 00214 00218 0021cC 0022 0022A 00228 0022¢C 0023 0023A 0023R8 0023¢C 0024 00244 00248 0024C 0026 00264 00268 00001.000 09001.000 00001.000 00001.000 00001,000 List of Materials DALEPSHCARIPCRTTIONC.OcNcTRcOsLsLsEcRsso-scAcUaTsOassINcSsEsRsTsacsan CONPONENT.. DESCRIPTIONcoccocccaccavcasssocsccscsses 0972900~-T7420 NETWORK SNT4LS20N U3l ITEM 116 (PN 2210614~0001) 0219402-7486 0219402-7610 0972900-7432 0219402-7400 0219402-7404 0972900-7404 0972900-71T4 1S AN ACCEPTABLE SUBSTITUTE NETWORK SNT4S86N U3 ITEM 117 (PN 2210749-0001}) 1S AN ACCEPTABLE SUBSTITUTF IC, SNT4SION u33 ITEM 118 (PN 2210740-0001) IS AN ACCEPTABLE SUASTITUTE TUTTTI1I11SN4NTEEETTMHAWNOORR1KK1--A-9-SCSSSNCNNSNTETTNS(T4P44PTN4LNTLL4TLSASSL4S3BIISS3I2L223O222ENNN2ON1NN06S2U1B-S0T0I0T1U)TE. u3s ITEM 120 (PN 2210735~0001) IS AN ACCEPTABLE SUBSTITUTE NETWORK SNT4S04N u3s ITEM 121 (PN 2210738-00011 1S AN ACCEPTARLE SUBSTITUTE NETWORK SNT4LSO4N u3? ITEM 122 (PN 2210604-0001) 1S AN ACCEPTABLE SUBST ITUTE NETHORK SNT4LS1T4N u18 ITEM 123 (PN 2210674-0001} UM EA EA FA "EA EA « A EA EA 5-23 12/14/83 PART NUMBER REV 2223009-5001 R ITEM. QUANTITY. 0026C 0029 00294 00001.000 0030 00001.,000 0030A 0031 00002.000 00314 0032 00001,000 0032A 0033 00001.000 00334 0034 0C001.000 00344 0035 00006 .000 00354 0036 00002.000 00364 0037 00001. 000 00374 0039 00014,000 00394 00398 0040 00010,000 00404 00408 0047 00001,000 00474 00478 List of Materials DESCRIPTION ccssccscasesvsosnnssoscasscses ALPHA CRT CONTROLLER - AUTO INSERT COMPONENT., o DESCRIPTIONGcceveccsccncasannssscsssssees 0972946-0041 0972946-0074 0972946-0066 0972946~0091 0972946-0076 09729646-0084 0972946-0081 0972946-0057 0972757-0009 TS AN ACCEPTABLE SUBSTITUTE RRRRRRRRRRRRRRCRRRRRRRRRRRRRRRRRR146OS2EEEOAOOEEEOOOOOEEOOOOOO1O3THSSSHPHHSSSHHHHHSSHHHHWHH2,4R,R1RBFFFFFFFFF01I,IIIIIIII3XXXXXXXXXR-----==----==--= I,CRRR3RRRRR4RRRRRR6RR12141RE2-7-.----0---=----.--...R0102202222222222222224715555K55%55555K555KK51KK,4RTOOOOODOO1OHHHHHHHH4PMMMMMMMMF,R5LS55555S %%E10T%%%%%%..22......55222222S555555OVWW W W W W W W CARBON CARBON CARBON CARBON CARBON CARBON CARBON CARBON 3 FILM FILM FILM FILM FILM FILM FILM F+ ILM c1 0972763-0013 0972763-0025 0219402-7174 CAP,FIXED .010UF 50 VOLTS 004222-MC10SE0132 4,C5,C7,(8,(9,010,C11,C12 004222-MC1051032 C13,C14,C15+C16,C17,C18 004222-MC105E1032 CAPACITOR, .10UF 50V FX,CERAMIC COR CA-CO3Z5U1042Z050A 27,30,C31,C32,C33,C34 COR CA-CO3Z5U1042050A 35,038,C39,C40 COR CA-C03Z5U1042050A NETWORK SMT4S174N Ti- -SNT4S 174N U39 TI- =SNT4S1T&N ITEM 124 (PN 2210763-00011% TI- -SNT4S174N DIEL UM A Fa EA EA EA EA EA EA EA A EA 5-24 12/14/ 83 PART NUMBER REV 2223009-5001 R ITEM, QUANTITY, 0047C 0049 00001.000 00494 00498 0049C 0050 00001.000 00504 0106 00000, 000 0106A 01068 o107 00000.000 01074 01078 0108 00000.000 0108A 01088 0109 00000.000 01094 01098 o110 00000,000 01104 01108 o111 00000.000 01114 nli1s Gii2 00000.000 01124 ol1128 o113 00000.000 01134 ni13e List of Materlals DESCRIPTION ecoovvovoscsssscssansosscsse ALPHA CRT CONTROLLER = AUTO INSERT COMPONEMTo. NESCRIPTIDNccesococossscecosassssnsccccs UM 1S AN ACCEPTARLE SUBSTITUTF TI=- ~SNT4S1T4N 0219402-7157 NETHWORK SNT4S1S5TN EA 0972946-0079 2210660-0001 2210695-0001 2210721-0001 2210764~0001 2210694-0001 2210669-0001 2210662-0001 2210761-0001 u20 ITEM 125 (PN 2210759-0001) 1S AN ACCEPTABLE SUBSTITUTE RES FIX 3.9K OHM S % .25 W CARBON FILNM EA ROH - R=25 R1S ROH = R=2S ICyLS155,DUAL 2-LINE TO 4-LINE DECODER EA V-LIST-t.5155 BURN-IN us V-LIST-LS155 BURN-TN SUBSTITUTE FOR ITEM 7 V-LIST-LS15% BURN-IN IC,LS245,0CTAL BUS.XCIVER,3ST.OUTPUY EA V-LIST-LS245 BURN-IN urT,U8,U? V-LIST=LS245 BURN=-IN SUBSTITUTE FOR ITEM 8 V-L1ST-15243 BURN~IN 1C,LS374,0CTAL D-TYPE FLIP=-FLOP EA V-LIST=LS374 BURN-IN U10,UL1,UI4,UL5 V-L1ST-1.$374 BURN-IN > SUBSTITUTE FOR ITEM 9 V-LIST=L5374 BURN-IN 1C,S179,QUADF/F,DOUBLE RATL QUTPUT A V-LTS5T=S173 BURN-IN > Ut6,uUl17,u27 V-LIST=S175 BURN=-IN SUBSTITUTE FOR ITEM 10 V=L I5T=5175 BURN-IN 1C,1.5264,0CTAL BUF/LINE DRIVER/RECEIVER EA V-LTST-L5244 BURN-IN uUlz,ul3 V-LIST-LS244 BRURN-TN SUBSTITUTE FOR ITEM 11 V-LIST-L5244 BURN-IN IC+LS166,8-BIT PARALLFL/SERTAL INPUT EA V-LIST~LS166 BURN-IN u19 V-LIST-LS166 BRURN-IN SUBSTITUTE FOR ITEM 12 V-LTST-LS166 BURN-IN IC+LS157,QUAD 2-LINE TD 1-LIME DATA SELE EA V-LIST=-L5157 BURN-~IN u2t,022,u23 V-LIST-LS187 BURN-IN SUBSTITUTE FOR ITEM 13 V-LIST=-LS157 BURN-TN 1Cy S163, SYNCHRONOUS 4-BIT COUNTER EA V=LIST~S163 BURN=-IN u24 V-LIST-S163 BURN-IN SUBSTITUTE FOR ITEM 14 V-L1ST-S163 BURN=-IN 5-25 12/14/83 PART NUMBER REV 2223009-5001 R ITEN, QUANTITY, 0114 00000.000 01144 01148 0115 00090.000 Ol15A 01158 o116 00000.000 ol16A 01168 o117 00000.000 01174 01178 o118 00000.000 01184 01188 0119 00000.000 0119A 01198 ot20 00000.000 01204 01208 o121 00000.000 01214 o121 0122 09000.000 oL122A 01228 0123 0000.200 01234 01230 0124 0000C.000 List of Materials ADLEPSHCARIPCRTTIONCcOaNvTReOcLsLsEsRace-ssAsUsTcQcscIcNSnEnRcTosance COMPONFENT.. DESCRIPTINM.cucececsssocccncscsssencanse UM 2210631-0001 2210649-0001 2210614-0001 2210749-0001 2210740-0001 2210621-0001 2210735-0001 2210738-0001 2210604-0001 2210674-0001 2210763-0001 IC,LS74,0UAL D FLIP-FLOP W/PSFT & CLR EA V-LIST-LS74 BURN-IN u28,029 V-LIST-LST4 BURN-IN SUBSTITUTE FOR ITEM 16 V-LIST-LST4 BURN-IN 1C,15125,QUAD BUS BUFFER W/3-STATE OUTPU EA V-LIST-LS125 BURN-IN u3o V-LIST-LS125 BUPN-IN SURSTITUTE FOR ITEM 17 V-LIST-LS125 BURN-IN IC,LS20,4D4 UIANPLUT NAND EA V-LIST-LS20 BURN-TN U3l V-LIST-L520 RURN-TN SUBSTITUTE FOR ITEM 13 V-LIST-LS20 BURN-TN 1C,S86,QUAD, 2-INPUT EXCLUSIVE 0R A V-LIST-S86 BURN-IN u32 V-L1ST-5S86 BURN-IN SUBSTITUTE FOR ITEM 19 V-LIST-586 BURN-IN 1C,yS10, TRIPLE, 3-INPUT PNSITIVE AND EA V-LIST-S10 BURN-IN u33 V-LIST-510 BURN-IN SUBSTITUTE FOR ITEM 20 V-LIST-S10 BURM-IN A ICyLQUS AD3¢ 22 -TI, NPUT 0OR EA V-LIST-LS32 RURN-IN u3s V-LIST-LS32 BURN-IN s SURSTITUTE FOR ITEM 21 V-LIST-LS$32 BURN-1N 1C,500,QUAD,2~-TNPUT NAND EA V=L IST-S00 BURN-IN u3s V-LIST-S00 BURN-IN SUBSTITUTE FOR ITEM 22 V-L1ST-S00 BURM-IN 1C+504,HEX INVERTERS EA V=-LIST~-S04 BURN~TN u3s V-LIST-S04 BUPN-IN SURSTITUTE FOR ITEM 23 V-LIST-S04 BURM-IN ICsLS04,HEX INVERTERS EA V=LIST-LS04 . BURN-IN u37 V-L1ST-1S04 BURN-IN SUBSTITUTE FOR ITEM 24 V-LIST-LS04 8URN-IN T1C+LS174,HEX,D-TYPE REG W/ COMMON CLR FA V-LIST-LS1T4 AURN-IN uls V-LIST-LS174 BURN-IN SUBSTITUTE FOR ITEM 26 V=LIST-LS174 BURN-IN IC,S1T44HEX,FLIP-FLSIONPGL,E RAIL OUTPUT EA V-LIST-5174 BURN-IN 5-26 2/14/84 PART MNUMAER REV 2223009-5001 R ITEM, QUANTITY. 01244 01248 0125 0000.700 01254 01253 List of Materials OALFPSHCARIPCTRITNN,CONsTuRuOvLeLeFsRs sesscsescsersoscns AUTD INSFRT COMPONTNT.. 2210759-0001 DESCRIPTION..ceeeoneeenscasasoncosencees UM uuVVVVVSS21----1-UU0eLCLLLLBBI,1I1SSISSSTS§TST5ITITTT1=TT----5-UUSSSS7STT1111,1FE575705747407ADFF,OAABABRRR2UUUUU/RRRRR1MNNMMN{I-----TTIIITTEELNNNNNMMIMF4479 SELFCT/MULTIPLEXEP FA 12714783 PART NUNRE®R REV 22230C9-80n01 R ITEM, QUANTITY, 090t 00001 .000 DFSCRIPTeIcOeeNas ALPHA CRT CONTROLLF esesescensesssns SPARFS COMPOMFNT.. DESCe cR eeovI osaP ancT sossI scaM csanN soans 2223009-0001 A1L2P5H4A-30C0RT9-0C2O9NTPOLLFP UM FA P ' =TS0t 222 w1 TesTaI90E[--a NOISNVdX3 WV OWLANIS|,P , o] iteyt sy AE o L e = T A0 Tiwve { s e Toeg | 1!.*'_oT.] o°v em |enod 1 nouves SsLaTviy e e | = e STeise8wTo GG/8 [160zz22| V|Si i|al5lev6[1r[|¥|F51 [17 ¥00[00-i--0 ws2Foi1oEoc0rsEs02es2ssZ]| TEwyE¥IovGswMsidae & (7A¥73g0G07002s7522Wi54m; t4arx9rki0ill|ooyNi4 goro| .io«oet.--.2.0u6" | WTrQayvuveiWes|e(' * - 1000~2L28222 084 15U | ] T -- ((Xx28A621X)1T)SNI LoPN aQuUrMaY WWWwyDryyLd V (I3X2B0Z0 H o.WyNYW`wYYONwYIowoiSN\NSSXNwOEnE"LNywIkVZseXiIsNyFX:GV3.TS||| 3 zSuo21Tv0o0o0 o0v0o5We--<0 Ss---.isi5SoGr1010 sMo00£s62M522222\2122222.22WK_urut7é00v0+.x4u04c_wVuA,.IfiflSew:é0LdV 4 Elfi ~ e 0 _ et - y S g = S ' IG fl g H._m_ 1 no .I = -] g g {---- = --o 7 og l <f 3 Y8919[9 vV[]110I00000--L911008T222L2 | WOWIQ ELY) Li[3*10o]1 =| 11 0000-5021z0r80z2e2z2| ISIoBmWaIiSsEnY] ogL 70" - SIHONI uny 14VHD NOISUIANGD mH__ mnm g mu g ' i ;| B3 T-- --ELi TeSe~ET RGaNrMoaGTIey1mNyNB nAsTes2 wahntiialy! 5r) PV ATy 01 7A007I0M £S5 GAVI`51N81C90T13I10VN0N0CAw9Za~vGHiIV)GA)OAVoLpwI1Ld0ioea0vWn0ais+gLns$u7ol!0[0s0T- IO [ ey [ T e L|INYTNAY=H]ISLOIzFL 3Ni7vloaSa@WnA(GL1I2WnLAaI7v7SsOYe0oTnSid(L1t KD [ 3 Wi[7] [e fanS2002od )©1 o I_u_uz_ 5 K | ] D: al o ] 250 ..Dm_ == s 7 finmm ._u = I.umu.."_r UGN WD JOWN O3IVKDSNOINI GLNAWANIER] SNXIL NOTSNWATD WeE 4537 400010 aXn o0 (7] MKTJLQOOHWNUYROKWWCWS IDYIVWLGRY&LiAY1 I»X3TT%4TI0oY01tI KLL.I9QFNT OMI0GIYNNS4CGT I\X HWLTLQSIIKMGIT0 FI&INSOTG.NIHC %SVJI26"22EII001S1%) SXK¥MH\ANLIYSNWUSY(YND}ONBLSI%LIOWLSWHC&OlILIOOINTNO-[3IX%IRT3NWoHO1ON&I1YI..ZDQW4HWAoAY0GIITKSn4ILH§)tyOE % S v z < T 9 HIJVIIESHVAGNS TH&IYIWSILlONYX34300£0QISUS30i1Io¥G0G0Ns FF1IoaSm¥ydSNyvbMW E NyGILBV3HgOuNnIn WI0SVYdGS NJIiy¥i£3v4aS1o3Sy73d0d0Ny4O4ISIWAv¥T3WYd (] FAWLOGYMOToL:oHI0I0I%H!e oLoIINY8N77IT?N13SGI8WIJHlWSaG1vSsWIHQSWSWVwPOKiEQ,inOyiyyxSIoeNdwLT R (2) SI(ITO}N I z I e o ! | T & Srofzz? QWNNMum o <« 5-29 = TG Ayg v e ' I ¢ 51C. el | 12714793 PART NUMBER RFY 2223215-0001 J ITEM, 0002 0004 00044 000471 N004C QUANTITY, RFF 00018.200 0004N 0009 REF 0010 REF n101 4919 CCON1.CO0 00000.500 List of Materials DESCRIPTIOMNeescesenvoscccssassancccccnce FXPANSTION RAM COMPONENT.. 2223017-C001 2210147-0012 0974396-N001L 2223212-n001 2223015-5001 7239999-9999 NESCRIPTINN.ccceccoosvocscscsccascsesaas SCHEMATIC, EXPANSION RAM SOCKETDIP,16-PIMNS,L(M PROFILF SEE T -1 DRAWING XULO,XULT,XUL2,XUL3,XUL4 SFE T -1 NRAWING XULS, XUL16, XULT, XUJ18, XULD SEE T -1 DRAWIMNG XU20, X214 XU22,XU23,XU24 SEE T -1 DRAWING XU254XU26,XU27 SEE T -1 DRAWING PROC ., STTF/DATE CONE AND SFRIALTZATINN SPEC,UMIT TEST-E£XPANSION RAM EXPANSION RAM -AUTO 1254-3016~042 COST, SHRINKAGF INSFRY UM EA A FA FA EA FA 12/14/83 PART MUMAFR PEV 2223015-7102 J ITEM, QUANTITY, 0002 REF " 0003 00034 00038 0004 00044 000648 0004C 20040 00099.000 00018.000 0009 REF oole REF o101 00001.000 9999 00000.500 4 g DESCRIPTION ceeaacsoscssvocnccsscacsacces EXPANSION RAM (12AK) - COMPNNENTe 2223017-0001 2211118-0004 2210188-0012 0994396-C001 2223272-0001 2223015-5002 02319999-9979 DESCRIPTFIOM.cceccacccavovssoacncoscsacnoe SCHEMATIC,EXPANSION RAM IC,64K-BIT DYNAMIC RAM,150NS TA/ROW TMS416-4-15NL 1110,U11,U12,U13,U14,U15,U16 THMS416-4-15NL ui7,u18 TMS416-4-15SNL SOCKET,DIP,16-PINS,LOW PROFILE SEE T ~1 DRARING XULO XUY 1, XUL2XUL3X1,14 SEE T -1 DRAWING XUL1S,XUL6,XULT,XU18,XU19 SEF T -1 DRAWING XU20¢XU21¢XU224X112X312,4 SFF T -1 DRAWING XU25y XU26, XU27 SFE T -1 DRAWING PPNC.s STTE/DATE CODE AND SERTALIZATION SPEC,UNIT TE%Y-EXPANSIHN RAM EXPANSTON RAM 1254-3018-006 [128K)-AUTO COST, SHRINKAGE TMSFRT UM FA FA FA EA A EA EA 12/14/83 PART NUMBER REV 2223015-0003 4 ITEM. QUANTITY. 0002 REF 0003 00018.000 00034 00038 0003C 0004 00018.000 0004A 00048 0004C 00040 0009 REF 0010 REF 0101 00001.000 9999 0C000.500 List of Materials DESC s seR ecesI avsP acnaT sascI cssO scsaN vocnes EXPANSION RAM (192K} COMPONENT.. DESCRIPTION:csocaceoncacscccscssssocscscss UM 2223017-0001 SCHEMATIC,EXPANSTION RAM FA 2211118-0004 ICy64K-RIT DYNAHMIC RAM,150NS TA/ROW EA TMS416-64-15NL Ul0,UL1,U12,U13,U14,UL5,U16 TM5416-4-15NL u17,U18,U19,020,U21,U22,U23 TMS416-4-15NL U24,U25,126,027 TMS416=-4-15NL 2210188-0012 SNCKET,0IPy16~PINS,LOW PROFILE EA SEE T =1 DRAWING XUL0yXUX L2U , XL UL3L , , XULS SEE T -1 DRAWING XU1S,XUL6,XXULU8L, TXU,LY SEE T -1 DRAWING XU20 s XU21 4 XU22 4 XU23,4 XU24 SEE T -1 DRAWING XU25,XU264 XU2T SEE T -1 DRAWING 0994396-0001 PROC., SITE/DATE CODE AND SFRIALIZATION EA 2223272-0001 SPEC,UNIT TEST-FXPANSION RAM A 2223015-5003 EXPANSTON RAM (192K)-AUTO INSERT A 1254-3020-008 0239999-9999 COSTy SHRINKAGF EA A 12714783 PART NUMBER REV 2223015-0004 J ITENM. QUANTITY. 0002 REF 0009 REF 0010 REF 0101 00001.000 TM DESCRIPTINN.ceoecoccsnasasscsscsscsssnse EXPANSION RAM (192K) COMPLETE COMPONENT.. DESCRIPTIONeseccocsscess ecsacescece UM 2223017-0001 SCHEMATIC,EXPAMSTON RAM EA 0994396-0001 PRDC.y SITE/DATE CODE AND SERTALIZATION FA 2223272-0001 SPEC:UNIT TEST-EXPANSTON RAM EA 2223015-5004 AUTO INSERT TAPE FOR-0004 EA 1254-3022-000 5-31 12714/83 PART NUMBER REV 2223015-5001 J ITEM. QUANTITY. 0001 00001.000 0003 00009.000 00034 0005 00002.000 00054 0006 00010.000 0006A 00068 0007 00011.000 00074 00078 0008 00002.000 00084 List of Materials DESCRIPTIONeeececsacossaansascssccccocce EXPANSTOMN RAM ~AUTO INSERT COMPONENT.. DESCRIPTION.ecsevscseosonoesnonassananss UM 2223016-0001 2211118-0004 2220360-0002 0972763-0001 0972763-0025 0972924-0018 cTTuCCU SCCCCCCC1SCQQ1OOOEOOOPEAP2CH2HAI1I116PR0RRLERRRFPLC8C2APSS8,61W,,,,PA44,C91 ,0R6¢0AC11C-2£TCCCCTCCC4F22C,I6610IIT41IAAAAKAA39TI--F-A~X900-, 2------~OTL44,0XR3C,CCCC-CMRO-I=C0OP,C00M0,O03,RTDDT112-2C3U U21A323A3,9RRN5500Z9%4NIZ3ZI.Z0N[AARNN,05.T0,,5A50,5SWWO50SL1LDC0U0UMC0U2 IIUNUUCU3OY123SLNN511L111/UN1/SGGUF0y000014A01ORUFD2C4, 424-M4L2-AR62II26ZZ22C2M2IDC51004301131VN005SS05C0U 050EUVO000400T40R,TVAAAAR6,A44C,.A03 F1U8MX8F68X,,,3,,1C-CUCM5ESF991C0RDTE7NAARSMTAI1EM0CITCAOT /UDRITD3CFP5IWLUELTSVOLT £A A A 7 A FA 12714783 PART NUMBER REV 2223015-5002 J ITEM. QUANTITY, 0001 0003 00001 ,000 00009.000 00034 0005 00002.000 00054 0006 00010.000 00064 0006R 0007 00011.000 0007A 00078 0008 00002.000 0008A a DESCRIPTIONcccwoass escssscsvesensare EXPANSION RAM (12BK)-AUTD INSERY COMPONENT., DESCRIPTION.ceccrvacvsnsscovscssnoscocas UM 2223016-0001 2211118-0004 2220360-0002 0972763-0001 0972763-0025 0972924~-0018 PWB, EXPANSION RAM EA 1669-0000-000 TC+64K-BIT DYNAMIC RAM,150NS TA/ROW A TMS416-4-15NL Ul,U2,U3,U4,U5,U6,U7,U8,U9 TMS416-4-15NL 1C, NCTAL DRAM DRIVER, 3-STATE OUTPUTS A SEE TI- DRAWING u28,uU29 SEE TI- ODRAWING CAPACITNR, .001UF SOV FX CERAMIC DIEL EA COR CA-C02Z5U1022100A 1,C24C3,C44C5+C64C7,C8,C9 COR CA-C0O275U1027100A 10 COR CA-C02Z5U1022100A CAPACITO. R10,UF S0V FX,CEPAMIC DYEL EA COR CA-CO03Z5U1047050A C11,C12,C134C14,C15,C16,C17 COR CA-CO3Z5U1042050A 18,C19,20,C21 COR CA-CO325U1042050A CAP FIX TANT SNLID 6.8 MFD 10 T 35 VOLTY EA QPL -M39003/1-2304 22,C23 qQPL -M39003/1-2304 5-32 12/14/83 P2A2R2T301N5U-M5B0E0R3 RFVJ ITEM, QUANTITY, 0001 00001,000 0003 00009.000 0003A 0008 00002.000 00054 0006 00010.000 00064 00068 0007 00011.000 0007A 00078 0008 00002.000 00084 12/14/83 ' PART NUMBER RFV 2223015-5004 J ITEM. QUANTITY. cootl 00001.000 0003 00027.000 00034 00038 0003C 0003n 0005 00002, 000 00054 0006 00010.000 00064 00068 oco7 00011.000 0007A 00078 0008 00002.000 0008A List of Materials DESCRIPTION.cccosossessccacacsaans EXPANSION RAM (192K)-AUTO INSERT COMPONENT. DESCRIPTION cessacsnacsascacsvocssnnsace UM 2223016-0001 2211118-0004 2720360-0002 0972763-0001 0972763-0025 0972924-0018 PHB JEXPANSION RAM EA 1669-0000-000 101 64K=-BIT DYNAMIC RAM, 1SONS TA/ROW A TMS416=4~15NL ULyU24UUS4311644 U UT & 4UR,oD TMS416=-4=~15NL 1C,OCTAL DRAM DRIVFR, 3-STATE NUTPUTS A SFE TI- DRAWING uz8,u29 SEE TI- DRAWING CAPACITOR,,001UF S0V FX CERAMIC OTEL A COR CA-CO02Z5U1022100A C1,C2+C34C49CS54C6,CT79CB4CO COR CA-C0225U1022100A clo COR CA-C02I5U10271004A CAPACITOR,.lOUF 50V FX,CERAMIC DTEL EA COR CA-C0325U1042050A C11,C12,C13,C14,C15,C16,C17 COR CA-CO3IZ5UL1042050A 18,19,C20,C21 COR CA-CO325U104Z050A CAP FIX TANT SOLID 6.8 MFD 10 % 35 VOLT A QpPL -M39003/1-2304 Cc22,23 QPL ~M39003/1-2304 DESCRIPTIONc coosverccsccacscecccnsscnnse AUTO INSERT TAPF FOR-0004 COMPONENT.o DFSCRIPTION.ccsccccccccsacaasscnsssscacss UM 2223016-0001 2211118-0004 2220360-0002 0972763-0001 0972763-0025 0972924~0018 PHB ,EXPANSINON RAM 2 EA 1669-0000-000 1C, 64K-BIT DYNAMIC RAM,]150NS TA/ROW EA TMS416-4~15NL Ul,U2,U3,U4,U5,U6,UT,U8,U9 TMS416-6-15NL U10,U11,U12,U13,Ul4,Ul5,U16 TMS416~4-15NL Ul7,U18,U19,U20,U21,U22,U23 TMS416-4-15NL U24,U25, U269 U27 TMS416~4~15NL IC,OCTAL DRAM DRIVER, 3-STATE OUTPUTS EA SEE TI- DRAWING 1y28,u29 SEE TI- DRAWING CAPACITOR,.001UF S0V FX CERAMIC DIEL EA COR CA-CO21I5UL027100A C14C2,C3,4C44C5,C6,4C7,C8,C9 COR CA-C02Z5U102Z100A clo COR CA-C02Z5U1027100A CAPACTTN. RLO,UF 50V FX,CERAMIC DTEL EA COR CA-CO315U1047050A Cl14C12,C13,4C14,4C15,C16,C1L7 COR CA-CO3I5U10420504 C18,19,C20+C21 COR CA-C0375U1042050A CAP FTX TANT SOLID 6.8 MFD 10 % 35 VOLYT EA QrPL -M39003/1-2304 22,C23 QPL =M39003/1~2304 6-33 12/14/83 PART NUMBER REV 2223015-8001 J ITEM,. QUANTITY, 0001 00001.000 List of Materials DESCRIPTIONcercovsovevsccccsccsscssccsccas EXPANSION RAM - SFARFS COMPONENT,, DESCRIPTINMN eecosscncnsosssossscsscsasnce 2223015-0001 FXPANSION PAM 1254-3015-042 UM EA 12/714/83 PART NUMBER REV 2223015-8002 J ITEM. QUANTITY. 0001 0C001.000 NESCRIPTION ceoescacoacecsssvoccccncccncse EXPANSION RAM (128K) - SPARES COMPDONENT.. OESCRIPTION:ccaccasessesasccassssoscasss 2223015-0002 EXPANSION RAM (128K) 1254-3017-006 UM EA 12714793 PART NUMBER REV 2223015-8003 J ITEM. QUANTITY. 0001 00001.000 < « DESCRIPTION . ceveovas .............-.:- EXPANSION RAM {192K) - SPARES COMPONEMT.. DESCRIPTION.cseesscscascccocaccssssscccs 2223015-0003 EXPAMSION RAM (192K} 1254-3019-008 UM EA 12/14/78) PART NUMBER REV 2223715-8004 J ITEM. QUANTITY. 0001 0002 00001.500 REF DESCRIPTINNceeseoscoasacsccnccacanssscas RAMJEXPANSION 192K COMPLETE/SPARES COMPONENT.. DESCRIPTIONGccescensccccascsscsasscccsce 2223015-0004 2231993-0001 EXPANSION RAM (192K} COMPLETE 1254-3021-023 SERVICF PACK INDEX~RMR UM EA EA 5-34 v 2221021 L,. 1 | APPLICATION NEXT ASSY USED ON 8501 REVI + LEVEL 2 I REVISIONS l 5962 2500 DESCRIPTION I DATE I APPROVED 1.0 SCOPE: £e THIS SPECIFICATION COVERS THE REQUIREMENTS FOR AN N-CHANNEL, DEPLETION LOAD MOS NUMERIC DATA PROCESSOR INTEGRATED CIRCUIT WHICH EXECUTES TRANS- CENDENTAL FUNCTIONS AND PROVIDES ARITHMETIC AND LOGICAL INSTRUCTION SUPPORT FOR NUMERIC DATA. 1)) ABSOLUTE MAXIMUM RATINGS: SEE TABLE I. 2.0 APPLICABLE DOCUMENTS: WHERE THIS SPECIFICATION REFERS TO ANOTHER DOCUMENT, THAT DOCUMENT IS OF THE ISSUE IN EFFECT ON THE DATE OF INVITATION TO BID OR REQUEST FOR PROPOSAL. REFERENCED DOCUMENTS APPLY TO THE EXTENT SPECIFIED HEREIN. THIS SPECIFICATION GOVERNS WHEN A REFERENCED DOCUMENT CO&FLICTS. CAUTION: & STATIC SENSITIVE EZLECTROSTATIC DISCHARGE CAM DAMAGE THIB COMPONENT, PRODUCT MUST BE BHIPPED IN ANTISTATIC CONTAINER AND MAINTAINED IN ANTISTATIC PACKAGING, INDIVIDUAL DEVICKS BSHOULD BE HANDLED ONLY AT STATIC-FREE WORK "A`I'lo_fl. REV SHEET REV STATUS OF SHEETS REV SHEET 5 11213 ]4 |56 |7 |8 {9 |10]11f12|13}14]|15]16]17 {@"~ TEXAS INSTRUMENTS SI-METRIC Oightsi Sywtame Growp INTEGRATED CIRCUIT, NUMERIC DATA PROCESSOR | THRD ANGLE [V mre----. SIZE Fseuuo /g SCALE NONE £ o DRAWING NO 2221021 sHEET 1 OF 17 FlLiacl 5-35 PIN (TCOOPNNEVCITEIW)ONS GNDE 1 {M1g) ap14 [1f 2 (A13) A013 [ 3 (((AAA11102))) 012 oAp11yo [ [ 4 )6 ((nagg)) aanogg [[}}|7e Aoy Q|9 asoosg [[ fu110 ADg E 12 ADrAo3zr [[Jffa1s13 Ao [ 16 ne [ ne [J]1s Lk ] 19 GNO [t 20 40 :] Vee 19 |[] a015 328|3|[J ma1r6//s5q3 3356 ||[3J AA1e8//s5s5 u | swessy 33 |[J mseT, 2|0 u |3 mvwrET, 30 |3 ne 29 11 e 22286|100|H 5%% 25 {17 aso 26|17 o5y 23|[3 susy 22 |[J ReAoy 21 |[J Reser FIGURE 2 (@x\ TEXAiBalSTelctlaatIlSaNrltoSronTleaRlAaUtvoMlEeiNoTS A SHeer 22210421 [REV) Ti-e280.4 f 5-36 DC CHARACTERISTICS (Ty = 0 9C TO 70 ©C, Vgg = 5V + 10%) SYMBOL PARAMETER TEST CONDITIONS VIL |INPUT LOW VOLTAGE Viy |INPUT HIGH VOLTAGE VoL |OUTPUT LOW VOLTAGE ToL = 2.0 mA VoH [|OUTPUT HIGH VOLTAGE Igy = -400 wA TcC |POWER SUPPLY CURRENT TA = 25 OC TLr |INPUT LEAKAGE CURRENT 0V < VN < Ve 1,0 |OUTPUT LEAKAGE CURRENT 0.45 V < VouT < Vg VCL |CLOCK INPUT LOW VOLTAGE VCH |CLOCK INPUT HIGH VOLTAGE CIN |CAPACITANCE OF INPUTS fo = 1 MHz Cio |CAPACITANCE OF I1/0 BUFFER fc = 1 MHz [(RAQD/0G-T1)5, ANAD16-CALlK9, BHE, S2-S0, CouT |BCUSAYP,ACITIANNTCE OF OUTPUTS fe = 1 MHz TABLE 11 MIN MAX | UNITS -0.5 0.8 v 2.0 |Vect0.5 | v 0.45 v 2.4 v 475 mA +10 uA +10 vA -0.5 0.6 v 3.9 |veerl.0| v 10 pF 15 pF 10 pF AC CHARACTERISTICS (Tp = 0 ©C TO 70 ©C, Vge = 5 V + 10%) TIMING REQUIREMENTS SYMBOL PARAMETER TEST CONDITIONS TCLCL | CLK CYCLE PERIOD TCLCH | CLK LOW TIME TCHCL CLK HIGH TIME TCHICHZ | CLK RISE TIME TCL2CL1 | CLK FALL TIME TOVCL | DATA IN SETUP TIME TCLDX | DATA IN HOLD TIME TRYHCH | READY SETUP TIME TCHRYX | READY HOLD TIME TRYLCL | READY INACTIVE TO CLK TGVCH | RQ/GT SETUP TIME TCHGX | RQ/GT HOLD TIME TQVCL | QSg-1 SETUP TIME TCLQX | QSp-1 HOLD TIME TSACH | STATUS ACTIVE SETUP TIME FROM 1.0 V T0 3.5 V FROM 3.5 V T0 1.0 V TABLE "111 Ti--e230. @TEXAS INSTRUMENTS INCORPORATEOD T oe ? ? MIN ~ 200 (2/3 TCLCL) - 15 (1/3 TCLCL) + 2 30 10 (2/3 TCLCL) - 15 30 -8 30 40 30 10 30 MAX [UNITS 500] ns 4 10 10 v ns 2221021 REV A SHEET 5 6-37 | TABLE 111 - CONT AC CHARACTERISTICS (T4 = 0 9C T0 70 OC, Vgc = 5 V + 10%) TIMING REQUIREMENTS SYMBOL PARAME TER TEST CONDITIONS TSNCL | STATUS INACTIVE SETUP TIME TILIH | INPUT RISE TIME (EXCEPT CLK) FROM 0.8 V T0 2.0 V TIHIL | INPUT FALL TIME (EXCEPT CLK) FROM 2.0 V T0 0.8 V TCLML | COMMAND ACTIVE DELAY [2] TCLMH | COMMAND INACTIVE DELAY [2 TRYHSH | READY ACTIVE TO STATUS PASSIVE TCHSY | STATUS ACTIVE DELAY TCLSH | STATUS INACTIVE DELAY TCLAV | ADDRESS VALID DELAY TCLAX | ADDRESS HOLD TIME TCLAZ | ADDRESS FLOAT DELAY TSVLH | STATUS VALID 10 ALE HIGH [2] CL = 20 - 100 pF (FOR ALL TCLLH | CLK LOW T0 ALE VALID [2) MOl E IoAb TCHLL | ALE INACTIVE DELAY [2 TCLDV | DATA VALID DELAY TCHDX | DATA HOLD TIME TCVNV | CONTROL ACTIVE DELAY [2] . TCVNX | CONTROL INACTIVE DELAY . " TCHBY | BUSY AND INT VALID DELAY TCHDTL [ DIRECTION CONTROL ACTIVE DELAY = TCHDTH | DTRECTION CONTROL INACTIVE DELAY [2 TCLGL | RQ/GT ACTIVE DELAY _ CL = 40 pF (IN ADDITION TCLGH | RQ/GT INACTIVE DELAY T0 NDP' SELF-LOAD) TOLOH |OUTPUT RISE TIME FROM 0.8 V T0 2.0 V TOHOL | OUTPUT FALL TIME FROM 2.0 V T0 0.8 V NOTES: [1] APPLIES ONLY TO T2 STATE (8 ns INTO T3) SIGNAL AT BUS CONTROLLER SHOWN FOR REFERENCE ONLY, SEE FIGURE 3 APPLIES ONLY TO T3 AND WAIT STATES [4] REFERS TO THE NUMERIC DATA PROCESSOR SPECIFIED BY THIS DOCUMENT TABLE 111 MIN [mAx |units 30 ns 20 | § 12 10 | 3 10 | 35 110 10 {110 10 |13 10 [110 10 TCLAX | 80 15 15 15 10 {110 10 5 | a5 10 | 45 10 [150 50 30 0| 8 o | 8s 20 |y 12 | ns Ti-ezss-t = f[LEAXS RNS TRR UMETSR [P SHEET 22210621 REV 5-38 6.0 6.1 Ti-a2se.q | APPLICATIONS INFORMATION: (FOR REFERENCE ONLY) PIN DESCRIPTIONS: NOP REFERS TO THE NUMERIC DATA PROCESSOR SPECIFIED BY THIS DOCUMENT. SYMBOL TYPE NAME AND FUNCTION IAD15-ADg AAA111789///555456,, A16/S3 1/0 ADORESS DATA: THESE LINES CONSTITUTE THE TIME MULTIPLEXED MEMORY ADDRESS (T)) AND DATA (T2, T3, T, T4) BUS 1/0 AMTMTANS(3RAO6IADH,,ELSOTDITNIRGSOEHHT.SNIS)y4INSS,,,CPIRUG1TOSNMDAWASPIENNHURDDMFIRAOLOIIVWECRNCAHTSYEGAII43:SN.CLSTSHA5MOABRERLEMATEDFIOHSDOURERDRYR1RISOAENENLSNNGSWEDDOSIPPARNPTYVEHTSEyREMLCCDSAIOOOETNNNNTLIETITOHASORTWERNLN.OOSDOISLERLN,FSLEOCESRUATDRRHWSEERHTMDSEEAEUBENNTMURTTUSOIHSLRNEALYYGNICNYFIECOONOTESLUpNFPXR,EEOETSRRE,-AR-- 1/0 BUS HIGH ENABLE: DURING Ty THE BUS HIGH ENABLE SIGNAL (BHE) SHOULD BE USED TO ENABLE DATA ONTO THE MOST SIGNIFICANT HALF OF THE DATA BUS, PINS D15 - Dg 1/0 STATUS: FOR NDP DRIVEN BUS CYCLES, THESE STATUS LINES ARE ENCODED AS FOLLOWS: 52 ST S 0 (LOW) X X UNUSED 1 (HIGH) 0 O UNUSED 1 1 READ MEMORY 4 ---- O 1 0 WRITE MEMORY 1 1 PASSIVE RQ/GTo RQ/GT] STATUS IS DRIVEN ACTIVE DURING T4, REMAINS VALID DURING T1 AND T2, AND IS RETURNED TO THE PASSIVE STATE (1, 1, 1) DURING T3 OR DURING Ty WHEN READY IS HIGH 1/0 REQUEST/GRANT: THIS REQUEST/GRANT PIN IS USED BY THE NPX TO GAIN CONTROL OF THE LOCAL BUS FROM THE CPU FOR OPERAND TRANSFERS OR ON BEHALF OF ANOTHER BUS MASTER. IT MUST BE CONNECTED TO ONE OF THE TWO PROCESSOR REQUEST/GRANT PINS. 1/0 ARNEOQTUHEESRT/GLROACNATL: BUSTHIMSASTREERQUETOST/FGORRACNET THPEIN NDIPS UTOSEDREQBUYEST THE LOCAL BUS. TIF THE NDP IS NOT IN CONTROL OF THE BUS WHEN THE REQUEST IS MADE THE REQUEST/GRANT SEQUENCE IS PASSED THROUGH THE NDP ON THE RQ/GTg PIN ONE CYCLE LATER. SUBSEQUENT GRANT AND RELEASE PULSES ARE ALSO PASSED THROUGH THE NDP WITH A TWO AND ONE CLOCK DELAY, RESPECTIVELY, FOR RESYNCHRONIZATION. RQ/GT] HAS AN INTERNAL PULLUP RESISTOR, AND SO MAY BE LEFT UNCONNECTED dpTeasannaTe DIGITAHLOUSSYTSOTNE.MSTEOXIAVSISION Al e SHEET 15 IREV T; 5-39 6.1 PIN DESCRIPTIONS: CONT SYMBOL QQss1o, INT BUSY READY RESET CLK vVee GND TYPE NAME AND FUNCTION 1 QS1, QSo: QS1 AND QSo PROVIDE THE NDP WITH STATUS TO ALLOW TRACKING OF THE CPU INSTRUCTION QUEUE 0 Qs(LOW) Qs0o NO OPERATION 0 1 FIRST BYTE OF OP CODE FROM QUEUE 1 (HIGH) 0 EMPTY THE QUEUE 1 1 SUBSEQUENT BYTE FROM QUEUE 0 INTERRUPT: THIS LINE IS USED TO INDICATE THAT AN UNMASKED EXCEPTION HAS OCCURRED DURING NUMERIC INSTRUCTION EXECUTION WHEN NDP INTERRUPTS ARE ENABLED. INT IS ACTIVE HIGH 0 BUSY: THIS SIGNAL INDICATES THAT THE NDP NEU IS AATEIONCCXTTEIICTTVVUHHEEETEINCCUHGIAPNGSUTHE`IASL NOFUTTHEMESEATRNIECXPUICNINEMNPASTSTTIKOROENUDPCRTOIEIVSOXICNDE.CEPLTEIASORYNIETNDC.HBIRSUOSYNCBIUOZSNRAYNETEMICAOITISNEN.DS 1 READY: READY IS THE ACKNOWLEDGMENT FROM THE ADDRESSED MEMORY DEVICE THAT IT WILL COMPLETE THE DATA TRANSFER. THE RDY SIGNAL FROM MEMORY IS SYNCHRONIZED BY A CLOCK GENERATOR TO FORM READY. THIS SIGNAL IS ACTIVE HIGH 1 RESET: RESET CAUSES THE PROCESSOR TO IMMEDIATELY TERMINATE ITS PRESENT ACTIVITY. THE SIGNAL MUST BE ACTIVE HIGH FOR AT LEAST FOUR CLOCK CYCLES. ,RESET IS INTERNALLY SYNCHRONIZED © 1 CLOCK: THE CLOCK PROVIDES THE BASIC TIMING FOR THE PROCESSOR AND BUS CONTROLLER. IT IS ASYMMETRIC WITH A 33% DUTY CYCLE TO PROVIDE OPTIMIZED INTERNAL TIMING POWER: Ve IS THE 5 V POWER SUPPLY PIN GROUND: GND ARE THE GROUND PINS Ti-e2se.L @ TEXAS INSTRUMENTS 2221021 REV ION I0IC TAnLO oUR s8T¥P o8NTO E,NR STeA DRINT VEIR BIOD N A SHEET 16 5-40 1 B[ =e [ zes _ [§L8n5lI0zL/a= 2z : ASSY AlddNS ¥3M0d & ¢ [PNUIAsiNIeS T i A9 Sivve | im0 w0 AT I [ 42-TSI6S65255272 AJlUTMM- MSOAAUI1N2G40A2 NAUw2Adl-oA!P1IceSLD.EIWw)nTNzTe 2=|3 =rrSSaeye] FT29o6Wi6Lal] 303TNITNNi1Od90u5I12N0FILWGiI12AR3SN021G9Nv(WLF1lIQ 8VetIS-iW2N)LeIIrS[RTg]E] NOILIISIO ON L8V TUNOLINAINSIH *FAASSSSYY AKlNdMSS I¥NINOOSS | 1000 -LEOS 222 2000-LE0ETZT (741L2001) {D`bfgi\. [POt PO P] e STx = = -- w:" = 2 ) (el T (L802m w73 409 QINONIY W A03) § NILI t PR X = 2, 2, FLCe S / ~==(E2e90 0ET a N %o'T=o=vl=a0 r 9 oSs Q-. QvsNOWLTsRS Q.vIut ) aozuzBE P2 e [ ] a3y 2{0) ») £ TIHOWIY *§ WAL ALRYTI `YMOT ¥OF WLIN N3 S0 _ fl. otiT varart s<stis o ..e.l_T T rees2 T 2075 G | 3_ 10-221{ 905 | T V= (12)2 58 yl NI10D*) wWw ¥'S2 eeomWaNiEC1sR3'es9Ce ||| mwmenwiwrzrwooosjsee1St0oO0 | soo1m3007| -NOKIGkAuNOlD -] 5-41 = T2s,| 7F7u g L ~f|T uSmwwRsS I707277T02I16112O1W9SvOwOwM"ZVn4SoNM1Ev Vs000Wn7i-alrSeANwTGlTiFiaVvTt?essoNoeWQs3eE0sTL2oUWLwu0TN0SoaeNmlDsB|| W 1 1X9 IR OW LN T) AJH (I NIINAIGEIISISTRNT /1) S0 SymM NE2I7N300G5YS(&(WD7) 146SoXOw30T?S9P20P9N702wEDY0 H5[.T(]1) NTO EGILTvIw¢VASNSoTO9V-AQWANITN I12WUAaW_ITSLSLIaIigiM1PNIGH4NDI0LGNMNS3TO38INL3LTYOLTNNTAI)IViWNRLOS (3] [ M daAnOeZrES xStau7NiOrUsISAdeO (3] NAfL A Qligvam I38NIOLOSDNSW JuCTR sam W B ASI? $1 YOURE OWN 10 : d7 RemW XUITTFS TN B wigieo o el [T) wro;ro @ e (@ wwirr a v [E) T8QLMI W DLIRI TL CUTRUINNRTNMe (B § WU DI O TIOOWW DI IZ Al 77T 20000 (B] 1 s Ly g o [ s ousmv s53 [7) CERSOD FIMESEPNNUTDUON t T T+ w7z « T - ¥ - T ~ V- (2w}tIs NHLWILSOTI NN &0 NTROT(3R 77;1 N 2CO0e5E L1U5TRY [ A1&] 17PN s asociys olima oo 0 2Rt OMT ONY SwT 0L SE e77P| 7¥ |gpyoL2ansaicsvQh-a0oy s;1M9,N|A ddav] JIV NOiLadra?s xT ANGT AFY ' [ T usoezzz, ] | 2(-52-0)swm S (I 4L i I T R S B sT 30 W3 whaIwrvO`wi £0WvZ3_yQ3138044O000L97W7OeW3w8IQINlNiA1Wg5Y3wY0 ¥_ONwOYNavw6wa2TlglE (5] (] ) JOISH INL x;u.:Oxx» SIwLE QI M INOD SZUON z T ] 5-42 12/14/83 PART NUMBER REV 2223037-0001 W ITEM. 0001 0002 0003 QUANTITY, 00001 .000 0000t.000 000901.000 0004 0005 00001.000 00001.000 0006 0007 00001.000 00000.500 0010 00004.000 0011 00004.000 0012 00003.000 0018 0020 0025 00002.000 00001.000 00000.000 00254 00258 0026 00001,000 0032 00092.000 0034 0035 0036 0038 0039 00003.000 00001 .000 00002.000 00001.000 0c001.000 0040 0041 00001.000 00000.167 List of Materials DESCRIPTION ccoccssoovscsococecnes POWER SUPPY ASSY-115V ESTIC COMPONENT,. DESC G ccR tccI ssovP ccrT osssI sscO csssN oncns UM 2223091-0001 2223025-0001 2223026-0001 2211949-0001 2221478-0005 2221479-0001 0418082-0001 PNWER SUPPLY, PEGASUS SEE TI- NRAWING EA CHASSIS ,POWER SUPPLY 1678-3025-903 EA COVER,POWER SUPPLY 1678-3026-044 EA SWITCH,ROCKER,DPST, 104,250V SEE TI- DRAWING RECEPVACLE+AC PDWER,UL/CSA/VDE APPROVED SEE TI- DRAWING AUX RECEPTACLE,POWER,SINE FLANGF MOUNTIN SEE TUI- DRAWING GROMMET, PLASTIC, FNGING 0972831-0004 0972684-0018 RIVET,1/8X.275, TUBULAR,STEFL,BLIND 019738-1821-0410 SCREW 8-32 X 3/8 THD FRM,SLOT HX WSR HD 01726A4~0011 SCREW, THREAD FORMING,6-32 X ,.375 1658- =000 2232997-0001 WIRE, GROUND, LUGGED, GRN/YEL SEE TI- DRAWING 2233003-0001 CABLE, POWER SUPPLY, TIPC SEE T1- DRAWING 2223000-0001 PIWER SUPPLY, 115V 1254-1000-000 *MAY BE USED AS AN 1254-1000-000 *ALTFRNATE TO ITEM 1 1254-1000-000 2207869-0001 LABEL,WARMING HIGH VOLTAGF A 1234-1869-000 0411115-0084 NUT,PLAIN 8-32 UNC-28 HEX CRES EA QPL - M$35649-284 0411100-0072 LOCKWASHER #B, [NTERNAL TONTH CRES EA QrL = M535333-72 2220354-0001 CARLE CLAMP 3M 348-4-1000 EA 0996810-0007 CAPACTTNR, 3900PF 400V DRALNR-SDPJ1 B40OVN 20% CER,DIN TYPE A 2221327-0001 CORF,MAGNETIC,FERRITF 1293~ =000 EA 0972632-0001 STRAP,TIE DOWN,CABLE-NON-STD,0-1-1/4 D, A 02421302499997--00. 000027 SQEPWIEILNRSE,UTLIA-TGI-ROAOD1NUR3N4AD9WS,ILNEGELVUIGNGGE,D, GRN/YFL TEFLON #20 NATURAL EA FT 5-43 12714783 PART NUMBER REV 2223037-0002 w ITEM, QUANTITY, 0001 00001.000 0002 00001.000 0003 00001.000 0004 00001.000 0005 00001.700 0006 00001.000 0007 00000.500 0010 00004.000 0011 ¢0004.000 0012 00003.000 ools 00001.000 0020 00001.000 0025 00000.000 00254 00258 0026 ¢oo001.000 0032 00002.000 0034 00003.000 0035 00001 .000 0036 00002.000 0038 00001.000 0039 00001.000 0040 00001.000 0041 00000.167 List of Materials DESCRYPTION<ccosecsscsasosccncasesaconns POWER SUPPLY ASSY, INTERNATIONAL COMPONENT.s DESCRIPTION:esessscsvssscccncscscccscescs UM 2223091-0001 2223025-0001 2223026-0001 2220637-0001 2221478-0005 2221479-0001 0418082-0001 POWER SUPPLY, PEGASUS EA SEE TI- OrAWING CHASSIS,POWER SUPPLY A 1678-3025-903 COVER,POWER SUPPLY A 1678-3026-044 ROCKER SWITCH FOR EURNPFAN ASSEMBLIES EA SEE TI- DRAWING PECEPTACLAEC POWER,UL/CSA/VDE APPROVED EA SEF TI- DRAWING AUX RFCEPTACLF,PNWER,SIDF FLANGE MOUNTIN FA SEE TI- DRAWING GROMMET, PLASTIC, EDGING FT 0972831-0004 0972684-0018 RIVET91/8X.275, TUBULAR,STEEL +BLIND EA 019738-1821-0410 SCREW 8-32 X 3/8 THD FRM,SLOT HX WSR HD A 0972684-0011 SCREW, THREAD FORMING,6-32 X .375 FA 1658~ -000 2232997-0001 WIRE, GROUMD, LUGGED,y GRN/YEL EA SEE T1- DRAWING 2233003-0002 CABLE, POWER SUPPLY, TIPC EA SEE TI- DRAWING 2223000-0002 PONER SUPPLY-RPO EA 1254-2000-000 *MAY RE USED AS AN 1254-2000-000 *ALTERNATE TO ITEM 1 1254-2000-000 " 2207869-0001 LABEL WARNING HIGH VNLTAGE EA 1234-1869-000 0411115-0084 NUT ,PLAIN 8-32 UNC-2B HEX CRES EA QPL - MS535649-284 - 0411100-0072 LNCKWASHER #8, INTERNAL TOOTH CRES EA QPL - M$35333-72 2220354-0001 CARLE CLAMP EA IM 348-4-1000 0996810-0007 CAPACITNR,3909PF 400V 20% CFR,DIN TYPE EA DRALOR-50P J18400VN 2221321-0001 CORE,MAGNFTIC, FFRRITE EA 1293- =000 0972632-0001 STRAP,TIF DOWN,CABLE-MNON-STN,0-1-1/4 0. EA 2232997-0002 WIRF, GROUND, LUGGEDs GRN/YEL EA SEE TI- DRAWING 0410499-0007 INSULATINN SLEEVING, TEFLON #20 NATURAL FT QrL -81349 12/14/83 PART NUMBER REYV 2223037-0003 W ITEM, QUANTITY, 0001 00001.000 0002 0000t.000 0003 0000t.000 0004 00001.000 0005 00001 .000 0006 00001.000 0007 AR 0010 00004.000 oo11 00004.000 0012 0003.000 0013 00004.000 0014 00004.000 0018 00001.000 0020 00002.000 0021 00002.000 0025 00000.000 00254 00250 0026 00001 .00C 0027 07001.000 0032 00002.000 0033 00001.000 0034 00002.000 0035 0C001.000 List of Materials DESC e eR sccI cvseP sovT ecccI cacO ccccN cncas IMACTIVE PER ECN 501607 COMPONFNT. o 2223091-0001 2223025-0001 2223026~0001 2211535-0001 0996260-0001 2229485-0001 041R082-0001 PESCRIPTIONccecccassocessossccsssasnasss POWER SUPPLY, PEGASUS SEF TT1- DRAWING CHASSIS,POWFR SUPPLY 1678-2025-903 COVFR, POMER SUPPLY 1678-3026-044 SWITCH,DRPSO T,LCIK GHE TENR,1, 64, 250 V SEE TI- DRAWING RECEPTACLE,3~PIN AC PWR scT =FAC-301 RECEPTACLEAC POWER,FFMALE,3 PIN = e =000 GROMMET, PLASTTIC, EDGING 0972831-0004 0972988-0041 RIVET,1/ TUB8ULX AR .yS2 TEE7L 5 , B, LIND 0197398-1821-0410 SCREW 8-32 X .250 PAN HEAD CRES 0972684-0011 0411101-0059 0416622-0024 2232997-000) 2232995-0002 2232996-0002 2223000-0003 2207R69-0001 2223088-0001 0411115-0064 2223048-0001 0411101-0058 2220354-0001 SCRENW, THREAD FORMING,6-32 X ,37% 1658- =000 LOCKWASHER # 8 EXTERNAL TNNTH CRES QrL ~ MS§3533%5-59 WASHER 48 FLAT QPL - ANS60CSL WIRE, GROUND, LUGGED, GRN/YEL SEE TI- DRAWING WIRE, POWER, AC, GRY/YFL SEF TI- DRAWING WIRE, POWER, AC. GRY/BLK SEE T1- DRAWING PNWER SUPPLY-VDE 1254-3000-000 < *MAY BE USED AS AN 1254-3000-000 -~ *ALTERNATE TO ITEM 1 1964-3000-000 LABEL,WARNING HIGH VOLTAGE 1234-1869-000 CABLE ASSY,PONER RCPT TO PR SUPPLY RD i 000 NUT,PLATN 6-32 UNC~2B HEX CRFS QPt. - M$35649-264 CABLF ASSY,INT'L FAN CORD wmm--m=see=(00 LNCKWASHFR #6 EXTERNAL TNOTH CRES QPL - M535335-58 CABLE CLAMP 3M 348-4-1000 UM EA EA EA FA A EA FY EA FA EA FA EA EA A EA EA FA EA EA EA A 5-45 List of Materials 12/714/83 PART NUMBER 2223037-8001 REV W ITEM. QUANTITY. 0001 00001.000 DPNOEWSECRRIPSTUIPOPNLY ooASvSoYveos=ne 15 vesssssavsses =STIC-SPARES COMPONENT.. DESCRIPTINNcssecoceccssccocosnsncccccoss 2223037-0001 P1O6N6E9R-10S3U7P-PY000ASSY-115V DOMESTIC UM EA 12/14/83 PART NUMBER 2223037-8002 REV W ITEM. QUANTITY. 0001 00001,000 DESCRIPTION POWER SUPPLY acAcSoSsYaca- ncBcP0sss-ssScPsAsReEcScscccosn COMPNNENT.. DESCPIPTIONcscccsoanasvcccrccssasccsscnse 2223037-0002 P1O6W6E9R-20S3U7P-P0LY00 ASSY,INTFRNATIONAL uv EA 12/14/83 PART NUMBER 2223037-8003 RFV W ITEM. QUANTITY. 0001 00001.000 DPOEWSFCRRIPSTUIPOPNL.Yc,VoDeEose-s~ ssSPsAsRcEsSssccancsosccscss < COMPONENT . . DESCRIPTIUN......-....-.....-....< ;:..... 2223037-0003 I1N6A6C9T-I3V0E37-P0E0R0 ECN 501607 - UM EA 546 | Wy 2ze 1 < T [T C13o000o0o0s0,.9ee6cc0e§oz8i72r3s7 [9F100UT-t0O= ~Q0A0MCED-Wa EPAVL1LCE2MO2lE9R7T5Vb2M020)00E15NvTmMt5f&N)7r2a4or4Wp02Y [s3Y4sI72 SAOAlDOT4F1c1MG1O2o1£-4DL-s1I22P zCE0bo6, mR F'&3£(03AL04k8], s 5 W eSare Gz S s G@o-g TR wmn areadeEe ey N I v BN et SR) R01 se1etvy 1) ORI FagBac 1M SLom ® ® 5-47 12/14/83 PART NUMBER REV 2223038-0C01 AC ITEM, QUANTITY. 0001 00001.000 0003 00001.000 0004 0C001.000 0007 00001.000 0016 00003.000 0017 00003.0C0 0018 00002.000 0019 00004.000 0022 00002.000 0023 00008.000 0024 00001.000 0025 00001.000 0030 00002.000 0032 00001 .000 0033 00002.000 0034 00002.000 0035 00002.009 0037 00001.000 0038 000Nl .000 0039 00004.0C0 004" 00001 .000 0042 00001.000 0043 00003.000 0044 0¢005.000 0045 00002.000 0048 00001.000 List of Materials DMAETSINCRIEPNTCILODNS.UcREo,sSvUcBeAvSeSsYscscossvassncnansne COMPONENT.. DESCRIPTION:cessvccsscecsccscssscsscanes uM 2223024-0001 CHASSIS, TERMINAL EA 1678-3024-054 2223037-0001 POWER SUPPY ASSY-115V DOMESTIC EA 1669-1037-000 2220632-0003 FAN, 115 VAC, 71 CFM, 13 W, TUBEAXTAL A 0000-9009-000 2223003-0001 MOTHERBNARD - PEGASUS EA 1254-3003-069 2211907-0005 SPAC¢E 31"R BOD, Y 4P NYLC ON,R HO, LF/#6 SCREW EA SEE TI- DRAWING 2220484-0001 SUPPORT ,PC BOARD, SELF-MOUNT EA = - =000 2220487-0019 SPEE4D J-TNYPUEHT ITH T-NUT,2ZINC ELECTRO EA SEE TI- DRAWING 0972684-0012 SCREW 6-32 X 1/2 THO SLOT HEX WASHER HO A 0972969-0013 SCR,THREAD CUTT ING,PLAIN HEX WASHER HD EA 0972684-0018 SCREW A=32 X 3/8 THD FRM,SLOT HX WSR HD EA 2211896-0012 SCREW,HFX HD,SLF-LKG,ZINC PLD 32 X .375 FA 2210006-0003 ASSY,HEX NUT,LOCKWASHERS, B8-32 FA 092550-SEE DRAWING 0611100-C072 LNCKWASHER #8, INTFRNAL TODTH CRES A QreL - M535333-72 2223080-0001 PLATE BLANK,EXTERNAL FLOPPY EA 1678-3080-026 0972988-0014 SCREW 4-40 X .312 PAMN HEAD CRES EA 0411104-0135 HASHER, LOCK-SPRING, HELICAL, #6 ? EA QPL = M535338-115 0411027-0803 WASHER .125 X .250 X .022 FLAT CRES A 2220556-0001 QeSLPEAKER-S,M8S15O7HM95-280W3ATT - EA 0972373-0001 0972802-0014 2223108-0001 2223092-0001 --0SRCCGFTF7mAAEUNAR8BAmDSLR5=TFD5TmE3IGMm--UAEFeCIA-SRDN=1-,SDE400SYRT1P,0A6,3EWS10LE2IP4OD-3NEWG6AE3KR2ME-IRMTO,DSITFLI,E6D-32,.41 L FA A A EA 2211909-0003 PCB SPACER,NYLON, .50" BODY EA 2220850-0001 GUIDEyNYLON,2.50° LONG,GRONVE MOUNTING EA SEE TI- DRAWING 2220956-0001 SPACFR NUT A 2232335-0001 ROD,STIFFENER EA 1678-2335-037 12/14/83 PART NUMBEPR REV 2223038~0002 AC ITEM, QUANTITY, 0001 00001.000 0003 00001.000 0004 00001.000 0007 00001,000 0016 00003.000 0017 00003,000 0018 00002.000 0019 00004.000 0022 00002.000 0023° 00008.000 0024 00071.000 0025 00001.000 0030 00002.000 0032 00001 .000 0033 00002,000 0034 00002.000 0035 00002.000¢ 0037 00001.000 0038 00001.,000 0039 00004.007 0041 00001.000 0042 00001.000 0043 00003,000 0044 00005.000 0045 0002.000 [+[o12:] 00001.000 0049 00001.000 List of Materials DESCRIPTINNGcsvoevrsonsscvscocessscsssses MAIN FNCLNSURE SUNASSY-RPN COMPONENTee DESCRIPTINMeccrccocscccccccncsssnnsascss UM 2223024-0001 CHASS IS, TCRMINAL EA 1678-3024-054 2223037-0002 POMFR SUPPLY ASSY, INTERNAT[ONAL FA 1669-2037-000 223232R-0001 FAN, TUBFAXTAL, 230V FA 2223003-0001 MOTHERBMARD - PEGASUS EA 1254-3003-069 2211907-000% SPACoE 31 R *BO, NY,P MYLC ON,B HNy LE/#6 SCREW EA SEE TI- DRAWING 22204R4-0001 SUPPORT,PC BNARD, SELF-MOUNT EA o = -000 2220487-0019 SPEE4 D J=TNYPU E,MTTTH T~NUT,? INC ELECTRO EA SEE TI- DRAWING 09726R4-0012 SCREW 6-32 X 1/2 THD SLOT HEX WASHER HD FA 0972969-0013 SCR,THREAD CUTTING,PLATIN HEX WASHER HD EA 0972684-0018 SCREW 8-32 X 3/8 THD FRM,SLOT HX WSR HD EA 2211R96-0012 SCREW,HEX HDySLF-LKG, ZINC PLD 32 X .375 A 2210006-0003 ASSY JHEX NUT JLNCKWASHERS, A~-32 FA 092550-SEE DRAWING 0411100-0072 LOCKWASHFR #8, INTERNAL TOOTH CRFS EA . QrL = M$35333-72 2273080-0001 PLATE ,ALANK,EXTERNAL FLNPPY, A 1678-30R0-026 b 0972988-0014 SCREW 4-40 X .312 PAM HFAD CRES S EA 0411104-0135 WASHER, LOCK-SPRING, HELICAL, #é EA QPL - M$35338-135 0411027-0803 WASHER 175 X .250 X ,022 FLAT CRES FA QrL - MS15795-803 2220556-0001 SPFAKFRSo8 NHM 2 WATT FA SFE TI- DRAWING 0972373-0001 GUARN FAN FA RTN ~=4T6143 0972802-0014 FASTENFR ¢SPEED NUToSTL,6-32,.41 L FA 078553-C10132-632 2223198-0001 CARLF ASSY,SPEAKER FA L, 000 2223092-00901 CARD GUIDE LOWFP-MNDIIFFD FA 2211909-0003 PCA SPACER,NYLOM, .50" ANNY Fa ?2220850-0001 GUIDE +NYLDNs2.50% LNNG,GROOVF MOUNTING FA SEE TUl- DRAWING 2220956-0001 SPACER HUT FA 2232335-0001 RONGSTIFFENER EA 1678-2335-037 0972632-0001 STRAP,TIF DOWN,CARLFE=NNN=-STN,0-1-1/4 D, A 12714783 e g PART NUMBER - REV 2223038-0003 - A AC ITEM, QUANTITY. ooot 0003 00001.,000 E 00001.000 £ 0004 00001.000 0007 00901.000 0016 00003.000 o017 00003.000 oo1s C0002.000 0019 00004.000 no22 00002.000 o023 00008,000 0024 00001.000 0025 00001,000 0030 00002,000 0032 00001.000 0033 0C002.000 0034 00002.000 0035 0Cc002.000 0037 00001.000 0038 00001.000 0039 00004.000 0041 00001.000 0042 0001.000 0043 00003.000 0044 0045 00005.000 00002.000 0048 00001.000 List of Materials i DESCRIPTIOMa0sevovcsessosvoscosccsasncss . MATM ENCLOSURE SUB ASSY-VDE COMPDMFNT.. ODESCRIPTINONGssccsevcsossssssccccscacassss UM 2223024-0001 CHASSTS, TERMINAL FA 1678-3024-054. 2223037-0002 POWER SUPPLY ASSY,TNTERNATICNAL EA 1669-2037-000 2232328-0001 FAM, TUBFAXTIAL, 230V EA 2223003-0091 MOTHERBOARD - PEGASUS EA 1254-3003-069 2211907-0005 SPACER,PCB4.31NY"LBON0, OHNNLEY/,6 SCREW EA SEE TI- DRAWING 2220484-0001 SUPPORT,PC BOARD, SELF-MOUNT EA = = =000 2220487-0019 SPEEy JD-TN YPU E,WTITH T-MUT,ZINC ELECTRD EA SEFE TI- DRAWING 0972684-0012 SCREW 6-32 X 1/2 THD SLOY HEX WASHFR HD EA 0972969-C013 SCR,THREAD CUTT ING, PLAIN HEX WASHER HD A 0972684-C018 SCREW 8-32 X 3/8 THD FRM,SLOT HX WSR HD FA 2211896-0012 SCREW,HEX HDySLF-LKG,ZINC PLD 32 X .375 EA 2210006-0003 ASSY yHEX MUT,LOCKWASHFRS, B-32 EA 92550-SEE DRAWING 0411100-0072 LOCKWASHER #8, INTERMAL TOOTH CRES EA QrL - M$35333-72 2223080-0001 PLATE+BLANK,EXTERNAL FLOPPY EA 1678-30R0-026 0972988-0014 SCRFW 4-40 X .312 PAN HEAD CRES e EA 0411104-0135 WASHER, LOCK-SPRING, HELICAL, #4 A QPL - M$35338-135 0411027-0803 HWASHER .12% X .250 X .022 FLAT CRES EA QPL - MS15795-803 2220556-0001 SPEAKERS,8 OHM 2 WATT EA SEF TI- DRAWING 0972373-0001 GUARD FAN Fa RTM -=-476143 0972802-0014 FASTENER ySPEED NUT,STL,6-32,.41 L A 078553-C10132-632 2223108-0001 CARLE ASSY,SPEAKER FA --------- 000 22273092-0001 CARD GUIDF ,LOWER-MODIFIED FA 2211909-0003 PCR SPACER,NYLO.N50," BNDY FA 2220850-0001 GUIDE,NYLCN,2.50" LONG,GRONVE MOUNTING EA SEE T1- DRAWING 2220956-0001 SPACER MUT FA 2232335-0001 RNDySTIFFENER 1678-2335-037 EA ' .73_ ] 6£0¢2ez_8999A 0[N 0[ N. ZAEN3SSSNYSY903gdv0aAay ." X o Svaa e =WOy, 4 | 7 s = _ __ i . | - & N(O»I-L8)OTS © s3ovwe B @ kuk\@@ : \ [ oo jA B = v = -- 7 a - -- s 5 : ] 1B - AT i ||;_M|_FNS|s ALTeD<3N'V.'8TuZ 1500)4Wu s5NwGeA-- ov2CmeAeeus]l ONIXFIIVWGID(I2T8 SOONY= 2I8N6I/NV4Y0 WYAIYLW: 3F§IIWTYTX0THS) ATEWHIaSISMY (240W223Wi)L 7U2Y8YTIC02D2vaYYyIvLM HINOW wuvw [E] ¥ s I 9 Q381238 $1 DNIGNNGES AN3WIINDT ONY ¥OLVYIIO `IOWYNDSAT IL¥LSOYLIZTT WOLS FOVWKT 0L IV USTISNS ) WILl SINL INOILAVD @ SM3IYOS I @ (zom p1528) wyE20 S FSINL ¥`OOFsBOILIENOFYWOAHLIHLOINSASITYINTN SIUON 4 [ a8 v, 12714783 PARY MUMBER REV 2223039-0001 A ITEM, QUANTITY, 0001 00001.000 0002 00001.000 0003 90004.000 0004 00001.000 0005 00001.000 0006 AR List of Materials DESCRIPTION.sooeaccscscosccscacccssccsne KEYBOARD, DOMESTIC COMPONENT.. DESCRIPTIMN.ceccsvosccrcesssacsnccsssnas 2223006~9001 2207R20-0002 0972679-0016 KEYBOARD - PEGASUS 1254-3006-000 REZFL,KEYBOARD-P EGASUS 1255-4059-001 SCRFW #6-19 X 7/8 THREAD FNRMING 2207822-0002 2223018-0001 0996943-0001 BASE,KEYBDARD-PEGASUS 1255-4058-001 PLATE,KEYBDARD 1255-3520-000 ° LABEL ySELF-ADHESIV.E6,56 X .25 1652-1274-000 uM A EA EA FA A EA 5-62 : - i Wl 0%"0A¢SeSUeYeS,3WN.3C1ASA[Sooo PIBLAW. IiS]v,eeny o L0 v z ks= BTg S USSR = BkO ST AdNd2O4d\TS A OOR2EI SI30M 50 3OOTLi0Vn3d - TDvN MI0KZE `1 w0yiF3niEygeonr!e; ATKXAVSSY WWIILGSLAET CAT$N5O-G2) $OIO9N0O-Nv:iIIiOIaW3S) T71U00V33ao33M-0- 096U00s6Oel2Euz2v22a221S 7300508227 brocae - : £ ¢ ATING 000~ (&V-o¥)Y 1Mwy 204> @ o S 868 3 5-53 @ = L-¥! EHs L_uxM w2 e & e 57RIML371w-OQN°0J:IQI b1P71H+NENOSeO IImNON2ID22)1D:03)6N4XAO6oT%TMSWIWLCNILN7Io | 3 A211oTS0T0TV5F= 72-59g 19- UeM1[2TE2eWis1eAAnOLD§OAOLT|V(DL-W0TX ISL8,S253ToG1EiR 2LoWU9EeY1T 0rsN5Z,rYG73HkT74NEoG3GkZOF)((2B9Ni2R ))1@As371NT G13eU11W1r03WK3ar03G6c317X3Xbos1dNL32LI0vEr0S0,Nov95s%ogN2woNWWH1I4W1GInDwIi0ViTO3[[O[n[V(T1s<1T1(W)T101])1)]|,5 --e -- T o NI IATY e & 0 o Era Ueee, | 1S-Q1 SHS IMVD SIiow o i et @ WW 8M12BST8 40 XOVG IT TNAN70H1¥T"5ISN3¥Y039I7N AN00W3IQTMI FY0O61V5`1SIGSNI1WSVIVIIQRWT9FIONTMTTIINI1%TIT2LTT5§O2I0LN2N7NYTLTMVN NTA3I9O3SNdIYTaI C0SvLeaTILviYxNmwvvvnwwe [ ([ | TNW1U0WnI0Uo0IKNiNIsI-LHSIICTVI2LNWL)IIgY1OVIRIWdINIISICHa3M0d07T33& BS0OTTLLE5RT2Yw5W93a3@0Y3%71I0TW1D59lLNOA0F01R{ToW4NLWSGgNVGOIo@eHtLfUTc4AoI Yi INceL7T-e)9oY7m)W8rx @ [ TJB--UT iSO w v 7 { v 438 % A\ 9 Mve3d8133S WiWdSs 2O3NY UL9273 wTaLad93 WWIiVnIg P 2L3II0N20N3LIY&324Lw0 o6u13s SIRIVWIM $901d 10N TVAIS3RVITu2WvIIAN6T2T1NU1iDL43WNIOTLLO23ILL0I0OyW76oI-1kHi3NIwO-i1MZU10dwW27iO02sSRs53MH4- OI0O[0LN2NLTDYL3MIOO51TNNW39INM20GO3QWJDuIHLnSS3SONSS3LY1 NIUN 03OoG N4yT WM e WF50 SNI TIoN AkI eRtS OWAI5S0N 3 T(SgO FWILaT A1TIgGVPRte eLYAvLa2k3S yE¢ f s I 5 M ATELYRIYT Mady 034 VEIT N s LINN3 T3 2738 4 W3 AT NGNS 2085QN Qlavi i NVG LeS tW7LSwLTV [M) a6m FANE RN Al st e 0 e g [B) 5] [G) A 10D¥LSARLO36HITN3RLdIN0II,aN1MN1(3OvM0HO4aDN0WSaIWWJ3NaAWA¥GDL,LLI4IIESv NTNI5TLW0S1Aa43Gk dQ`YD4ADPUL2TV2GIIX3NSNYI31aWVS73EmN41Y0Y0Lve 9ONn3UMToHL3NhNIILYYv3AsMXDaYRWL 2 LT3 00N 1 WAL 40 Tavd 3 [ ORSD3B ISWUIMLO SSTINN SILON T ¢ e £8 % Fo91-t - Ha|LdTTaGaar72| |W78 J0O00N--5LO0SI22RX 2AANRT3N1AG17L005Wz,Ve0| J ey | VY] A ITVTOYV.Qx 2| 8T957- 0 T | liswis wns @0Qe wrqow v 0wn0ewUino didW2w, SSwka 5suS4go19a0L-IN0ewn,o1 INTT SMUIST L 2 MIA $31 0 B3 23 B/,AaNn/=w///w/fletvflmm 5 / r @ -~ o P Pyo -] - s | X . - 4 Ll I il & ~ @ o 5-54 A3 [ | ©. fozr| 12GNOXe: TV T2 SHSWToe)o12vr5vri1SvyI5eo38]| S| MEicAtsO3mLv0le i2sWsY8X Di1i70yO4Qo2m1wO0wNTiwiILno0viNeAcyTOloDeDamwAn!oIOPIMaVoS1GA 1AvN2IRRa#vOBWarOIdsiRASed1RIR Ie8(G1A8m2R90I5w3TOMwRiFI0sITTNn3rTbPGW1ei52NogorN0DiNnE0ns1ogtR|| e [yl P 1y (] ¥ T () 378Y) g 4 c==s3 == rem ww & TWERm S-oSL"~S|il}& 7 4 . y 0 G WMa BOLNAO3W T p-- tB e+ Ts | S ' a dm3i=AT 335 e 4 3) vy Qe % 97D IIVAWILE wlIWAd : T 2. osoeeze ANTD SNOSIATY T © BT v T s T ° sefl] or - ® 2 8 . a rEs s73v78 S\@F 4 o vz @ (e1] e 0coezzs. Pressla-wir e o 4591 33LM108 a2 : E@ --f 9-8 M3 m ® = l@ | 33UJ.\MN J\M V -Nsfl(WM 5-55 TP P/e I RAouones (0(.) T0020TTENT | |3V N THPA) 2R27/ | qacos s nesewa oe marv ae |£Y] @ 1 lel \ A ! \\3*--. ol Tag \\\ A NMO Y A S(Y3N M TG I10150N 1S NWI? | HY 07 NO ¢t NGA NS 1D T 05121 TH | £F-0b D20QviByMl OANDEA 1D, |--28) £8-7-4 | £8-76 | waai'y00%io 0imTo o oVaEnCv mRmu2auaSV|a srMoq7nn | av] Arsaei Nt W3aR u2syC 4 3TY2M4w9It3AR02RI0AU3C 102F1id3T3av9vi9aes7 6D ]1 B | i 30 WOLIAN T 0 £ (o2 NS wiys. ANDD SIION } v ¥ - o) g-QINTLMNE-OJIr2LTaTnETS EX] | 2 | - 4 MIAA [ 9 ] L e 5-56 [ = _o5oe=z2] | CAINO 000 C2C W{3WI2LT7L)SWWIILON1I)MNI)NINSTINYINIINeI4IVLOONANNVLLIAvOLN"LANIWSzNVLWCNWOFUIIWIBGuOYVSWDN4SOLISVW`R)1SW03I88ZC0TLH6CLE8IOFiIO0(0EALwLAEsIITHS1LOWS5JWI0I0ULLLLwSV9D3IeAOWT,UVIW"WOsN(ITL¥NJLIIiLXTtvNG 1LYRWaWWEMd03N .INWlL3W¥I¢VvNINY ClAIIIM0YgN5IUMILIM7YNMEWILTEDIMLIWTT3NT$El£aNSTOT3CvGe80aNEiavI0TdvddOS-WdvN0WaIIyLNiNwL3av2«dvIvLw73vwY2sU:0 (] B 3 (5-0IEHS WOoHS LNGY 15 ILONV 9 L 12714783 PART NUMBER REV 2223050-0001 AH ITEM. QUANTITY., 0001 00001.000 0002 00001.000 0003 00004.000 0004 00001.000 0006 000C1,000 0007 00000.000 00074 00078 0009 00001.000 0010 AR 0011 00001.000 0013 ocooz.00C 0014 00010.000 o017 00001.000 0020 00000.000 00204 00208 0025 00001.000 0029 00001.000 Q031 00001.000 0032 00001.000 0033 00001.000 0035 00004.000 0036 00001.000 0037 00001.000 0038 00001.000 0039 00001.000 0041 00001.000 0046 00001.000 0048 00001.000 0050 00001.000 List of Materials DSYESSTCER'IPTAISOSNY-cSvTeAeNcNsAeRaDvacnansssscccsscccces COMPONENT.o DESCRIPTINNecocesocsscscoscsccaccssnnacs UM 2223938-0001 MAIN EMCLOSURE,SUBASSY 1669-1038-000 A 2223029-0001 COVER, TERMINAL 1678-3029-999 EA 22213033-0001 PLATE QPTION RNARD Ea 1678-3133-0%2 2223034-0001 INSFRT PLATE,FLOPPY EA 1678-3134-0641 0996289-0001 CORD SET,3~-PIN PWR-DNYMESTYIC RLACK EA 080126-0-7889-008-GY 0996289-0002 CORD SET,3-PIN PWR-DOMESTIC GRAY W/CLIP EA 080126-0-7919-008-GY *MAY BE USED AS AN 080126-0-7919-008-GY *ALTERNATE TO ITEM 6. 080126-0-7919-008-GY 2223075-0001 LAREL,SFRIAL-950 TERM, STANDARD DOM EA 1669-1075-000 0996943-0001 LABELySELF-ADHESIVE,.656 X .25 EA 1652-1274-000 2211919-0002 PLUG HOLE-1.563 DTA EA SEE TI- DRAWING 09729848-0043 SCREW A-32 X ,375 PAN HEAD CRES A 0972684-0011 SCRFW, THREAD FORMING,6-32 X .375 EA 1658~ =000 2229446~0001 DISK DRIVE ASSY,.FLOPPY,5.25 INCH FA 1254~ =000 2223009-0001 ALPHA CRT CONTROLLER EA > 1254-1009-029 $THIS ITEM MAY BE SURSTI- 1254-3009-029 *TUTED FNR ITEM #S54 1254-3009-029 2223082-0001 INTERCONNECT DTAGRAM EA 0972632-0001 STRAP,TIF NOWN,CABLE-NON-5TR,0-1-1/4 D, A 2223076-0001 2223020-0001 2223090-0001 0972969-0010 --P1NSI1eCAN22RSmAM55EEEm55WRPNm--TLe,33AEm55F#Tm12R6SELO19=-W,N--=2IT0000T10P0C18R0HOX FEO1SPSFLTNGOINNTAGHLD COMPUTER PL HFX WASHER A EA EA FA 0972969-0009 SCREW,6-20 X 7/8 HEX WASHER HEAD EA SEE TI- DRAWING 2232333-0001 LAREL,FCC-CLASS B FA- SEE TI- DRAWING 2269942-0001 LABEL UL EA 2269943-0002 LARFL, CSA,LR49011,COLLEGF STATION FA SEE T1- ORAWING 2223097-0001 CABLE ASSY,MOTHEPBOARD TD FLOPPY A --o---w==-=-000 0999456-9701 MAN , IU TNFA ORML ATTON REQUFST FORM A 1225-9456-000 2223203-0001 MAMUAL-GETTING STARTFD EA 1212-3203-000 2223279-0001 CONF IGURATION,FLOPPY DISK DRIVES A 1666-0000-000 5-57 12/14/83 List of Materials PART NUMBER REV 2223050.--0001 AH NESCRIPTION ceseccovocccvessecnscanssncsnse " SYSTEM ASSY-STANNARD ITEM, 0051 QUANTITY, COMPOMEMT.. 00001.000 ®2232983-0001 DESCRIPTION.csessocasesssssesasssncacsss LABEL,LOAD RATING,PROFESSTNNAL COMPUTFR 0052 OObOI.OOO' 2232338-0001 LARFL, PARALLEL PRINTFP 0054 0054A 00548 0056 0000: 1.,000 - . - s 00001.800 2223109-0001 0936667-0001 VIDED CRT CONTROLLER 1254-3100~060 #[TEM #2720 MAY BE USED AS AN 1254-3100-060 SALTERNATE FOR THIS PART 1254-3100-060 LAREL, IDEMTIFICATION PROF, COMPUTER 0057 00001.000 0532997-0019 BAG,POLY, 12 X 12 SEE TI- DRAWING y UM EA EA FA FA FA 12/14/83 PART NUMBER REV 2223050-0002 AH ITEM, QUANTITY. 0001 ©0001.000 0092 00001.000 0003 0¢005.000 0004 00002.000 0006 00001.000 0007 00000,000 00074 00070 0009 00001.000 0010 AR 0011 00001.000 0013 00002.900 0014 00007.000 0025 00001.000 0029 00001.,000 0031 00001.000 0032 90001.000 0033 00001.000 DESCRIPTION cesocnccsssscsvrasovscnsnccocos SYSTEM ASSY-BASIC COMPONEN.T DESCRIPTINNccescoccscessovesscansosnsoss UM 2223038-0001 2223729-0001 2223033-0001 2223034-0001 0996289-0001 0996289-0002 2223075-0002 0996943-0001 2211919-0002 0972988-0043 MATN FNCLOSURE, SUBASSY EA 1669-1038~000 COVER, TEPM INAL EA 1678-3029-799 PLATE NPTION ROARD EA 1678-3133-052 INSERT PLATE,FLOPPY A 3 Ea 1678-3134-041 CNRD SET,3-PIN PWR-NDOMESTIC BLACK EA 080126-0-7889-008-GY - cnPD SET,3-PIN PHR-DOMFSTIC GRAY W/CLTIP EA 0R0126-0-7919-008-GY *MAY BE USED AS AN 080126-0~7919-009-GY *ALTERNATE TO {TEM 6. 080126-0-7919-008-GY LABEL,SERIAL-950 TERMINAL,RASIC DOMESTIC EA 1669-2075-000 LABEL, SELF-ADHESIVE,.656 X .25 EA 1652-1274-000 PLUG,HOLE-1.563 DIA EA SEE TI- DRAWING SCREW 8-32 X .375 PAN HEAD CRES A 0972684-0011 SCRFW, THREAD FORMING,6-32 X .375 FA 1658~ -000 2223082-0001 INTERCONNECT DIAGRAM EA 0972632-0001 STRAP,TIE NOWM,CABLE-NON-5TN,0-1~1/4 D, EA 2223076-0001 2223020-0001 I1P1NA22NS55EE55LR--,T3355F21RS19OW--NI0T0T10C18H DPENING EA EA 2223090-0001 N--A--M--E--P--L--A--TE,--0P0R0OFESSINNAL COMPUTER FA 5-68 12/14/83 PART NUMBER REV 2223050-0002 AH ITEM, 0035 QUANTITY, 00004.000 0036 00001.000 0037 00001.000 0038 00001.000 0039 00001.000 0041 00001.000 0046 00001.000 0048 00001.000 0051 00001.000 0052 00001.000 0056 00001.000 0057 00001.000 List of Materials DSYESSTCERMIPTAISOSNY-«BsAcSeIsCeecacscscassasecnanonnes COMPOMENT,. 0972969-0010 0972969-0009 2232333-0001 2269942-0001 DESCRIPTIONcecoaases vecsvsssscssnes SCREW #6-20 X 1 LG THD PL HEX WASHER SCREW,6=-20 X 7/8 HEX SEF TI- DRAWING LABELFCC-CLASS 8 SEE TI- DRAWING LAREL UL WASHER HFAD 2269943-0002 2223097-0001 0929 56-9701 2223203-0001 2232933-0001 2232338-0001 LABEL, SEE T1- CSDARA,WLIRN4G9011,COLLEGF STATION CABLE ASSY,MOTHERBNARD me--=esw-=-000 TO FLOPPY MAN , IU NFOA RMAL TION REQUEST FORM 1225-9456~000 MANUAL-GETTING STARTED 1212-3203-000 LABEL,LOAD RATING,PRNFESSTNNAL CDMPUTER LABEL, PARALLEL PRINTER 0936667-0001 0532997-0019 LABEL, IDENTIFICATION BAG,POLY, 12 X 12 SEE TI- DRAWING PROF. COMPUTER UM FA EA EA FA EA FA FA EA A FA FA EA 12714783 PART NUMBER REV 2223050-0003 AH ITEM, QUANTITY, 0001 00001.000 0002 00001.000 0003 00004.000 0004 00001.000 0006 00001 .000 0007 00000.000 0007A 00078 0009 00001.000 00094 00098 0009¢C 0010 00011.000 0ot 00001.000 0ot3 00002,000 DESCRIPTIONessasess SYSTEMS ASSY STANDARD- ®ssssscccscccnses 320K 2 COMPONENT.. DESCRIPTINN.cceeoccsosccsssccacscscoveas 222303R-0001 2223029-9001 2223033~0001 2223034~0001 0996289-0001 0996289-0002 2275609-0004 MAIH ENCLOSURE, 1669-1038-000 SUBASSYTM COVER, TERTM INAL 1678-3029-999 PLATF OPTION ROARD 1678-3133-052 INSERT PLATE,FLCPPY 1678-3134-04] CORD SET,3-PIN PWR-DOMESTIC 080126-0-7839-008-GY BLACK CORD SET,3-PIN PWP-DNMESTIC GRAY W/CLIP 080126-0-7919-008-GY *MAY RE USED AS AN 080126-0-7919-008-6Y *ALTERNATE TO ITEM 6. 080126-0-7919-008-GY 10, SERTAL ND LAREL, RLANK, COLLEGE STA *D=PROFESS IONAL COMP BASIC *N=2223050-0003, A= 2.5 *V= 120, F=60, W=250 0996943-0001 2211919-0002 0972988-0043 L1A6B5F2L-y1S27E4L-F0-0A0DHESIVE,.6%6 X PLUG,HNLE-1.563 DIA SEE TI~ DRAWING SCREW 8-32 X .375 PAN HEAD .2S CRES UM A EA FA FA A EA EA EA Ea A 5-59 12/14/83 PART NUMBER REV 2223050-0003 AH ITEM. QUANTITY. 0014 0017 0020 00204 00208 0025 0029 0031 0032 0033 0035 0036 0037 0038 0039 0041 0046 0048 0050 0051 0052 0053 0054 0054A 00548 0055 0056 0057 00010.000 00001.000 00000.000 REF 90001.000 00001 .000 00001.000 00001.000 00004.000 00001.000 00001.000 00001.000 00001.000 Q0001 .000 00001.000 00001.000 REF £0001.000 00001 .000 00001.000 00001 .000 REF 00001.000 00001.000 List of Materials DESCRIPTION cccosescscvsvssecscccsssccccs SYSTEMS ASSY STANDARD-320K COMPONFNT.. DESCRIPTION..cevcccccscsscrcvscccacaanes UM 09726R4-0011 SCREW, THREAD FORMING, 6-32 X .375 FA 1658~ -000 2220446-0002 DISK DRIVE ASSY,FLOPPY,5.2STNCH-DUAL HD FA SEE TI- DRAWING 2223009-0001 ALPHA CRT CONTRNLLER EA 1254-3009-029 *THIS ITEM MAY RF SUBSTI- 1254-3009-029 *TUTED FOR ITEM AS4 1254-3009-029 2223082-0001 INTFRCONNECT DUAGRAM EA 0972632-0001 STRAP,TIE DOWN,CARLE-NON-STD,0-1~1/4 D, FA 2223076-0001 INSERT SWITCH OPENING EA 1255-3519-008 2223020-0001 PANEL,FRONT EA 1255-3521-011 2223090-0001 NAMEPLATE yPROFESS TONAL COMPUTER A ------- =-=-000 0972969-0010 SCREW #6-20 X 1 LG THD PL HFX WASHER EA 0972969~-C009 SCREW,6-20 X T7/8 HEX WASHER HEAD A SEE TI~ DRAWING 2232333-0001 LABEL,FCC-CLASS B EA SEE TI- DRAWING 2269942-0001 LABEL ,UL A 2269943-0002 LABFLy CSA,LR49011,COLLEGE STATION EA SEE TI1- DRAWING ? 2223097-0001 CABLE ASSY,MOTHERBOARD TO FLOPPY EA ---------- 000 0999456-9701 MANUAL, INFORMATION REQUEST FORM EA 1225-9456-000 2223203-0001 MANUAL-GETTING STARTED EA 1212-3203-000 2223279-0001 CNNFIGURAY TON,FLOPPY DYISK DRIVES EA 22329A%-0001 LABEL,LOAD RATING,PROFESSTINNAL COMPUTER FA 2232338-0001 LABFL, PARALLEL PRINTFR FA 2261914-9901 TI-MIX MFMBERSHIP FORM EA 1261- REF-000 2223100-0001 VIDED CRT CONTROLLER EA 1254-3100-060 *ITEM #20 MAY BE USED AS AN 1254-3100-060 *ALTFRNATE FOR THUS PART 1254-3100-060 2275610-0001 SPECIFICATINN, IDEMT SERIAL NN. LABEL FaA 0936667-0001 LABFL,JDENTIFICATION PROF. COMPUTFR EA 0532997-0019 BAG,POLY, 12 X 12 FA SEF Ti- DRAWING 5-60 v WOIvOiTedy. + v [-- PwRANSUOSlYAwoynNWd--3_--zA1uS_TSiNv--Sve]n--B-- eYe Ty T T TeEEEEe EE i - £948 wa-t -- NOLLS 463 XO2E - IPNOLONUTINI® ASSY WIISAS s | % == e 5-61 g --n (L GIENSa B m. 220202SO"Hw0EAmkST tV0fl- !SR-RN7TIr ¥lSGru,<2r26] 'sEJ81¢1ero-0-OOVQe£35IW)1SV|DT 22)1S| 2o0aH3 0-TCesl SRl7VyoDey05 m2PVl1HaE3lLO3MeoSJTviOdywNWlD7OittINt/SW aAS1wSk0e i N bnvOS-9wOaI8tNt0i iOmO3rO¢oIM0r -(VPsSWBeAO'IpIiwe SSNAhlyeBH!?TcT2Cn ALcWLIELSoWOe NOLywI NvYReY)sVeZTes20WT-IW2||RGT5)VoMT 3 [E-oTenv w7 s5200 027 0L8/F QMY 970153 13GL2T L ITNNO. l§«v (w1 INS 012dav-d -W1Y1|ST$E23e 0; 4Wwig07G0FOo0WGILySY 0W 00 T G4NSeVeliOe-o0O 181 umnr #3 QL aaiwov0 vHcIaVvZo1a1 StLMnIOw iIYoYNnC0 NSOD(5S5T @) ) Z 3. k w wr 0107F 5e0 S bS oo noxdL EB& - SNV A(1QD)S 1b41LEE3N13T0 ISoN110OHum NiIy nMwil`sGI03IuAnOdY3Ss (@ v A g BZN P LITRZ 10007 W TV OIENDIY ONKINNOYD e, = ) eSuosud [T YIIOES * AIDNISSY M4 NO 7 OI200a7 (1] w| INAIT FAUIENIE NIVLE NOILOVD B S v TRreTiEy e - ' I Telsaizee T 1 T v 74! - 65 WB 3LI) ASEY NOIN(GYITLY2TMSGO NOLLYIOY A8NOLLIAWYDIMAAUWIOIRLCIIVOIRJWIXMNOl NIOIRAZLVYSI,) = o ( 29 ) 1) VIV 4 LI -- 7% B MG Q3avi ONY (LS W37 9vA A0 NI QIWAIVL 32 QXVNG Z5% ¥ O T Wit m ¥ ° T ° == & (LrONvE wiiy) SI30VTTIYN2L0IND NOLLNVIOTG [B) 62 WIL2I24 HLwI¥Mg/OmJyUN1D2I0S® sava9NuMsaODeMNnSod3S3YoV1 () (¥ HIL) DMNIINDIL FEXIPE VINNS ANONL SO CONNIO LBMYEY LINE IO LSO (0 WII) BaVIS LNBEIN 4O 3OVS B CIEIBIE FOWIHID BEII JRION { < i o ~ 5-62 I_|~iw._0nmmm I._o.._.w.@ ._d||!N_ Ty ......_ G-iws y 1 -- 3 SVD FIN SO 0LO v e jfl : ¥ 4 b uxm@ ® @ W P fl/ u N e Lo ir |2s R oAw(F57Hv7 Oo20N5sBN@0eID) NWGonIIeOTOSvsLIHTSANd) | [0 av] F I - sy | amsanc2i00o0°nF QusYwssuv il A OEt) g 5 8-65] $9-15F| aQrWI1am0NiO0nLVvHiNa1Eus0NmnNAumYWam7dOI(Ny(O0VOeLIYbEsLRzSIi2IWeS3aNlsD]7 IVY Al M Taa2vDsstry B4-ug®tre KARo SOHS@ v §1N7So) :a0Ng7:Ot S2I0A5TE s o L @\ @ P £< m © sat 7 - p 5 o o3 = . ~J /@ (o 07G70d00v:w2: 200053 SUWNiLM221G2R5TMWOeA DW)id 9150§ 31WIL09Tv6Ee¥WL67oNWT1il0[0]0] 7vS7ro4rgw] ot ey e g $6 777 | n- it weini 3N r6n68 oW3aLN0SscNW2| Sénicy] o RS R R 2o] Ty sert N 7, o 2Trerm2ig]|2 <tEi-5y:-19|[Bfkrgirhoowme7 eiOs$3 TimoGAov"oiN wA3ava0cwa(e)3) 1ZK&)%t2pe12w 0TL5EMoND5 D E IO\ AR0W)E-I% 0SIYZA E 2Q1LEIJTi0ViZ1TNTV GQ7U7v0O5aW7NiVNLTNIEVNs-NNVNGEILM'NVIA107 2TTNV $7E OESLTLsDN3WT2MV0I8tJA; v T T Bl e soez T ] ' | | I | ! ' | | '\ \ E s (r-9)cws g Le==1d" B ( Gl \ : ¥ O 1 ' T> pomomm e 1_ 4I9VD MMA MOLINeOW < 0 v 14010[882413y v---- ' . t9 o] 1 ¥ R .r @ ! ---- IR QY3N 5 20w -~ s T i /%4 ° Bl e o e i e]fff e [ _aw. LEAMS e e ° [C i T " e w i = N VR A SISWNUIWS26 (& 53912 (@) » l < ¢ % (%7)] 8 A O ! o] i1sogeeze { z 51296/ | = e 6-63 v «09(1&-A0M)2OwNs 8-8 M3 £ 3(-F8v32av0:N1OI1LLIILvPI5SIS A7 --r-- e 13IWS INIATIINF MIA MIA Jave T SWNT.zvtl VY KSUNACSONSaIe aTes Aw3s.ai de5IS0tS0I7NWIMDv7FI7O650LY2WWT2HIkCsRE4aoTTI2iaHKTm¢YaGvE63aOd9INw3DiG YrrORIvvQ-TwuSa3vidAwsvTTw [3] ] 2@ NN WS 35 L IWTATI Pt]2lWLL IOTNVLYOo3MWNIwATNViSOPVNJI3AATLILLNLLJYNuC1vxiBNseTIL4TTIVOPN2DDYTSYTIINbSYSNTNRVIEewIViRcLDsI2VMNL1I2wwPwAiN4v TgSTLITNNBsT2EaCNIvIwNT3Ny9TiInDvReLv.x [BT#]X ] 3 =.Li 1 v T s =TI 5 g 2Q+ NO1LLLT2IINSS SISSwHI NIV T z B X =_= 23 12/14/83 PART NUMBER REV 2223051-0001 AR ITEM. 0001 0002 0003 0004 0006 QUANT {TY, 00001.000 00001.000 00004.000 00001.000 00001.000 0009 00094 00001,000 0009n 0009¢C 0010 ootl 0013 00011.000 00001 .000 00002.000 0014 cot? 0020 0020A 00010.000 00001.000 00000.000 00208 0025 REF 0029 0031 0032 0033 0035 00002.000 00001.000 00001.000 00001.000 0C004.000 0036 0041 0046 0047 0048 0049 00494 00001.000 00001.000 00001.000 00001.000 0C001.000 00000.000 List of Materials DFSCRIPTION .cccccccsencsecccsassccascsns SYSTFM ASSY-TNT*L-320K COMPONENT.. DESCRIPTIOM.secssseeecesoceneasssnseases UM 22222233003209-200> 000012 CO1MV6AET6NR9,-2E0NT3CE8LR-OM0SI0UM0RALE SURASSY-RPO A £A 2223033-0001 2223034-0001 0996290-0001 111PCI666LNO77TASRT88REEDR---TS331E110OT332PP,439TLP---IAO009OTM459NER129-,WFBELNSOATPRPDY EURN-RT ANGLE PLUG EA £A FA 2275609-0004 1D,SERTAL NO LABEL, BLANK, COLLEGF STA FA *D=PROFESSIONAL COMP INT'L *N=2223051-0001, A=1,.25 *V=240, F=50, W=250 0996943-0001 LABEL SELF-ASTD VE,H.E656 X .25 A 1652-1274-000 2211919-0002 PLUG,HOLF-1.%63 DIA EA SEE TI1- DRAWING 0972988-0043 SCREW 8-32 X .375 PAN HEAD CRES EA 0972684-0011 SCREW, THREAD FNRMING,6-32 X ,375 EA 1658~ -000 2220446-0002 DISK DRIVF ASSY,FLOPPY,S5.2SINCH-DUAL HD EA SFE TI- DRAWING 2223009-0001 ALPHA CRT CONTROLLER EA > 1254-3009-029 *THIS ITEM MAY BE SUBSTI- 1254-3009-029 *TUTED FOR ITEM #54% 1254-3009-029 2223082-0001 INTERCONNFCT DIAGRAM EA 0972632-0001 STRAP, TIF DOWN,CABLE-MCN-STD,0-1-1/4 0. EA 2223076-0001 INSERT SWITCH OPENING EA 1255-3519-008 2223020-0001 PANEL,FRONT EA 1255-3521-011 2223070-0001 NAMEPLATE, PROFESS [DNAL COMPUTER EA ~--=m--=-----=000 0972969-0010 SCREW #6-20 X 1 LG VYHD PL HEX WASHER EA 0972969-0009 SCREW,6-20 X T7/8 HEX WASHER HEAD EA SEE TI- DRAWING 222309 7-0001 CABLE ASSY.MOTHFRRDARD TO FLOPPY FA i ------ 000 0999456-9701 MAM y IU NFOA RMAL TION REQUEST FORM FA 1225-9456-000 2222574-0002 LABEL, CAUTION (BPO) EA 0000-10100-000 2223203-0001 MANUAL-GETTING STARTED EA 1212-3203~-000 0996694-0001 CABLE ASSY,PWR,ELEC {INTERNATIONAL} A 080126-64-1-075 *THIS PART MAY BE USEDN AS 080126-64-1-075 5-65 12714783 PART NUMBER REV 22230510001 AB ITEM, QUANTITY. 00498 0050 RET 0051 0052 0054 0054A 00001.000 00001.000 00001,0C0 00548 0055 REF 0056 00001.000 0057 00001.009 List of Materials DESCR e 0vI evvP scvsT csvI escO ssscN asa. cncse SYSTEM ASSY-INT'L-320K COMPONENT., o NESCRIPTINNeeooeovseescccssncncccscnsese 2223279-0001 *AN ALTERNATE FOR ITEM & 0A0126-64-1-075 CNNFIGURATION,FLOPPY DISK DRIVES 2232338-0001 LABFL, PARALLEL PRINTFR 2261914-9901 2223100-0001 2275610-0001 TI-MIX MEMBERSHIP FNPM 1261- REF-000 VIDEN CRT CONTROLLER 1254-3100-060 *ITFM #20 MAY BE USED AS AN 1254-3100~-060 *ALTERNATF FDR THIS PART 1254-3100-060 SPECIFICATION, IDENT SFRIAL NO. LABEL 0936667-0001 LABEL, INENTIFICATION PROF, COMPUTER 0532997-0019 BAG,POLY, 12 X 12 SEE TI- DRAWING UM FA A EA £A EA FA FA 5-66 W 22 /w1 | 1 - ' T T19l0£222, _ [89T 990[0 18YD ITISOOIHHLINTOEDO v [orasan-is,..: ---- ] NOLRI530 FIOWN J5ver] FNUId £ - §H3I7VII0N4LiNNOCD)_L1¥8DD SSNHNHIaVvIEDD |20|i0100-06-11990082222,. -- TRS,AFILGEIUIRNS-NIgITSVSNTuVGVLSIWT -- IIATITFTNTIIIOOCSNWIINNNOGGYTS 1d1¥YuTT_* WITI0MINGY_1n3 ' SS§IIINHAHSIVVVEIIDDT 'SIIHAVED | 1005 [/00F T--79190900£EE22222,222 |300W 7190T22E \ RS98 8 N.\Q R = = L p wen ' o Hom S 2oW8oriT vevilyoesyonecA < GSA|T9OaN[eeE[Iet V[VerI]N_ ]____1i0o100c00oG-- - 2I999000¢8¢,,. alu[»[afa]xix] 1000-222¢ b=t Tl T LHOIZH Pr1d :t 21 / | 7= Av_Ti.Or.Ns.IoTIoSn[ImaC.]glH_| NuOe9Im7S1I5e947337=] * 1932 1IN T WEleiv3elenz avsiRy s wigNWM¥1.>NM st nw2n0"0& | I10 ||ew1w0»-[v=e2wXT0\I0`ELTT]N|w[ Meo.wNw| % o M e ANOIFH W XVU 311 / Qu3[|]| gov9|[3[e][v]n[s|*w]|[9] 1r000000--ez9v00crzz2eze | Wvwo5vi|a [ 23] 77000000 --TtazvzEez2z2z2 || AdTseawc3asmSaV|R|) 8 B ox~| = o [ © = @ Fom St Gom (=3 Saa ' | e on 5-67 £3-91-2 | [$1xL901wV02M3001 0,AeN0 il 0 ISwWmt5w 1£2L1a40ut 07cM)erv e | 957 A SvTSiIoaAwToyson0A3Ty|y W £8:21-0) | gy v cvaathiagoy Y @ an Lol o Lio v Lootl ov Lolén o Lol o ¢ Lof o Leof 1 fd :_ B[] e o X . o o sen ein' f3 a0l 963 =3seoa sint .3 @ = =52 n m. W | 7£ oess-2:fepWkeAioLw2i0av01l50t0W5w010S110W0IVaGdSoVw~ImAaeITfY'2G5V22Q1AL0SWA8S9NS518v95QG9vaa0av5beeenMWwn1| y | §2) W2 $IIWUE 5141 1@8)92012262922222WY $Nv PN4 - ¥3078 IR87M74m1AO31279000250A2Ww24120218099O0055L1Y2- 2tv1w301{0SNodW0m] % 1o [raws] 17 YA s0wTN6vIoVA31Is1T (28()0A@50T)$0Y3L3eOI9oIn/vZr5JOz5I5o10vs650awN30da-nSWIeSe( (1 i --- --_- ---- - -- e F1005- WL 2-L150222 W] Wa-e 4211 a0V $¥M LI 200K AL o 2005~ a |3 2008 WAV 21005N02 1110 19062=21W214 11(@) 1£3505006 W3 [T Te raow] e > 7m031F(I0@)55032a0vR4ovrazVse0isnT1 vwr [(1Tvg) QIIVAGTM TN M1 VIKIY AT L`iviSa5a3cu0d4s4w wwev4e (B 393007 13-27 AINO (TN AT82IWIWiStSY T1S900 () 30'S A TASSNN3A0SO AWTIUSBSM TNWIILDAAN(VA)N 0S°26 S2 ,D WOA W) A4TWSSIIVNSW40N[T --_-- ---- - - --- == v AER TV BANRDINBNNAaNn'LshA0SiR2I0n0o0g-we0) [ IHSOOLSVINWVIYHND_NIOJISOPGOULOWNELOI3VID~SIIDFOUIIONVJLNVAHVIIIILSIDIASODEMNNNWINSSIOSIHSISOIJ0YAVIVILSIVOLNSNNSIi¥SLfNNItLLGLINIIOINN3FINNONHOOINIIWLiOWOAI3OOUYaNYIIIvV 5 VHIIONOONV TvBa2iSNILOINV ¥33d003GISLsYIiIi5Iv0Od8NaI 3135OVNIVSxaeOw'v [B OrCmary t va IT oLY A moezez] w | . $39VId¥ -- ---- - -- =5 { |fl - 7 @ @ #3 OQNIVLVBIIIGONNON IIHVSIVSO NIILVuiTBLILOIVNadsYNsOIISoXIoIAuVZdWY (T] £7 3¢ NS 0uvOR MOTI0 MLONIT OV wwirvw (B 3L 3A0GV 1n9IIN A9N5INOO38WOD1SWon0i¥xVvowP () `OAIDIAS FTWMBIHIO SSIIN SILON L [ 8 5-68 o g 1TFUW NDuANWi LIEg20DIovVWtil-NCOG0LQTL2L1ET1V9IA0S5TY0M520AN65 BN TSI AI AI *DRAWING N O #** e C C 2223061 = * »--n » P P * oo * 3= * P * e 0.23 - --_-- 0.5 e e e ee e e e 1.5 2.3 5.6 e ee 11.2 23 A T I B TEIE AN 300040 T 060 2536 963 3005 353600 3106 06 3000 20 3 5 9 4 496303 45 96 4 * =aa=== MM MM e MM MM MM MM sazaaz= == i 0.010 o ---- i 0.02 e e eee ! 0.046 A e e e ee e ! 0.0% e e e e e e ee e e e e ! 0.22 + ------ - ! 0.44 e - m=s=== e -------- ---------- IEEEEEREEREEREEEEEENEEEEENEEERESNESEEENE:E N® N X % X ¥ %k % ok %k ok k %k % Kk ¥ ok &k & & &k k & k& k¥ %k ok %k ¥ k& ok ok ok ¥k k& 3060 3332 I FE 62 I 636 I3 AT I ST *## STEIXA-S MIENSTTRRUMIENCTS INCORPORATED U6 345 B I I 336 B 26 S8 38 30 3B 66 38 3 A 3038 30 36 3 3 66 E 00 4 26 ## T I TLGER!APHICCONCVRTERSCIOONNTROCLHLAERRT, [MED *2 *353023 30 * *#* U336 I 36 #I *35 PT R3O5 I J66*D5 IAT38E63®*3 I SCALE #*DRAMWING NO®REWV# 36 S TE 36 3 3 36 306 S 3 0 38 3 3 3 63 35 35 4 3 36 36 38 3435 38 36 44 26 36 4 3 34 3 46 6 40 3 3 226 * N C * * * * #* *# 8755 #= 11/01/82 *» NONE **3H©EOET2223061 10F)]=»7 /R* = *****{*****l'gii**l*l**&********l'**i******'l***{*f%#**!*i****i&i*il*&i*****&*i&* 5-69 12/14/83 List of Materials PAPT NUMBER REV 2223061-0001 R NESCRIPTINNGceessseccvssvscnnccccscscnce GRAPHICS,CRT CONTROLLER ITEM, QUAMTITY. COMPNINEMT., DESCRIPTINH.cvececscvrscescescccccssanses Ul 0002 REF 2223063-0001 DIAGRAM,LOGIC,GPAPHICS CRT CONTRNLLER A 0007 00074 0007R 0007C 0021 00214 0022 00001.000 0972900-7138 NETWORK SNT4LS138N EA TI ~SN74LS138N u2é6 T! =SN74LS138N ITEM 33 (PN 2210653~0001) T! =SNT4LS138N 1S AN ACCPFPTARLFE SURSTITUTE T ~SN74LS138N 00001.000 2210288-0022 HFADER ,1-FOW,22 CONTACTS, 100%TM CENTERS EA SFE TI- DRAWING P4l SEE TI- DRAWING 00004.000 0996341-0003 SPACER,PC BOARD,ZYTEL,NATURAL COLOR FaA 0023 00234 0024 00001.000 2210057-0011 REF 0994396-9901 HEADER, STR. PIN, 22 POS EA 007791--87215-7 P42 007791--87215-7 PROCENURE,SITF § DATF CODF SERIALIZATION EA 0027 REF 2223273-0001 SPECIFICATION,UNIT TEST-GRAPHICS CRY FA 0028 AR 0411400-0024 WIRF, 24AWG ELECTRO TIN PLATEDN COPPER FY 0033 00000,000 22106%13-0001 1C,L5138,3-T0-8 LINE DECONER EA V-LIST-LSI38 DBURN-IN 0033A uz2é6 - V-LIST-LS138 RURN-IN 00338 o SUBSTITUTE FOR ITEM 7 V-LIST-15138 BURN-IN 0999 00001.000 2223061-5001 GRAPHICS,CRT CONTROLLFR-AUTO TMSFRT EA 1254-3061-012 9999 00001.0C0 0239999-9999 COST, SHRINKAGE A 5-70 12/14/83 PART NUMBER REV 2223061-0002 R ITEM. QUANTITY, 0002 REF 0007 0007A 00001.000 00078 0007C 0021 00001.000 0021A 0022 00004.000 0023 00234 00001.000 0024 REF 0027 REF 0033 0033A nN0000.000 00338 0999 00001.000 9999 00001.000 List of Materials DESCRIPTION.ccosecosscsccccscsncacsacces GRAPHICS CRT CONTRMOLLER 3 PLANE COMPONENT.s DESCRIPTIDN:evsccccsesscscscsvosssnscses UN 2223063-0001 DTAGRAM;LCGIC,GRAPHICS CRY CONTROLLFR FA 0972900-7138 NETHWORK SNT4LS138N £A TI ~SN74LS138N u26 Tt ~SNT4LS138N ITEM 33 (PN 2210653-0001) Tl -SN74LS138N IS AN ACCEPTABLE SUBSTITUTE T1 =SNT4LS138N 2210288-0022 HEADER, 1-ROW,22 CONTACTS, .100" CENTERS EA SEE TI~ DRAWING P4l SEE TI- DRAWING 0996341-0003 SPACER,PC BOARD,ZYTEL,NATURAL COLOR EA 2210057-0011 0994396-9901 HEADER, STR. PIN, 22 POS EA 007791--87215-7 P42 007791~-87215-7 PROCEDURE,SITE & DATE CODE SERIALIZATION EA 2223273~0001 SPECIFICATIOUNN,TT TEST-GRAPHICS CRT FA 2210653-9001 2223061-5002 0239999-9999 1C,L5138,3-T0-8 LINE DECODFR EA V-L1ST-15138 AURN-IN uzé V-LIST-LS138 BURN-IN SUBSTITUTE FOR ITEM 7 n V-LIST-LS138 BURN-IN GRAPHICS,CRT CONTROLLER 3 PLANE-AUTO INS EA 1254-3063-032 COST, SHRINKAGE - EA 12714783 PART MUMBER REV 2223061~-5001 R ITEM. QUANTITY. 0001 00001.000 0003 00004.000 J003A 0004 00006 .900 00044 00048 0004C 0005 00001.000 0005 A GDREASPCHRIICPSTIO,CNRT ceCoOoNvTeRcOscLeLsF ssecssscssssanse UTO INSERT COMPONENTeo DESCRIPTIONcccoccnvsacasccsvaccnssvscnscss UM 2223062-0001 PWB ,GRAPHICS CRT CONTROLLFR EA SEE TI- NRAWING 222051 7-0002 TCy16KX4RIT RAM,330NSEC READ CYCLF TIME EA SEE TI~ DRAWING u1,U2,U3,U% SEE Tl- DRAWING 2220521-0001 IC, TTL SHIFT REGISTERS FA U13,U14.U15,U16,U17,U18 ITEM 31 (PN 2210669~0001) IS AN ACCEPTABLE SUBSTITUTE 2223084-0001 GRAPHICS LOGIC ARRAY £A 1254-0000-000 U4l 1254-0000-000 57 12714783 PART NUMBER REV 2223061-5001 R ITEM. QUANTITY, 0006 00006.000 00064 00068 0006C 0007 00001.000 0007A 00078 0007C 0008 00084 00003,000 00088 0008C 0009 00003.000 00094 00098 000%C 0010 00004.000 0010A 00108 0010¢C 0011 00002.000 00114 oolia 0011C 0012 00001.000 00124 00128 List of Materials DESCRIPTION.cccesaccacssoncncsoscsccancs GRAPHICS CRT CNNTROLLFR-AUTO INSERT COMPONENT.. DESCRIPTION:ccecscacsassssnsssscacncsnas 0996755-0001 0972900-7138 0801383-0001 ICySNT4LS245N BUS XCVR TRANS!TION 001295~SNT4LS245N U19,U20,U21,U22,U23,U24 001295-5NT74L5245N ITEM 32 (PN 2210695-0001} 001295-SN74LS245M IS AN ACCEPTABLE SUBSTITUTE 001295-SNT4L S245N NFTHORK SN74LS138N TI -SN74LS1338M uz2s T1 =SNT4LS138N ITEM 33 (PM 2210653-0001) Tt ~SNT4LS138N 1S AN ACCEPTABLE SUBSTITUTE T -SNT4LS138N NETWORK SN74LS1SIN u27,U28,U29 ITEM 34 (PN 2210658-0001) 1S AN ACCEPTABLE SUBSTITUTE 0996029~ 0001 0972900-7153 0996508-0001 0996420-0001 IC, SNT4LS273N OCTAL O-TYPF FLIP/FLOP TI =SNT4LS273N U3o,Ull .32 TI ~SNT4LS273N TTEM 35 (PN 2210702-0001) Tt ~SNT4LS273M 1S AN ACCEPTABLE SUBSTITUTE T -SNT4LS273N NETHORK SNT4LS153N » TI =SNT4L5153N u33,134,U35,U36 T ~SN74LS1532N ITEM 36 (PN 2210659-0001) T ~SN74LS153M IS AN ACCFPTABLF SUBSTITUTF T1 ~SNT4LS153N IC,T4LS393N DUAL RINARY COUNTER 001295-74LS393N u3i7,u3s 001295-T4L5393N ITEM 37 (PN 2210727-0001) 001295-74LS393N IS AN ACCEPTABLE SUBSTITUTE 001295-74L S39N ICs SNT4LS373N 001295-SNT4LS3TIN Use2 001295-SN74LS373N ITEM 38 (PN 2210720-0001} 001295-SNT4LS3T3N UM EA EA EA EA EA EA A 572 12714783 PART NUMBER REV 2223061-5001 R ITEM. QUANTITY, 0012C 0013 00001.000 00134 oo138 0013¢ 0014 00001.000 00144 00148 0014C 0015 00001.000 00154 00158 0015¢C 0016 00001.000 00164 0017 00004,000 00174 0018 00001.000 00184 0019 00019.000 00194 00198 0019¢ 0020 00020.000 00204 00208 0020C 0025 00001.000 00254 0026 00000.000 0026A List of Materials DESCRIPTINNe cocane esesssncesecsscse GRAPHICS,CRT CAHTROLLER~-AUTD TNSERY COMPONENT,. 0219402-7174% 0972669-0001 0219402-7400 0972784-0002 0972946-0081 0972924-0018 0972763-0013 0972763-0025 0972946-0027 2220517-0001 DESCRIPTINN.ucccsconcoccacasocsccnsoonce UM 1S AN ACCEPTABLE SUBSTITUTE 001295-SNT4L S373N NETHWORK SNT4S1 74N EA Ti- ~SN76S174N U43 TI- ~SNT4S174N ITEM 39 (PN 2210763-0001} Ti- -SN74S174N IS AN ACCEPTABLE SURSTITUTE TI- ~SNTASIT4N NETHWORK+ SNT4LS163N EA U40 ITEM 40 (PN 2210667-0001) TS AN ACCEPTABLE SUBSTITUTE NETWORK SNT4SOON FA Us4 ITEM 41 (PN 2210735-0001) IS AN ACCEPTABLE SURSTITUTE NETWORK SNT&LS14N EA uss 4 RRRROOLEHMSyR2F,IRX-=3~ ,R4RR--.422T55K OHM 5 % .25 n~ W CARBON FILN FA CAP FIX TANT SOLID 6.8 MFD 10 2 35 VMT EA QPL -M39003/1-2304¢ cl QPL -M39003/1-2304 CAP,FIXED .OLOUF 50 VOLTS EA 004222-MC10SE103Z C24C3,C4,C54C6,C7+C8,C9,C10 004222-MC1051032 11,C12,C13,C14,C15,C16,C17 004222-MC105E1032 18,C19,C20 004222-MC105E103Z CAPACITOR,,10UF 50V FX,CERAMIC DIEL FA COR CA-CO3Z5UL04Z050A 21,22,023,C244C25,C26,4C27 COR CA-C0O3I5U1042050A 284C29,C30,C31,32,C33,C34 COR CA-CO3Z5U1042050A 35,C36,C37,C38,C39,C40 COR CA-CO32Z5UL042050A RES FIX 27.0 OHM S ¥ .25 W.CAPBON FILM A ROH = R=2% RS . ROH - R-25 IC+16K X 4=-RIT,RAM,26NNSEC READ CYCLF T FA SEE TI- DRAWING *THIS ITEM MAY BE USED AS SEE TI- DRAWING 5-73 12714783 PART NUMBER REV 2223061-5001 R ITEM. QUANTITY, 00268 0030 00001.000 00304 00308 0030C 0031 00000.000 00314 00318 0032 00000.000 00324 00328 0033 00000.000 0033a 00338 0034 00000.000 00344 00348 0035 00000,000 00354 00358 0036 00000.000 00364 00368 0037 00000.000 0037A 00378 0018 00000,000 00384 00388 0039 00000.000 00394 List of Materials NESCRIPTINNceoesccosensssosscncsscsssannns GRAPHICS,CRT CNANTRNLLER-AUTO INSERT COMPONFNT.. DESCRIPTIDN.ucevcooosscssasrcvccsccscsnse UM *AN ALTERNATE TO ITEM 3, SCE TI- DRAWING 0219402-T163 NETWORK, SN74S163N Fa U39 ITEM 43 (PN 2210761-0001) `IS AN ACCEPTABLE SUBSTITUTF 2210669-0001 2210695-0001 2210653-0001 2210658~-0001 2210702-0001 2210659-0001 2210727-0001 2210720-0001 2210763~-0001 IC,L5166,8-81T PARALLFL/SERTAL INPUT EA V=L 1ST-LS166 BURN-IN ut3,ul4.U15,Ut6,U17,Ul8 V-LIST-LS166 RURN-IN SUBSTITUTE FOR TTVEM 4 V-LTST-L 5166 PRURN-IN 1C,15245,NCTAL BUS,XCIVER,3ST.OUTPUT FA V=LIST-LS245 BURN-TN ul9,u20,U21,U22,023,U26 V-LIST-1S245 BURN-IN SUBSTITUTE FOR ITEM 6 V-LIST-LS245 BURN-IN 1C,15138,3-T0-8 LINE DFCONER EA V-L1ST-LS138 BUPN-IN u2s V-LIST-LS138 BURN-TN SUBSTITUTE FOR ITEM T V-LIST-LS138 RURN-IN IC,LS151,1-0F-8 NDATA SELECTOR/MULTIPLEXF FEA uV2-7L,I0S2T-8L,SU12591 BURN-IN < 3 V~LIST-LS151 BURN-IN SUBSTITUTE FOR ITEM 8 ~ V-LIST-LS151 BURN-IN ICsLS273,CCTAL, N-FLIP-FLOP W/COM CLONCK A V-LIST-15273 BURN-IN U3o,u3l,uU32 V-L1ST-15273 BURN~IN SUBSTITUTE FOR ITEM 9 V-LTST-LS273 BURN-IN ICyLS153,DUAL 4-LINE TO 1-L DATA SFEL/MPX FA V-LIST-LS153 BURN-IN U32,U34,U35,U36 V=LIST-LSI53 BURN-IN SUBSTITUTE FOR ITFH 10 V-LIST-LS153 BURM-TIN IC,LS393,DUAL,4-BIT BINARY COUNTFR EA V-LIST=L5393 BURN-IN u3rT,u3s V=L IST-LS393 BURN-IN SUBSTITUTE FOR ITFM 11 V-LTIST-1L5393 BURM-IN 1C,L5373,0CTAL D-TYPE LATCHES EA V=LIST-LS373 BURN-IN Va2 V-LIST-LS373 AURN-IN SUBSTITUTE FOR ITEM 12 V-LIST-LS373 BURN-IN ICyS174,HEX,FLIP-FLSTONPG,LE RAIL OUTPUT FA V-L15T=S5174 BURN-IN U4l V=LIST-S174 BURN-IN 5-74 12/714/83 PART NUMBER REV 2223061-5001 R ITEM. 00398 QUANTITY. 0040 00000.000 0040A 00408 0041 00000,000 00414 0041R 0043 0043A 00007.000 00438 12/14/83 PART HUNMBER REV 2223061-5002 R ITEM, QUANTITY, 0001 00001.Cc0C 0003 00012.000 0003A 00038 0004 00006.000 00044 00040 0004C 0005 00001.000 00054 0006 00006.000 0006A 00068 0006¢C 0007 00001.000 00074 00078 0007C List of Materials DESCRIPTION eoccasoscenscssscssencannsnas GRAPHICS,CRT CONTROLLER~-AUTN INSERT COMPNNEMN.T & 2210667-0001 2210735-0001 2210761-0001 OESCRIPTIONcccececsossacoscascsosncaanece SUBSTITUTE FOR ITEM 13 V=-LIST-S174 BURN-TN IC,LS163,SYNC 4-BIT BINARY CNT,SYNC CLR V-LIST-L5163 AURN-IN us0 V=-LTST-LS5163 BURN-IN SUBSTITUTE FOR ITEM 14 V=-LTIST-LS 163 BURN-IN 1C, SO0, QUAD, 2-INPUT NAND V-LIST-S00 BURN-IN Uss V=LTST-S00 BURN-IN SUBSTITUTE FDR ITEM 15 V-LTST-S00 BURN-IN 1C¢ 5163+ SYNCHRONOUS 4-BIT CNUNTER V=L IST-5163 BURN-IN U39 V-LIST-5163 BURN-IN SURSTITUTE FOR ITEM 30 V-LIST-5163 BURN-IN UM EA EA EA DESCRIPTINON. ccecssocovsnsnse seoves GRAPHICS ,CRT CONTROLLER 3 PLAME-AUTD INS COMPOINENT.. NESC c eR esocI escP ccaT ssccI cscO cccsN snces UM 2223062~0001 PWB,GRAPHICS CRT CONTROLLER EA SEF TI- DRAWING 2220517-0002 1Cs 16KX4BIT RAM,330NSEC REAQ CYCLE TIMF EA 7 SEE T1- DRAWING i U1, U2,U3,U4,US,U6,U7,U8,U9, SEE TI- DRAWING u10.U1,U12 ~ SEF TI- DRAWING 2220521-0001 IC,TTL SHIFT REGISTERS FA U13,U14,U15,U16,U17,UL8 ITFM 31 (PN 2210669-0001) IS AN ACCEPTABLE SUBSTITUTE 2223084-0001 GRAPHICS LOGIC ARRAY EA 1254-0000-000 Usl 1254-0000-000 0996755-0001 IC, SN74LS245N BUS XCVR TRANSITION FA 001295-SNT4LS245N u19,U20,U21,U22,U23,U24 001295~-SNT4LS245N ITEM 32 (PN 2210695-00013 001295-SNT4LS245N IS AN ACCEPTABLE SURSTITUTE 001295-SNT74LS245N 0972900-7118 NETHNRK SNT4LS138N EA T1 ~SNT4LS138N U2s TIITEM 33-SN(7PN4L52123180N653-0001) T1 ~SNT4LS138N IS AN ACCEPTABLE SUBSTITUTE T1 -SNT4LS138N 5-75 12714/ 83 PART NUMBER REV 2223061-5002 R ITEM, QUANTITY, 0008 00003.000 00084 0008a 0008cC 0009 00094 00003.000 00098 0009¢C 0010 00004, 000 00104 00108 0010C 0011 00002,000 00114 00118 oolLicC 0012 00001.000 00124 00128 0012C 0013 00134 00001.000 00138 0013C 0014 oco0l.000 0014A 00148 0014C 0015 00001.000 0015A 00158 List of Materials DESCRIPTIONecevecacaccsoenscsoenasccnsass GRAPHICS,CRT CONTROLLER 3 PLANE-AUTO INS CNMPONENT.. DESCRIPTION ceccecscacossovcasescscosescne 0801383-0001 NETWORK SNT4LS1S51IN u27,128,U29 ITEM 34 (PN 2219658-0001) IS AN ACCEPTABLE SUBSTITUTE £ 0996029-0001 0972900-7153 0996508-0001 0996420-0001 0219402-7174 0972669-0001 0219402-7400 IC, SNT4LS273N OCTAL D-TYPE FLIP/FLOP Tl =SN74LS273N U30,U3l,.u32 T =SNT4LS273N ITEM 35 (PN 2210702-0001) T =SNT4LS?73N 1S AN ACCEPTABLE SUBSTITUTF TI ~SN74LS273N NETWORK SNT4LS153N Tt ~SNT4LS1S3N U33,u34,U3sU,6 T =SN74LS153N ITEM 36 (PN 2210659-0001) TI ~SNT4LS153N IS AN ACCEPTABLE SUBSTITUTF T1 ~SNT4LS153N IC» 74LS393N DUAL BINARY COUNTER 001295-74L5392N u37,u3s 001295-74L.5393N ITEM 37 {PN 2210727-0001) 001295-74L5393N IS AN ACCEPTABLE SUBSTITUTE 001295-74LS393N I1Cs SNT4LSITIN 001295-SN74L.S3T3N u42 001295-SNT74LSITIN ITEM 38 (PN 2210720-0001) 001295-SHN74LS373N IS AN ACCEPTABLE SUBSTITUTE 001295-SN74LS3TIN NETWORK SNT4S1T4N TI- -SN74S174N U4 TI- =SNT4S1T4N {TEM 32 (PN 2210763-0001) TI- =SN745174N IS AN ACCEPTABLE SUBSTITUTE TI- =SMNT74S174N NETHWORK , SNT74LS1 62N u40 ITEM 40 (PN 2210667-0001) IS AN ACCEPTABLE SUBSTITUTE NETWORK SNT4SOON Uss TTEM 41 (PN 2210735-0001) UM EA A EA EA EA EA EA EA 5-76 12714783 PART MUMBER REV 22230615002 R ITEM. QUANTITY, 0015C 0016 Q0164 0017 00174 00001.000 00004,000 0018 0o018a 00001.000 0019 00194 00198 00019.000 0019C 0020 0020A 00208 0020C 0025 00254A 0026 0026A 00268 00020.000 00001.000 00000.000 0030 00001.000 0030A 0030Rn n930C 0031 00314 00000.000 00318 0032 00324 00000.000 00328 0033 0C000.000 List of Materials & GDREASPCHRIICPST,ICORNT.ceCeOsNvTsROsLeLcEcRosn3csPvLoAcNcEn-nAsUsTnDscsIsMS COMPONENT.,o DESCRIPTIONeoessecsscccsocascccoscnssnne UM IS AN ACCEPTABLE SUBSTITUTE 0972784-0002 NETWIRK SNT4LS14N EA U4s 0972946-0081 0972924-0018 0972763-0013 0972763-002% 09729460027 2220517-0001 0219402-7163 RFS FIX 4,7K OHM S T .25 W CAPBON FILM ROH - R-25 FA R1,R24R3,4R% ROH - R-2S CAP FIX TANT SOLIO 6.R MFD 10 % 35 VOLT A QL -M39003/1-2304 cl QPL -M39003/1-2304 CAP,FIXED .O10UF SO VOLTS 004222-MC105E1032 EA 2yC34C4,C5,C6,C7,CA,C9,C10 004222-MC105E1037 C11,C12,C13,C14,C15,C16,C17 004222-MC1051037 c18,C19,C20 004222-MC105E103Z CAPACITOR, ,10UF S0V FX,CERAMIC DIFL EA- COR CA-CO3Z5U1042050A 21,C22,C23,C24,025,C26,C27 COR CA-C0325U1042050A 28,29,C30,C31,32,C33,C34 COR CA-C0325U1047050A 35,C36,C37,C38,C39,C40 4 COR CA-CO03Z5U10420504 RES FIX 27.0 OHM S % .25 W.CAPSON FILM EA ROH - R-2S R5 = ROH - R=-25 I1Cs 16K X 4-RIT,RAM, 2600NSEC READ CYCLE T EA SEE TI- DRAWING *THTS ITEM MAY BF USED AS SEE TI- DRAWING *AN ALTERNATE TO ITEM 3, SFE TI- DRAWING NETWORK, SNT4S5163N A u3e ITEM 43 {PN 2210761-0001) IS AN ACCEPTABLFE SURSTITUTE 2210669-0001 IC41LS166,8-BIT PARALLFL/SFERIAL IMNPUT FA V-LTIST-LS166 BURN~-IN U13,U14,U15,U16,U17,U18 V-LIST-LS166 BURN-TIN SUBSTITUTE FOR ITEM & V-LTST-LS166 BURN-IN E 2210695-0001 IC,15245,0CTAL BUS, XCTVFR, 3ST.OUTPUT EA V-LIST~1L5245 BURN-IN U19,U20,U21,U22,U23,U24 V-LIST-L5245 BURN-IN SUBSTITUTE FOR ITEM 6 V-LIST-LS245 BURN-IN 2210653-0001 1C,LS138,3-T0-8 LINF DECODER FA V-LIST-LS138 BURN-IN 5-77 12/14/83 PART NUMBER REV 2223061-5002 R ITEM, QUANTITY. 00334 00338 0034 00C00.000 00344 00340 0035 00000.000 00354 00358 0036 00000.000 0036A 00368 0037 C0000.000 0037A 00378 0038 97020.0090 00384 0038A 0039 00000.000 00394 0039R 0040 00000.000 00404 00408 0041 00000.000 00414 00418 0043 00434 00000.000 00438 List of Materials OESCRIPTINN cecoeoectoansscoconssns cee GRAPHICS CRT CONTRNLLER 3 PLANE-AUTA INS COMPONENT. DESCRIPTIONcececcecssaccsscsccccsasances UM uz2s V-LIST-LS138 AURN-IN SUBSTITUTE FOR ITEM 7 V-LIST-LS138 BURN-TIN 2210658-0001 IC,LS151,1-0F-8 DATA SELFCTOR/MULTIPLEXF EA V-LIST-LS151 BURN-IN u27,U28,U29 V-LIST-L5151 BURN-IN SUBSTITUTE FOR [TFM 8 V-LIST-LS151 BURN-IN 2210702-0001 IC,LS273,0CTAL,,D~-FLIP-FLOP W/COM CLOCK EA V-LIST-LS273 BURN-IN u3o0,uU3t,u32 V-LIST-LS273 BURN-IN SUBSTITUTE FOR ITFM 9 V-LIST-L5273 BURN-IN 2210659-0001 IC4LS153,DUAL 4-LINE TO 1-L DAYA SEL/MPX EA V-LIST-LS153 BURN-IN U33,U34,U035,U36 V-LIST-15153 BURN-IN SUBSTITUTE FOR ITEM 10 V-LIST-LS153 BURN-TN 22107271-0001 1C,1S393,NUAL,4-RTT BTNARY CNUNTER FA V=LIST-LS$393 AURN-IN s U3aT,u3s V-=1.1ST-15393 BURN-IN SURSTITUTE FOR ITFM 11 V-LIST-LS393 BURN-IN 2210720-0001 IC,1.S373,0CTAL D-TYPE LATCHES 4 EA V-LIST-LS373 A!URN-IN u42 V-LTIST-LS373 BURMN-TIN SUBSTITUTE FOR ITEM 12 = V-LIST-LS373 BURN-IN 2210763-00C1 TCyS174,HEX,FLIP-FLSTONPG,LE RAIL OUTPUT FA V-LIST-5174 SURN-IN U4l V=L TIST-S174 BURN-IN SURSTITUTE FOR ITEM 13 V-LIST-S174 BURN-IN 2210667-0001 IC+LS163,SYNC 4~-BIT BINARY CNT,SYNC CLR EA V-LIST-LS163 RURN-TN us0 V-LIST-LS163 BURN-IN SUBSTITUTE FOR ITEM 14 V-LIST-LS163 BURN-IN 2210735-0001 1Cy SO0 ,QUAD,2-TNPIT NAMND FA V-LIST-S00 BURN-IN Uas V-LIST-500 BURN-TN SUBSTITUTE FOR ITEM 1S V=LIST-S00 BURNM-INM 2210761-0001 TCyS163,SYNCHRONAUS 4~BIT CNUNTER EA V-LIST-S163 BURN-IN U39 V-LIST-S163 BURN-IN SURSTITUTE FOR ITEM 31 V-LIS5T-5163 BURN-IN 5-78 i 12/14/83 P2A2R2T306N1U-MB8E0R01 REVR ITEN, QUANTITY, 0001 00001.000 List of Materials GD RAPE HICS S,CRC T eR COoNeI TvRoOoP LsLeEcRT onn-I csSsPsN AsRsEsSN nsnG ascns COMPONENToo DESCRIPTINN.ccaesccecoscccvcasssoccaccce UM 2223061-0001 GRAPHICS,CRT CONTROLLER 1254-3060-016 EA 12714783 PART NUMBER REV 222306 1-8002 R ITEM. QUANTITY, 0001 00001.000 DESCRIPTINNccesesssccsscocoscen GRAPHICS,CRT CONTROLLER 3 PLANE COMPONENT.. DESCRIPTION.csecvecosocccassoscosssnscass 2223061-0002 GRAPHICS ,CRT 1254-3062-032 CONTROLLFR 3 PLAMF UM FA 579 Nid v MUK | w177 gLI_T_ 5-80 i a 2 o 1 12 316(B28S-E0e3n3S5 ~, (2-5)oHS Lr 3Ca5VwOEA3I3NE ~ (4@ prs 5% #¢ A0 316vL 33§ T3VTIVAPS 5 AN s, Y9 35w0-tnn3s75 SNDAIINNCD ONIOYD T N 25 - Y NG » ON.IwOqTuzvu} 1\OII3an5ds5O / .\\yw(u-r8.}\ 12H55S 4na1 FINCISE I ------ PN [ _ (ee o bt i [==--= -- i $$N8 ¢ NFOII(E@Sb-NL0F)IE3XN3TS5 $r tanL i 433® 73389(5L-vNGO)LII3hG5$O5 Vi ALIOoVS F7(Ta8Yv-Ne0Y)I63In3Ns5 (0-0) pus \ A06tS 3I6W¥O1NEIL3X5T8 .|.|:.v:a. 0 Fievt T te-wiimns 9 T 2OIHrNvGIsEoDs (Hi F) 1 10icind e & 3ievsT i t--er--~{ [ 4 ) 1 ------] fcoseee JUVOgYIHLION " =T3ae / n a3l wa c 1 --] {£-D) INS / 423128 & 30_0331871 v3s2(@W-3VO23y8 1 3N3S5 wozazsI w7o2ns (G-' oQHE vz IICVL 238 WYY NOISHYIYY __\_ / \\ N ISLPeDIQ2IQFIR 5TS Us 0T 233 *3-3 (o-v)ins » a0z FSEV IISSAT4WA3S31G(3N§5E13-I76ND1L13T JPSANTEY5-HDO3R4I1OD1L5F-N04O10D3D) 134N 97030003997 sSnwcGeyd >x8v || p§r:95--c5e73|| T Seri 223]3 T1e-9c5itnwsoTMwe1WsWo3Ai7:v0Qwc\iy-"] z are(vLs2} 3H3S5 WCr2327 /07CSY] 1 |ShELTirasenp73o A 3o30reSNTene¥oIr.aosJo3M [(V7 | I v ¥ s I s azav3es ngofluE I < 8 v v ¢ s1 e(13 T23H5S NOILYOREIINDD YN 22 ATING ONY S43YOSY N, 5-81 e I eSuIinmessnaTedW K3T57l07 v v_(e- ey 335 - 60222 2 PG M TIP3S5 W advog wWwod -- le-- 5 27|32273||| T 1t2a537v26e6l6-e53#s8565 e v 5 ` W024N0&3>37(S6$2w-i0M3dET3n3aS5D -,\ i, 3 SSIBo1COY37S(0IU2N6SY3E345D8 2 S Rl oaSi7res e|55O:02r07W.EAF | @ 1410144 = (242 M St 3% = 3, ----T-- oa Zog &<2 190e222 aQyv08 SOIHJYYI a a TTFTzzoreee T T I v T : s _ .. S -\ ;. ceeEe22 e e |vizeea # 3FrrE12G2CAH < A s STStENo7GNEoa36vD| n3iS4oAeAE- | W TTy2&£:e A(Nrg)10e0ns 03¢Tl 37B6V0,1 4--n--30ri1inOi0n_ | ¥ILrIS C(JHrIoHJAOEEis_II2EG3a5W0G8D (- QTS erteoansogonr1eitsaIB||nRoliVoty2 $$2000o71 "37(S9H¢2HOCE3an3sD5 eog29--nn26owee4. e 222 = oz&o64 aao"arnio-cooe =o2!&=2z72 E&£nodvl s 2 »&2" 2c&R "iwr o ar&" oyv OF |S 4ee4 or S | T v v e 5 o S & v e o17 " : $ ~T_tloic&oeyor1a(5)$-|0)7eO'mNsnssisTo'»nGt"%(so2qi0vn)glFTuSosDriimoo1eo#4a,rrvs"eo o Tow ¢e*)`i IVevd IOIIN6OD35(0SEZ7=i0i2a6 2I3O5) o, =1~s2p7v25o0o09 N 2 2 ouo&2 i =M, & 2 Fl229o7Rwo50or00x . | | | o&@uz M 9 >-e0qozm0 |zo"o"7 o2~32H2ae00gs0a0 | or@%4. | S-r-gSneCswoog2o$Zaccs2axOooo)|oxrlxxun | | | [t&sow 9 o e s ¢ _I--_ver7t00o:A5osfZE09gw_0EToe)J-o2nJieIdn02<z.`8s12ToNaO]-DD)TESoNI--.S621HrLA75aG200xvoTN}&I|oDoFrnrasv<e<z dg * \ GI012A1 F3e4(1w25-d35)or3e03mD5s < 2/ v I=T-eor oer e\ -- oF=) =i 22 600feee v eMe yk SsCi B ayvod ¥37704LINOD OIAIA 3 Y, SN L3a1(@6-753,6§n7835 \ v _--_ i T T cs0ree] | T T v ¥ s b o % 6o202 [k 25oo¥ooo27zzzr T e" o2-os" r o¢ - ¢ z U [on Wig ' .o,(6As7=- 075|"ON I# 3 woi`" e 2y, z H . ¢ e ant s » ---srr a2agalon1ocnn-nh3n>aeo5ooote L | tew%n:<<@\8) #0iN3i5gmin9o,13A_aAgFaoO(r1Es7-|FVT1iTaovtsinea"er:oesi@ a'nTONTtVSiNid] oa249sv5nv5e4xxS0x GFvwx [{l|nlTw(0e.oeieim£zccgwRc3vvavryvs/eruoise0o./sscoc9mZe||| |---2oowCgovcwioraioxwrwomxrwxx | | | |«|s $se[weo1wi"rewi6vzv.sv/i\air\0icrme8zzmg e ||voassseaobuvrvavwo11rxtxxr | A||| ||[ [2[cfeZ[1vss2s25re0a2ii222zczav3g0lvarvvv.iss0iseiaa/9cz9E0ei02crsmeeeessL|| g R-Io-| S-2mA7voazl 1zv2owoanrv0ex-xoxem4 2 |||||| #61éoOCcc9roaar2vssnis3entEe2rrsr cax #2O0nw7vx2r arex crvx ewy vn5o0i4E 5|||[I[hl|oewwoLN2owreamz3zBi20ivovs@v9/39vsissrs/eaie8ois2eEcse(ne6g6§-|3||0|)H5TE_TuAn3NDs-aazsi0vEcrizaaOa1IorxyvsxSS¢ A 3vwsLrs ] [ < I ® 5-82 ] 1 W ] 2 } s | 2 L ] oD W2 5 -- 23 iy 222 2z oAcoe (12 T /Z soAGwH worn ovw ga -ssZooavoonnww2my Ljaao21o£¢5ds65F)) ] crw e A7TTY wa\u Lo4I22&~7.4 o22 n&w) ANey e 5 & ane | oekr arvo | oF6] & #.2 &%5p&Luw6y= | | | |s-ouuaeravoaonNodvoeloreml |S-2a2l0ve0dm| ||||| e2L&o/oe66%y Tol2 | 522os2¢2 152 && | oiveovvo|| 9¢22 & ¢ --6vaa2in3noe5ow| | | | o¢&&z l-egreooozienonoglmdm||el||||Iol6eo&u¢ E] onvo| ¢s 52 z or _ 0 "9"/ Io oAo 1naoEveesee B oo»oo"7 A~xP oowd o " e oLo] 2 * s od B Jvnos <9222|4 |on 2me | aLnWo e ' < Tvors | ow vL l F21 i -raoisnse| | 2v |iWNOoS%7 cq|O!] s_Jsyonepvodi2ne|se||| 10§i2N2g2l 222 ave HoN)N_2rOviDa2t' iOk [ oo quroonroe|t ' ¢ MO7zF&1, o] 5 200 T--I¥Ni9Si1ioSd | ON ?1M amtuv 2OLDINO(D5°0) Wod 7rs 0N2OISFNIYGIFXLF (1) - BQIDINNOD AdeC1d TYNDILXT 150) 175 &1 316V (Lr) 1804 13V I0YS (26} 175 &1 918w a3es@7y $£77337 e vvaouvwvaaeoxooa|o2ry | | | 5 2 e v oolg S50rv)_s&£a3u.s_nQ)avoeAAIR_/Nvro_sPIL. | NCo\l BEYT M-Y2WO 13E3TT1-N36AC2--ANO AN W z . (L8= nznimvro.n.omom\snnwomes\nlx\3.3\ 237 23737 7 tonss=u ] L TGy T e & FIev Grrigmi=:9e-20v2 870 PRV PIVEoTtYIROPN 14AOD Da D P SI 1N75~ W Y PFT-L6a2c3e -s2a74s9c7e-1is3 35 635-9/22 93 -1. xZ 22 XV £ BCIINGD SETXATY (QHTCE SMOLLYINIWOR 19-0) SweTwy BIOws muu 7 i d [(T9e7n)oAaaiZrsiNEeedN.GS1 o#n3Mv23:idg | (G-v)ins 1237002 vannowoarrevssa| | e2z | i 2 2 wel a7 el oO » EY7] I 2 nros| @ wI/VIE " o ono a7e | ®¢ aosorvizv||| e 2 ONDTw$eISiEsVYND. | ovN'd- 7 (»-G)Tns »1 F10VL 5-83 v T Trleeoreegd | : T v T : T 5 z s NULIN-18] = =CTTT775SN527IS5QOD 0N3NOGMYONDi3o S9H,iDAa VR,ool| ----e-- T NOILdTY 7530 ON_1yvd J¥ISNI_OLNV-UAVNVD SNOSfNIOVUYIJIINNMNANWOND)O|)| 1000-v60cz2T 1005 -+608227 s | [R13191¥T000- 2605222 | wraswia | x2070 gFl|98¥I|v2[]8l ir1c00o0000c--vsvei6c20ce5a22s22ez2 | A1r§7e1msBAsaigyndn | 27a423y7 [B#) 35 ! [ED o8 2 @ --I'( 7 g Y7005 IAVR | 00| HMIGM¥I¥TT08 57 ON2V0H0 || 0100| 20-p2i | %075 1 1100--2L026! |v|a¥v@1w5! 2 S>N |[WeT]le]3TgT[SH[Te[3g11[00r00o00~o~0s69c060oTtrz2z22e2 | 2] Wvadwia o MBWASaMSaV<]|7| |[ajele[v]v]1000-pretzze[ 15U 1inn|S| | 2 S¥0A 14 §Lov9G2-630T2v1i1r 12 WY 10A0AS0T%Oy05W ]W16SHQ MVWIILAO£M ZWD T&JYIAMLETANAIV(TTAZ= IDP0WA~TIIN~01IA0Tm0N0G&STAW INNW(NLIaYE)Li )eHnAAo0¥ErLSSVbVA W3I1lvTda]n4|] 462 ATA 6 U]00[02VI2SB "QIS5T]H QUVOANCEI BE AWNL 1U20V60I0LISWOW0LI1-L ~9Q3eI9G2OT0YA8SGEW0OSOYVSMeToI1ST2S9AA0T06iaY05ELe$K24TNTM9E103W[14W[23LTT1 | 1090110 BIMNNINC1122254Q+£IS2OIL0WANT0WA061YLT 3L3RL(D2a/grTY91 oU0AEe,V51r5o1Wr610eD354T23I[YM[YT ] YH2SY0SQ3o0-2T2IAT WTLN430103AG0GBv1EIoWVr0f4T7074oI4v|LaTpHaW10An01L029Bb3BVwIaVGtE2 Si( XreDAe3(e2W0f700e V3£2L21 D1S615W20re1rW264A0015TS SMy S M W[9TlT | | roe (3) c2our4zve0s07 wWo7 i[17) 4 hmm'__v QOV(E)6 NHKWLIOT9H SII1O3NAITdOYAJY(2) OI1 LYAAdGDdL WI1INAYU} o e We FHIeIe e i3 W | 281599 e[ = 2079 JL1y3oaon5ecwe3s 5(1)[] - o020 ¥ 2_1u3)rd2?22w32y8/1) 5] TST V 230T Wi8vgOaIn W7 ¥ ] ST wLosiaiyivo eoeeee~d = T 02 40 INDIM WOVHIVW SVM CGINOR NOILAG il TST$37W~YA{1T3SFOIQOG00IN1°TSL72EISHIVIII3II0VWVTIOISMI91 GI0L2YHETIATV1WYW1WI0DV}MIS1KL0IV198NI7QNAII$DT03GNwV01I3H0AL0UTr2M(31316O-9NT013Q1II31OGw3O1IL1f2ieAseNOwn0NVW1eiSdL (o B [§) I v .Av sor W = Vu<2] 1 Y L 1 | m g 3 o -- T - o82£2Lo900080""1 SIHONT s00052£822070/22 W T4VHD NOISUIANDD L = =v F i = - n =% =Zin o H w Wwmfl--Wu _=Aflu u _D. 6 v 0 ibti3 " n E £ i 11.a g D E ¥ 19 X& OTToIoEo:IvTeHsNizNtUzE'oTm--CNasey ¢ e o 2on wewre /@ ASSV ¥IL4V ZZ NIZ2WIOLLIN92O NLI2H WILALldd5v0 12 V311 POUs QUSVMIISWIIAS AONVVIMNAVSYSY Z 0L JAOHONIIYYd A~NWYIOONTDFIOYIWONVWVM2OIY5AIN0GN1¥GZFFO>A0O1INULYYOINFNSIYIISGSIOHG1NAALI1OIH6NIiLWTIIG3N1VLS0SISS1SyIOMYH~TItISONVtImIGsIIN"TNN0TSGONISFoNYiIvWLNQOoyONKwSSSYdI < I ° e &= O NIVFYIIGVWUISNSY $T2HIWNIISL) OFNI¥f 3C00I5L£VI3OS1NSvTIGo03¥IisISS oOnYN i NO£ISISTSYI00O4NdY YYIoGWION2LNHISVGGNI ILI6WII¥ST0XNdIdY ¥31X1¥3VTN (E) Oyvo§ IHL MOIIG HioNIT Cr'IFT 78rwi7rWeHnS (2) QUYO IHL FAOGY LHSIN LNINO0I6lMOS 3O warIiIiMsvEw [i1 OFLI3AS ISIAUIHLO SSIWNN SALON 0 L 8 12/14/83 PART NUMBER REV 2223094-0001 R ITEM. QUANTITY, 0002 REF 0010 00001.00C 00104 0019 00001.000 00194 0020 00002.000 00204 0021 00001.000 0021A 0022 00002.000 0023 00002.000 0024 REF 0025 00001.000 0026 00002.000 0027 00002.000 0028 AR 0030 REF 0999 00001.000 List of Materials DESCRIPTIONcccacssscccosccsvscesosscscne COMMUNTICATION CARD ASSEFMBLY COMPOMENT.. DESCRIPTION:cccocccscccccssssocsccaccass UM 2223096-0001 DIA,LDGIC, DETAILFD, CAMMUNICATIONS CARD FA 2220519-0001 1C,USART,SERTAL COMMUNICATINNS CONY EA 1254- ~-000 us 1254~ -000 2210835-0003 CRYSTAL QUARTZ, 4.9152 MHZ, HCIB1U EA SEE TI- NWG Yl SEE TI- DWG 2210288-0006 HEADER, 6-PINS .600 L,SNG ROW,STRT-POST EA SEE TI- DRAWING E1-F6,ET-E12 SEE TI- OPAWING 2220488-0003 CONNECTOR, RECEPTACLEPCB,25-PINS FA SEE TI- DRAWING 369 SEE TI- DRAWING 0532348-0400 STUDy EXTENSION-CRES #4-40 X .188 A 0085936-0064 EYELET-ROLLED FLANGE,.116 0.D.,.219 L FA 0994396-9901 PRACENURE, STTE & DATE CNDF SERTALIZATION A 2223033-0002 PLATE,OPTION BOARD,WITH CUT QUT EA 1678-3223-023 0972487-0001 JUMPER PLUG,COMNNECTNR BLACK A 5935-0900-000 0411104-0135 WASHER, LOCK-SPRING, HFLICAL, #4 A QPL - M$35338-135 4 0415804~ 0005 SEAL COHP'A'RHBIC--BLUE'QH Cy10CC BOTTLE FA 2223274-0001 SPECIFICATINUNNI,T TEST-~ COMMUNTICATIONS FA 2223094-5001 AUTD-INSERTED PARTS LIST FNR -0001 EA 1254-3095-067 12714783 PART NUMBER REV 2223094-5001 R ITEM. QUANTITY, 0001 00001.000 0003 00001.000 00034 00038 0003C 0004 00001.000 0004A C0048 DESCRIPTINNe eecesvvesoscenscsocsscncsasn AUTO-INSERTED PARTS LTST FOR -0001 COMPONENT.. DNESCRIPTIONececorcecscsoscosccsscsacsncsses 2223095-0001 0972900-7432 0972900~7410 PWB COMMUNTCATIONS CARD 1254-0000~-000 NETWORK SMT4LS32N Tt =SNT4LS32N ut TI ~5NT4LS32N TTEM 32 (PN 2210621-0001) 11 =SNT4LSIZN 1S AN ACCEPTABLE SUBSTITUTE TI =SNT4LSI2N NETWORK SNTSLS10N 1225-5503-000 u2 . 1225-5503-000 ITEM 33 (PN 2210608-0001) 1225-5503~-000 UM EA A EA 5-85 12/14/83 PART NUMBER REV 2223094-5001 R ITEM, QUANTITY, 0004C 0005 00001.000 00054 00058 0005¢C 0006 00001.000 00064 00068 0006C 0007 00074 00002.000 00078 0007C 0008 0cootl.000 n008A 00038 DOOBCC 0009 00094 00001.000 00098 0099cC o011 00002.000 00114 0012 00002.000 a0124 0014 00001 .000 00144 0015 00006.000 List of Matarials DAUETSOC-RTINPSTEIRNTNEcDoeoPvAoRTvSecoLoIeSTccnFnOnRcnc~0s0s0a1snanas COMPONENT.. DESCRIPTION.ececsscsosacssnnsscossscncee UM IS AN ACCEPTABLE SUBSTITUTE 1225-5503-000 0972900-7139 METWORK SNT4LS139N EA T -SN74LS139N u3 Tt -SNT4LS139N ITEM 34 (PN 2210654-0001) T =SNT74LS139N IS AN ACCEPTABLE SURSTITUTE T ~SNT74LS139N 0972900~ 7400 NETWORK SNT4LSOON EA 1233-7564~-000 Us 1223-7564-000 ITEM 35 (PN 2210600-0001) 1233-7564-000 IS AN ACCEPTARLE SUBSTITUTF 1233-7564-000 0972900-T474 HETWORK SN74LST4N A Us, U1l ITEM 36 (PN 2210631-0001) IS AN ACCFPTABLE SURSTITUTE 0972900-7402 NETHORK ySNT4LS02N EA us ITEM 37 (PN 2210602-0001) = 0996755-0001 2211189-0001 2211349-0001 0972946-008S 0972946-0065 IS AN ACCEPTABLF SUBSTITUTE TCySNT4LS245N BUS XCVR TRANSuITION A 001295-SNT4L S245N ur C01295-SN74L S245N ITEM 38 (PN 2210695~-0001) 001295-SN74LS245N 1S AN ACCEPTABLE SUBSTITUTE 001295-SNT4LS245N 1Cs SN75 3, B1 URN8 - T8 N, QN UADP RUPLE LINE DRI FA SFE TI- DRAWING U9, ulo0 SEE TI- DRAWIMG 1C, SN751894AN3, QUAD LINF RECEIVERS A SEE TI- DRAWING Ui, ul12 SEE TI- DRAWING RES FIX 6.8K DHM S 2 ,25 W CARROM FILM FA ROH - R-25 R3 ROH TAR=25 RES FIX L.0K OHM S%T .25 W CARADN FILM A ROH - R=25 5-86 12714/ 83 List of Materials PART NUMBER REV 2223 094-5001 R DESCRIPTION:vcossvosvcccacstvannsacnnsas AUTO- [NSEFRTED PARYS LIST FOR -0001 ITEM, QUANTITY., COMPONENT.. DESCRIPTIONe¢ocsccos eesses 0015A 0016 0016A ool7r 00174 0018 00184 00188 0032 00324 00328 0033 00334 00338 0034 003424 00348 0035 00354 00358 0036 00364 00368 0037 00374 00378 0038 0038A 00388 . 00001.000 2211247-0029 00001.000 2211247-0010 00009.000 0972763-0013 00000.000 2210621-0001 00000.000 2210608-0001 00000.000 2210654~0001 00000.000 2210600-0001 00000.000 2210631-0001 00000.000 2210602-0001 00000.000 2210695-0001 R14R2,R4+RS5,R6,R7 ROH - R-25 CAP,1000 PF,10%,50VDC,CERAMIC SEF TT1- DRAWING C1 SEE TI- DRAWING CAP,12.0 PF, 5%,50VDC,CERAMIC SEE TI- DRAWING c2 SEE TI- DRAWING CAP,FIXED .0LOUF SO VOLTS 004222-MC1051032 3,C44C54C64C7,CA,C9,C12, 004222-MC105E1032 c17 004222~MC1051032 1C,LS32,QUAD,2-TNPUT OR V-LIST-1532 BURN-IN ul V=LIST-L532 BURN-TN SUBSTITUTE FOR ITFM 3 V-LIST~LS32 BURN~IN IC+LS10,TRIPLF,3-INPUT V-LIST-LS10 u2 BURN-IN NAND V-LIST-LS10 BURN-TN SUBSTITUTE FOR ITEM 4 V-LIST-LS10 BURN-IN 1C,LS139,0UAL 2~-TO-4 LINE V-LIST-LS139 AURN-IN u3 DECflDER V~-LIST-LS139 BURN-IN SUBSTITUTE FOR ITEM § V-LIST-LS139 BURN-IN TM ICyL 500, 0UAD42-TINPUT NAND V-LIST-LS00 BURN-IN Us V=LT1ST-LS00 BURN-TN SUBSTITUTE FOR TTEM 6 V-LTST-L500 BURN-TN IC,LS74,DUAL D FLIP-FLO® V-LIST-LST4 BURN- [N us,u13 W/PSET & CLR V-LIST-LS74 BURN-IN SURASTITUTE FOR ITEM 7 V-LIST-LST4 BURN-TN 1C, 1502,0UAD,2-INPUT NOR V-LIST~LS02 BURN-TN us V-LIST-LS02 BURN-IN SUBSTITUTE FOR ITEM B V-L1ST-L502 RURN-TN 1C,15245,0CTAL BUS,XCIVER,3ST.OUTPUT V-LIST-LS245 BURN-INMN ur V-LIST-L5265 BURN-IN SUBSTITUTE FOR ITEM 9 V-LIST-LS245 BURN-IN UM EA EA EA A EA : EA EA FA A EA 12714/ 93 PART NUNBER REV 2223094-8001 R ITEM, QUANTITY, 0001 00001.000 List of Materials DESCRIPTION.cceseonccreoesscosesssscanscs COMMUNICATION CARD ASSY - SPARFES CONPONFNTes DFSCRIPTIONceesevccccescssancootscnnscass 2223094-0001 COMMUNTCATION CARD ASSFMALY 1254-3094-047 UM FA - -------------- Fomm e e b e e e NEXT ASSY | usep oN | REV | DESCRIPTION | DATE -------------- e e er e m e --m e - | 8755 | E |CN485026(E)C. KLuNKERTlfi p -------------- #=---=----=--wcje------+REDRAWN PER EXTENSIVE+-~ ______________ | T e T T |ENGINEERINGs L CHANGES,LDSWG WAS LC SIZE e -------------- t| ommme ey | e e eT THIS IS A COMPUTER GENERATED DOCUMENT, DO NOT REVISE MANUALLY. < = ------------- dommmt oot --bm--t bt bbb m--pmmt oot --b o -- o mb et REV sTaTus | Rev | E| Ef E|] EI} E| El E{ El EV El E} ! % | | | | OF SHEETS +4------=4---~d---t---t---t-t---t-otoctoctoctoatmtodoatentoctoct--t--ae boe e $Iosudgmemtm|tmm1tl m--2b1 omd3| o&o4t smip oetf 71 8! m 9leromffnno l mm b 1 b| b ¢t b| bbI | -- oo unless other-- | DATE | Texas Instruments | wise specified] DWN C.KLUNKERT 08-02-83] Incorporated | SI-METRIC divmensions are| CHK"D J.MOON 04-15-82] Data Systems Group | in millimeters| ENGR CLAY _ T 04O -1N 9-82|----=--c-mmmmmeeoo oo tolerance: O | APV"D SAULKINS 04-19-82| angles +/- 1 | QA R.CAPA T04-30-82| CABLE ASSEMBLY, MOTHERBOARD TO 21 ppllaaccee ++//--0..255|] MRFEGL_MS..WBORLIFD_G_E_N_ 0044~-1390--8822]] FLOPPY, TIPC \{oro_' OKwWLNUNKERT 0O8AT-E 02-83 TL`Afiézggiifh"r" ISSUEiDATE 1-25910 OO SAIZl [ FSC9NV 6NOD214 scae NONE A 5-89 DRAWING NO 2223097 sweeT REVE 1 OF if \_`_CL w ' e REV S3ovid ¢ Y MIIAN 2223097 |snszr 9 DRAWNG NO B-z-83l Al 96214 SCALE NONE SIZE | FSCM NO S2O12aNNCD 95 ANV b-e NIIMLZT SASA Hiog N SLONS WUJJQ@ S f[ .oT Nn_,_eu ® ) % 5 (S | =IAFODIA ASSY Igvo Q304NN @ : A R 0 3aIS0ve = [ Y NMIA FT--- 2943 S\HL 3dise 2000 /J e a/- Inl\L. @ QS LNOS _._" i e e vE p---------- 09 £O" 06\ -------- ® e e is Q7D FOTGOb e ] 0 DATE hect 7 Festt pATe owN TEXAS edIoNnSroTnRaUsMENTS FI-25910 = jone Y s | S OEIZID 4) 3 FLACES 1 i | ! ' (--] N 28.) REF I a4 Fas [e--s i L = \ 57.2ti12.0 = / / 34 P 2oPM,Uao2eB2kBEH""RiPeeHDS,wT2 AWCMOiPNr,Ti. Rd--AZ; TING | I Pl --MARURBKS.B"EPR-BIST"AMwiPT,H C2.O2N9TRAHiSGTHIRG COLOR. S e eARk A-PZ2P2R2ZO2P0S9Z7A-T0EcoRtEV ConTRASTING COLoe. 2CBM.OUA2LBR9OBKRE,RRPIG2H S,TCOAwNWMTiRTPHASTING: FOLDED CARLE ASSY FIGURE 2 W Pt I':`. OWN Texas o INSTRUMENTS FEsFoate scg3| Al 96214 DATE SIZE [ FSCM NO scale NONE 2223097 DAAWING NO Jswer 10 EREV A A 5-91 TABLF # 1: APPROVED PARTS LISTING This {s a listed in tionally, the right suggested parts listing only. Parts other than those thls drawing may be used provided that ¢t hey are func- physically, and electrically equivalent. of final appraval on any cable assembly. TI retains Fig. 1 Item Description TI Part # 1 Connector, Cable, 2220042-0015 Female 2 Connector, Ribbon 2211341-0001 Cable, 34 Posttion 3 Cable, Mulci-Cond., 0996491-0003 34 Conductor 4 Clamp, Cable (Fig 2) 0983903-0002 8 Key, Polarizing 2211340-0001 Vendor Name 3M 3M M 3M M Vendor Part # 3414-6000 3463-0001 3365-34 3484-1000 3439-0000 | 5A ?(v\flv UNKER T [;JQ-YE0O2Z- 83 SIZE | FSCM NO DRAWING NO 2223097 Rs\é Trxas INsTRUMENTS Fesoroave W A scaie N9ON6E21 4 SHEET 11 F1-259°0 ` 5-92 12/14/83 PART NUMBER REV 2223099-0001 o} ITEM, QUANTITY, 0001 00009.000 0002 00001.000 0003 00000.083 0004 00001.000 0005 REF 0006 00001.000 0007 00001.009 List of Materials DESCRIPTION:ccvessceavscaveccsscacmsscss OPTION KIT - RAM CHIPS COMPONENT.. OESCR.I - eP eesT ccI cosO cnN cnss ces UM 2211118-0004 I1Cy66K-BIT DYNAMIC RAM,1SONS TA/ROW TMS416=~4-15NL A 2211752-0001 PLASTIC BAG, ANTI-STATIC FA SEE TI~- DRAWING 0970950-0003 URE THANE SHFET FT SEE TI- NDRAWING 2223269-0001 CAUTION INSERV,RAM CHIP KIT ------ ~=--=000 A 2362996-0061 PACK ASSY, RAM EA 2362993-0001 PWB ROX,1/2 SIZE EFA 0936667-0001 LABREL,INENTIFICATINN PROF, COMPUTER 5-93 TO'0feezz, 2] _ e9TW9a1sn0s[5ea] Y31I0YINOD 14D 03TIA U_zh.__\z_._m_,.x.n....r...fi....t:.u_ o] A w0 arureae T iEY Sieea [SSse527o08rivleovjasoaeovyeOztzzye]z[sa][3[1a3|[lu]a][3a[58]f]e3]] 100100o00.00--szc1oao1ireezz22zz22 Wvuoowniao]T amd| Agw3sse] X[ x| x| x| w] 1000-6¢2e222 | 3345 1534 1NN s9s ieiees o] w1x3o4t0a ISR 830105 IAwM Dl lae oas0 <OofH T .n._.TT2Ie.l.z.e. @ taf3l 3] 31Q]Q}1000-20i£ 222 (W2[3351[ F[H{193] jTooc00v--0i0v1ict323z2e Wi AAWIMS| | y3oe ' w+f]r«|]o»f{%[]x]alx]{00100cOSTChZoEzTeTzZ|e | IS ISHLON noavi e A 5-94 AN35NI-O1NY ¥N"3O¥1L3011841.10184NL30N5)O3)0 13178 030I3GIGAI_|A | 11H00I000G5WA00N001IEL222Y22V2] : Ty -- Cprs.,] TPI TFTHE | = UL | e o apmm s sevrorST YKT5neAT,WT oIA3Jx5,0oONN 0O1H71133I7VE03V517iV1L0$IT7a1W0aiS7tveSIue@amAs1eAA1n4T W co-z-or 59 o f| ovmerQ niA mo3WnIaOSG1 InN G11esT00i0e0000aT0-TIN vAy owAaTWiTwIoirl1Ily1cA4~11eT~¥v*wHw1 evartiTmTIiy0 OWBgSwAln@14{aeS )0s0 rcicRo)(ar)c0rs5o0 0oeo1(rs3ossww0swrJ63oLreow0v4|snu)¥])| 3 &` p 2O0LA1THdNW04G .1I 6T 5N 2EG 2I 2§OAIOT 7VN R1W405IA LT0WT10I-Y AN0TV0YIA1LNKweY8) 13|I e -1 TV1000 g W1£t9H1WL39 WVi26 W0l1 4 Y3o1o0V0 | IV GO0V£ 24TY S NN OVl O`EF:L 2,7S2 |f8--5£e2*9 | VAI2RLNTAYT W GoUNGaIanNM0NITSIN|LS D -- $- N £4-£2°7 DORtLTSWTIROAEGeTAWTiLmA9DF0TW8a8ik1Sti20T0aRo1eNnI9TGIav1n0R | 3 6 Z`yW. -P F | &5z T i| Sp T o :e .2wV .FmI,T .3 :osne1 jy£.s DdaYvat0 r1aNy 4r7eN 0ruIbriAvenvOeoaVlrn2 | g a0z . ) ' - g roo il one =] = = - - T - - Q3LVIJOSSYANY ALVId NOILDO IHL 40122L5H1OISaYMOLWDAAWINXNVOIDE [E] 221 SIHOLDANNGD 20 1HOIZH WWIX via [ ETakne -B SOUNLLOS 3NeiI¥SQ I¥T3YiIV-1R 5V04LgV2(S 4Oo3R5LT 0I oI38 A CA01eItvOi9s2u0=({T[]of 29 W3 40 NINOLOYLIUINVYATSYMIS ¥33L43Y11I(I401T0AN¥Y9LSWAL030AANlUdSd)y (9] GINIVISHE SMIANIS GYIAHTNBYWDISS2 YQBVOLISIMQOINGNV v WILAlOWIYNI a ,N"vR F952-.2 [PQUAv0T0% 0D4 eA1.SR~e6Va1E@ sSv4ee1<Dno31o01011wDWe165i87Lw0Sk2 tT 2 353339 w3F01I9Vl0aa4nAWWT1_Ja v | a2 705 40 1003 S10N) `2 awon SUv¥CMWAlL1 SS0IN1TQOT1IIAAS0YIudIN01A0M%N0AAVT0LI4NI1IT3Y0110SNt08] gSDyLSINIAINYGNIoLNNOnSCNI1OIOWLNWUOLNOID2ND3O1NAI3NNAILIWBLIWWuIYIOSIoIdNDsNLIDaSIsO8ItN9tYJeYGIssNIWiVAYYInTWASaGHlNOIiOIL"SnS VQSi3H3YL¥rIO1IsJA8NTS iOD1ASnI1IRYdT HE*L3)ES3IiS98INiBN'NppWOS3iIHT9tOIIWaRNSNs3oIIYnuwoNODiYaLYg(3G) -- T T TV T palcass ¥ = -- fifl T L--1} q | WW3I1BlWAYNId£ W$5IN3MS)O0HUSdGFYOINYYI30H0MOD' A3H11A9I0YLNYOW3VI0U5XOYHSwIaJvYmvy (3] +1%0ddY 55¥3I70LuL4TuYd N¥OiIdSIAINYMMOOMWISSLVIB3 AJOWTUudmdY AT13HIaLwVnI [ USLD ML ELRLERED) IACAY LHIIH 92 29 1wHS CRL9NU06I3E8N9RG334IA85WZOI1DS1MvUHBL SWUACWI aITuXv8YoNWa (8] `S(311]0N 1 -- 2 OWe222 -- SY. BMd JZIOTWAS-IH AING STMI F 7NOINSIOAITSYI N3OR Ll < S¥ DMy I7IWRWAG-IN LINO SIMS 2NOISIAIcYin3Ny2 ' ANN0 DL 1M SSEMROTIAD ¥KIAILWINOSHI @M NMWO3IIdSdIWKNAIOPYILY`16IT0OV1T190W0I14L9I73A4R92IHWNOII1SME0HINN21 `SI ATM8ACYO3v I9 O A1VF N31TNHIM MI LNOnOVWTLY0T4HL "M JWL 50 1S Y IMLIIND JWI0OH ON¥IILINWAIOTMW W1SWISLO1IOISINRLy OI MLV HILT 102 HOLIINNGI T4 QYYI TNL M7 TS HILINO FYNANLDYONAGV SYLIWIIIN" LOL 4125& QM oN1Ic)YIWNGOUSFHNWIIdNNLEL UGN * L0 VIS Nicd JAOWIH ANY W0 IWVOIIWLHO1Ni9Ict1MBI§1S51HN103idd °2Y SOMd NOIIAY TIV NGS YHOMIY 1 I % T ° @ @ 5-95 12/14/83 PART MUMBER REV 2223100-0001 R ITEM. QUANTITY, 0002 REF 0004 00002.000 00044 0025 00001.000 00254 00258 0025¢C 0027 00001.000 00274 0028 00001.000 0028A 0038 00001.000 00384 0041 00001.000 00414 0042 00001.000 00424 0043 000C1.000 00434 0044 REF 0045 00001.000 00454 0046 00002,000 0052 00001 ,.000 00524 0053 00001.000 0054 00001.,000 0061 REF 0062 00002.000 0063 00002.000 0064 AR List of Materials DESCRIPTION.cseacscoas VIDED CRT CONTROLLER COMPONENT.. DESCRIPTION.ceccnceacnsscosoescacccncsss UM 2223102-0001 DIA LAGIC,NETATLED, VIDEO CRT CONTROLLER Fa 0996952-000% 0996508-0001 2210835-0004 2211878-0002 0972924-0014 B 2220488-0001 2211409-0020 2210970-0005 0994396-9901 1C,2K X 8-BIT STATIC RAM,1S0NS,PLASTIC FA SEE TT- DRAWING 2,03 SEE TI- NRAWING 1C+74LS393N DUAL BTINARY COUNTEFR FA 001295-74LS393N u3s 001295~-T4LS393N ITEM 105 (PN 2210727-0001) 001295-74L $S393N IS AN ACCFPTABLE SUBSTITUTE 001295-74L5393N CRYSTAL,18 MHZ,HC-18/U WITH GND LEAD EA SEE TI- DRAWING Yl SEE TI- DRAWING TRANSyMPS6602+ NPN,COMPLEMFNTRY DRIVER A SEE TI- NRAWING Q1 SEE TI- DRAWING CAP FIX TANT SOLIN 15 UFD 10% 20 VOLT FA QPL ~M39003/1-2289 c2 QPL -M39003/1-2289 CONNECTOR,RECEPTACLE, PCB,9-PINS EA SEE TI- DRAWING J40 SEE TI- DRAWING s CNNNECTOR,421 --RPODW,SRT ANGLE, TIN EA SEE TI- NRAWING E1-E2 SEE TI- DRAWING - CONN, 22-P0S.,PC BD, SINGLE ROW,.100 CNT FA SEE TI- NRAWING J&l SEE T1- DRAWING PROCENURE, SITE & DATE CODE SFRIALIZATION EA 2211047-0002 CONNECTNR4RECEPTACLE2-ROW,11-POSITION FA SEE TI- DRAWING Ja2 SEE TI- DRAWING 0085936~0064 EYELET-ROLLED FLANGE,.116 0.0.4.219 L EA 2220609-0001 CONNFCTOR, JACK,FEMALE, 3 CONDUCTOR EA SEE TI- DRAWING J43 SEE TI- DRAWING 2223033-0004 PLATE,OPTION BOARD,9-POS VIDEO EA 1678-3433-025 0532720-0007 WASHER s SHOULDER , NONMETALLTC,38.5 1D EA SEE TI- DRAWING 2223275-0001 SPECIFICATION,UNIT TEST-VIDED CRY EA 0532348-0400 STUD, EXTENSIDON-CRES #4-60 X .188 A 0411104-0135 WASHFR, LOCK-SPRING, HELICAL, #4 EA QPL - MS$35338-135 0415804-0005 SEAL COMP,A'RNBIC-BLUE,GD C,10CC BOTTLF EA 12714783 PART NUMBER 2223100~-0001 REV R ITEM, 0065 QUANTITY, REF 0087 00000,002 0105 00000.000 01054 01058 oL06 RFF otoz 00001.000 0109 00000.063 o111 00000.100 0112 00001.250 01124 ot12n o113 00000.001 o114 00000.000 01144 0999 00001.000 9999 00000,750 List of Materials VDIEDSECDRIPCTRITNMCOeNsTePcOoLLoFsRcevcsascnssnsssscaaca COMPONENT. . 2219301-0001 0411435-0416 2210727-0001 2237441-0001 0535978-0058 0411400-0074 0411400-0020 0534458-0053 0996069-0003 0966760-2692 ~2223100-5001 0239999-9999 DESCRIPTINN eensaneeecnoccarvanceancnneas SPEC,HDLG,EC SENSITIVE PARTS ANN ASSYS INSUL TAPE, ELEC, 1/2"W -SEF TI OWG I1C,1L5393,NUAL, 4=RIT RINARY Vu3=sLIST-LS393 BURN-IN COUNTER V~-LIST-LS393 BURN-IN SUBSTITUTE FOR ITEM 25 VSP=ELCIISFTT-CLAST3I9N3N, RURM-IN TIPC CRT CONTROLLER WIRF ELFC.»SOLID, "KYNARTM INSUL #30 ANG WIRE, 24AWG ELFCTRO TIN PLATED COPPER WIRF #20 ELECTRO-TIN-PLATCOEPDP,ER CARLE, TWISTED PR T =2XV8736U 28AWG TSTRD WHT/8LU *ITEM 114 (966760-2692) IS 17T =2XVB736U *AN ACCEPTARLE SUBSTITUTF T =2XVB736U ADH, SOL 1D, THRMPLSTC 1280-4506-000 25# BAG ANAEROBIC WIRE,TWISTED PATR #26 uL = 1472 TSTR ULE WHT/RED I[PVC *SUBSTITUTE FOR IYEM 112 vt - 1672 TSTR ULL 4 V1I2D5E4O-31C0RT1-0C6O0NTROLLER,AUTO-INSERT COSTy SHRTNKAGE = UM FA RL EA A FT FT FT FT A FT EA EA 12/14/83 PART NUMBER 2223100-5001 REV R ITEM, QUANTITY, 0001 00001.000 0003 00001.000 00034 0005 00001.000 00054 0006 00001.000 0006 A 0007 00001.900 00074 00078 VDIEOSDEENRIPCRTTIONC:OeNoTvReOaLvLsEoRc,vAoUsToOs~sTcNcSsEcRTasccscens COMPNMENT,. DESCRIPTIONcccecossosorascosasscccccsecns 2223101~0001 2220443-0002 2223060~0001 2223058-0002 0972900-7155 PWB, VINEOD CRT CONTROLLFR SEE TI- DRAWING ICy CRT CONTROLLER,2 MHZ SEE TI- DRAWING CLOACK RATE U1 SEE Tl- DRAWING LNGIC ARRAY,HALIOLS 1669~0000-000 U4 1669-0000-000 LOGIC ARRAY,VIDEND SEF TI1- DRAWING CRT CONT(HAL16RAA-1) us SEE TI- NRAWING NETWORK SN74LS155N T1 =SNT4LS155N ve T =SNT4LS15SN ITEM 67 (PN 2210660-0001) TI =SNT4LS155N UM EA EA EA EA EA 5-97 12714783 " PART NUMBER REV 2223100-5001 R ITEM, QUANTITY. 0007C oocs 0003.000 0008A 00088 0008C 0009 00004.000 00094 00098 0009C 0010 00003.000 0010A 00108 ooi0C ooll 00002.000 00114 ootis ooL1c 0012 00001.000 00124 oo12s 0012C no13 00003.000 00134 0013R 0013C 0014 00001.000 List of Materials NESCRIPTION. ccecosesscscsvscncsnsccanccnse VINDED CRT COMTROLLER, AUTO-INSERT COMPANENT,. 0996755-0001 0996420-0002 0219402-7175 DESCRIPTIONccsscccccococacosanccccccnces UM T0U00U05511I5ISS07LT0T099II90E1E,C011C666M1M2Us,2,2222AA98SS2N9NU--9-5N,N5L0050966~TTU-11L89-1-5AA449S00,S0SCCLLS-N00U0NNCSCSNT((--1-STT23EETPP4004044T4PNNPN4L00,0L54LTTLT000UNNSSAAS412$22B1B2222524LSL4L4411BE5E555S5U00NNNNSN6792SS51UXU--CBB00VSS00RTT00II11TT))TUURTTAEENSITION EA £A 51SN9E6T2AH-NO0R1KA0,C0SC-MET0P70T40ASB1LTESN SUBSTITUTE EA Ul6,ULT,027 ITEM 70 (PN 2210764-0001) 1S AN ACCFPTABLE SURSTITUTE 0996089-0004 2220521-0001 IuCIIS1,TI2ECM,,TAUSNT1LN37T1-~-A~4SSCSSLSNHCNNSH(T7IET2TPFNA44P44T4LTLLLNSASSS2B2222R2L4644E1EL4444G0INNNNNI6ES9ST4UE-BDR0SRS0TI0IV1ET)RUTE, . : FA Ea u19 ITEM 72 (PN 2210669-0001} IS AN ACCEPTABLE SURSTITUTE 0972686-0001 NETHWORK-QUAD MULT [PLEXER, SNT4LSISTN FA u21,u22,U023 ITEM 73 (PN 2210662-0001) IS AN ACCEPTABLE SUBSTITUTE 0219402~7163 NETHORK, SNT4SL63N - A 12/14/83 PART NUMBER REV 2223100-5001 R ITEM. 00144 QUANTITY, 00148 0014C 0015 00154 00001.000 0016 00002.000 00164 00168 0016C 0017 00174 00001.000 00178 0017C ool 00001.000 00184 oolas oolscC 0019 00194 00001.000 0oi9n 0019¢C 2020 00204 00001.000 00208 0020C 0021 00214 00001.000 00218 0021¢C 0022 00001.000 00224 List of Materials DESCRIPTION.eoeceas VIDEO CRT CONTROLLER, COMPONENT. o DESCRIPTION.eeecsnccssocecsasveonssasaas U24 ITEM 74 (PN 2210761-0001) 2223065-0001 0972900-7474 IS AN ACCEPTABLE SURBSTITUTE ROM,CHARACTER GENERATOR -- =] =000 u2s = =000 NETWORK SN76LST4N u2s,uz29 ITEM 75 (PN 2210631-0001} 0996422~-0001 0972900-7420 IS AN ACCEPTABLE SUBSTITUTE IC,SNT4LS125N 001295-SNT4LS125N u3o 001295-SN74L S125N ITEM 76 (PN 2210649~0001) 001295-SN74LS12SN IS AN ACCEPTABLE SUBSTITUTE 001295-SNTALS125N NETHORK SNT4LS 20N un . ITEM 77 (PN 221061170001) 0219402-~7486 IS AN ACCEPTABLE SUBSTITUTE NETWORK SNT4S86M u32 ITEM 78 (PN 2210749-0001) 0219402-7410 IS AN ACCEPTABLE 1C, SNT4S10N SURSTITUTE u3l ITEM 79 (PN 2210740-0001) 0972900-7432 0219402-7400 IS AN ACCEPTABLE SUBSTITUTE NETWORK SNT4LS32N T ~SN74LS32N U3s T ~SN74L 832N " ITEM RO (PN 2210621-0001) 71 ~SNT4LS32N IS AN ACCFPTABLE SUBSTITUTE TI ., -SNT4LS32N NFTHWORK SN74SOON u3s UM EA EA A EA EA A A 11.) 5-99 12/14/83 PART NUMBER REV 2223100-5001 R ITEM, QUANTITY, 00228 0022¢C 0023 00234 00238 0023¢C 0024 0024A 00248 0024C 0026 00264 00268 0026C 0029 00294 0030 00304 0031 00314 0032 00324 0033 00334 0034 00344 0035 00354 0036 00364 0037 00001.000 00001.000 90001.000 00001.000 00001.000 00001.000 00001.000 00001.000 00001.000 00006.000 00002.000 0cool.000 List of Materials DESCRIPTIONceeceesososesonscescovascsses VIDEO CRT CONTRNLLER, AUTO-TNSERT COMPONFNT, » DESCRIPTION ceccccsscsccosooscsscancsase UM ITEM 81 IPN 2210735-0001) IS AN ACCEPTABLF SUBSTITUTE 0219402-7404 NETWORK SNT4S04M EA u3é ITEM 82 (PN 2210738-0001} IS AM ACCEPTABLE SURSTITUTE 0972900-7404 METHORK SNT4LSO4N EA usT ITEM 83 (PN 2210604-0001) IS AN ACCEPTABLE SUBSTITUTF 0972900-T174 NETWORK SNT4LS174N EA uts TTEM 84 (PN 2210674~0001) IS AN ACCEPTABLE SUBSTTTUTE 0972946-0041 v RREOSH FIX- R1-0025 OHM 5 % .25 W CARRON FI. LM R1 A ROH - R=25 0972946-0074 RES FIX 2,4K OHM S % .25 W CARBON FILM EA ROH - R-25 % R2 ROH - R-25 0972946-0066 RES FIX 1.1K OHM 5% .25 W CARRON FILM EA ROH - R=-25 R3 ROH - R-25 0972946-0091 RES FIX 12 K OHM 5% .25 W CARBON FILM EA ROH - R-25 R4 ROH - R=25 0972946-0076 RES FIX 3.0K OHM S % .25 W CARBON FILM EA ROH - R-25 RS ROH - R-25 0972946-0084 RES FIX 6.2 DHM 5 T .25 W CARBON FILM EA ROH - R-25 R6 ROH = R-25 0972946-0081 RES FIX 4.7K NHM 5 X .25 W CARBON FILM FA ROH = (3] RTyRBeRIIR11,R144R16 ROH - R=25 0972946-0057 RES FIX 470 OHM S % .25 W CARBON FILM EA ROH - R-25. R12,R13 ROH - R~25 0972757-0009 CAP FIX CER 470PF 10% SOV EA 5-100 12/14/83 PART NUMBER REV 2207985-0001 E ITEM. QUANTETY, 0001 00001.000 0002 00001.000 0002A 0003 00012.000 0004 00001.750 List of Materials DESCRIPTION ccocscecsccosecssscsscosscns TEST PLUG, EIA, MODEL 767 COMPONENT,. DESCRIPTIOMeccesonccccacancasccssccancss 0539903-0001 0539409-0005 0539430-C003 2210012-1999 HODOD,CONN 25 PIN WITH RETAINERS AMP = 206478-3 CONNECTDR,PLUG 25 PINS AMP -205208-1 Pl AMP -205208-1 CONTACT,PIN 24=-20AHG .068 INSUL DIA AMP -205202-2 ST WIRFJELECToWHT,26 AWG,19 X 3B8,U/L 1429 090484-SEE T1 DWG UM EA EA EA FT 12/14/83 PART NUMBER REV 2207985-0002 ITEM. QUANTITY, 0001 00CcO01.000 0002 00010,000 0003 00001 .250 DESCRIPTION eceeovcocsscavecosasassocens TEST PLUG,TYY,810 INTELLTIGFNT INTERFACE COMPONENT.. DESCRIPTION:ccccscccocsassosncsscsccnces 0539 09-0005 0539430-0003 2210083-0003 CONNECTOR,PLUG 25 PINS ANP ~205208-1 CONTACT,PIN 24-20AWG .068 INSUL DIA AMP =205202-2 ST WIRELELEC,COND U/L STYLE 1213,24 AWG 090484-WTE24A UM A EA FT 5-202 Wl 1 ] _V--Nmzwdmz_m. . w\n\mmmm'w9\wMmd?l&,1q5u31 sy et e e q=T PR T v EEEEAR & [ OVMe M.A71 -- TSoratsTuvs 2 ooe ) e e Tsiy 18 vt i 50 1va == - |HU > -4 TT R | e 5 v = T o 1] & ivoTiVnNmN KK3V15°6 150 1 21 [ 10054 206 [>revw] 1 O_N_._.NE IIVSIIING NGILOIFISIT Lo 1IO `01O3N 9N INITITITLN 018 `ALL'ONM IIONIN L¥vS 153L | 1000-586L022! LS | T000-$861022) Awo_muquv_ <$3208d u3d i (FAISAVaN) GN1 YSS3ON0081dUVdJ3d UXV3IR1I1d3O7HJANYOISWIAUTYV-- L SFL 1T WWOILNGYW 8 N o o= & « W\ dniai Srvwny veid| fi-ta | PS1-dd|| G D2t WI6S> AOLL 1700412627 | 29"2 | Jamm "98w eZ| S v OZ-1a| B-id RO! QD oL £0112 r-ig deid | X7QAALL OF GLWYALL] 2 2710 | S-1d | ¥QINIALL Ot OATYALL] 2°0L | UM OMY 2 ? [ S ] IS wnsovors |monwat| UwSoTuTaornsNaGemze 0|0--gy% el * ~ F DIDLuSWsLI00LwLISS5I1 USLNLSOVSLWRI3LE9SDSIWs3RLanJ0wawWeVRiaRarrr0|0 | | Li-it|e2-r] 2Si-t-aal er62-4|0\ sio0 oL snea| zoL | sum w9 66017192020oL 0s2169a35 || Z2o0LL | d|sesdm;uzoomymy9322}} ©o 2 + & + A RSULII2HTLIOIAVILHOSSILKNIIANHW£IOSLOSSNWHI3SA NIH0#TSNIMI72N2 SI0L2SO)ML0N7H9)NOLIFM| S 1| b=t Do) @11 | -S191|l221e1 | FO/ 93 0L SO L0 DI 2L 60/ 42 | o L6r F2T0 oaLn 801 ¥GG2 || 29 2702 2Z729°1U | ILM8t s M WEDZ) iotor 92| f[ammuomgt/MsoMyy 992T| © 2 7 i4 z === SIST e S i U IVIS| R T 2UNIISeWINTT| (Y1O54I75s3ONI0YIM | o 1000 AN 109-4539vd 21(8) ¢ 1d @ AW 2000-*1d 01 (2) C2ONV[A]C]SIS s - Qo 3% mN\. ol2 SIHONI Z2 o mM..W ww AUHVVHHOINOISHIANOD QVaIN3HOWVMJIFISIAoNDH S IS ILITCID QdIIQT>VIAAH3LNIVLHILYS [ 5-201 SMIAANDYS M1 IAWNA3VILS SHduId1mW>VIQDIIIONI3V1LI9OIVNZD a SNOILYIINOWWOD TeN |eSS -1 oVmIgTT(2"1USS2TF90L0-50S14Y32M96054030I(L[1I--LF OuwsIE30 A SNOISIATY i FIN0I3V0LIvZ3IHLHON3O9PHL1SNAT31S3MN3AA1W1DO2S>5 _IN._ 1 . SZ$°°00FF == SSTTiVYSWWIIIODDN3IVQdHII330DDVLV1dd VHOIIMNNLOID [Z] SUILINITUN N1 3wy SNOISNAwG Ty [T) `GNIOWMS ISNYIIO SSTN "SHON v 12/14/83 PART NUMBER REV 2230528-8001 L ITEM. QUANTITY. 0001 00001.000 List of Materials DESCRIPTION. . secsccsscenccsscsnssss KEYBNARD, TILTING,LOW PROFILE - SPARES COMPONENT.. DESCRIPTIONcsecsscveccsnscsccncnssssssee 2230528-0001 KYBD, TILTING,LOW PROFILE,DNMESTIC STN 1665-1528-002 UM EA 5-200 12/14/83 PART NUMBER REV 2230528-0008 L ITEN. QUANTITY. 0001 00001 .000 0002 00001.000 0003 00001.000 0004 00002.000 0005 00001.000 0006 00001.000 0007 00001.000 0008 00001.,000 0009 00001.000 0010 00001.000 ool1 00001 .000 0012 00002.900 0013 00002.000 0014 00002.0C0 0015 00001.000 0017 00002,009 oo1s 00006.000 0019 00003.000 0020 00002.000 0022 00002.000 0023 n0006.000 0025 00001.000 0026 00001.000 0027 00004.000 0028 00000.048 0029 00001.000 00294 00298 0029¢C 00290 List of Materials NKYERSDC,RITPITLITOINN.G,cLoOMcvePvReOsFcIsLsEo,oSoWnIsToZoEcRnLaAcNsDncnss COMPONEMT.. DESCRIPTINMNcccescocsvsae ecsnscsscss UM 2230529-0001 BAS E,KEYROARD FA 1255-7500-015 2230536-0001 HNUSTNG ¢ SHAFT 4R IGHT EA 1255-7504-006 2230534-0001 HOUSTNG »SHAFT (LFFT fA 1255-7503-006 2230532-0001 SHAFT,CLUTCH SPRING A 1255-7502-007 2210546-0001 SPRING, CLUTCH FA 2230546-0002 SPRING, CLUTCH A 2230547-0001 SPRING, RETURN £A 2230547-0002 SPRING, RETURN FA 2230540-0001 2230527-0008 2239530-0001 2230538-0001 2230554-0001 2230552-0001 2230549-0001 09726 79-0029 0972679-0012 0972679-0015 2230555-0007 2230556-0001 0972679-0013 0936643-0001 0936664-0002 04111010058 0972436-0011 227%609-0004 FOOT,TILT ADJUSTMENT 1255-7506~008 KEYBOARD,LOW PROFILE,SWITZERLAND SEE TU- DRAWING COVER,KEYBNARND, PERSONAL COMPUTER 1255-7501-015 BUTTOM, REL,TILT FOOT,PERSONAL COMPUTER B~1R--CCm2aAALm5mCBImL5mKPFm-mE,e7mTCe5aLAa0eUS,=e5TSS=m-CYP00H0R,000IK007NEGYB,OBAURTDTON SCREW . * A EA EA EA z EA £A FA EA SCREW # 6-19 X 3/8 SLOTTED HEX £a SCREW #6-19 X 3/4 THD SLOTTED HEX A RING,RETAINING A PAD,NONSKID,P/T FA SCREW # 6-19 X 1/2 SLOTTED HEX EA LSSQPOLEEPCIFELWONCSCKULWTPTL1AAIRA--SMTO-HSIFEHNIDDRMNELRRSLEAA3LWW5#SII36LKNN3EETGG5EYH-VBEE5OIRX8ANMTRGOED,FRPONVRACBMLOX STYRENE TONTH CRES 8 X.133 £A A EA FY 003A90-HT-105C-8 10, SERTAL NO LABEL, BLANK, COLLEGE STA FA * D= {OW PROFILE KEYRNARD, * SWISS, N= 2230528-0008, * A= 0,35, W= 4.2, V= 12, * F= 0y P= O 6-199 12714783 PART NUMBER REV 2230528~0007 L ITEN, QUANTITY, 0001 00001.000 0002 00001.000 0003 00001.900 00C4 00002.000 0005 00001,000 0006 00001.000 0007 00001.000 0008 00001.000 0009 0010 00001.000 00001.000 0011 00001.000 0012 00002.000 0013 00002.000 0014 00002.000 0015 0000t.000 0017 00002.000 0018 00006.000 0019 0020 00003.900 00002,000 0022 90002.000 0023 00006,000 0023 0026 00001.000 00001.000 0027 0028 00004.000 00000.048 0029 00001.000 00294 00298 0029¢C 00290 List of Materials DESCRIPTION:ccoccoocacssoavocsassacscnnsne KYBDo TILTING,LOW PROF JLE, DENMARK/NORWAY COMPONEMT.. DESCRIPTIMNccccceccacccoscacsscaccscanss 2230529-0001 2230536-0001 2230534-0001 2230532-0001 2230546-0001 BASE,KEYBOARD 1255-7500-015 HOUS ING y SHAFT,RIGHT 1255-7504-006 HOUSTING o SHAFT,LEFT 1255-7501-006 SHAFT,CLUTCH SPRING 1255-7502-007 SPRING, CLUTCH 2230546-0002 SPRING, CLUTCH 2230547-0001 SPRING, RETURN 2230547-0002 SPRING, RETURN 2230540-0001 2230527-0007 2230530-0001 2230538-0001 2230554-0001 2230552-0001 2230549-0001 FOOT,TILYT ADJUSTMENT 1255-7506-008 KEYBOARD,LOW PRNFILEDENM/HAORRWKAY SFE TI- DRAWING COVER yKEYB»OPA ERR SOD NAL COMPUTFR 1255-7501-015 BUTTON,REL,,TILT FOOT,PERSONAL COMPUTER 1255-7505-007 BRACKET,SPRING,BUTTON e 00 0| CLIP, CLUTCH N 000 CABLE ASSY,KEYBOARD 4 0972679-0029 SCREW g 0972679-0012 SCREW # 6~19 X 3/B SLOTTED HEX 0972679-0015 SCREW #6-19 X 3/4 THD SLOTTED HEX 2230555-0007 RING,RETAINING 2230556-0001 PAD, NONSKID, P/ T 0972679-0013 SCREFW # 6-19 X 1/2 SLOTTED HEX 0936643-0001 0936664-0002 0411101-0058 0972436-0011 22756 09-0004 PC CLAMSHELL THERMOFORM STYRENE SEE TI- DRAWING LOW PROFILE KEYBOARD ROX SEE TI- DRAWING LOCKWASHER #6 EXTERNAL TOOTH CRES QPL = M$25335-58 INSULATIOM SLEEVING,PVC R X.133 00N3890-HT-105C-8 10, SERIAL NO LABEL, BLANK, COLLEGE STA *D= LOW PROFILE KEYBOARD, * DEN/NORN,= 2230528-0007, * A= 0,35y W= 4,2, * F= 0, P= 0 V= 12, UM EA EA A EA A EA EA EA FA EA EA A A £A EA EA A EA A EA EA A FA £A FT FA 6-198 12714783 PART NUMBER REV 2230 528-0906 L ITEM, QUANTITY, 0001 0002 00001.000 00001.000 0003 00001.000 0004 00002.000 0005 00001.000 0006 00001.000 0007 00001.000 0008 00001.,000 0009 0010 00001.000 00001,000 ool 00001.000 0012 00002,000 0013 00002.000 0014 00002,000 0015 00001.000 0017 00002.000 oolr8 00006.000 0019 00003.000 0020 00002.000 0022 00002.000 0023 00006.000 0025 00001,000 0026 00001.000 0027 00004.000 0028 00000.048 0029 00001.000 00294 00290 0029C 00290 List of Materials DESCRIPTIONccecevcscnvnncocse ccesoe KYBDs TILTING,LOW PROFILE, DEN/F INLAND COMPONENT.. DESCRIPTINN.cesescsvoscocssocsccacssoscce 2230529-0001 2230536-0001 2230%534-0001 2230532-0001 2230546-0001 BASE,KEYBOARD 1255-7500-015 HOUS TNGy SHAF T, RIGHT 1255-7504-006 HOUSING » SHAF T, LEFT 1255-7503-006 SHAFT,CLUTCH SPRING 1255-7502-007 SPRING, CLUTCH 2230546-0002 SPRING, CLUTCH 2230547-0001 SPRING, RETURN 2230547-0002 SPRINGs RETURN 2230540-0001 2230527-0006 2230%30-0001 22230538-0001 2230554-0001 2230552-0001 2230549~0001 FOOT,TILT ADJUSTMENT 1255-7506-008 KFYROARD,LOW PROFILE,SWEDFN/FINLAND SEE T1- DRAWING COVER KEYBOARDy PERSONAL COMPUTER 1255-7301-01% BUTTON,REL,TILT FOOT,PERSONAL COMPUTFR 1255-7505-007 B--R--AnCmKmEwTme¢=S=P0R0I0NGy BUTTON CLIP,CLUTCH ---------- 000 CABLE ASSY,KEYBNARD A 0972679-0029 SCREW 0972679-0012 SCREW # 6-19 X 3/8 SLOTTED HEX 0972679-0015% SCREW #6-19 X 3/4 THD SLNTTED HEX 2230555-0007 RING,RETAINING 2230556~0001 PADGNONSKIN.P/T 0972679-0013 SCREW # 6-19 X 1/2 SLOTTED HEX 0936643-0001 0936664~-0002 0411101-0058 0972436-0011 2275609-0004 PC CLAMSHELL THERMOFORM STYRENE SEE TI- DRAWING LOW PROFILE KEYBNARD BOX SEE TI- DRAWING LOCKWASHER #6 EXTERNAL TOOTH CRES QPL - M535335-34 INSULATTON SLEEVING,PVC 8 X.133 003490-HT-105C-9 1Dy SERTAL NO LABEL, BLANK, COLLFRE STA * D= LOW PROFILE KEYBOARD, * SWE/FINy N= 2230528-0006, * As 0.35 H= 4.2, V= 12, ® F=0, P= 0 UM EA EA FA EA A EA EA FA A EA EA EA A A FA EA EA A A A A EA A A FT FA 5-197 12/14/83 PART NUMBER REV 2230528-0005 L ITEM, QUANTITY. 0001 00001.000 0002 00001.000 0003 90001.000 0004 00002.000 0005 00001.000 0006 00001.000 0007 00001.000 0008 00001.000 0009 00001.000 0010 00001.000 00l 00001.000 0012 00002.000 0013 00002.000 0014 00002.000 0015 00001.000 0017 00002.000 0018 00006.000 0019 00003.000 0020 00002.900 0022 00002.0C0 0023 00006.000 0025 00001.000 0026 00001.000 Q027 00004.000 o028 00000. 048 0029 00001.,000 00294 00298 0029¢C 00290 List of Materials DESCRIPTIONccaceccosasascsvosonccoscnsses KYBD,TILTING,LNW PROFILE,SPANISH COMPONENT.e DESCRIPTTONccecacscoacssassscconssssnces UM 2230529-0001 BASE.KFYBOARD FA 1255-7500-015% 2230536-0001 HOUSTMG ¢ SHAFT, R IGHT A 1255-7504-006 : 2230534-0001 HOUSING » SHAFT,LEFT EA 1255-7503-006 2230532-0001 SHAFT,CLUTCH SPRING EA 1255-7502-007 2230546-0001 SPRING, CLUTCH A 2230546-0002 SPR ING, CLUTCH EA 2230547-0001 SPRIMNG, RETURN EA 2230547-0002 SPRING, RETURN A 2230540-0001 FOOT,TILT ADJUSTMENT EA 1255-7506-008 2230527-0005 KEYBOARD,LOW PROFILE,SPANISH EA SEE TI- DRAWING 2230530-0001 COVER,KEYBOARD, PERSONAL COMPUTER EA 1255-7501-015 2230538-0001 BUTTON,PEL,TILT FOOT,PERSONAL COMPUTER EA 1255-7505-007 2230554-0001 BRACKET 4 SPRING,BUTTON A g --000 2230552-0001 CLIP,CLUTCH FA -------------------- 000 2230549-0001 CARLE ASSY,KEYROARD s EA 0972679-0029 SCREW EA 0972679-0012 SCREW # 6-19 X 3/8 SLOTTED HEX EA 0972679-0015 SCREW #6-19 X 3/4 THD SLOTTED HEX. EA 2230555-0007 RING,PETAINING EA 2230556-0001 PAN,NONSKID.P/T FA 0972679-0013 SCREW # 6-19 X 1/2 SLOTTED HEX FA 0936643-0001 PC CLAMSHELL THERMOFORM STYRENF EA SEE TI- DRAWING 0936664-0002 LOW PROFILE KEYROARD BOX EA SEE TI- DRAWING 0411101-0058 LOCKWASHER #6 EXTERNAL TDOTH CRFS EA QrPL - M$35335-58 0972436-0011 TNSULATION SLEFVING,PVC B X.133 FT 003890-HT-105C-8 2275609-0004 10, SFRIAL MO LABEL, BLANK, CNLLEGE STA FA * D= LOW PROFILE KEYBOARD, * SPN, N= 2230528-0005, * A= 0,35, M= 4.2, V= 12, *F= 0, P= 0 5-196 12/14/83 PART NUMBER REV 2230528-0004 L ITEM, 0001 0002 0003 0004 0005 0006 0007 0008 0009 0010 onit 0012 0013 0014 0015 0017 0018 0019 0020 0022 0023 0025 0026 0027 0028 0029 00294 0029A 0029¢C 00290 QUANTITY. 00001.000 00001.000 00001.000 00002.000 00001.000 00001.000 00001.000 00001.000 00001.000 00001,000 00001.000 00002,000 00002.000 00002.000 00001.000 00002,000 00006.000 00003,000 00002,000 00002.000 00006.000 00001.000 00001.000 00004.000 00000.048 00001,000 List of Materials DESCRIPTIONccocesococcsscassnsvscsncasnns KYBD,TILTING,LOW PROFILE,GERMANY/AUSTRIA COMPONFNT.. 2230529-0001 2230536-0001 2230534-0001 2230532-0001 2230566-0001 2230546-0002 2230547-0001 2230547-0002 2230540-0001 2230527-0004 2230530-0001 2230538-0001 2230554-0001 2230552-0001 2230549-0001 0972679-0029 0972679-0012 0972679-0015 2230555-0007 2230556-0001 0972679-0013 0936643-0001 0936664-0002 0411101-0058 0972436-0011 2275609-0006 ODESCRIPTION:ccescoccccevsescccsccanscsses UM HH11O1O1SSB222UU2PHA555SS5RAS5555IIIFEN----NNT,G7777GG,,K5555,,CE0000LY4302UBCSS----TOLHH000C0AAUA001H0FRTF665T7DCTH,S4LRPERFIIGTNHGT . £A EA A EA EA SPRING, CLUTCH A SPRING, RETURN A SPRING, RETURN £A C--CS1--11AECFKROB=222mEBOLEURVm555mLOIYTAEm555ETPBmTCm-R--T,,OOKmm7,I77TCAN-Em555KImLRA,T=0L00EUDSRn,Te561YT,ESDSmu---CBLLYRP00H00aOO,,0ARA0001HAT0mKWID07850IREINJLDNYGUPTG,B,SRNPTBOAEMUFFRRETTODSNTOLTOOTENN,,APGLEERRSMCOAONNMAYPL/UATUECRSOTMRPIUATER A EA A FA FA A EA SCREW s EA SCREW # 6-19 X 3/8 SLOTTED HEX EA SCREW #6-19 X 3/4 THD SLOTTFD HEX EA RING,RETAINING FA PAN,NOMSKTD,P/T A SCREW # 6-19 X 1/2 SLOTTED HEX FA LL0SSQP1NCEDEPO0IO,EELNWC3SK8CSUW9ELTPTLA0RIAIRAS--I-MOT-HAHSFIELOHTIRDDMNEL-RR§EL1AA3NL0WWO5#S5II36LCKNN3LEE-GGT5AYE8H-BBVEE5EOIX8RLANT,MRGEOD,RFPNBRVALBMCLAONXK,8TSNTOVXTR.CHE1ON3LE3LCERGEES STA EA EA EA FT FA * D= LOW PROFILE KEYBOARD, * GER/AUS, N= 2230528-0004, * A= 0.35, W= 4.2, V= 12, * f= 0, P= 0 5-195 12/14/83 PART NUMBER REV. 2230528-0003 L ITEM. QUANTITY, 0001 0C001.000 0002 00001.000 0003 00001.000 0004 00002.000 0005 00001.000 D006 00001.000 0007 00001.000 0008 90001.000 0009 00001.000 ooi0 00001.000 o011 00001.000 0012 00002,000 0013 00002.000 0014 00002.000 0015 0000%t.C00 0017 n0002,000 o0o18 00006.000 0019 0020 00003.000 00002.000 0022 00002,000 0023 10006.000 0025 00001.000 0026 00001,000 0027 00004.000 0028 00000.048 0029 00001.000 00294 00298 0029C 00290 List of Materials NESCRIPTIONceecscoosns KYBN, TILTING,LOW PROFI COMPONENT.. DESCRIPTIONceoccosceccseacsssevecsnccccnes 2230529-0001 2230536~-0001 2230534-0001 2230532-0001 2230546-0001 BASE,KEYBNARD 1255-7500-015 HOUS ING y SHA4FRITGHT 1255-7504-006 HOUS ING o SHAFTLE,FT 1255-7503-006 SHAFT,CL UTCH SPRING 1255-7502-007 SPRING, CLUTCH 2230546~0002 SPRING, CLUTCH 22305471-0001 SPRING, RETURN 2230547-0002 SPRING, RETURN 2230540~0001 2230527-0003 2230530-0001 2230538-0001 2230554-0001 2230552-0001 2230%549~0001 FOOT,TILT ADJUSTMENT 1255-7506-008 KEYBOARLDOW PROFTILE,FRANCF SEE TI- DRAWING COVER,KEYBDARD,PERSONAL COMPUTER 1255-7501~-015 BUTTRO EL N,T, ILT FOOT,PERSONAL COMPUTER 1255-7505-007 BRACKET, SPRING, BUTTON --==--e===-==000 CLIP,CLUTCH e 000 CABLE ASSY,KEYBOARD > 0972679-0029 SCREW « 0972679-0012 SCREW # 6-19 X 3/8 SLOTYED HEX 0972679-0015 2230555-0007 SCREW #6-19 X 3/4 THD SLOTTED HEX RING,RETAINING 2230556-0001 PAD,NONSKID,P/T 0972679-0013 SCREW # 6-19 X 1/2 SLDOTTED HEX 0936643-0001 0936664-0002 0411101-0058 0972436-0011 2275609-0004 PC CLAMSHELL THERMOF(ORM STYRENF SEE TI- NRAWIMG LOW PROFILE KEYBOARD BOX SEE TT- DRAWING LOCKWASHER #6 EXTERNAL TNOTH CRFS QPL - M535335-58 INSULATION SLEEVING,PVC 8 X.133 003890-HT-105C~8 ID,SFRIAL NO LABEL, BLANK, COLLFGE STA * D= LOW PROFILE KEYBOARD, * FRENCH, N= 2230528-0003, * A= 0.35, W= 4,2, V= 12, * F= 0, P=0 UM Fa EA FA EA EA EA EA EA EA EA EA A FA EA EA EA A EA EA FA EA Ea EA EA FT FA 5-194 12714783 PART NUMBER REV 2230528-0002 t ITEM, QUANTITY, 0001 00001.000 0002 00001.000 0003 00001.000 0004 00002,000 0005 00001.000 0006 00001.000 0007 00001 .000 0008 00001.000 ooc9 00001,000 0010 00001.000 0011 00001.000 0012 00002.000 0013 00002.000 0014 00002.000 0015 00001,000 0017 0C002.000 0018 00006.000 0019 00003.000 0020 00002.000 0022 00002.000 0023 00006.000 0025 00001.000 0026 00001.000 0027 00004.000 o028 00000.048 0029 00001.000 G029A 00298 0029¢C 00290 List of Materials DESCRIPTION cccacvoscsavscevssosccasscss KYRD, TILTING,LOW PROFILE,VU.K. COMPONENT,» DESCRIPTION.coscscccosovcvcconccsccsssas 2230529-0001 22305360001 2230534-0001 2230532-0001 2230546-0001 BASE,KFYBOARD 1255-7500-015 HOU»SSHI AF M T, RG IGHT 1255-7504-006 HOUSTNG SHAFT 4 LEFT 1255-7503-006 SHAFT,CLUYCH SPRING 1255-7502-007 SPRING, CLUTCH 2230546-0002 SPRINGs CLUTCH 2230547-0001 SPRING, RETURN 223054 T-0002 SPRINGs RETURN 2230540-0001 2230527-0002 2230530-0001 2230538-0001 2230554-0001 FOOT,TILT ADJUSTMENT 1255~7506-008 KEYBOARD+LOW PROFILE,UNITED KINGDOM SEE TI- DRAWING COVER ,XEYROARD, PERSONAL COMPUTER 1255-7501-015 BUTTONREL,TILT FOOT, PERSONAL COMPUTER 1255-7505-007 BRACKETY ySPRING,BUTTON 2230552~0001 2230549-0001 CABLF ASSY,KEYBOARD & 0972679-0029 SCREW 0972679-0012 SCREW # 6-19 X 3/8 SLOTTED HEX 0972679-0015 SCREW #6-19 X 3/4 THD SLOTTED HEX 2230555-0007 RINGLRETAINING 2230556-0001 PAD ¢ NONSKIDP/, T 0972679-0013 SCREW # 619 X 1/2 SLOTTED HEX 0936643-0001 0936664-0002 0411101-0058 0972436-0011 2275609-0004 PC CLAMSHELL THERMOFORM STYRENE SEE TI- DRAWING LOW PROFILE KEYBOARD BOX SEE TI- NRAWING LOCKWASHER #6 EXTERNAL TOOTH CRES QPL - M$35335-58 INSULATION SLEEVING, PVC 8 X.133 003890-HT-105C.-8 10, SERTAL NO LABEL, BLANK, COLLEGE STA * D= LOW PROFILE KEYBOARD, * UK, N= 2230528-0002, * A= 0.35, W= 4.2, V= 12, *F=0P,= 0 UM EA EA EA EA EA A EA EA EA EA EA EA EA FA EA EA A EA EA EA EA EA EA EA FT EA 6-193 12/14/83 PART NUMBER REV 2230528-0001 t ITEM. QUANTITY, 0001 0002 00001 .000 00001.000 0003 00001.,000 0004 00002.000 0005 00001.000 0036 00001.000 0007 00001.000 0008 00001.000 0009 00001.000 0010 00001.000 0011 00001.000 00L2 00002,000 0013 00002.000 0014 00002.,000 0015 00001.000 0017 00002.000 0018 00006 .090 0019 0020 00003.000 00002.000 0022 00002,.000 0023 00006.000 0025 00001.000 0026 00001.000 2027 00004.000 0028 00000, 048 0029 00001.000 00294 00298 0029¢C Q030 00001.000 0031 00001.000 List of Materials DESCRIPTION.ccvacsvosccoccascnnn KYBD, TILTING,LOW PROFILE, DOMESTIC COMPDOMENT.e DESCRIPTINNceeecccacscncscnsscscsncsscss 2230529-0001% 2230536-0001 2230534-0001 2230532-0001 2230546~0001 BASE.KEYBOARD 1255-7500-015 HOUS ING y SHAFT o RIGHT 1255-7504-006 HOUS ING, SHAFT, LEFT 1255-7503-006 SHAFT,CLUTCH SPRING 1255-7502-007 SPRING, CLUTCH 2230546~0002 SPRING, CLUTCH 2230547-0001 SPRING, RETURN 2230547~0002 SPRING, RETURN 2230540-0001 2230527-0001 FOOT,TILT ADJUSTMENT 1255-7506-008 KEYROA4RLDOW PROFILE,NOMESTIC STD 2230530-0001 2230538-0001 2230554-0001 2230552-0001 2230549-0001 0972679-0029 0972679-0012 0972679-0015 22305550007 2230556-0001 0972679-0013 0936643-0001 0936664=-0002 0411101-0058 0972436-0011 2275609-000% COVERKEYBOARD, PERSONAL COMPUTER 1255-7501-015 BUTTON,REL, TILT FNOT,PERSONAL COMPUTER BCB1-RAC-2ABL-5CLI-5KEP--E,-7TC-5LA-0US,-5TS-S-CYP0H,R000K00I700ENYGB,DRAURTDTON 4 SCREW SCREW # 6-19 X 3/8 SLOTTED HEX SCREW #6-19 X 3/4 THN SLOTTED HEX RING,RETAINING PAD,NONSKIN,P/T SCREW # 6-19 X 1/2 SLOTTED HEX SLQSPEMPLECIEWLEONCSCKULTTWPLIIAARA--MSOT-SHIFFHOIDDMRENLRRSLEAA3LWW5#SII63KLNN3EETGG5YEH-BVEE5OIRX8ANMTRGOED,FRPONVRABCMLOX STYRENE TOOTH CRFS 8 X.133 003890-HT-105C-8 ID, SERIAL NO LABEL, BLANK, COLLEGE STA * D= LOW PROFILE KEYBOARD, * N= 2230528~0001, A= 0,35, * W= 4,2, V= 12, F= 0y P= 0O 2269942-0001 LABFL,UL 5 2269943-0002 LAREL, CSA,LR49011,COLLFGE STATION SEE TI- ORAWING UM EA EA FA EA FA EA EA EA EA EA EA EA A £A EA A EA EA EA EA A EA EA EA FT EA EA EA 5-192 [ el @& T ] T SNSOLADIN S =R 2 (OTOWITIVLI)SN! SNIWFA PNIANWIELOIRVY WSLIMONITT20U0°3 9NT 0Y0" t5(Av0H Frtr--: 2 Y1S0W5IL)(3 WS3NISHOLHavisNsI [B) UURUNDL PRIT DL BT TR [ FALIVEAY NUFYQZ 20V 0L 8 Wil MMW RTI02T2 S0IN U 6& wWI3nl MGY T8 QLY W3t NMPVTGTYO0T01°£ O0IFO 221A00Y1L §7 £W2 WwWI3LHy 000K vINaGeRL [ 300201 [B) 3HoI0x00Mu0L [@ ] [T METOIE0'C & L w3 02 [3) A("SFFTNROV0T HMSIYZMVWZLSNYFSIIOG/LIO1P(54N)IOWIFVRITUSS1]RO)4VM0SIATSNSGMOHLIIILGANGSNIGWTIKGNHOFMUGTHVUOLLMLTyS)/1LL0OyDSXW0HSNYWTLWIAQTINROLSESOWNONNIIIIZSIY0SUMUSNSHLW0SGILIN2G{UNfINC33WSNY8WIT(X3ASYLSIlWWT0NT)HIMWAIMWNHYSKe¥SO00¥3YN58TTMR()N6OVITGWNISTM3HIIN§LSL1X5IY4'4)M0ANIOUTOVNWLIWYLIIS0INNA Y0OTTNNI4IIUIWIWT IYNNOSFDIWGHoY0LWIY&TySN8InL.TG 5] + 177HS WO¥S GINNILNOD SOV [ ° | Z { e 5-191 | v 4 s ;m"_ wo _ 9 | L v 3-3/8 N3O7Iv3L835 S A O N{_3z-N0O 5N2-MSO3I10&S#K5W)Sls o SIS s s - -0 NOI1L23S -- o 474 & 220 @ 5| G Rz ] 8 @@ .CW.N 7 ~p & T S : w i il n -7 ST el = ! La _ Beg-- B} o) ..erIJr...a F`}MJ."_J= - -- Fs ais Si R BB i M T LY O Mol` ] ,.-_2N_.. = @ (LA __`--.l&\-.ufl' 234 / __ | / 6 - \o© el __VR \ © o [l a 5-190 > | Lelezeose|z T v iy s ° ¢ 23 @/ B& | Flofxin [« |de/d I SOR3V0S 0WwA7TiANLNON7OT IU7AINM9NNTAONSYV_0A3R 1)L§9Q()O(7:5(N7GTVB3vSGVIIz0EE3G00GL5IOOIEE0SIEWIS'NiNNCYNlMDDIY., 1 vl _GIOOY ROV RL1GUIWH)TIO1r §LI00~IA08VR00I0-0S-T((ODG]B)0RfZYPE_O9G2I2L0I)O0TS0H5H7-YD -- & | #zeosze, ) _ (38 71 uS) V-V mM3IIA / P / / / t Y| aINTNIz | SOESE _[VI2796[=a TIITY, } s | s PJF2I7NLN[ x]]~ es [-oen] o TLU2ADS MOT -- v fee] mmms | [ -- I TLS TV 0N0 gMz T M3e N ANDR 9 WXTONX I a5 vecs oe // HREAHt VIGMSiS2Ey9 ! Nt | anvinil wst £ FvdS < IS M TINILTIL OuvOR - 3> Iy vyT T - 2SRT 5-188 .p:eSflgPuU fih 3 S8O-S0I3wSPAQ {2)IB-LD2°O%MSHWS9=-0A'(L3Y]OHS1.TB(CI)LT1T9L2D10TO0Y() T LTI O CIVIINGT §II0N (1 IL) ISHG SIMIWS TH2L0"AIWTTAGRNUOTDIoVOUHSLYSONINQ(L18ITNWOIaOWS2I1OY)MNITAII8TIO3YmYWiWHSTLQNoNVlI(NM(S1NNWTTSIYLHIZ)ITGINGLSIWVELT(UNU RFIWIIINQUMIUO)L`IWQTG3R6IPESHSO¥OTA1'A7NDITwNHTITSTQFVLHI(I3ATV0AGNw0DiNTtTOY)YNXSO7OWL4XO1YIW7WI052INNNTSI7Y4STINItHWT3LG [E) Q7HIMS JMMIO SSIND 510N | v ¥ s T ° T z -/ 12714783 PART NUMBFR REV 223426 1-0001 A 1TEM. QUANTITY, 0001 00001.000 0002 00001.000 0003 00001.000 0004 00001.000 0005 00001.000 0006 00001.000 0007 REF 0008 00003.000 0009 00001.000 0010 00001.000 List of Materials DESCRIPTION. co0ccosnscosrescscoscccasson SPEECH MODULE, PROFESSIONAL COMPUTER COMPONENTos DNESCRIPTIONceccosccsscccasacacsccccneasss UM 2232403-0001 TELEPHNGNE ELECTRONICS A 1254-2403-000 2232373-0001 SPEECH ELECTRONICS EA 1254-2373-000 2211839-0003 SPACER,PC BOARD,NYLON EA SEE Tl- NRAWING 2221313-0001 HDNR ,DUAL RODY,12 STR PINS .370" 1ROW EA SEE TI- DRAWING 2221313-0002 HD, R DUAL BODY,18 STR PINS .370" 1ROW FA SEE T1- DRAWING 2221313-0003 HEADER, DUAL BODY,22STR PINS .370" 1 ROW A SEE TI- DRAWIMNG 2219301-0001 SPEC,HDLG,EC SENSITIVE PARTS AND ASSYS FA 0996341-0001 SPACER,PC BOARD,.1825" BODY,PLASTIC EA SEE TI- DRAWING 2237357-0001 SPACFR, SPFECH BOARD EA SEE TI- DRAWING 0972632-0006 STRAP,TIE DOWN,CABLE-NON-STANDARD EA 0604T7-SST2S 2 12714783 PART NUMBER REV 2234261-8001 A ITEM, QUANTITY. 0001 00001.000 0002 00001.000 0003 00001.000 0004 00001.000 0005 00001.000 0006 00001.000 0007 REF 0008 00003.000 0009 00001.000 0010 00001 .000 DESCRIPTIOMeccceonssoscssccsos~onancnncss SPEECH MODULE, PROFFSSIONAL COMPUTER/SPRS COMPONENT.. DESCRIPTIONuccsccsccccscssnsnccsecssnsces UM 2232403-0001 TELEPHONE ELECTRONICS EA 1254-2403-000 22323 73-0001 SPEECH ELECTRONICS EA 1254-2373-000 2211839-0003 SPACER,PC BOARD,NYLON A SEE TI- DRAWING 2221313-0001 HDR,DUAL BODY,12 STR PINS .37C" IROW FA SEE TI- DRAWING 2221313-0002 HDR ,DUAL RBODY,18 STR PINS .370" 1ROW EA SEE TI- DRAWING 2221313-0003 HEADER,DUAL BDDY,22STR PINS .370" 1 ROW EA SEE TI- DRAWING 2219301-0001 SPEC,HOLG,EC SENSITIVE PARTS AND ASSYS EA 0996341-0001 SPACERyPC BDARD,.1825" AONY,PLASTIC A SEE TI- DRAVWING 2237357-0001- SPACER, SPEECH BDARD A SEE TI- DRAWING 0972632-0006 STRAP,TIE DOWN,CABLE-NNN-STANDARD FA 060477-SST3S 6-187 ny 1 H2L-0AdSS0Y00 3nAGT v Puan-isl. S5 ..l_ ------ ---- _ g ) a2 %7 o [FREIEL =/f | womwta e 0 eonvi(6 -2E82460 g T B o ey OO AWN/Ea PGOVNI10 OOVT-{51201LED2y2 MSAv¢m &WOALY AOOLV o8| | = NG T -- = CAIIMTWAOILVNLOLIFISISAIWTASAiTnIeYNOLLVMI1NH0IY.TPT4O2I.L4TS47EO3WDvFLHoE06:20EUTQII3HNL1 AWIdSTwBIMS1Gy§t) 2 oo o0A.3 W-(O)I3aNlOs1D0IQ0YNM3Yvw0TeANTdBIN0011IVSTTyNWS0i1ns4*W1LBHIwCyoNSrvNiQtuTyIw)]w ¢ 03412345 BSmuIu0 SSIWA ShON < | ® 5-186 12/14/83 PART NUMBER REV 2234246-0001 B ITEM, QUANTITY, 0002 REF 0003 00006.000 0005 00002.000 0005 0009 REF 0010 REF 0011 REF 0999 00001.000 List of Materials DESCRIPTIONccsacosscerccvssscsacscsccsne 256Kk RAM EXPANSION {SLAVE BNARD) COMPONENT,., DESCRIPTION.esevceccecassaccsasscacancss UM 2234248-0001 O1A,LOGIC,NETAILE2D5,6K RAM EXPANS[ON EA 0996341-0003 SPACER,PC BNARD,ZYTEL,NATURAL COLOR EA 2210288-0022 0994396-9901 HEADER, 1-ROW,22 CONTACTS, 100" CENTFRS FA SEE TI- DRAWING Pl,P2 SEE TI- DRAWING PROCEDURE, SITE & DATE CODF SERTALIZATION EA 2219301-0001 SPEC,HDLG,EC SENSITIVF PARTS AND ASSYS FA 2237301-0001 SPEC,UNIT TEST-256/512K BYTE SLAVE PWB EA 2234246-5001 256K RAM FXP.{SLAVE BRD) AUTO-TNSERYT FA 1257-5246-002 12/14/83 PART NUMBER REV 2234246-5001 8 ITEM. QUANTITY., o001 00021.000 0004 00036.000 0004A 00048 0004C 0004D 0004E 0004F 0006 00018.000 00064 00068 0006C 0007 00018.909 00074 00078 0007C 0008 00001 .000 00084 DESCRIPTION<coecosocrcnscsnscoscsansscnns 256K RAM EXP.ISLAVE BRD} AUTO-INSERT COMPONENT.. DESCRIPTINN.ccecesvsancscscssossnccsssss UM 2234247-0001 PHB y256K RAM FXPANSTION £A 2211118-0004 0972763-0025 0972763-0013 0972924-0018 IC,64K~BIT DYNAMIC RAM,150NS TA/ROW FA TMS416~-4-15NL i V60,61 ,U62,U63 ,Ub%,U65,U66 TMS416-4-15NL U67,U68,U70,UT1,U72,UT3,U74 TMS 416-4-15NL U75,U76,U77,U78,U80,UB1,U82 TMS416-4~15ML U83,U84%,U85,U86,U87,UR8,U90 TMS416-4~15NL U91,U92,U93,U94,UU99, 5U,7 TM5416-4-15NL u9s TMSAL16-4-15NL CAPACITO. RLO,UF S0V FX,CERAMIC DIEL EA COR CA~CO3I5U1042050A C404C51,9C424C4%3,C44,C45,C46 COR CA-CO3ZI5U1047050A C474C48,C49,C50,4C51,C52,C%3 COR CA-C03Z5U1042050A 5440554C56,C57 COR CA-CO032I5U1042050A CAP,FIXED .010UF S0 VOLTS A 004222-MC1OSE0137 C58,C59,C60,(61,062:C63,C64 004222-MC105E1032 C654C66¢C6T¢C68,C69,LT0,CT1 004222-MC1051037 CT24C73,C74,CT5 004222-MC105E1032 CAP FIX TANT SDLID 6.8 MFD 10 ® 35 VOLT FA QrL =M39003/1-2304 76 QrPL ~439003/1-2304 5-185 ' W vevess {QYv08 3AvS) NOISNYJX3 WYY 3952 DIYLIN-IS] <102 [£835(n1ONV0O1NUV_JA(V0IaNSvO0)IGLI3NIAIOvII1SSS)INTVGoXX3T wWyoya wX995527 11002005I0O--NW99OvpNzZ_vLpeaEvz2yz2| T 7 T T7TeTeT so00-gvz9522] T |vls i000-zr2eEzz T 1817 " 1000-9v2v622] wwaowio x2078 gmgl VAN Avemisey J ¥61 270105 WM 00| ¥30705 ONvHI 00 (51v3 18 #0700 0% 101 101 20-v21 18G5 1 10121 10-206 | | 380w75l, 2 £ s3907t 9 (©) 220 L _| eQo)ols OeFz _| ozio0cCc|o|sz§oO Hani a Qe IUwIHI(2) So6r6er6e0: WILSon TgIOO7 7Y0(0)%~¢ W55lL0L30SW3Y13N0IMI[NDT| -- T swory | ISVIIIY VAN WI WWH0S 6DLLOS amI | b i - " `P90 NANL OPN "QLA NBHL 8GR NUHL 06N OLN `9N AL ONT 02N 138V SiSIN3I9vNAGoI¥WdOD ONYJALOLNISNNOIZSD 21ILNuIiSWGIQN3O33IN0a3nYe FOIV'IIDIAVSHIO SIO ALINLSOALIINT WOs IONWYO OL NIVAID 3MOBNVVidAIITSBAWSISSY3aY SININCIWOD SINL INOILAYD § A JAIMGMNY K1O3'LFYNIHXS0YSIdVdAYVS3007 £ 5837084 W331lv0 B33gus NMxOeHvSw [3] E SS331010327d Ad33d ONNYMONOSN HJSAYIOMM ILAVIINLdYONWdIaXy OSwuIvSwY [] £2 38 TIYHS HI9NTI Qv3T wnwixww 3] 9°5 38 MWHS IMDIIH LNINOGWOD whwirsw [7) 03493¢5 Z9MFIUO SSFWA S2UON ol -~ 12/714/83 PART NUMBER REV 2234243-5001 0 ITEM. QUANTITY, 00234 0026 00001.000 6026A 0029 ©000.000 00294 0029R 0030 00000.000 0030A 00308 0031 00000. 200 00314 oo31B 0032 00000.000 00324 00328 0033 00000.000 00334 00338 List of Materials NESCRIPTION....« 256/512K RAM E AIN BRD)-AUTN-INSFRT COMPONENT.. DESCRIPTI(Ncececcesassonavasccsscnssscss UM 0972946~ 0045 2210631-0001 2210689-0001 2210704~ 0001 2210649-0001 2210695-0001 C40 qQrL -M39003/1-2304 V*VV*RV#V*V*VVSRVV*«V*1SI1ITSMEETTMME---MA--------CCCC0FS00AEAAALLLLLLLLL,LLL,,,YYYYIIITIILIIIIIILLL.SSESSSSSSSSSS55FTTIII5RTTTTTTTTTTTT12I1ITTBTBBB2N---------X--4-E-2E2EEFEE8AM1LLLLLLLLLMM,L150T5SSS5SSS5SDS,,,UODUUUE2221127T27U120QS9SSSRR52222A228444A8#8UUEE-0EET19AA111550L0A0ADD0DDBWWLTDIIIOTNNAODAAAGGSSSSHBNBBBBBBBBIMUUUBBUUUNBUUUTDFSRUUURERRRERRRDLAAAANRRRMNNNN-NNNNNILLL=NNNS-----S--/PT-T--T-BTITIIHITEI-TIEIEEUX#NNNNNONNMVNNNFRR8FRTELNNFN.NOFAAA2RPTTT5EEEPAWWW R//IP3CTS~AYESPTTBAOGTNFE&N/FCCLIOHRLUKMTPY EA EA EA A VVV#V*1«M----CTAOLLLL,YIIII1SSSS5ITTTT2TB----4EELMLL15SS55,U22210S#4442CE1555T5D1AL ASBRRUAUBRURAUMRNL=SN--T-,TITEXNNNRCNIAVTEER,®3ST.OUTPUT BURN-IN EA 5-183 12/714/83 PART NUMBER RFV 2234243-5001 0 ITEM, QUANTITY, 0010 00001.000 00104 oottt 0C001.000 00114 0012 00003.000 00124 0013 N0002.000 00134 0014 00036.000 00144 00148 0014C 00140 0014E 0014F 0016 00003.000 00164 0017 00001.000 00174 ools 00001.000 oo184 0021 00024.000 00214 00218 0021C 00210 0022 00019.000 00224 0022R 0022¢C 0023 00001.000 List of Materials NESCRIPTIONccesccoosvcscovscssnncsacaces 256/ 512K RAM EXP.{MAIN BRD)}-AUTO-INSFRT COMPONENT.. DESCRIPTIONceccscscasvensensscccnsscccca UM 0996422-0001 0996 755-0001 2220360-0002 0972141-0062 2211118-0004 0972946-0065 0972946-0113 0972946-0110 0972763-0025 0972763-0013 0972924-0018 1Cy SNT4LS125N 001295-SN74LS125N EA ur 001295-SNT4L S125N TCs SNT4L S245N BUS XCVR TRANSITION FA 001295-SN74LS245N us 001295-SN74L5245N IC, NCTAL DRAM DRIVER, 3-STATE NUTPUTS EA SEE TI- DRAWING U, UL, UL SEE TI- DRAWING NETHWORK yRESISTOR 6.8K OHMS SEE = T1 DRAWTING 2% 14 PIN EA ur2,u1s3 SEE = T1 DRAWING TC»64X-BIT DYNAMIC RAM,150NS TA/RNW TMS 416-4-15NL EA U20,U21,1122,U23,124,125, THS&16-4~15NL u26,u27,U28,U30,U31,U32, THS416~4=-15NL U33,U34,U35,U36,U37,U38, TMS416-4-15N1 U40,U41,U42,U43,U44,U4S, THMS416-4-15NL UG6,U47,U48,US0,USL,US52, TMS 41 6-~4-15NL US3,U54,1155,U56,057,US8 TMS416-6-15NL < RES FIX 1.0K OHM ST .25 W CARBON FILM ROH = R=25 £8 R24sR44RE ROH =25 \ RES FIX 100K OHM S % .25 W CARRON FILM ROH EER=25 £A R1 ROH ~ R=-25 RES FIX 75 K OHM 5 % .25 W CARRON FILM ROH = R=25 FA R3 ROH = R=25 CAPACTTOR,.10UF SOV FX,CERAMIC DIFL FA CO3R4C4C,AC-5C,OC36745CU71,0C4780,5C09A,C10, COR CA-C0375U1042050A CO1R1,0C1A2-,CCO123Z,SCU1L4N,4CZ10S50,AC16, CCO41R27,,CCC41A38-,,CCC0413497,,5C£U621500,4C720510,AC41, COR CA-CO3Z5U104Z050A CAP,FIXED .O10UF SO VOLTS 004222-MC105E1032 FA C2,4C22,023,4024,C25,C26, 004222-MC105E1032 002472,2022-8M,C012095,EC13003,2C31,C32, 003432,2C23-44,C01305S,EC13063,7C37,C38,C39 CAP FIX TANT SOLID 6.8 MFD 10 % 35 VOLT FA QPL =M39003/1-2304 5-182 12/714/93 PART NUMBER REV 2234243-0001 D ITEM. 0002 0006 0¥00010564 00154 0019 QUANTITY. REF 00001.000 00002.000 00001.000 00194 0024 0025 0027 0028 0034 0999 REF REF 00001.000 00002.000 REF 00001.000 List of Materials DESCRIPTIONGcossosovssocsccssacossnsscns 256/512K RAM EXPANSION (MAIN BOARD) COMPONENT.. 2234245-0001 2210293-0003 2210970-0005 0972927-0034 09943969901 2219301-0001 2234297-0001 0085936-0017 2237300-0001 2234243-5001 DESCRIPTIONeccccscccsccsccocsccscsssosce UM DIA,LOGIC,DETAILED,256/512K RAM EXP £A uCcCSSISSSS13AOEEDEEEEyPEEPEFEEENRLNOA9.YC2TTFTTTTEIIIIIII~D-X-----M2UO2RO-EDDDDDMDU,PIRRRRRRLSC0AAAAAAEAISWWWWWW,T.IIIIIIE,NNNNNN5GPGGGGG0TC0A&VPP8DE0A2D,T0,E0 3NS RISE TIME MAX® | SINGLE ROM,.100 CNT PF 5 % CODE SERTALTZATION EA EA EA EA SPEC,HDLG,EC SENSITIVE PARTS AND ASSYS A SOU1PSPE6EHYT7CEIL8IOE4FNT2I9=CAP.1TL7#2-AS10ETI0-EO04,NB6F,AXURNPRIEATLNSIOTODENSTX-.R12AM8%76/SL1G2KFALYATNEGE PW8 EA A EA 256/512K RAM EXP.(MAIN BRD)-AUTO-INSERT A 1287-5243-002 12/14/83 PART NUMBER REV 2234263-5001 0 ITEM. QUANTITY. 0001 00001.000 0003 00001.000 00034 0004 00001,000 00044 0005 00000.000 0005 A 0007 00001.000 00074 0008 00001.000 00084 0009 00001.000 00094 ¢ DESCRIPTIONses evcsossccnne 256/512K RAM EXP.(MAIN BRD COMPONENT. e 72342440001 2220645-0001 2223234-0001 2211984-0011 0972810-0001 0972900-7474 0972811-0001 DESCRIPTTONccescccscssccsacsscncocsocsse UM PWB,256/512K RAM EXPANSTON A uv*SS1SS1tzEEEEHA2N2I1EEEEA55LCECL44,TT,,--DEDWTTTTMYMROIIIINEPNR----AMAAKMOLT-IR1DEDSCDDY6RRNRRR--AAAAT004WWWW4C00MFNIIII00LOOECNNNNRSNMGGGG2TO2RRIYO1TLNEMCOANR&TRARYOLLER FA EA 50 £A A us NETHORK SNT4LST4N EA us | NETHORK-SNT4LS280N EA 3 5-181 | w| z WY- Y er=2ve2z W2IG/952 19999e0A120 ASVNIS - = o M Z SNLLTNIoo S5 ].,sveny BP[THT0R57 T~ A ..E._ 010 W0 BT NOLL 13530 1YISNI-OINY ((RQIIVVOOGF MNIIvVWH)) NNOOIISSIN-YYIaXXIT WMV NX22II5571995522 || 11A000I05G0W--O6N9p2e9r16eA2a%2z Te ece@ Joworesa i s _ coce[99oezzeezlzlz] |- 1T IINXPSIVTvvTl #[e+] roo0--,sezoezz NI 2121318] s000- vozeeez HT=l wvaovia] 8Md]| 381 1(000000~-§9piZzpiEp2i2z__ATOH2I1S9S07Y] =l Q7| 1000-sc88r22 gmg| _h... sclaeiel (1 4[31000-cv2e622 x781v355Y e s woote 13437 w0A3Y¥ VAN A8 ! i e e S 3S 0705 JAYM nlicol ez-l o'¢fis Lvd) #79 ¥0T102 08 'L9H | 10 | 10-206 s .. L sas e [wdVW | & £ [ i3 g e o100 s2'0 THVHHDINT _NOTSIIwAwNGD 5-180 A | ev s s [PR20 TRWB (B9 BISHI | 4 F97FP| 8- 07 -7W[3V807T60E720T3 D3UlAve IGCIIPISILIIUGDNDI| 3 S B g il Qe $3G O2xdaN 42 200 S e 27] 138 0300w `o1 - 3PP2.6 SYM 87 WILl wit|a 100G S¥M, NS 12 IW5NI6RL31R5040Q1)0L#W2LTLO2G10000N7D51~90 1 FIH] vveer " Frd[f131@0052-f503120y035ui8t[n@)] Y| FSvI o732y I3y gy 0TPv? WNI2 O0Se s L Obacaar | | o 1 ITIETETAE --actw [ Ion ] f_..\ v oo B S e e 028 ATBWISSY Sii NO GISh 1ON 89D 9 a;)RMTsNi 385 5% QIH3I8%N0ISYniSiI oIuNnIsSsYNIoVSnkHoIAL0I0TL03%wSt QOULNNvYI1NSOo`JOHWNIIO5OD3NN1O3YSNIHVLOLIuNY3SI]WGO3INoNYwOMIvAdT`EOW0LILSYS¥TYITJAOYSiLHA13IIOSNNNOYSIHLIASuYIYDO S wun arai ST #W2_pWe31u1an4=34TeNiMSOSdNIeS20-¥o3dY1n0Is0OHDNMY A0'TCILHYIWYIHXIOYNUAYYY I1V0/3LIS NuvK (3] s 2 o Vo Wi ouaav) @ £°2 38 TIYHS HLINIT OYI HONIXYR E 9°6 38 TIVHS LHDIIH ININOIHOD HANIXYR [1] v T s I ° OIROISS ITMIILO SSITN SILON ¢ i 2 ' - 12714783 PART MUMBER REV 2232403-5001 M ITEM. 02014 QUANTTITY, 0202 00000.000 02024 0203 00000.000 02034 0204 00000.000 02044 D206 00000.000 02064 0207 00000.000 0207A 0208 00000.000 02084 0209 00000.000 02094 0210 00000.000 0210A 0211 00000.000 02114 0212 00000.000 02124 0213 00000.000 02134 0214 00000.000 02144 List of Materials DESCRIPTION veeseessccsvsvccossossssssasse TELEPHONE ELECTRONICS-AUTO INSFRTED COMPONENT.. 2210600-0001 2210604-0001 2210606-0001 2210631-0001 2210636-0001 2210644-0001 2210649-0001 2210752-0001 2210665-0001 2210718-0001 2210651-0001 2210663-0001 DESCRIPTIONccocecsovecsvesoccessscsccsns UM I**VV*VV*VVV*VVV#V**V#VVV*VVVVVVVV*V*V*C-#SS--S-I--SS--#*----1-S-=-1«S----I1«S---1--III1,I11SLLLSSUULUCLUULLLLCLLSLULLLCSCULCLLLCCCULLLLLCCLCUIIUUI,ABIB,UIBBIIIIU,II1B,III,,,,BIIIIBIII,II,S,BSSBBLSILBSSBSSLSSSLSSSSLLLSSSS$SSSSSSLSSSSSSSLSL0STTSSSSSSST$STTTTSSTTT5TTTT1TTTTTTT$TTTTSTTTTTTSTT-~TT4TTT1117-118II--III--3---IS--3---5I-I--------I1-IIII-653402L5TT5TTL36T0LL5TLL0LLLLLTT1LLLLLLLLTLTTLTTL182,95,S7,UU81UUSUSS01USSS5SSUSU5SSSSSSS5¢USUUSUUS,,N,,,,41,1TT3TT,3T113T31HBT1111T080O0T72T10TT1TTCSUQQH0Q-6Q3EQEE3EE6E633E65E020SE85E0&823444EE5E4EOYEAUUUUBXU1-U712789592585XNLAAAAIAIACDDLDTDDNFFFFFFBBFFFFFFF,I,POOOOOOOOUOOOOOUBD22NURRRRRRRRRRRRRRURB-BBB4BB2BB2BB-BJBBBVTBMBBNSNKU-U-BI-UUUUUUUUBBBBUIUUEUBBUAU-UFS-BULRUUUUNIRRRRRRUURRRNRPRTRRGRRLIIIIIIIIIIIIIIIRRRRRIRRNPINNNNNNNNNNPNNTNNNNNTTTTTITTTTTNTTFDTNTNNNNNNNNNU-P-------U~---E-EEEE--EE-IEEEEEPAEE~RL----B--ETUIIIIIIIITMIIIMMMMIRMMMIIIMMMIMTMNI-IIITIIIIUTNNNNNNNNNNNNSNNNNDNUNNNNFNNVFP3BDELF-I3T43343333N2AE22R2EOF7O561030N2687N5AGNSRPLADNAAORDTN1CPYFD-4OWWL,M//ISP3PWCNCSA-/NEHERSPTTMATS,ITEADDTTOITSTRR£E,IC£NLDCTVRLRUCRITLGRPOGUU ) EA A A EA A EA EA FA EA EA EA EA 5-179 N - T P 12714783 PART NUMBER REV 2232403-5001 N ITEM, QUANTITY, 00750 0077 00001.000 00774 0078 00003,000 0078A 0079 00012.000 00794 00793 0080 00001.000 0080A 0081 00001.000 00814 0082 00006,000 00824A 0087 00002.000 0087A 0089 00001.000 00894 0090 00001.000 00904 0091 00002,000 00914A 0092 00924 00001.000 0093 00001,000 00934 0094 00001.000 00944 0140 00001,009 01404 0201 00000.000 List of Materials DTEELSECPRHIOPNTEIONE.LcEeCcToRvOvNeIvCcSc-sAsUnTsOrsnIcNsSsEsRsTsEnDscoce COMPONENT.. DESCRIPTION.sescessoncccesvvssncaccssoes UM R53,R74,R75,RI1,R106,8R4 1658~ =000 0539370-0359 RESISTOR,536 OHMS .25W 1% FIXLD,FILM EA R112 0972946-0105 0972946-0113 0972946-0087 0972454-0002 0972932-0001 0539370-0481 0972946-0137 0972947-0089 0972946-0101 0972946-0117 0972946-0153 0539370-0364 0972946-0129 2210695-0001 RES FIX 47 K OHM S % .25 W CARBON FILM FA ROH - R=25 b R76,R102,R114 ROH ~ R=25 RES FIX 100K DHM 5 % .25 W CARBNN FILM EA ROH - R-25 RA, R714RT24RT7,R79,RBO,RB6y ROH - R-25 RAT,R88,RIT,R104,R113 ROH - R-25 RFS FIX 8.2K OHM S % .25 W CARBON FILM A ROH k=25 R95 ROH - R-2S DIODE,1NT18A 15V S¥ SIL VLT REG ~1M718A FA CR8 ~1N718A DIODE 1N914R SEE TI- DRAWING EA CR2,CR3,CR&,CR5,CRI,CR1L SEE TI- DRAWING RES FIX FILM 10.0K OHM 1% .25 WATY FA COR ~NAS5D-100PPM/C R49,R96 - COR =NASS0-100PPN/C RRRRRRROO[E8O1HHSS3H08 FIXFIX-- R1-.205M R1R0--5250K DHM DHM 5 T .25 ST .5 W W i CARBON FILM CARBON FILM FA EA ROH « R-50 CRnRSRRRSRRCROR71OEEEOOOAFER8HEF0SHHSHS5R1,ERSFTTFF1III{IIX0S--XX-----9TOPRDNDFRRR31-AIR3--R-52SL22A20A5SFM55K5WW1KIIXNN.6GNOG0HH6¥M4. 5 S % .25 W CARRON ¥ .25 W CARBON TMFG-01H1/M74SH,5 DOHM 13 .25 WATT FILM FILM 4 EA FA EA FA R111 cnr - NASS PES FIX 470K OHM 5 X .25 W CARBON FILM EA UL = R-25 R103 " ROH - R-25 IC,1L5245,0CTAL BUS,XCIVER,3ST,.IUTPUT EA V-L IST-LS245 BURN-IN 5-178 12/714/83 PART NUMBER REV 2232403-5001 M ITEM, QUANTITY. 00574 0058 00003.000 00584 0061 00002,000 00614 0062 00003,000 00624 0063 00002.000 00634 0065 00002,000 00654 0066 20003.000 0066A 0068 00003.000 00684 0069 00003.000 00694 0070 00T0A 00006.000 0071 00003.000 0071A 0072 00006.000 00724 0073 00001.000 00734 0074 00001.000 00744 0075 00024,000 007SA 00758 0075C List of Materials DESCRIPTIONccacsvssccacccncncscconcocncs TELEPHONE ELEC TRONICS-AUTO INSERTED COMPOMENT.. OESCRIPTIONccccccecrcsssscsccccsacacaccs UM C84C53+C58,C6T7,LT1,C72,C73 COR CA-C0225VU1022100A 0972763-0013 CAP,FIXED .O010UF SO VOLTS FA 004222-MC105E1032 374050,C66 004222-MC105E1032 0972946-0017 0972946-0082 0972946-0099 0972946-0034 0972946-0051 0972946-0061 0972946-0065 0972946-0073 0972946-0079 09729460081 0972946-0091 0972966-0027 0972946-0089 RRRRRRRRRRRRRRRRRRRRRRRRRRRRRR RRRRRRRRRRRRRRRRRRR1111EREOREOOOOEOOE2R1OE4EE3O5OOOOOOOOEE15OOSOO41OOO16363966EEESHSSHHHHS6SHHSHSHSS7HHHHHHHHSSHM4HH,HHH10,455SSS5518581S67R81,R888T,,,=47+,,R-4-y-R4RR"FFRFFFFRFFFFFF3RRFRS,6I3IR92IIII6IIIII&I3IS6SRXXTXXXXX969XXXXX69X281=-------------=---=--1=--~,,3, ,,,4R,R,R1RRRRR2RRRSRRRRR6RRRR52RRR3RR4RRR2R4112RR11R5673.=----=.===--872R ---=-1=-4.7-==---0.,010T926-2222220012222T22..3222229.~22222220~--0,T20047S-55S55-K55055055550K0S550555555KKK,5K00K6 0,K00o0R000RR0RR3O6IOOOO&OONO4OOOO04HHHEHH8HHHH2HHHH1,MMMMY,MMMMBMMMM,,R, yRR3RR4955S55BS5SS5552$SSR 30%T%2,,,,4R%TT¥XR%%XR6 RG3..R1.312.26S..2.....1..,05522522222222,2-0S555,5555555 W,CARBON W CARBON W CARBON W.CARBON W CARBON W CARBON # CA"¥RBON W CARBON W CARBON W CARBON W CARBON W.CARBON W CARBON FILM FILM FILM FILM FILM FILM FELM FILM FILM FILM FILM FILM FILM A A EA EA EA EA FA FA £A EA A EA £A 6177 12/14/ 83 PART NUMBER REV 2232403-5001 M ITEM. 0038A QUANTITY, 0039 00001.000 00394 0040 00001 .000 00404 00408 0040C 0041 00001.000 00414 0042 00001.000 00424A 0043 00002.000 0043A 0045 00001.000 00454 0046 00002.000 00464 0049 00001.000 00494 0054 0C001.000 00544 0056 00029.000 00564 00568 0056C 00560 0056E 0057 00007.000 List of Materials DESCRIPTIONesevovescssocavsacnascccosans TELEPHONE ELECTRONICS-AUTO INSERTED COMPONENT.. 2221005-0001 0972686-0002 DESCRIPTIONcceccccssosscaccsscsscssveces UM u32 SEE TI- DRAWING 1C+MOS,QUAD 2-TNPUT AND GATE 14PIN PLSTC SEE TI- NRAWING EA us SFE TI- DRAWING NETHORK SN74LS158N EA u22 *ITEM 216(P/N 2210663-1}1S *AN ACCEPTABLE SURSTITUTE 2221069-0001 1C,MOS QUAD,2~INPUT, 14PIN NOR GATE EA SEE TI- DRAWING uar SEE TI- ORAWING 0972757-0041 CAP,FIX,CERAMIC, 33 PF, 50 V, 10T EA 007115-SFE TI DWG c35 007115~-SFE TI DHG 0972757-0021 CAP,y FIX, 470O0 PF, 50 V, 10% EA C3.C28 0972763-0029 CAP ,22MF,50V,+80,-202 FIX AXTAL LEAD EA SEE TI- DRAWING 31 SEE TI- DPAWING 0972757-0043 CAPACITOR, 15PF ¢10%,50WVDC, CERAMIC EA SEE TI- DRAWING C1,C2 SFE TI- DRAWING - 0972757-0019 CAP,FIXED CER 3300PF 10% 50V EA 36 0972763-0021 CAP, FIXED,AXTAL LEAD, .047 UF,480%,-20% EA 1632-0000-000 c21 1632-0000-000 0972763-0025 CAPACITOP,.10UF SOV FX,CERAMIC DIEL EA COR CA-C03Z5U1047050A 5,C6,07,9,C13,C19,C23, COR CA-CO3Z5U1042050A 24,025,026,4(29,C30,C31, COR CA-CO275U1042050A C424C43,4C444C45,C46,C4T, COR CA-CN375U104Z050A C489C49,C51,C52,£54,C55, COR CA-0325U10420504A C564C5T75CT74,4CT5 COR CA-C032I5U1042050A 0972763-0001 CAPACITOR, .001UF 50V FX CFRAMIC DIEL EA COR CA-CO02Z5U1027100A 5-176 12714783 PART NUMBER REV 2232403-5001 M ITEM. QUANTITY, 00308 0030C 0031 00001.000 00314 00318 0031C 0032 00001.000 00324 00328 0032¢C 0033 00001.000 00334 00338 0033C 0034 00001.000 00344A 00348 0034C 0035 00003.000 00354 00358 0035C 0036 00002.000 0036A 00368 0036C 0037 00001.000 00374 00378 0037C 0038 00001,000 List of Materials DESCRIPTIONcevoccsocsancsscvossoncsscncs TELEPHONE ELECTROMICS-AUTO INSERTED COMPONENT. o DESCRIPTION.cececccoccsvacccasrssccncane UM *ITEM 206(P/N 2210631-1)1S *AN ACCEPTABLE SUBSTITUTE 0972815-0001 NFTWORK-SNT4LS85N A u9 *ITEM 207(P/N 2210636-111S *AN ACCEPTABLF SURSTITUTE 0972900-7109 NETHORK SN74LS 109N A 0000-0000-000 u10 0000-0000-000 *ITEM 208(P/N 2210644~1}1S 0000-0000-000 *AN ACCEPTABLE SUBSTITUTE 0000-0000-000 0996422-0001 1C ¢ SNT4LS125N EA 001295-SNT4LS125N us 001 295-SNTST42L5N *ITFM 209(P/N 2210649-1}1S 001295-5N74LS125N *AN ACCEPTABLE SUBSTITUTE 001295-SN74L5125N 0219402-7133 NETHORK SN74S133N EA > 0000~0000-000 139 0000-0000-000 #ITEM 210(P/N 2210752-1}1S 0000-0000-000 *®*AN ACCEPTABLE SUBSTITUTE 0000-0000-000 0972669-0003 1Cy SYNCHRONOUS 4 BIT SN74LS161IN A T1 -SNT4LS161IN U12,U13,Ul4 T1 ~SNT4LS1 61N *ITEM 211(P/N 2210665-1)1S Tl =SN74LS161IN *AN ACCEPTABLE SUBSTITUTE T ~SNT4LS161IN 0972787-0003 NETWORK SM74LS36TMH FA U3l,uls *]TEM 212(P/N 2210718-111S *AN ACCEPTABLE SUBSTITUTE 0972782-0001 NFTWORK SN74LS132N EA Tt ~SNT4LSL32N u7 Tl =SNT4LS132N SITEM 213(P/N 2210651-111S Tr -SN74LS132N *AN ACCEPTABLE SUBSTITUTE Tt -SN74L5132N 2221082-0001 1, CMOS ,RUFFER,HEXy P-CHANNEL ,OPEN DRAIN EA SEE TI- DRAWING 5-175 12/14/83 PARY NUMBER REV 2232403~5001 M ITEM. 00194 0020 00204 002t 00214 0022 00224 0023 00234 0024 00244 0025 00254 00258 QUANTITY, 00003.000 C0001.000 00091.000 00002.000 00001.000 00001.000 0025C 0026 00264 00268 0026C 0027 00274 00278 0027¢C 0028 00284 00288 0028¢ 0029 00294 0030 0030A N0001.000 00002.000 00001,000 00001.000 00005.000 List of Materials DESCRIPTION.cooesee TELEPHOME ELECTRONI esescassoccsccsss UTO INSERTED COMPONENT,, 2221100-0001 2220999-0001 2221098-0001 2221099-0001 2221247-0001 0996755-0001 L 0972900-7400 0972900-7406 DESCRIPTINMicovecsvoosceoscoscsccscssncsae UM ICSUSUEE,32EE3M8,0,UUSTT321,I4--9,DUFND3CRR0NAANWWEIIPNNGG EA SEIFC,D¥-IT-YPFDRAQWUIANNG FLIP-FLOP,16-PIN PL PKG EA uyuSSSSu00SSSSu0*2EEEEaEEE2E220I0IIII0sEFEEEErE1E3CTCC1C11,,E,,,222DSMuMS999TTTTTTTT-I2OH5iI15IIIII5TNsST------~---Y-G,42SPLSSNL0ENENHCS1DDDNDDDNTTTT2(RRRRRRRR4A444PAAAAAAAAOLL8LL5/WWWWWWWWC-SNNSIIIIIIIITB2NSN2NNNNNNAID2GGG4GGGGL4GT6-5B525TUN2NNSYF1SPFL0ER6IX9PC5V-LSR-FAH1LIT)FNCT1TPHRS/EAMSNRU,SGLI2TTT0RII-,VOP1NII4AN-R,PAPITLNIPRKGPL A EA EA EA 0NU«11AlE02NT13W32N-9AR75CK5-C6SE4NPS-TTM0A4T0BL40LSLF2S4O5ONSNUBSTITUTF * EA «11I22T33E33M--77552660442--(00P00/00N 2210600-1}1S g, *1MA2NE3T3W-OAR7CK5C6E4PS-TN0AT0B40LLESO4&SMURSTITUTE EA uz,u3 *ITEM 203{P/N 2210604-1)15 *AN ACCFPTABLE SUBSTITUTE 0972749-0001 NETWOPK, SN74LSOBN EA us *1TEM 204(P/N 2210606-1)1S *AN ACCEPTABLE SUBSTITUTE 2221239-0001 1CUS6E,E TRTI1-PLEDRANWAINDNG GATES,3 INP.UTS,FAST FMLY EA 0972900-7474 SNFFETWOTRIK- DSRHA7W4ILNSGT4M ? FA U16,Ul7,U18,U19,U20 5-174 12714/83 PART NUMBER REV 2232403-0001 M ITEM, QUANTITY, 0142 00003.000 0142A 0143 00002.000 0143A 0146 00000.100 0145 00000.300 0148 00001.000 List of Materials DESCRIPTION: cososcveencosnssscsncosnscose TELEPHONE ELECTRONICS COMPONENT.. DNESCRIPTIOMcoesecoconcccccoscconccscnnce UM 2211348-0002 HEADER,1-ROW 2-P0S,100 CENTER GOLD EA SEE TI- DRAWING 22-23,E1-E104 E8-E9 SEE TI- DRAWING 2211348-0003 HEADER » | ~R(W,3~-P0.S1,00 CENTERS ,GOLD EA SEE TI- DRAWING E13-E2-E16,E24-E25-E26 SEE TI- DRAWING 0410499-0009 INSULATION,SLEEVING #16 NATURAL FT qQPL - MIL~-1-22129 0410499-0012 INSULATION SLEEVING, TEFLON #10 NATURAL FT 2234295-0001 LABFL,FCC APPROVAL - SPFECH PwWR EA SEF TI- DRAWING 12714/ 83 PART NUMBER REV 2232403-5001 M I1TEM. 0001 0003 R00000073A 00074 0010 00104 0011 00114 0014 00144 0016 00164 0017 00174 0018 00184 0019 QUANTITY, 00001.000 00001.000 00001.000 00001.000 00001.000 00002.000 00001.000 00001.000 00001.000 . ; 00002.000 DESCRIPTINN evosecroorevsccacessnsssnces TELEPHONE ELECTRONICS-AUTO INSECRTED COMPONENT., 2232404-0001 2221071-0001 ?2211781-0001 2221075-0002 2221150-0001 2210594-0002 0996304-0001 221107; 7-0001 0996437-0001 2221063-0001 DESCPIPTIONcessocovrcccccconcecocccances UM ICuuVSU1SSSSSSIS[,Is44FsEEEPEEEECO2CC932EsEEE,EECEEH,P5oWH4T8BM=N~,TTTMTTTTTNA-,RSII1IIIIIKSM0PCI--------SPE0TOOLE2U,BCI0PDDDDDDDDD9HF-TR.RRRRRRRMNI0MA3AAAAAAA,UFF0WW0WWWWWWLPR0II0IIIIIITI,NN0NNNNNNIGRTGGGVGGGGGGPNEYLNCJIF.FFI,ERBS5TAGOVC-ELK,IMAD6NEAT2PRCI~5UA,ONTT.NW,O5i ,,R%10<L10O8L0PWITI-NNCN,TO4RISP,SOLEPNALWSSTTICC £A FEA FA EA EA EA U4T,U48 IC,LM306,AMPL,PHR ,AUDTO EA u3s 0u0SuSI3E3EI00ICsEsF,CC11,,22AS99LTTNN5511MA7----3L53OSS49GNN6D,D773RR855AASP44WWBW66IIUI33NNRTD8BGGNCUPP-AHLI,N18PYEQURAIADPNHAELDROIAGFLF. COMPARATOR POS & DRIVE SIG.RNG,PL, EA EA EA SEE TI- DRAWING 5-173 12714783 PART NUMBER REV 2232403-0001 M ITENM. 01084 QUANTITY, o109 01094 00001.000 o110 00001.000 01104 o111 00091.000 ol114 o113 01134 00001.000 o118 00001.000 01184 0124 00003.000 01244 0125 AR 0126 AR 0127 AR o128 AR 0129 AR 0130 AR 0131 AR 0132 REF 0136 01364 00001.000 0137 00002,000 0138 00001.000 0l38A 0139 00001.000 0141 00001.000 List of Materials DESCRIPTIONcsecccoososcnnssssssssvaccans TELEPHONE ELEC TRONICS COMPONENT,. DNESCRIPTIOM.ceeccccscsncccnnascossssasas UM Jé SEE YI- DRAWING 0972594-0005 SWITCH,ROCKER-PWB MNUNTED 023880-900128 FA Sl 023880-900128 2221073-0001 CONN.FLANGED THREADFED PLUG,3-P0S,AUNTO SEE TI- DRAWING EA P13 SEE T1- DRAWING 2221130-0001 CONNECTOR, JACK SEF TI- DRAWING EA Ja SEE TI- DRAWING 2221079-0001 AUDIO INTCOM CPLG XFMR,900/600 0OHM,90MA EA 2232385-0001 0185113-0001 TCSSPX111EEA122EE2B55SL44PE~-ATTCII-E-ARSSODYR=R=XA0SA0T0W0WS00IIPNNETGGAO-K1E8R-SCPAESEECH £A EA *® - ** INSTAL=L UNDER Q4,C11,C12 0417836-5099 0417836-5199 0417836-5299 0417836-5399 0417836-5499 0417836-5599 0417836-5699 2219301-0001 uUuUuWUutLLLLLWWLWWWWISIIIIIIRPRRRRRREEEEEEEEC,#N######2222222D-------4446444LAAAAAAAGPPPPPPP,PPPPPPPWWWWWWWERRRRRRRHHHHHHHCOOOOOOOTTTTTTTVVVVVVV///////FEEEEEEYGBBROBDDDDSDDDELRRERLELKNNDGUNSITIVE IPVC 1 SLD CND 1PVC IPVC 1 1 SSLLDDP CND CND IPVC IPVC » 1 1 SLD SLD CND CND IPVC 1 SLD CND IPVC 1 SLD CND PARTS AND ASSYS FT FT FT FT FV FY FY FA 2210188-0016 0085936-0017 2210188-0018 USSXSXSEFEEUUSSEHEYF44ONE10CCLFKKTTTTEETT~---,,111.DN1#II25DDDPP1ERRR,,-AAA424WWW04B6III--ANNNPRPGGGRIIFNHLS,,LLO0OWDW PROFILE X.1A7 LG PRAFILF FLANGE EA £A EA SEE T -1 DRAWING 2211540-0001 FOAM, .35X.50X.05,PNLY, ADHESIVE BACKED FA SEE TI- DRAWING 2232403-5001 TELEPHONE ELECTRONICS-AUTD ENSERTFD EA 1254-3403-008 5-172 12714783 PART NUMBER REV 2232403-0001 M ITEM, QUANTITY, 0060 00001,000 00604 0064 00001.000 0064A 0067 00674 00001.000 0076 00001.000 0076A 0083 00003.000 0083A 0084 00001.000 0084A 0085 00001.000 00854 0086 00001.000 0086 A : 0096 00004.000 0098 REF 0101 REF 0102 00001.000 0102A 0103 00001.000 0104 01044 00001.000 0105 00001.000 01054 0106 00001.000 0106A o107 00001.000 01074 0108 00001.000 List of Materials DESCRIPTIONccoscasssosccccssncccocsscces TELEPHONE ELEC TRONTCS COMPOMENT.. DESCRIPTION eccesencscocccsosscncsannass UM 2210449-0002 0972946-0041 2210996~-0011 09729460097 0972934-0003 0972138-0001 0972537-0003 0972537-0002 0972487-0001 0994196-9901 OSC MODULE yCRYSTAL,4.096 MHZ,.01% FA SEE TI- DRAWING Y2 SEE TI- DRAWING RES FIX 100 OHM 5 ¥ .25 W CARBON FILM EA ROH =SUR=2S R89 ROH - R-25 RES,VAR,20,000 OHMS +-10% TOL. 1 TURN EA SEE YI- NRAWING R11S SEE TI~- DRAWING RES FIX 22 K OHM S X .25 W CARBON FILM A ROH - R-25 R90O ROH - R=25 DIDNE,INT4BA 3.9 V 5% SIL VOLT REG EA T =IN7648A CR6¢CRT,CR13 TI -IN748A DIODE,TRIGGER DIAC EA SEE TI- DRAWING CR1 SEE TI- DRAWING DIODE,LED RED RT ANGLE A 072619-550-0406 Cr10 072619-550-0406 DIODE,LED GREEN RY ANGLE EA 072619-550~-0206 * CR12 072619-550-0206 JUMPER PLUG,CONNECTNR BLACK EA 5935-0900-000 ~ PROCENURE,STTE DATE CODE SERTALIZATION EA 2234242-0001 UNIT TEST SPEC, TELEPHONE A 2210841-0011 2234252-0001 2210841-0017 2210841-0021 2221458-0002 2211483-0002 2211483-0003 CONyNC, ARD EDGE 100"CTR,1-ROW,12CONT. A SEE TI- DRAWING J3 SEE TI- DRAWING PLATF, SPEECH OPTION FA 1678-4252-002 CONN. CARD EDGE,1-ROW,18 CONTACTS,.100%C A EEE TT- DRAWING SEE TI- DRAWING CONN, CARD FDGEy¢1-ROW,22 CNAMNTACTS,.100"C EA SEE T1- DRAWING J2 SEE TI- NRAWING : AUDIO JACK,VERTICAL,.14" DIA,SOLDER LUG EA SEE TI1- DRAWING Pls SEE TI- DRAWING JACK, TELEPHONE, 6-CIRCUIT MNDULAR A SEE TI- DRAWING J5 SEE TI- ORAWING JACK, TELEPHONE EA SEF TI- DRAWING 517 12/14/83 PART NUMBER REV 2232403-0001 M ITEM, QUANTITY, 0002 REF 0004 00002.000 0004A 0005 00001.000 0005A 2008 00001.000 00084 0009 00001.000 00094 0012 00003.000 0012A 0013 00001.000 0013A 0015 00001.000 00154 0044 0044A 00001.000 0047 00006.000 00474 0048 00001.000 00484 0050 00005.000 00504 0051 00001.000 00514 0053 00003.000 00534 0055 00011.000 00554 0059 00001.000 00594 List of Materials PTEDLEESPCHROINPETIOENL.EsCsTsRsOoNcIsCcScossscscsoscscnsconse CNMPONENT,. 2232405-0001 2221054-0001 2221093-0001 2220425-0007 2234254-0004 2221072-0003 0972958~0001 0996938-0001L 2221243-0002 0972965-0036 2221243-0001 2220722-0028 2220722-0021 2220722~ 0040 DESCRIPTION.cceveesevvosecccccsaascscsce UM DIAGRAM LNGIC,DETAILED SPFECH,PIGGY BACK FA REL AY y ARM»A SET ALEDU , DR PDTE , 2.0 A A K1,K2 TJEIyT0T00SQuSRUSSVS1PSS1FCII43E0CsEEE1E04EEIM0A2R2E,E94lEEEEAE4E,4CI5NO5MTPQ7,4CM4S7O,,21M~R,-T1ISTTTNPTTT,I3CII4O4I3IIIS,O-0------T--22P--TL-3CSIM55RMYOHYFLC44EOCDRDSA2DN2DDDNO-TS-TCRRNTRNRNCRRRS0TI09EAA22AOAEAAANAE400LLWS9WD9WWWWWMER2C00OOI0SIE0IIIII,LNPSN5SRON5NNNNNS2,,AGAAGARGGGGGP9NFCC/0EEOPPMJ5EGIIUACALCN,HT,CRI+TOPVI1CNEOUOPNFM,,PGV1UEOFT0NLIF%,TER,PALU4GDPE0P0.VEFR,gFEASEGWXCUTLTAOLT-EO5ARD EA EA EA EA EA EA EA c38 B SFF TI- DRAWING CAP FXD 1UF,10%,50V,CERAMIC MIL =CKO6BX105K A C44C20,C224C27,C34,C40 MIL -CX06BX1 05K CAP,POLYESTER FOTL,+33UF,10%,400V SEE TI- DRAWING EA C39 SEE TI- DRAWING CAPo AL ELEC,47 UF,35 SEE TI- DRAWING V,RADIAL TERMINALS EA C14,C15,C16,C17,C32 SEF T1- DRAWING CAPACITOR,ELEC, 100UF/25V LB SERIES SEE TI~ NDRAWING EA c18 SEE TI- DRAWING CAP,AL ELEC,10 MF, SOV RADIAL TERMINALS EA C10,C11,C12 2220722-0039 CAP,AL ELEC,4.7 MF, S0V RADTAL TERMINALS EA Cal 2210835-0005 CRYSTAL, 3.579545 SEE TI- DRAWING MHZ, GND LFAD HC18/U EA Yl SEE T1- NRAWING 5-170 om 1 v | Tw2 0pP2Eee | TIIT 3NOHd373L oLIN-1], T, B vam v o ----o-- 57wwSa0OSS/zvSvsanV#WAOGA5D37LBS0(A(T0225U7y9A4N5LM508NNB1T7TIw-9S0F1W»7Wi°2QAAt70LTLiA T7LftSoS5NorI L 5OJNsWHII,0MWL1v4w>(ESD315gID1AO Ms3M1GO0GT4rI1I3d-N9VGr(CEIWF)TT S61rIeeLAir3¥I1QdI1O0Mw)p3IiFEJ18NSowI-¥SgoToOTMwvNdT2SsdWlatQ7(sseINCYa)OSBewHIV02unTN1i0IiLIOp0myEY--MTITW QINNIINDD :SAON 9e32~62Bi0o0vA7Ei22(0e T2N2a GGlICRoeOlrrLNeGSb,2WI0 HLvmiLIdoLPpG lArTnL3I:[ B Lwsi3tu7k3t7WF5OT0"n2W1 ac1NDeDO216Tn02S0s5``OABIevTleZ (3 « 5w31S \WwSWTTNpiQg(Ni1vF3e-3K382QiO&P)A(O\11N0LL0\15L.~6 S = e sior : ¢ L57A307 e SYM030607 e II1O8N1 S W32#1130}0- IN2101dPZ2LIE06300570YHSOYMOw6MO01 M¥gA0IML0I1(E¥G4O1 EKOMi)SdH]1t T ] LTHowiv Eorzeed | Se%RyTaIe = = et 2 3 3 . s | ol IIT o e srnam [ o TH--S ou- Ayuaa rD ET~ e =T BS [ 001t 00000 VSOoVeNei22TTT ufi 0% TR 2, [¥TE]iot 1v20 378 033 powt nfi30fi3] m6 T 24| s 10 . 1000-2¥2bE22 | 345 1531 1INAL NYHOVIO ONIHIM @5 = |~ lo|w|2]2is SR --lne <frbeom|n =f| --jlmlel T0DWNSR IWT83iaOA07wZi/L/rTII11ItMF3R.EL W03 o1| mousfom v0 VWI0WIBSyHlI SMIILI2E0K 133V30Y339324190WIWIS1H WIONA (520 ViIZELSE)AN#AT21v3dSWY T1W)IS&K¥D 3IVVISA KON a6y W/11005- 341 K} OMIVINOD Quy IR 6E) ML 3d6v55 AAYNDS WTINSIASKYT) SSOUIV AN H3IMAN 6 WAL T2WmL0SH)13 SSOMY DN HIMON % I923 0VaVvIS5H2I3 SSOHIY DR UIMNN % AI£L2T3 0INWyLSH22T3 SSOUN MY YIRAN %6 AL 93 I0V¥ISK63 YBMIA S| A3S1N AO0M1S L3LIVIIRDCON LtMLRILETWOAMSISHA #I0111S50HdILI8JM00S73A8It NOH0I3IN100VI0I1ISIQSNO)dHILSIY38Y OI01NO0N}SI1IH1I5IL0IdM05S38 W10031 ONY YADV"2IO553M30M8M4 U33d35 S"IHSIKMO1L3JA0U0IGSNI`9NINI15ETIN 1600 (01124T0 W3N,I Fr ] &S&2=££3g5%% »n D& i 4 /m I * o " M30) 0OLWI WT3W1ASHMI1 K0O43189n0d1 [3|A1I¥MLI11dl TKTD0I41VALSOH0!I1 SAR1<N2VN1613¥N12"9O5M0O30IN48AN110ROE2SHM3TUL73d3WLI1N0V0IR3IYSOY¥ADIH31MDI4I0VNN0O3A4BSDNYYYIANOVSI1N1AD0NYTOOB`ANREH0NII1NODSGD1DSVYIYAHWAIIY1IVLS104I4vHL3I3I1SADSO1-MBN1NH1OVS32H1D1hILI0SAT4IIV1uYdDDAy RIVUDWYIGHAYNN 66 WMI3Y1I1S YG3N4Y R3M0O0ND£S 551A3V123016¥I4LAIISOXNOYMUAK0Y% Y5350313051Y0I11¥1K531dT3MT¥OIS"LRMNNI0OONIDNOSSINAOWIJOTE43KNMOJOIASVINAIAOB1JIA3YSO1INAYIATRSYIRYXO2NBI1IS9AVS0YRY1 04vD0 J1 017MMHI9N6I0T1 Y%2T 3A8NA1IIXNYHAS 31 0BVMO1401G¥3) 1Y N3M0BJM0TDIVHSRAA0LaXVY0R8 03412345 ISWMITUO SSIWN SN | < i BEE © 5-169 12/714/83 PART NUMBER REV 2232373-5001 G ITEM. QUANTITY, 0209A 0210 00000.000 0210A 0211 00000, 000 02114 0212 00000.000 02124 0213 00000.000 02134 0214 00000.000 02144 0215 00000,000 02154 0216 00000.000 0216A 0217 00000.000 0217A List of Materials DESCRIPTION.cesosoocsosacssavoscssocncscns SPEECH ELECTRONICS, AUTO INSERTED COMPONENT.. DESCRIPTIONcsvcccccscvsocacscsansascscas 2210733~0001 2210700-0001 2210710~ 0001 2210695-0001 2210738-0001 22106 08-0001 2210741-0001 2210746-0001 *SUBSTITUTE FOR [TEM 13 V-LIST-LS125 BURN-IN IC¢ LS669,SYNC 4~BIT UP/DN BINARY CNT V-LIST-1L5669 BURN-IN *SUBSTITUTE FOR ITEM 15 V=L IST-LS669 BURN-IN 1C,15259+8-BIT ADDRESSABLE LATCHES V-LIST-15259 BURN-IN *SUBSTITUTE FOR ITEM 16 V-LIST-LS259 BURN-IN IC+L5299 8-RIT UNIVERSAL SFT REGISTER V=LIST=-LS299 RURN IN *SUBSTITUTE FOR ITEM 17 V-LIST-L5299 BURN IN 1C¢LS5245,0CTAL BUS,XCIVER,3ST.0UTPUT V-LIST=LS245 BURN-IN *SUBSTITUTE FOR ITEM 19 V-LIST-LS245 BURN-IN IC+ S044yHEX INVERTERS V-LIST=-504 BURM-TN *SUBSTITUTE FMR ITEM 21 V-LIST~-S04 BURN-IN IC+LS10, TRIPLE, 3-TNPUT NAND V=L 1IST-LS10 BURN-IN *SUBSTITUTE FOR ITEM 22 I*#VVVVC=SS-I--,LLUCULLS,1BBI11ISISSSS1S6STTTTT6,T-I-I-,=TST5TS4LR16UU1=SI14T1T-1PE2E0L-3EBBB-,UUUFF2ORORRRRNNNB3---U-AIIIRINITNNNNNTTD-PEE-MWIUONTR-22I45PNOVSEIRTTIEVREiy AND 4 V-LIST=564 BURN-IN UM A EA EA A EA EA FA EA 12714783 PART NUMBER REV 2232373-5001 G ITEM. 00314 00318 0037 00374 0038 0038A QUANTITY, 00002,000 00002.000 0039 00394 00001.000 D042 00424 00002.000 0048 00484 00005.000 0052 00524 00004.200 0201 02014 00000.000 0202 02024 00000.0C0 0203 0203A 00000.000 0204 0204A 00000.000 0205 02054 00000.000 0206 0206A 00000.000 0207 00000.000 02074 0208 00000.000 0208A 0209 00000.000 List of Materials DESCRIPT I0Nceooosocsscsscassonsnsascance SPEFCH ELECTRONICS, AUTO INSERTED COMPONFNT.. DESCRIPTINMececcooseccscccocasnscccsscee MM 2220736-0001 2220726-0001 0972924-0014% 097 2946~-0034 0972946-0082 0972763-0001 2210600-0001 « 2210604~0001 2210606-0001 2210620-0001 2210621-0001 2210627-0001 2210631-0001 2210644-0001 2210649-0001 0C05001744322,422CC2226--21MM+,CCCC11630040559,EECC1123001433,,22CC4306,C44,047 c00U0CQ0uQ116PAPCCS000s0LL7yP,120000,,0000TTuU----F44660000IFF53X000030000020--,0090,MMTQ----Q33AU0000U99NA00000AT0D00000D0N33//S11ONP-L-AOI22NSD2D2,88099RG15ATGFAU,FT2DFS,21I0NTPUIT2NS0PUTVSOLT EA FA FA RRRROEO6HSH,R1FSIX=- R5=12.S0 R=25 OHY 5 % .25 W.CARBON FILM EA RRRROEO2HSH6,RF1IX6=-,RRRS1-=.7221,55KR1D9H,MR13S % .25 W CARBON FILM FA V*VCCCV*V11OOC--SAS--9C,RRLLUPUL,L+IA1IRBIICLSCSSSSSS1SCC0ITTTTTT01AA0T-4-II--,--OLLTTLL(CCRS¢SUUSS4,O0H,00TT0Q03E22U44FE00,X77AC.D5504,UU08FIF111OON200RRU=VF22BEBBBI72UUUURNRI1[1RRRTPNTTNNNS00E-UEE--O-00TRTMMVIIIIAASNNNN FX CFRAMIC NANQ S & DIEL A EA EA V*VV*VV#1TI---S-S-SCCCLL,LULULU,yTI1IBIBIRLLISLSSSSSS$S5TSTTTTTT3O3-T-I-I-I20B1-1TLTLT,,5L,SUSUSU80SSQ3T0T3-T0U3U2E8E0E80AADIDN,,P2FFF2UOOO-~TRRRIABBBBNIUUUUUNPNIIIRRPRRPATTTUNNNNNUNFEE-----TTDMMMIIIIINNNNN AND 7 8 OR 9 FA EA EA VV*VV11---S-CCLLLUL,,IUIBILLSSSSSSSTTTTT75---I-41LL1TL,,SS5USD2535TTU-121E4AWLIDFEON,R 3BBBBF-UUUULIIRRRRITNNNNNEP----PMI-TITUNNNNFTL1O0PANDW/P2S-EWTIDE £ AND-OR CLR FA A V*1-SCLUyIBLSSSTT1I-0TL9US,TTDE&UALFORJKBUIRTFNE-LMIINP-1F1LOP W/PSET & CLR FA *VS-ULBISSTTI-TLUST1E09 FORBURINT-EIMN 12 VVI--CLL,IILSSSTT1--2LL5SS,11Q02U95AD BRBUUUSRRNM--BIIUNNFFER W/3-STATE OUTPU 5-167 12714783 + PART NUMBER RFV ©2232373-5001 G ITEM, 00224 QUANTITY,. 0022n 0022C 0023 00001.000 0023A 0024 00001.000 00244 00248 0024C 0025 00254 00001.000 00258 002s5¢C 0026 0026A 00002,000 0027 00004.000 00274 0029 00020.000 0029A 00298 0029C 0030 00030.000 00304 no3on 0030C 0030D 0030 0031 00012.000 List of Materials DESCPIPTION: coee. SPEECH ELFCTRANICS, AU®TeOscsIcNcSsERsTsEcDncssnsas COMPONENT. o 2221239-0001 0219402-7411 0219402-7464 NESCRIPTION cceesnccsocecsovanacsannsccss UM U55,US6 1225-5503-000 ®ITEN 21S5(P/N 2210608-1)1S 1225-5503-000 *AN ACCEPTABLE SUASSTITUTE 1225-5503~000 1C,TRIPLE NAND GATES,3 SEE TI- NRAWING INPUTS,FAST FMLY FaA use SEE TI- DRAWING NETWORK SMT4S11N EA ust SITEM 216(P/N 2210741~-1)1S *AN ACCEPTABLE SUBSTITUTE METWORK SN74564N A Uk 2221064-0001 2221062-0001 2220921-0002 0972763~-0025 0972763-0013 *ITEM 217(P/N 2210746-1)1S *AN ACCEPTABLE SURSTITUTE SIECEs TTTLI,- MDRUAWILNGTIPDECLONEER X , QUEADR , P,LSTC PK EA C0CCCCCCUUUCUSSSSUSTSS1ON5OOOAO02EE5E2EA43E211EECC4RR0RRR6REFEPEE4E,EP8o5899129,%2A,4,,C,,,,TF2C1UC5CUUCCCCCCTTTTTTITTI21426,4LAAAA12IIAIIAIIIXKUT22-,6----0~--C6----30--EO9M,C,6,CCCC,,CDR,2CXM4O0OO0O,CUUO,UDD1UDCDDD3D36333C51233RRL7R04RRRZ2R72Z7ZT1Z410,AAA-TAAA.5A575.,555,,SU,,,WWBW0WWTWWU,1,U3UUUCCCUUIUUII1IIIIIP011C111163N185NT0N12NNNUNL,002UG1000UG30G,G2FGG52GUE0438F444s,40,,,X4Z7,2222RZ£1(EUU2,0CA000S0205R012U52OM555550,45S630V09,0000,0C9,,45,A4AA4(1CAUU5CV3F25123OX3,5742L,,C,,,N,TCSC10SUUCEE595l23CR368b85lAMRIECAD ¢ CYCLE DIEL TM FA FA A FA 5-166 12/714/83 PART NUMBER REV 2232373-5001 G ITEM. QUANTITY. 00128 0012¢C 0013 00134 00001.000 00138 0013C 0015 . 00154 00004.000 00150 0015¢C 0016 00164 00001.000 00168 0016C S oor7 < 00174 00001.000 00178 0017C 0018 000064.000 0018A 0019 00002.000 0019A 0019R 0019¢C 0020 00204 00002.000 9021 00001 .000 0021 A oo21s 0021¢C 0022 00002.000 List of Materials DESCRIPTION.. SPEECH ELECTROS sceccscccscssescsssses + AUTO INSERTED COMPOMENT.e 0996422-0001 0996765-0002 0996023-0001 0996425-0001 2221100-0001 0996755-0001 2221092-0001 0219402~7404 DESCRIPTION.ceccocavececcessevssvccecscs *ITEM 208(P/N 2210644~1)1S 0000-0000-000 #AN ACCEPTABLE SURSTITUTE 0000-0000-000 1C, SNT4LS125N 001295-SNT4LS125N u06021295-SNTALS125N *ITEM 209(P/H 2210649-111S 001295-SNT4LS125N *AN ACCEPTABLE SUBSTITUTE 001295-SNT4LS125N IC¢SNT4LS669AN, 4=BIT UP/DNWN 001295-SNT4LS669AN : COUNTERS U03021,2U9353-,SUN3T44,LUS36569AN *ITEM 210(P/N 2210733-1}1S 001295~-SNT74LS669AN *AN ACCEPTABLE SUBSTITUTE 001295-SNTALS669AN T1Cy SNT4LS259N TI «SNT4LS259N u40 T *ITEM TI ~SNT4LS259N 211{P/N 2210700-111S =SNT4LS259N ®AN ACCEPTABLE SUBSTITUTE TI =SNT74L 525N 1Cy SNT4LS299N 2 001295-SNT4LS299N U040l1295~-SNT4LS299N - *ITEM 212(P/N 2210710-1}1S 001295-SNT4LS299N #0A0N129A5C-CSENPTTA4RLL5E299NSUBSTITUTE 1C MOS,DECODER SEE TI- DRAWING U36,U37,U38,U39 SEE TI- DRAWING 1C,SN74LS24SN BUS 001295-SNT4LS245N XCVR TRANSETION ua, U9 001295-SNT4LS5245N *ITEM 213(P/N 2210695-111S 001295-SN74LS245N *AN ACCFPTABLFE SURSTITUTE 001295-SNT4LS245N 1Cy MOS,RUFFER/NRIVER/IMVERTER SEE TI- DRAWING uto,utl SEE TI- NRAWING NETWORK SNT4504M uso SITEM 214(P/N 2210738-1}1S ®AN ACCEPTABLE SUBSTITUTE 0972900-7410 NETWORK SNT4LS1ON 1225-5503-000 UM EA EA EA A EA EA A FA A 5-165 12714/83 PART NUMBER REV 22323713-5001 G ITEM . QUANTITY, 0001 00001.000 0005 00002.000 00054 00058 0005C - 0006 00001.000 00064 00068 0006C 0007 00001.000 0007A 0007R 0007C 0008 0008A 90001.000 00088 0008C 0009 0009A 00001.000 00098 0009C 0010 00001.000 0010A 0010n 0010C 0011 00002.000 00114 ool118 0011C 0012 00002.000 00124 List of Materials DESCRIPTIONccscessscecssesssocosnssconcnca SPFECH ELECTRNNICS, AUTO INSERTED COMPONENT. o 2232374-0001 0972900~ 7400 0972900-7404 DESCRIPT IONcscevoocevccocccasnscsacncess PWR, SPEECH 1254-0000-000 NFTHORK SNT4LSOON 1233-7564-000 usT,Us8 1233-7564-000 *ITEM 201(P/N 2210600-1)1S 1233-7564-000 *AN ACCFPTABLF SUBSTITUTE 1233-7564-000 NETWORK SN74LS04M us3 *[TEM 202(P/N 2210604~1115 0972749-0001 *AN ACCFPTABLE SUBSTITUTE NETWORK, SN74LSO8N U690 *ITEM 203{P/N 2210606-111S #AN ACCEPTABLE SUBSTITUTE > 0972900-7430 0972900-7432 0972900-7451 0972900~74T4 NETWORK SNT74LS30N T1 ~SNT4LS30N V64 T =SNT4LS3ION *ITEY 204(P/N 2210620-1)1S Tt ~SNT4LS30N #AN ACCFPTABLE SUBSTITUTE TI -SNTALSION NETWORK SN74LS32N T - SNT&LS32N us9 Tt --SN74LS32N *ITFHM 20S(P/N 2210621-1)1S TI ~SNT4LS32H *AN ACCEPTABLE SUBSTITUTE T =SNT4LSIZN METWORK SNT4LSSIN Tt ~SNT4LSSIN Uss T! =SNT4LSSIN *ITFM 206(P/N 2210627-111S T =SNT4LSSIN *AN ACCEPTARLF SURSTITUTE Tl =SNT4LSSIN NETWORK SNT4LST4N U66 ,U46 *ITEM 207(P/N 2210631-111S *AN ACCEPT%BLE SUBSTITUTE 0972900-7109 NETHORK SNT74LS109N 0000-~0000-000 U47,U48 0000-0000-000 UM EA A EA EA EA FA A EA EA 5-164 12/14/83 PART NUMBER REV 2232373-0001 G ITEM. QUANTITY. 0002 REF 0003 00001.000 0003A 0004 00001.000 0004A 0028 0028A 00001.000 0032 00002.000 00324 0035 REF 0040 20001.000 00404 0044 00001.000 00444 0045 00001.000 00454 ¢ 0046 20001.000 0046A 0050 REF 0051 REF 0054 00001.000 00544 0055 00002.000 0055A 0056 00001.000 0056A 0057 00000.002 0058 00001.000 List of Materials DESCRIPTION ccssnvecoccascsccsocsvacssancse SPEECH ELECTRNNICS COMPONENT.. DESCRIPTION .cceesccavcsse uM 2232375-0001 DIAGRAM, LOGIC,DETAILED,SPEECH EA 2237311-0001 MICROPROCESSOR ,SFLECTED TMS320 EA 1254~ -000 uL 1254- =000 2220963-0002 CRYSTAL yQUARTZ ,PAR RFES,20 MHZ EA Yl 2232353-0001 SYSTEM PRNM | A 1254~ -000 usé - 1254~ ~000 0972926-0006 CAP FIX MICA 500V 10.0 PF +/- 0.S PF EA QPL -CM04C100D0D c1,C2 QrL =-CM04C100D0D 2232416-0001 UNIT TEST SPEC,SPEECH BOARD EA 0972924-0015 2210841-0011 2210841-0017 2210841-0021 0994396-0001 CAP FIX TANT SOLID 47 MFD 10 % 20 VOLT EA QPL -M39003/1-2295 c3 QrL -M39003/1-2295 CONN,,CARD EDGE LOOTMCTR,1-RNW,12CONT. FA SEE TI1- DRAWING P3 SEE TI- DRAWIMG CONN, CARD EDGEL,1-ROW,18 CONTACTS,.100%C A SEE TI- DRAWING Pl SEF T1- DRAWING COMN. CARD EDGEs1-ROW,22 CONTACTS,.100"C EA SEE TI- DRAWING P2 SEF TI- DRAWING PROC.y SITE/DATE CONE AND SFRTYALIZATION FA 2219301-0081 SPEC,HDLG,EC SENSITIVE PARTS AND ASSYS FA 2232351-0001 SYSTEM PROM 2 EA 1254~ -000 u? 1254- =000 2210188-0014 SOCKET,DIP,20-PIN,LOW PROFILE EA SEE T -1 DRAWING XU4 6XUT SEE T ~1 DRAWING 221018a-0018 SOCKET+DIPy40-PINS,LOW PROFILE EA SEE T -1 DRAWING xul SEE T -1 DRAWING 0411435-0416 INSUL TAPE, ELEC, 1/2"W RL -SFE T1 DWG 2232373-5001 SPEECH ELECTRONICS, AUTO TNSERTED A 1254-3373-008 5-163 al 1 SoT)em | T HJ33dS A TR A ] rosry-- a TGS W i @ ~ 5-162 g7go] TR, e " " S| o R TS 111000006000aTp970622E25Ee22e7Z | 3395 (ASYIIEA IiSSTuNVdTl | NOqIaSaIA3134 [TTE]vsr 1var 218 82 o 901 1 10M[ 10 ; = ¢ - ' s3338I oo2 134 90l & 0 3] e JU AUU?? P.Je." "..?? =eHlH.E?_HH._?M ?Ue Q E?=..LH"_.?&M_.?BoM«:-w"e_.=Efl.-tg o, o e e et ) el et 1 el el bk =0 ) I v . v T s I 777S1I0N0I5HDAA®1ODQIX1I0 YISNIDSDFSNODNDY OM/F;uI1S1N0I00 QINiY K1Iu¥8% wyAiLMk % RIL TLISAED BIONA LS MILI 3dv1 TS s WNINSOUHYSS I 3$5ID01UTdIIYONAYIXO`KT'eaYHew3O0Y0DEYd3.v0 JSHYS SSW1ODI0SHIdAJYHddDISNOUTCHSChy TyAkTe9lA3S1S3Y3ty 3 & @ & 5 )`4un>su s AN 0 0IMI2)4S ISWHTUO SSTINA SUON 9 f ¢ [ 8 12/14/783 PART NUMBER REV 2232332-0001 * ITEM. QUANTITY, 0001 00001.000 0002 00001.000 0003 00001 .000 0004 00001 .000 0005 00002.000 0006 00002,000 o007 00002.000 List of Materials DESCRIPTION.ceeoccvccsnccscosccsasscnscs CABLE ASSY,MOTHFRBD TO EXTERNAL FLNPPY COMPONENT.. DESCRIPTIOM.ceecosccsccssovsoccssccnsscs UM 2220042-0016 0983903-0002 0996491-0010 0996928~-0003 0532340-06403 0411100-0070 0411115-0044 COMNECTOR,FEMALFEL,AT CABLF,40-PIN Fa SFE TI- NRAWING CLIP,CABLE A 1680-1903-035 FLAT CABLE.ELECTRICAL,37 CIRCUITS,28 AWG FY SEE TI- DRAWING COMMNECTNR,FLAT CABLE,37 CIRCUITS FA SEE TI- DRAWING STUN, EXTENSTON, <375 L LENGTH EA SEE TI- DRAWING LOCKWASHER #4 INTERNAL TOOTH CRES EA QPL = ¥535333-70 NUT44-40 HEXAGON CREFS STEFL EA MS =35649-244 5-161 ' | z ] ZEECECe [69990[Gl 7577 757775, WA0ASSSY T3N9Y0ILXF0L | ONLANAS], ezeven BT =] il e ey T Ty . oE ¥ 4 s o7 Toroessd ¥ * | ° | ¢ | 8 .. TTs| (SI031 B XG0 e G--icLonZ| 10| 10-T 206 |Xavev| Sh1) 20l @ i55v 3igvs a30707 5160 ' ROy | 22 A | &6 Nid INSANT 24 (7] Il 0oz 2 fiw Ta5357 103I9N8G57 @%.«w 2z \@ 1o 19192 OLIFNVWOSIS 2NoOt51 M2O3N8i0Td0'6HIELIYITMNd IHNSOP'1ZLS0SLI§FT1 NN3N1I8Z00OZNeV1l01MJGTMLa0IQ5IIN3SNiH0NdNIGDZHL3iIm72Md (&) 1 SS0050 I3 NOISIAZS NOMNOYHSIIIGNIIHNM 1A0TILFVLWVIIXIBSI0AdSIYSY33Y1S13O7W |1] 0IAVIIE IO SETIND SILON 9 I L -/ 12/14/83 PART NUMBER REV 2232329-0001 * ITEM. QUANTITY. 0001 ©00001.000 0002 00002.000 0003 00002.000 0004 00002.000 0005 00004.500 List of Materials DESCRIPTIONceecosccsvcnsonscscsscacccsns CABLE ASSY,MOTHERBOARD-EXTERNAL FLOPPY COMPNINEN.T. DESCRIPTINNceecccccasanas s0scccsacsas UM 0996929~ 0003 0983903-0002 2211341-0001 2211340-0001 0996491-0003 CONNECTOR,FLAYT CABLF .109"CENTERS-GOLD EA SEE TI- DRAWING CLIP,CABLF EA 1680-1903-035 CONNECTOR,RTBBDM CABLE.34 PNS W/0 EARS FA SEE T -1 DRAWING KEY o POLARZI]NG FA SEE T -1 DRAWING CABL y MUE LTI, -COF NDUCL TNRE ,FLC AT,34 CNDCT FT 008261-445-240-34 12/14/83 P2A2R3T232M9U-M5B0ER01 REV* ITEM, QUANTITY, 0005 00004, 500 ODESCRIPTIONcscccccsescnccscsncsccsscaccans SET UP IN ERROP COMPONENT.. NESCRIPTIONcencoecescnsscccccsvsescccsass UM 0996491-0003 CABLE,ELFCyMULTI-CONDUCTOR,FLAT,34 CNDCT FT 00A261-445-240-34 5-159 o w7t =) | =] z 6eeeze, [899900 T AdSOTS TN ILX3T ASSV 31870 v [PEEWIS]v ] et w o] o ovs vT + s s516__| 0005222 P = ! - = | -- £Bl 752 am s270 ei =10 o 5-158 a -- IVONS:¥I1W5M3-HR3)IS& > o o@211]1J5iE} 274 (3 71 () 237 &2 2 ---- i = TSEe eE e = J T g3 . s h 5 ¥ o Ev . [1Z__ ®g AT070I10T9eD P . 8o2oaf2l /= :\\ SV e 2 - M .\ ---- fR0Er -- / &v) ovs s / Nig 0950v60M012-2i793|5./l 095908 3 % _Il - Q` |3 sorsrovg /./| r-- lllr' | - | ok o 3om - 9 M L -- 90770, 7 ~= or Mo- M a3stmn 32 . DDLHI5ZPNNIOSOD12$I NII37460H9U7OIFM12777H4SMDt2MO3 H8SD51LIF3IY1NI9NN0O2DO1NIY9l4J7M0O1619NINNiGdNDTHFIMIM10 £ 1 $5320N0U0SIA9SY NOMNIYVSIBFVATNHIN 1VAIILIYAMITX1IKNIG0S0YY F33101070] (2] N1 NMOHS Sv OFAISSSIVML219A¢)T 03S0 7790950M77 (b ONV 1 W35L110)75SAN0GT3II£OM0M3I4NZ5GEII0 HW130LGI NSI2SToI9IVY5 STI|1O]N | v t s I 9 f < I e 12/14/83 PART NUMBER REV 2232327-0001 0 ITEM. QUANTITY, 0001 00001.000 0002 00001.000 0003 00002.200 0004 00001.000 0005 ©0001.000 List of Materials OFSCRIPTIONcoeosaosssccsceccssssaccnsccss CABLE ASSY,RADIAL COMPONENT.. DESCRIPTION.acecsoscssccscssccccansnsase UM 2220042-0022 2210149-0001 0996491-C006 09R3903-0002 2211340-0001 FLAT CAABLE CNNN,20CONT,. lOO"CENTERS 2ROW EA = =000 CONM,PBN CABLE/CARD-ENGE,W/0 MTG FARS,20 FA 000779-SEF TI DWG CABLE,ELECT,MULTI-COND,FLAT,20 COND FT 008261-SEE T1 DWG CLIP,CABLFE FA 1680-1903-035 KEY , POLARTZING FA SEE T -1 DRAWING 5-157 = J v ATBWISSY 318vD G3a104NA U (I39N03 0330102) v°9 + 0°005 /. £ g 1= | \ I NId i ¥w N0/d 230903-800699 | |&N|3| & o ~ /r VA4 £-91I1N6I6W0AINN/DdI dWYYy0 -- "1000-0£9LTY(90N1/d-0t11 N/WdO¥4¥3WINAY0Wd) 2060-£06£86 N/d 11--\ ! | p 9F%EEO ; : TWNOILdO 3dIS A8W3SSYv'93318v) 0-Q0390%104 7, 2 0 NId . s (s _ = - _ < z <o= = % 3= 5 w F|=% § 0z NId _ / = <oy N\ N ET S \ v MIIA 33S Q2 020-00I6N9I9TYANI/NdD>I9v3Y0ig-- \ [5° s =4] 1 NId Q0¥ NV (1 WILI")A18UY3OSLSDYINNHOSDINI¥AIAOOL (417WDILI)43171I3189vDNIV0Y7L0S3 [o] ar.Z<.Bm T# NId 39 01 $3838F 3903 OIN¥YW ¥010D aNY §- 101S N3I(M2L0I0E-¥9(£15090-9N6//d6)9 ¥ON/LdI)INNAOND N3IIv9d-%____.w_ 5-156 k Texas INSTRUMENTS| nveien 100-96I/N5F9TYANL/RdDI943480 L2 " Y34y SIHL NI 38 0L v° ¥Y3d SSNINWWW 1Y B ] *0314123dS 3SIMY3HIO SSIINA SALON _______________________________ v CONVERSION CHART | -------------- mm e et mm | INCHES | -------------- e -------- e et 0.00025 | .000010 | 0.00076 | .000030 | 0.0025 | L0001 f 00..525 | | ..00210 | | -------------- Fme e 3.0 | .12 | 6.4 | .25 | 40.0+/-6.0 I os.574/-.25 | 460,04/-6.4 | 18.11+/-.25 | 500.0+/-6.4 | 19.69+/-.25 | oo e + --------------------------------- CONVERSION CHART ---------------- Fom e e mee e o} CAPACITANCE rm | CAPACTITANCE ft ---------------- Fom ey 0.046 | 14 ----------------- oo | COMVERSION CHART Fommm e Fommmm e + | CECREES | DEGREES F Fommemenaee Fommmmmeeeeee + | -30 [ 5 | | -2421 | | ! 40 | 104 | 70 | 158 | Jomcomamnons R + Ao e} | CONVERSION CHART o e e e} | PROPAGATION m | PROPAGATION ft] Fo e e et | 4.6 ! 1.4 | Fom e e e ey mm 30T*.H.o 3R`,3Y8 +-00.,v0130 | HOLE TOLERANCE INCHES mm TgTH03R1Y3 +-.,000014 T1TH2hR,RU7g3s-+_00.,0230 | INCHES . 501 TTHHRSUS +_ .-0.00080 3e.oy20 +-0o,o%1s3 | Tg H1E2G6 +o.vo0t05 I TJ1HH9R,%U0G8g-+00..0235 | T.{H77R551Uge-.+,001000 T1R2.3,y8707%+-09.315 || f.5h205p01y +--906 f 2T505R.,y8403" +02-39 | T21.h.0e00y00"1" *- 012 e - Q@fl KLUNKERT 52716/83 ol | e TN 932927 g Trxas o IwNaSsaTmRatUnMENTS Fesmrsase sAcate N9OK6E21 4 SHEET 5 < Ti28910 ` 5-165 3.0 I 3.1.1 3.1.2 J.1'.3 3.1.4 REGUIREMENTS PUYSICAL: SEZ FIUURE 1 MATERIALS: HOUSINC, COVERS, GLALS REINFORCED THERMOPLASTIC, UL FLAMMABILITY RATING 94V-2 OR RET"ER CONTACTS: BERYLLIUM COPPER WLTF ENTIRE CONTACT UNRERPLATED WITH 0,76 mmNICKEL. CONTA'TS TO 0.76 mmGOLD PLATED. CABLES: Mo. 28 AWC, 7 STRAND, TINNED, ANNEALED COPPER, ONE EDGE TTOORS,HAVEUL COILOR STYLF STRIPE. 2651. POLYVINYL CHLORIFE INSULATION, 20 CONDUC- <VENDOR PART PARENTHLGTS DRAWINGS. NUMBFRS FOR COKNECTORS AND CABLE ARE SHOWN IN AFTER THEIR DESCRIPTIONS 1IN APPLICABLE FIGURE 3812 ELECTRICAL 2.2.1 VOLTAGE/CURRENT RATING: 300 VOLTS/1 AMP 3.2.2 IMPEDCNCE: 105 OHM NCMINAL 3.2.3 CAPACTTANCE: O0.045pf/mm NONINAL C» 3.2.4 PROPACATION DELAY: 4.6ns/m 3.3 ENVIRONMENT 3.3.1 AMBIENT TEMPERATURE: o o » OPERATING 5 TO 40 C, NON-OFPERATIXG =30 o TO 70 C 3.3.2 RELATIVF HUMIDITY: 10 TO 902% NIyi l"'(v`Lhl MNKK¥RT (;2'/514 1/83 SIZE | Fa M AT JHAWING NO 2932327 Piv B Texas INSTRUMLNYS sy TM 2sutn Frsoeoare A 9621 4 Xscaie NOME SHEET 3 5154 12/14/83 PART MUMBER REV 2232326-0001 D ITEM, QUANTITY, 0001 00001.000 0002 00001.000 0003 00002.200 0004 00001.000 0005 00001.000 List of Materials DESCRIPTION.eo csosocssnccasncensacscosss CABLE ASSY,DAISY CHAIN COMPONENT. & NESCRIPTIONcecooeososaccccscseccananasce UM 2220042-0024 2211341-0001 099649 1-0003 0983903-0002 2211340-0001 FLAT CABLE CONN,34CONT,,100"CFNTERS 2ROW FA = =000 CANNECTOR,RTBAON CABLF,34 PNS W/0 EARS EA SEE T -1 DRAWING CABLE,ELFC,MULTI-COND,UFCLATTN,P34 CNDCY FT 008261-445-240-34 CLIP,CABLE EA 1689-1903-035 KEY,POLARIZING EA SEf T -1 DRAWING 5-153 Y AT8K3SSY 318v¥D G307C4NN v'9+ 0°Shy 5 et o g 2 1(3J9Y0I3M 0340102) ~-- 1 Nid INJIV0A0I6N5D9I N/¥d0 $E0©d38 o SHEET DRAWING NO 2232320 SIZE|A TECM96NO214 scaLe NONE 2 5-152 DATE 1. 8-91I1N6I6T7YALINN/GdS an¥i0 -- \ 750/ TwNoILdo 3018 1 S-- vt Nid "1000-0£9LLb{30N1/d-0p11 N/dWGdddIMTAATYDWY) ZeI6SrES5SY 3707 2000~£06786 N/d :.`/ qll||l ¥°9 + 0°S8E IIIIII'_ . 1 NId 5/ . L | 1 | _ 7 / [ y-- 900-59£59 N/d 5438 Y NId-- y 7] B F = -- = NV N Y MaIA 335 T Nld G0V ONY (1 WiLlA)TSH¥IOSLSDY3NNHOSDINI¥A3AOOL (dITWD3LI4)31733748v3NIV0Y1L0S3 [v] 3 T# NId 39 01 £3079F 3903 QINYYH ¥0100 GNY S- 1075 N3(39I0ML0I-A%9£5(9100-'9N/6d£)S9YOLNJ/dI)NNODA NI3v19-dv [00-96£99 n/d Ludd ¥3uy SIHL NTU 33 OL v'¢ d3d NIV 1Y E *03141334S 3SIMYIHLO SSITNA S2LON OWN C. KLUNKERT ISSUE DATE" TRUMENTS] -------------------------------- + CONVERSION CHART | ------------------------------ Fommmm e nm ! INCHES | ---------------------------- Fom e m o ---- 0.0¢025 | .000010 | 0.00076 ! .0C0030 | 0.0025 | .0001 | 0.25 ! .010 | 0.5 | .02 | -------------- Fomemm e 3.0 | 12 ! 6.4 | .25 | 60.0+/-6.4 | 2.36+/-.25 | 434855..00++//--66..44 || 1157..1562++//~-..2255 | | -------------- oot _________________________________ + CONVERSION CHART | ---------------- o mmmm e} CAPACITANCE mm | CAPACITANCE ft | -------------------------------- Fomm e m e m e 0.046 | 14 | ---------------- o me e} --- i CONVERSION CHART | o emmt e e e | m | INCHES 1 Fomm oo m s} | 0.76 | .00003 | Fommmm e e e oo m e e + | CONVERSION CHART Fommmmmmnnee T + | DEGRFES ¢ | DEGREES F | tomemeeeneme Fommmmmmmeeee + | -30 ] -22 | 5 | 40 | 70 tmm e | 41 I 104 | | 158 | tommmmm o + e NS e R S T I | CONVERSION CHART o e e e | PROPAGATION m | PRCPAGATION ftl Fom e e S m e} | 4.6 | 1.4 e e ey HOLE TOLERANCE mm INCHES mm INCHES 0:33 +0.10 | 1013 4 00s || 12:73.0.20 | +301 +.008 3,18 "0-03 | [y75 --001 § ;g 05-0.03 | 350 --001 3:29 40,13 | 3125 +.005 | 19:98.0.25 el +.010 6.35 0.03 | 250 --001 § 25 40-0-03 | { `goo--00! 6T.H3R8U LTooc.1o5 || T:H2R5%U 47° 00g05y f 2TH5R:U43,"0g,°3003 || T1H0R0U1, T-o0n1o2y 12,70 TM° .500 ° 50.80 " 2,000 ° Bl 2. .25 Al ?'V;\UP KERT 002/51 10/83 A| 96214 SIZE | FSTM NO CRAWING NO 2232326 ¢REV| 2= scae NONE SHEET 5 4 5-151 3.0 3.1 3.1.1 3.1.2 3.1.3 3.1.4 REQUIREMENTS PHYSICAL: SEE FiGURE 1 MATERTALS: FLAMMABILITY HOUSING, RATING COVERS, 94V~2 OR CLASS BETTER REINFORCED THERMOPLASTIC, UL CONTACIS: BERYLLIUM COPPER 0.76 m NICKEL. CONTACTS TO WITH ©.76 ENTIRE m GOL[ CONTACT PLATED. UNDERPLATED WITH CABLES: 0. 28 AUG, 7 STRAND, TINNED, TO HAVE (OLOR STRIPE. POLYVINYL CONDUCTORZ, UL STYLE 2651, ANNFALED COPPER, ONE ELGE CHLORLDE INSULATION, 34 VEYDOR PART PARENTHESIS DPRAVINGS. NUMBFRS AFTER FOR THEIR CONMECTORS AND DESCRIPTIONS CABLE ARE SHOWN IN IN APPLICABLE FIGURE 3982 3.2.1 3.2.2 3.2.3 3.2.4 ELECTRICAL VOLTAGE/CURRENT RATING: 320 VOLTS/l AMP IMPEDENCE: 105 ORM NOMIXAL CAPACITANCE: 0.046pf/mm NOMINAL PROPAGATION DNELAY: 4.fns/w 343 3.3.1 3.3.2 ENVIRONMENT AMPRIENT TEMPFRATURE: T0 76 ¢ OPERATING o 5 RELATIVE HUMIDITY: 10 TO 90% o TO 40 C, by' NON-GPERATING o =30 Ny l"i` ?("II.NNL'\KER T 6"2"/ `14/? 3 B SRR LR AWING K0 22:213232626 '-ienl-s ¥o S TExas INSTRUMENTS I SSUE DATE sAcaie N9ON6E 214 A 2 5-150 12714783 PART NUMBFR REV 0996289-8001 AB ITEM, 0001 QUANTITY, 00001.000 List of Materials DESCRIPTION.cocccessscosoonrssccscsccccss CORD SET,3-PIN PWR-DOMESTIC BLACK COMPONENT., (©996289-C001 OESCRIPTIONcceessscecvcscscsocacassssanes UM CORD SET,3-PIN PWR-DNMESTIC BLACK EA 080126-0-7889-008-GY 5-149 SUGGESTED SOURCE(S) OF SUPPLY: i 5 . SGHAHREBSETMAR--ECSAE--H--E0O0-2B4EFACH--OLVE- 2 BPR.EILDC0E.HNMOBOCNXODRIP,1N101 {16428) 47374 : S SRDBNH2BLRE5E3E7HL0ES-VOEBATOREEIO-BT5EEFHT--EEEOREPBNREELAHETAU--O--RHNUdIBDS4E~EA7B--3AE5BIE37RL94EE8T LE5CE--TR{O5I3H6E--7EBEES 4------£OFTRROBAE-MESIEPGREHAC--NHPIAA--IRAHKEE--SH{--C6a0R1D3S1P) 5 HHNSE8ECMSFATOTHRNA--SERTHWREHECEETITRIG-E--HRA--E-----S--0C3A6B9L3EERE, 8.6------ESV6W6CSE.1IH8NE2CIBTH3CWOHA-A5MRSGRAG5OTIHR,NIRECEIHLKAYEA,SCILRPTL.RE----.EHR{MH.W--F6IRI0.ARIE6VEE--3E8PT0R2P&.8O9BC3UABELTES(--2B9C8HO7R.0P.) Ti--e230.8 TI PART NUMBER 996289-0001 996289-0002 996289-0003 996289-0004 TI PART N R 996289-0001 996289-0002 MF p URCE SQURCE 2 0-803 BK 37-008 33561 SOURCE_3 99 89- TI PART NUMBER 996289-0001 996289-0002 SOURCE B 996289-0001 996289-0002 x\ TEXAS INSTRUMENTS / 1 sreus OIvIIoN O':HIC"GID..I'POIAYID WOUSTON TEXAS 5-148 996289 [REV SHEET 4 AB O 4.0 QUALITY ASSURANCE PROVISIONS: 4,1 RESPONSIBILITY FOR INSPECTION: UNLESS OTHERWISE SPECIFIED IN THE CONTRACT OR PURCHASE ORDER, THE SUPPLIER SHALL BE RESPONSIBLE FOR PERFORMING INSPECTIONS THAT ARE SUFFICIENT TO ASSURE THAT THE PARTS SUPPLIED MEET THE REQUIREMENTS SPECIFIED HEREIN. --AT--------TOT-ACCERTAMCET DELETED TUTO ORI -- o 5.0 PREPARATION FOR DELIVERY: 5.1 PACKAGING: PACKING AND WRAPPING SHALL BE SUFFICIENT TO PROTECT AGAINST DAMAGE OR LOSS DURING SHIPMENT FROM THE SgPPLIER TO THE DESTINATION SPECI- FIED IM THE PURCHASE ORDER. (BULK PACK IS ACCEPTABLE) 5.2 MARKING: THE PRIMARY WRAPPING OR PACKAGING SHALL BE MARKED WITH THE TI PART NUMBER (SEE PART NUMBER BLOCK) AND THE COUNT CONTAINED. ADDITION- AL MARKINGS ARE PERMITTED. 5321 REGULATORY MARKING: EACH SEPARATE SHIPPING CARTON MUST INCLUDE MANUFACTURER'S U.L. CORD SET LABELS AFFIXED TO THE SURFACE OF THE SHIPPING CARTON, OR ON A TAG OR THE EQUIVALENT INSIDE THE CARTON. EACH SEPARATE CORD SET MUST INCLUDE MANUFACTURER'S C.S.A., LR, OR LL NUMBER PRINTED ON A DOUGHNUT-FLAG OR BRACELET-TYPE LABEL Timaz30-8 Jp TR ENATS --OIaITAL evareus Division | Al s SHEET 3 I EV| 5-147 FIGURE 1 - CONT P~ 650 TYP. ALTERNATE GRIP TI DASH NUNBER COLOR (REF) ELECTRICAL RATING WIRE SIZE, A AUG (STRANDING) | MIN B ¢ DIA MIN " -0001 GRAY OR BLACK | 10 A MAX AT 125 V| 18 (41 X 34) |[86.0 3] -0002 GRAY 10 A MAX AT 125 V§ 18 (41 X 34) 86.0 .32 . ~-0003 BLACK 15 A MAX AT 125 V| 14 (41 X 30) 116 .39 -0004 GRAY OR BLACK| 10 A MAX AT 125V | 18 (41 X 34) 116 | .32 NOTE: CORD GRIP DESIGNED T CLIP TO BODY (CABLE) OF CORD ASSY TO RESTRICT SLIPPING, -0002 ONLY FIGURE 1 3.4 3.4.1 MECHANICAL RETENTION FORCE, FEMALE PLUG: 3LB MINIMUM, 20LB MAXIMUM AFTER 10 CONDITIONING CYCLES TO A MATING RECEPTACLE. Timaz30-C B XIABINSGICTA"OLIOURSSNYTPSOSTNOETH®SRTAEXDUAiTSvMIESIEODNNTS ? 5-146 996289 REV| SHEEY 2.1 AB 382 383 3.3.1 RENUIREMENTS: PHYSICAL: SEE FIGURE 1 PLUG: PVC B80-86A SHORE. DURCMETER HARDNESS .. 60°C SERVICE, CORD: =38=aUG, 3 CONDUCTOR, TYPE SJUTMEETING U/L STANDARD 62 REQUIREMENTS. MARKING: PARTS SHALL BE MARKED WITH THE NMAHUFACTURER'S IDENTIFICATION, WIRE TYPE (SJ7),YIRE SIZETIEARG), AND NUMBER OF WIRES (3CONDUCTOR). FLASH IN WELL OF RECEPTACLE CONTACT SHOULD BE RESTRICTED TO BOTTOM 20% OF WELL ELECTRICAL: SEE FIGURE 1 ENVIROMENTALSTORAGE TEMPERATURE RANGE: -400 C TO 80° C (SCéi ! = | b e A MIN -- c DIA.--+ l] ) J¢ SEE FIGURE 2 B <_I 225 et~ (Al Sl ffi: --f 2 ~ eo-34 'S9;" q----1m30 -- = { OR BBRLOAWCKK. .2450 OGRREEYNELLO_ W / : --60 CVIEW A-a Ti--ez9s.0 "CSA APPROVED" : aeod . `7--18 --=] 1LABEL e--2.2 ---- L -813 r---9°5 ---- 27 2 3 ] WLHIIGTHET QBRLUE ) FIGURE 1 .200 WLHIGIGRTHEETENBORLUOER----+G3_|¥ s GRNYELLS BLACK X £ b3 BROWN .158 d ; .62 e------ |: - VIEH _ B-B o TEXAlSoitaLISNveSéTusRUoluMieEionNTS | A1 swee9r9_67280 4 .20 -REV| 5-145 REVISIONS CONTINUED FROM PAGE 1 REV LTR K L M N P R T u v DESCRIPTION CN__453115(0)PM.C CORMICK 12/27/79 CN458407(E) _form Lmnpoar CCNN3641162960(7F)6 S (E) Ftcrdesas L.WILKINSON CN 452365 (E) L. WILKINSON CH 472374 (E) J. A. ROY CN 465634 (E) G. BITTING ON 477463 (E) Z7 s von CN 484706 (E) Bemiloa, Loand W CN484753(E],1 éia`wlww Y CN 489091 (E) = 3., L CN 499203 (E) CBLOCK AB | CN 508766 (E) CBLOCK DATE | APPROVED |17/~ | oikdhee D Aas-90 [0 ¢ 6/73/40 ; 8/29/80 | 5e 5 , | WO 7 NN& . 1-20°9 | Oovg it ¥Dbendeo "%/5/ /['/ b |12-17 -9) ;/"5/!& 7%/)«"!"'\' 7082 | 5t 2-19-8% /7%/7" 5-2383 fa-- . Ti-4289. T TEXAS INSTRUMENTS I1N 0ITCALoOsR TSvaP anTO EUR SFA EADnIT sVIE SIOD N 5144 996289 REV| SHEET 1.1 #A[ 96209 W Level 2 ] ao01 {6150 0200 APPLICATION uUsEp ON 8501 `;}7713` s 7069 <737 USED ON REVISIONS i LT ORBCAFTION A (418859 (£) LENovERZ B {CN4Z3891 ZLarn Kewm C {CH424086 L. Piercey OATE APPROVED /-28-77 | 1/28/77 | naem ] v-3-77| Q] 7.19-77 | A= & ] D ] CN433186 F. Espinoza £ | CNA3TI0T Joud FHogel 4-2/-73 |7z~ ] 23 /18 | Zfo)merrme F |CNA3Lo4Z Crouisy lavpeo 50 2.0 G | CN 439003 REKHA SETH 2/10]79 1FE. ,[zfg?% H | CN 439009 REKHA SETH @/,/,/;7 / =% J ) CN 427221 GOULFT 9-12-79 7/ 267 s 1.0 SCOPE: SEE PAGE 1.1 FOR FURTHER REVISIONS THIS SPECIFICATION COVERS THE REQUIREMENTS FORA 3 PIN POYER CORD, UNDERURITERS LABORATORIES AND CSA APPROVEG. 2.0 APPLICABLE DOCUMENTS: THE FOLLOWING DOCUMENTS OF ISSUE IN EFFECT ON THE DATE OF INVITATION TO BID OR REQUEST FOR PROPOSAL FORM A PART OF THIS SPECIFICATION TO . THE EXTENT SPECIFIED HEREIN. 1IN THE EVENT OF ANY CONFLICT BETWEEN THIS DOCUMENT AND THE REFERENCE DOCUMENTS, THIS DOCUMENT SHALL GOVERN, MIL-STD-105 4 SAMPLING PROCEDURES AND TABLES FOR INSPECTION BY ATTRIBUTES N uL 62 FLEXIBLE CORD AND FIXTURE WIRE ReV [AB|AB SPECIFICATION CONTROL DRAWING SHEET 2`11.1 REV STATUS OF SHEETS REV AR AA| ylAD SHEET 1121 3] a SRS IAN gouamcerBewcusarss m010 S e P v S ':`*" `| CJ\ZU,A.,N_.c,Qe_\f_o.Qr..,h[i hize 1020 W077vy0, P17] A41£7 72k p\ TEXAS INSTRUMENTS Eoument Growp Daties. Tesss ] CORD SET, PONER-DOMESTIC 1 ] MFR / q/s $i2 COOE 10ENT NO ORAWING NO i) A | 96214 996289 ] PRESAN oo D o)0) soae yovr | 100 4 |=e=r ) 056 FILMED 5-143 D oy Tt oo ey e e 1 memites me v NOTE: 5| MPI MODEL 51/52 - ENABLE HE .D LOAD WITH MCTOR O AND DRIVL: SELECT 1 AS FOLLUWS: (® - MOVE 12 PIN SHUNT 70 POSITION CUNNECTING REF. DES. 1G SOCKET PINS 2 THRU 13. - CUT SHUNT BETWEEN: PINS 3 AND 12, 4 AND 11, 5 AND 10, AMND 6 AND 9. = R 2 3, ASDMY 039002 Te s Ti-az38.T FIGURE 1 - MPI 51/52 - PWB COMPONENT LAYOUT X ]'2@-) TEXAIL SNCAO oIA RNP oSOY MTRRyAUTMEEDNTS 5-142 A 222327_') REV SHEET ? APPLICATION N2E2X2T305A0SSY 5U7S5E5D ON REV AL i REVISIONS DESCRPTION DATE APPROVED 1.V SCOPE: THIS DOCUMENT DESCRIBES REQUIRED CONFIGURATION UF A FLOPPY DISK ODRIVE, SEE FIGURE 1 "» REV SHEET REV STATUS OF SHEETS Onifiwl;eissgfifll) s ] MLLMETERS * TOLERANCES: . E1 RAC\CEE DDEECCRIMMAALLSS REF ONLY =1° 0205,2,5 ' THIRD ANGLE PROJECTION @_g >~ TEXAS INSTRUMENTS INCORPORAFED Oighal Systems Group SI-METR]C A A q fo Lis - . i A i ! ST . CONFIGURATION, FLUPPY DRIVES g + .4 &.; | SZE [FSGANG DRAWING NG . -W/?Z/gz (A|O6668 L 7 N T SCALE N(NE SHEET T ] OF 2 5-141 OPTION PLATE -- NUT \/@ ~ NUT COMPONENT VERSION "p" TYP PHONO JACK & DIN CONNECTOR MOUNTING =Y 2\ TEXAaSEeNnOIUSrNTOSeN,TmRYAEXUTASMEE®NTS Al SHEET2223231 9 REY A 5-140 *D" CONNECTION OPTION PLATE \@ Q g \\\\ N . N * \u\ ~ HEX MTG S2 PATCOETRASL Troate ¢ TYP D" COVENRNSEICOTNION"C"MOUNTINGL/ TO OPTION PLATE %\ TEXAI2SHSM2IOURSNTrOSNO,TNRTAEUXATSMEEDNTS A | SHE92E2T23231 8 JREX 5.139 PWB Y 2 SCPRLEAWCES OPTION PLATE LOCK2NUTPWLAASCWHEIESTRH b » LS Y TYPVERTSABIONMOU"NB"TENG (I3 = TEXAS INSTRUMENTS slaiTal syeTeus aivision 2223231 REY SHEer 7 MODULAR PHONE JACK BERG, #66011-1 & -2 OR EQUIVALENT TAB MOUNTING LOCATION NEARSIDE/FARSIDE, OPTIONAL OPTION PLATE T--\ T T T . N / V7 f Ti=a288.E S~ SPOTWELD TOGETHER v VERSION "A" TYP MODULAR PHONE JACK MOUNTING o EXASN STREUMMEENNTSI DIGITAHLOUSGYTSOYNE.MS TEOXIAVSISION AR oo SHEE-T 6 AREV| ` 5137 *'k#0"0'*#**t`*#*#*v#**#*****#**#****'fi--%#t#vv`#«**#r"x?l`L"`é-*' ##***%%*fl**%***%#&*%#%i*%&#*%fi"#bk*+"*¥§***#*%**%*§#§fi44%**%***##%%*%*****k%i%% SI CMETRIC #Trtle # OUTLING SPFECIFICATION, CRTION EOaRD # %é%#fiw#*%%#*fi#***&#*##é*wévA*afifii&r**k§§l*Q*%*fi*%&é(é**fl#*#******fi*%**%% Kbt TEXAS INSTRUMENTS NCORFIRATED % Frod No. 2755 * ot NINE 0 o#Dwe, Na Rev * L S #& 4 * MR E R R RERE LR H RS E AR R RS G H U F USRS B2 AL o P S H Bh R FRDPER AR B E RECHEr pRa SR P ERHLLED 5-136 115.09 MM ' 4,521 IN % * Ok % ok X AR T R SI-METRIC I I RSB A B A R #Tartle I I B F I BRI AL H AR E R # CLITU ENE SPECIF DTATINN, OFTION BROARD * #*#fi##%##**##ffi&{*}%*####fi*}*&éfi#fiti&h*i&%&*#*&*fl#fl!&ék6*#***#*#%*#%**#***%*%** TEXAS INSTRUMENTS # DATE # 5,/ a SR + Praj Ko, 0 Ae 20w Na., Raov - INCORFORATED BRI IR o755 RO E R R R B B ARG PSSRt H U AR B Cth n B G 1 GIRH T o B H b MR BN REEE RS 5-135 ***#%fi*i&**#k*%%&%%*%&*%*#k*%é%4#"X%%&*#é**%}%*%*****%%#k%*##****§§44§****§*4*% w"I -METRIC *Trtle + QUL IMNE SPECIFICATIGON, GFTION EOARD » U R UH YR AUAESREBRSR CFE RS E B WT E-*d-#i#_fl'fl FRURFR CHEIRESEEHE CHFHA LR R R P30 TEXAZ INSTRUMENTS RATELD # Froj N, 2755 * * i@ NI U #lwea, Noo ; Rew #* c * #* # B FH RN AR RN R RS R E R R R R R ER R R R R U T LR R RAFRECAL EERLL ST LASRE REE L LR LY R LR 5134 * % &k k Xk X x RN AN RGN ST CMETRIC TGN R SR E SR RIS G B RE BRI B R SRk ¥ TEXA= INSTRUMENTS INCORFORATED # FProid No, :7 eb v D SIS I IR E N ST X R #T1tle OUTLINE SPECIFITATTON, G U R RER R A H R E X W R SR R B S OPTION BOARD AR R R R U # #* R R RS * = wioa .. f afpa Neo, : Rewv * G * & "h 4 NIINES Lt OF 4 +* 364 3 H 3036 3 38 403 36 3 3B R *k*&**fl#fi%@w%#&*fifi§#%#54§%éflIi%#é#&&#fi#kflfhkkt§§fl§é§§#*§§§#fi 5-133 12/14/83 List of Materials PART NUMBER RFY 2223220-8001 o DESCRIPTIONccc cacccasscssscas WINCHESTFR DISK CONTROLLER - ITEM. QUANTITY, COMPONENT., DESCRIPTIOM.csaces 0001 00001.000 2223220-0001 "WmIeMmCeHmEmST-E-R=00D0ISK CONTROLLER £A 5-132 DWG 2223220 ISH 12 ! + : - == ------------ e e e ": 3.2 | ======= Interface ===== Bu=s===Timinsgm--zDsisassmr=asm=s=smsmsocs=ssssssssssossssossssssSssssoo==S=s P] 3e .2.1 Timine relae tive to 0SC: --------mm e ! e g ! The timine diasram for the interface bus relative to 0SC ii. is shown in fisure 2. = -- Timine- relat-ive to CLKP: N S SV SV S S SN : The timine diasram for the interface bus retative to CLKP is shown in fisure 3. The resister assignment far the cantroller will ke as followss R i HEXLA Addre--ss N ! Q020 0031 . ! + . ' + ' ! + ¢ { + ' ' + IN Function Not used ' ' QUT Function + . | + ' . + ! ' + ` ' + __I_nt_e_r_r_u_pr_t___m_a_s _______ - i an IN Function gets data from the winchester contfibller toard, and driVes it onte the TIPC I/0 e¢xpansion bus. An OUT Function sets from the TIPC I/0 expansion bus and drives it anto the winchester controller board, d data .! 2.3.2 Winchester ' 3.3.2.1 ! ' ! ' ' ' ! . ! OATA INPUT 1/0 ' Port 1 FORT M3B - ! Address ' ! 0030 ! ' ! ' ' ! ' ! : ' ! ' ! : = STRLIMENT:S ' OATA STEMS ! SROUP ot oot ioccs o e seo ot Contreller Resister Definition Disk read data and controller | TN RICO : W DATE T & .- DATE 1221028 ALE:D + ) i NONG - VEHEET e = ENETE T ER Y 5-131 NON-MASKABLE INTERRUPT DATA 7 ( msb ) DATA & OATA S DATA 4 OATA 3 DATA 2 DATA 1 DATA O ( sk ) WAIT SROLIND ADDR 19 ( msb ) ADDR 1= ADDR 17 ADDR 16 ADOR 1S ADDR 14 ADDR 12 ADOR 12 ADDR 11 ADDOR 10 ADDR ¥ ADDR % ADDR 7 ADDR & ADDR S ADDR 4 ADDR = ADDR = ADDR 1 ADDR © ( 1sb ) GNI : RESET 2 +5 IRO NC . NC = 12 = DMA~ +12 GND AMWC~ MROC~ AIOWCIDRCN NC NC NC NC CLEF IRA IRS IR4 IRZ IR1 & NG RF2H ALE +5 QS GND GROUND RESET +3 VOLTS FOWER INTERRUFT O not connected not connected -12 VOLT3S FOWER DIRECT MEMORY ACCESS F12 VOLTS POWER GROLIND ADVANCED MEMORY WRITE MEMORY READ ADVANCED I/0 WRITE I/0 READ not connected naot connected ot connected not connected not cennected FROCESZSOR CLOCK (S MHZ) INTERRUPT & INTERRLFT S INTERRUFT 4 INTERRUFT 2 INTERRUFT 1§ not cannected REFRESH AODDRESS |LATCH ENAEBLE +3 VOLT POWER CeSC CLOCK GRIZLIND, (1S MHZ) t TIPC Expansion Bus Descrirtions » CLOCK. This &b607 nsec period sisnal is a hish speed =) (15.0 MHz). It has a SOY% du FRUCEZZSOR CLOCK. This is third of the 050 frequency (5.00 MHz), The clock has the svstem clock. It and has a periad of a 37.4% nominal duty is ane-- 200 nses cwviole (+=32%), aumRtsiTsfhEoineatZoegateEnnitarTaictc.ltetetnirhrdevieewinasspdTeteuhe1nli2adsacrdtteeviivsooilviltPnimetcaonmewreee,trdshhlia.iiisasnsDhetu.uerwrPluiesnvdaesrRgduoEmpoZraesEndptTdo.odwubererirrilseeTnotshewieusbstrrenonsa1we1onr.rwP1aioltlwoloeiewuvdnrtaisltttihabfsayrlaoellrieiolatwzuhoeretmePhio.elwfrleoRisrrEvZsTtEthisTeimumsepaspnPtdlisvne 5-128 BACK OF CHASSIS--\ J5 J4 J3 J2 WINCHESTER CONTROLLER BOARD CONNECTOR FIGURE 1 viarea.s - TEXAS INSTRUMENTS INCORPORATED DIGITAL SYSTEMS DIVISION HOUSTON. TEXAS 5-127 2223220 REN SHEET 8 DWG --_---- 2223220 #* 'SH 11 | IOWRITE~. The I/ write sisnal is rnormallvy driven b the svstem eprocessar and indicates that the [/0 device addressed bv the address bus should accert the data on the data bus. This sismal can be driven by an expansicn card after the CPILI ENABLE line is asserted., This sional is active low. IOREAD-. The I/0 read tine is normally driven by the svstem processor and indicates that the I/0 device addressed by the address bus should place its data on the data bus. This sisnal can be driven by an exPansion card after the CPU ENABLE line is asserted. This sisnal is active low, REFREZHING. This Vine indicates that a memorv refresh cvcle is takine place. It is positive true. While this line is asserted all bus activity should be isnored, P ENABLE. This line, when asserted low kv an exPansion card, causes the pProcesser to cive wp the svstem busses and enter a wait state. This allows an expansicon card to imPlement IMA ar another Processor. When asserting this line, the expansion card must wait until the svstem busses are inactive (MWRITE, MREALD, ITWRITE, IOREAD all inactive). When deassertina CPU ENABLE the expansion card must first wait until the bus has been inactive for two pProcessor clack eweles, assert the WAIT- tline, deassert the CPU ENABLE line, and cantinue to hold the WAIT- Tine far one addtional clack zvcle. This will allow the swstem Processar to correctly execute its next bus cvale. * INSTRLUMENTS DATA EMZ SR DWG 2223220 1SH 10 : # DATA 0-7. These bidirectional sisnpals carry the data between the processar, memory, I/0, and the expansion interface., These lines are active hiah. i # ANDR 0-19. These lines are normally driven by the svstem pProcessor to address memoary and I/0 devices within the svstem. Thev can be driven bv an exPansion card by asserting the CFU ENABLE line low., These lines are active hish. Onlwv XA0-XA? are used for I/0 addressins. : ' # ADDRES3S LATCH. This line indicates when the pProcessor is placins a valid address on the address bus. The address is valid on the fallins edoe of this signal. # SYSTEM FAULT-. This si=nal is driven bv one of the expansion cards te interrupt the svstem pProcessor. Its ' ! normal vse is to indicate a swvstem error condition. : # WAIT-. This sional is used te indicate when a device in i the svstem or expPansion bus is to held or holding the ' system processor to extend the lenath of a memory or I/ ! crcle. A slow device an the exPansiaon bus can assert : this line low when it is addressed to extend the time it | has to complete a cycle. An expansion card which takes ! aver the bus must monitor this line when accessins | memsry or 1/0 devices within the svstem. This line. ! should never be held lTow longser than 10 PROCEZSZOR CLOCK § cvoles. ! # INTERRIPT O-&. These lines are wused to signal the pracessor that an I/0 device resuires attentivn. In the event wof several devices reauiring service at the same time, the device assertine the lowest numbersd line sets serviced first. These lines are active hish. # MWRITE-. The memorv write signal is noermallv driven by the svystem processor and indicates that the information on the data bus should be written to memory at the address siven on the address bus. This signal is active Tow, This sisnal «can be driven by an expPansien card ! ' ' ' after the CFU ENABLE tine is asserted. # MREAD-., The memory read sizgnal is normally driven bev the svstem eprocessor and indicates that the memarwy addressed by the address bus should be pPlaced on the data bus. This sisnal can be driven by an exPansion card after the CFU ENARLE line is asserted. This siznal ! is active low. TATE DATE 12--10~ 5-129 12/14/83 PART MNUMBER REV 2223219-8001 8 ITEM. QUANTITY. 0001 00001.000 List of Materials DESCRIPTIONsss evsooccsoccoenssccasccccss COLOR ,MONITOR,120,VAC/SPARES COMPNENT.. DESCRIPTION.ceccscocrcrsssaccocccsscsnas 2223219-0001 MONITNR, COLOR 1669-0000-000 UM FA 12/14/83 PART NUMBER REV 2223219-8002 8 ITEM, QUANTITY. 0001 00001.000 DESGRIPTION,ccosescososcccoccscnasascnce COLOR 4MONI 222T , VN AC/R SP, ARES COMPONENT.. DESCRIPTINN . cceccsccsnsnccss 2223219-0002 COLORMONTTOR,222 VAC 1669-0000-000 ccsccas UM FA - 5-126 REQUIREMENT 3.12 CONNECTORS ) 3.12.1 VIDEO CABLE. THE VIDEO CABLE CONNECTOR TO THE COMPUTER SYSTEM UNIT SHALL BECPSVEAHIIQBADNULLEOIELOUVATALWCEIOMNBITENASTHLN.EESCHTTTOHEOEWRR9TNHM.EINPMIAINOVTNNECEINATDTDBaOOLbDRREleINSUSLBHET3A AN-ME6LGIRC.LTNMOHIINANNPTAERTUTCOHRIETEVSEDOIRDMEOCMNEOWCIANIOATTSNMOHUEPR1RCAETTMDOIEETRBTNHLEDIERSAASMOPF+W/IC-TOPOTH/HNVNENE1ER0TCACH2VTLMEI0OLD5RE2.SVQ0EH4NIL-DEEC4OLNARDGB'TETL'HODHESER INCLUDING CONNECTORS. Table 3-& SYSTEM SIGNAL CONNECTOR PINOUT PIN 1 2 3 4 S o 7 8 9 SHELL SIGNAL LOGIC GROUND (TIED TO PIN 2) LOGIC GROUND (TIED TO PIN 1) RED VIDEO GREEN VICDEQ BLUE VIDEO N CONNECT NO CONNECT 4 HORIZOMTAL SYNC VERTICAL SYNC CHASS1S (EARTH) GROUND TM < (:) 3.12.2 POWER. TCACUALAQ5(.NFANROEEICDTBIENGNR0HELTAGN1NMARESS0TAEISMFHLCNSATT1AHXAFOSTEIRPRRSGEIMORHERNDCUMIAOCSZGMLLUEIARMLNPDIOOTAD(EVUNHOCOI1ENERI,FNIDDTT)BBOOEYMTRR11OH9.2AAEN82POWAI30NPIT,6MRRG0PV1MEOO0OI5MR#VWCAOTOTFEETR-HNH,WSDRODETIHHERHSTEANMONL.CCBRLLAECEACOBFNAGAPMLSDOB/GUEWBEURLNLEIAH.EEREVSI5EACWULTTLHRHEEAE1EENRSSNTA3DGOMHSPT6ARTAIRE3)REHLIENM-.SFTMLLBA2IHRAL0TESOXSYEIMTIHSDO1M,AOBERULENLOOTSMLDARNHH1TTEAG9OEL8ABOLL3IFEN,BUEM1XNEE2IITL2GATFBTTAD0EHR3TPSLEMEO-HAMMNMECRI.IOANPRCCNNLIOOHETDMTLMINAECHUIPEUMNEGSCE/NELMTRNTSIICTAGIVMTHLMRSEUE3ODOMIFSOwRMFi.FGTITH3RCA9CTHTT-OA1AH3UOB4BITSTNLMLRRH'HOT8DEEMDESIENA UNIT AMD PROVIDED BY TiE VENTZOR. © T xAD INGTRUMENMTS, TNC. owWN DATE ISSUE DATE 01 /04, G 3-295 SIZE | FSCM NG Al 96214 SCALE A 5-1256 DRAWING NO 222321 SHEET ~ REk) A 1 REQUIREMENTE Table 3-5 SERVICE CONTROLS HORIZONTAL HOLD VERTICAL HOLD SUB BRIGHT VERTICAL SIZE VERTICAL LINEARITY FOCUS VERTICAL CENTERING HORIZONTAL WIDTH RGB DRIVE RGB BACKGROUND 3.9.2 OPERATOR CONTROLS. THE POSITION ENCLOSURE. GR OFF, MONITOR SHALL HAVE SEPARATE INTENSITY, AND POWER ON/OFF CONTROLS LOCATED GM THE AN INDICATOR LAMP SHALL INDICATE WHETHER HORIZONTAL FRONT OF THE POWER IS ON 3. 10 PELIABILITY 3.10.1 MEAN TIME BETWEEN FAILURES. 1 THE EXCLUDING MTBF FOR THE CRT. THIS MODULE SHALL BE GREATER THAN « 20, 00 HDURS 3.10.2 PREVENTATIVE MAINTEMANCE. NO PREVENTATIVE MAINTENANCE SHALL BE REQUIRED FORF THE MOMITOR ELECTRONICS. Y TEXAS JHSTRUMENTS, INC. N15 DWN DATE 3-20 SAIZlE | FS9CM 6NG214 DRAWING NO C22521 A REw TEXAS oIkNST RAtUMs UNTS Daras Toavas 5s0eoaTe 01/0a/3" Yo SCALE SHEE T A 5-124 REGQUIREMENTS 3.6.2 VIDEO INPUT IMPEDANCE. THE HSYNC AND VSYNC INPUTS SHALL HAVE IMPEDANCES IN EXCESS OF 1500 OHMS. VIDEO INPUTS SHALL BE 1 SCHOTTKY TTL LOAD EACH AND BE TERMINATED TO GROUND BY A 1000 OHM RESISTOR. 3.6.3 VIDED AMPLIFIER BANDWIDTH. THE VIDED AMPLIFIER BANDWIDTH SHALL BE A MINIMUM OF 25MHZ AT THE -3DB POINTS OF THE AMPLITUDE/FREQUENCY RESPONSE CURVE. 3.7 CRT ARCING ADEQUATE PROTECTION SHALL BE INHERENT IN THE DESIGN OF THE MONITOR TGO PRECLUDE ANY CIRCUIT DAMAGE AS A CONSEQUENCE OF CRT ARC(S). 3.8 POWER TURN ON AFTER POWER RESULT DUE TO VERTICAL SYNC. TURN ANY ON, NO PERMANENT MONITOR FAILURE INSTABILITY OR LOSS OF HORIZONTAL SHALL AND/DR 3.8.1 POWER OFF. WHEN THE MONITOR IS TURNED OFF, NO IMAGE SHALL REMAIN ON THE SCREEN WHICH COULD CAUSE PHOSPHOR BURNING. 3.9 CONTROLS 3.9.1 SERVICE CONTROLS. SERVICE ADJUSTMENTS SHALL BE PROVIDED AS SHOWN IN Table 2-E. TExat (HETRUMENTS, INC. -[5% DWN TEXAS INSTRUMENTS [S508 DATE DATE fio sy 01/irk 4835 Al 96214 SIZE |S=FS1C9M NO DRAWING NO 2223215 . A sl Seet Z 5-123 DWG NO | REQUIKEMENTS Table 3-4 VIDEO AC PARAMETERS REF PARAMETER VaLUE A A~ VIDEO DOT FREQUENCY B~ VIDED DOT PULSE WIDTH C~ CHARACTER BLOCK HORIZUONTAL D- CHARACTER BLOCK VERTICAL E- NUMBER OF CHARACTER LINES F~ NUMBER OF CHARS/CHAR LINE G- NUMBER OF ACTIVE SCAN LINES H- TOTAL SCAN LINES J- VERTICAL SYNC WIDTH K~ VSYNC FRONT PORCH L~ VSYNC BACK PORCH MN- VERTICAL DLANKING INTERVAL ACTIVE VERTICAL DISPLAY TIME P-- TOTAL VERTICAL TIME G- VERTICAL RATE R-- HSYNC WIDTH S~ HSYNC FRONT PORCH T- HSYNC BACK PORCH UVW- AHCOTRIIVZEONTHAOLRIZBOLNATNAKLINGDISIPNLTAEYRVATLIME TOTAL HORIZONTAL TIME X- HORIZONTAL RATE 18. 000 i% 95%55 1% 9 12 (13) 25 80 300 (350) 320 (383) 0.156 (.156) 1% 0 (0) 1% 0.884 (1.6644) 17 1.040 (1.82) 1% 15.60 (18.20) 1% 16.63 (20.02) 1% 60.10 (49.9%) 2 4.50 1% 2. 00 1% 5. 50 1% 12.00 17 39. 99 1% 51.99 % 19231 100 NOTE NOTE 1: 2: TAVI"NIASREMLSFIUEF"NEMIGSBGLULYREAEITNDTJOEUN3PRLS-ASY7TR.MEENRANTNETHDFSEERSREEFSOFTRLO E4CPTSTPOILHMYZIVNEGRRTTOEIFDCRI-AEA0LSG0HR0.2AM ~ UNE Y MHZ NS¢ DOTS SCAN L {WHEE ROWS COLUMNS SCAN LINES SCAN LINES MS MS MS MS MG MS HZ us us us us us us HZ TEXAS [MNQTRUMENTS. ING, 3-163 r . MI o EXAS INICoNHESmTE RATUMY ENTS Dartas Tewas OWN DATE ISSUE DATE 01 /08, e Al 96214 SIZE | FSCM NI SCALE 2223219 DRAWING NO SHEF oRE' 5-122 HORIZONAL VIDEO HORIZONAL SYNC VERTICAL VIDEO VERTICAL SYNC --e K --enf p-- e b | FIGURE 3-7 VIDEO TIMING DIAGRAMS P TEXAS INSTRUMENTS INCORPORATED DIGITAL SYSTEMS DIVISION HOUSTON. TEXAS 5-121 2223219 REV SHEET 25 REQU Tr Mz iR 3.5 3.2 BRIGHTNESS LEVEL. WITH THE BRIGHTNESS CONTROL SET AS SPECIFIED IN THE PREVIOUS PARAGRAPH, ALL VIDEO INPUTS ON, AND A FULL SCREEN OF WHITE REVERSE VIDED GCCUPYING THE VIEWABLE AREA, THE BRIGHTNESS LEVEL SHALL BE GREATER THAN 15 FOOT-LAMBERTS IN THE CENTER OF THE SCREEN. BRIGHTNESS UNIFORMITY OVER THE ENTIER SCREEN SHALL CONFORM TO SPECIFICATIONS IN THE NEXT PARAGRAPH 3.5.3.3 BRIGHTNESS UNIFORMITY. OVER THE ENTIRE VIEWABLE AREA THE CONSTANT WITHIN +/-20%, AT A BRIGHTNESS LAMBERTS. BRIGHTNESS SHALL BE MEASURED LOCATIONS (CENTER AND FOUR CORNERS). BRIGHTNESS SHALL BE LEVEL OF 10 FODOT- AT A MINIMUM OF 5 3.5.3.4 FOCUS THE MONITOR SHALL EXHIBIT A SHARP FOCUS OVER THE ENTIRE VIEWABLE AREA. THERE WILL BE NO BLURRING OR FUZZINESS OF INDIVIDUAL DOTS WHEN OPERATED AS SPECIFIED IN THIS DOCUMENT 3.5.3.5 JITTER. UNDER NORMAL OPERATING CONDITIONS, NO MOVEMENT GREATER THAN ITS OWN DIAMETER. PIXEL SHALL 2 EXHIBIT 3.6 SIGNAL TIMING THE MONITOR SHALL BE REGUIRED TO OPERATE AT THE RATES SPECIFIED IN Figure 3-7 AND Table 3-4 3.6.1 SIGNAL LEVELS. VERTICAL SYNC SHALL BE A NEGATIVE TRUE TTL SIGNAL. HORIZONTAL SYNC AND THE RED/GREEN/BLUE VIDED INPUTS SHALL ALL BE POSITIVE TRUE TTL SIGNALS. A TRUE OR "ON" CONDITION SHALL BE DEFINED AS A "OFF" CONDITION VOLTAGE BETWEEN 2.4 AND 5. 25 VOLTS. A FALSE OR IS A VOLTAGE BETWEEN 0.0 AND 0.4 VOLTS. DRIVE CURRENT IS PROVIDED BY A 74L.5244 BUFFER ON EACH VIDED LINE AND HSYNC, AND BY A 74586 DEVICE ON VSYNC. THE MONITOR SHALL OPERATE OVER THE WORST CASE OUTPUT CHARACTERISTICS FOR THESE DEVICES AS DEFINED IN THE TI TTL DATA BOOK TEXAS INSTRUMENTS. INC. Ili i g TExAS oI:;¥RrIs`kME.\'TS owN DATE SSUE DATE 01/06/8 Te 204594 3-16 SIZE | FSCWTM NC A 9621 4 ORAWING NO 223M% A REV gt St =4 A 5-120 REGUIAEMENTS 3.5 DISPLAYED COLORS AND BRIGHTNESS 3.5.1 COLORS THE MONITOR WILL BE CAPABLE OF DISPLAYING THE COLORS SHOWN IN Table 3-3 Table 3-3 DISPLAYED COLORS VIDEQ INPUT {GREEN! BLUE ! DISPLAYED ' COLOR OFF IOFF OFF IOFF OFF {ON OFF 10N ON {OFF ON (OFF ON {ON ON ION | OFF ! ON i OFF i ON | OFF | ON { OFF t ON i BLACK ! BLUE ' GREEN { CYAN ! RED ! MAGENTA ! YELLOW i WHITE U3CWCMIO.OITL5NTHO.T.R2RONLOWLSIECTVOTHELROLOFASRC,AELTSLHAEDIJVONUFIAMSDDOTEENOMDIQTETUHNOAETRRTI.NEPUSCTOODSLEOGTARSHAOSENU,STSOSDIUUTNEPHGIEPNLSTIUOSOERRCRERMEIOEUSSTNTHAHEADLJSOLUFHCSAOTLLASLMODPERJENUCBTSEIPTFUIRAOCIFTTAHPYTEUIIRNOEDNIIONFVTIEWCDROHNULITAAOTHLLREE CONVERGENCE. 3.5.3 BRIGHTNESS BRIGHTNESS MEASUREMENTS SHALL BE MADE WITH A 759 FOOT-LAMBERT METER, OR EQUIVALENT. BRIGHTNESS IS MEASURED FROM THE AT THE CENTER OF THE RASTER AT A DISTANCE CRT FACEPLATE. AMBIENT LIGHT SHALL BE SUCH WESTON MODEL DEFINED AND OF 50.8 MM THAT IT DOES NOT AFECT THE BRIGHTNESS MEASUREMENTS. 3.5.3.1 BRIGHTNESS SETTING. WITH THE FRONT PANEL MAXIMUM, AND NO RGB VIDEO BRIGHTNESS SERVICE CONTROL BRIGHTNESS INPUTS APPLIED SHALL BE SET (INTENSITY) CONTROL SET AT (BLACK SCREEN), THE SUB- S0 THAT THE BACKGROUND RASTER 1S5 NOT VISIBLE. -- TEXAS INSTRUMENTS, INC. S DWN DATE 5 ot 11/05/82 TEXAS INSTRUMENTS [1550F OATE T1-20458A 3-15 SIZE | FSCM NO A 9 6 2 `| 4 DRAWING NO 2223219 soms sat 23 ` 5-119 - REVISIONS DESCRIST-ON T "vare '"-':_ i o | aeproven :r`?:; o - BEY, SHEET REV STATUS OF SHEETS or»«mu%ssssgscsso 2223219-0002 COLOR MONITOR, 220 VAC 2223219-0001 PART NUMBER COLOR MONITOR, 120 VAC DESCRIPTION A 23124125 REV SHEET TWR A, ALAIATALA AlA AlB|B A (26 (27 |28 [29 (3013} [32]3334 | 3536|237 {38] 3P4 o4l (42 8 AlATA AlAJAIALA A A A A tl213lals|elrlalolo |v2[rahalis|ic]i7|igfiof2o]2|212 ROY D DATXBY,/19/82 @ ° TEXAS INSTRUMENTS INCORPORAIED ) A/82 | . Digta) Systema Group SI-METRIC QA` < L & £ [ LTHISD ANGLE PROJECTION] (o gy APVE-MFG o LT S 7 7 " COLOR MONITOR SPECIFICATION S|ZEA[FlSCoM 6NOees 2 SCALE NONE 40) 5-118 DRAWING NO 222321 9 SHEEY ] (F 42 TAyME TMi 5 A 4 g Y<W<MN.r_ SAYYWIN 52 - 24 e 4 2 4 22 -2 0f - 1d 62 4 L2 ¢ 52 - 14 flmImM_www_q_&wfin_n.uMmvw vflp"u%flrww_flww--u(&xnhn%um vw aNNOYY A * aNno¥o FPNLYNOIS » LHM/A18/NyD OMY b2 5¢ LHM/%18/03Y ve 034/%18/LHM 0{ 2 Q34/1HM/ATE MY b2 22 mW Mmv. NOILdI¥ISIa J"AiOINM 7 TEXAS INSTRUMENTS INCORPORATED REV A 2223107 DIGITAL SYSTEMS OIVISION HOUSTON, TEXAS SHEET T1-132186 5-117 ¢ s | A x_ . " : | i : Ll - £ . I [ v . `ON ot Y/N . o Syavway 12 - 2d 3 {) 2 - 1d 1z b 61 61 81 oz 0 9¢ 91 1e st 2 L vl 3 : 21 T 1 2t ! 11 OIENE ot | 6 | 6 g 8 A A L g ] 9 Sl g v v £ Y z v - 2d 1-1d NOUVIS z%_»uwzu%mnv | | ININOIWOD NOUVIS Z%WWMMMU i ININOJWOD aNNOYY ) 4 aNNoYD -NO1L0373S -1IN1 -170v4 Q334 0Ly IIT NO ON339vd ASNg -3903 THONNDY 8 vlvg L vIvg 9 VLvg 5 viva v viva £ Vv z vivg 1 vLva -38041S V1vQ R ANLYNOIS m m i - N4I/NYO BV b2 N¥9/03¥ a3y/n1g 034/N¥0 3/t | a34/118 1HM/me LHM/NYD 1HM/QTY LHM/ 18 Aa/ma A19/N¥0 ¥18/Ny9 ¥18/03Y %19/ 1HM n18 NYO NY¥9 a3y ¥ A8 oMy b2 NOILdII$3a < oz} 61 m = gt | & a g il ar v ie . £1 21 mm5mm3_mfim 1 mumm ot m-mn s &° 8 L 9 5 v £ Z 1 um_fl J-- TH-132148 5-116 12/14/83 PART NUMBER 2223106-5001 REY G ITEM. QUANTITY, 0003 00025.000 0004 00002.000 0005 00006.500 0011 00000,003 List of Materials DESCRIPTIONceacessosocccosossocsncssnncns BULK CABLE ASSY,PARALLEL,PRINTER COMPONENT.. DESCRIPTION:cocsscoccossscoscnvosccssscs 0539430-0003 221031 7-0001 2210505-0007 0972361-0003 CAMOPNTACT,-20P5I2N 02-2 24-20AWG ST 068 INSUL DIA L0A8B5E4L8»0~B-LSALNPKF,-C1A9B3L1F9-4MARKFR CABLE,SHIFLDED,25 CONDUCTORS SEE TI- DRAWING TAPEFNAM, VINYL,SELF~ANH.25THK .50WIDE 012624-V548 UN EA EA FT RL 12/714/83 PART NUMBER 2223106-5002 REV G iTEM, QUANTITY. 0004 00002.000 0005 00007.000 0007 00001 .000 0011 00000.003 DBUELSKCRICPATBILEONcAcSoScYossPcAoRcAaLsLoEvLasoscaconscsnccns COMPONENT.. DESCRIPTINNeecccscsssa-csessscccsccascns 2210317-0001 2210505-0007 2211389-0001 0972361-0003 OLARB5E4L80y-BSLLAPNFK-,1C9A3B1L9F~4 MARKER CABLE,SHTELDEN,25 CONDUCTORS SEE TI- DRAWING LUG, SEE RING TI~- TOMGUE,20-24 DRAWINMG AWG TAPE FOAM, VINYL, SELF-ADH,25TUK 012626-V548 < .SOMNTDE UM Fa FT EA PL . 5-115 12714783 PART HUMBER REV 222310 6-0001 G ITEM, QUANTITY., 0001 00001.000 0002 C0001.000 0006 00001.000 0007 00001.000 0008 00001.,000 00909 REF 0010 0012 00091.000 REF o101 00001.000 List of Materials DCAEBSLCERIPATSISEOMNR.LsYe,coPsAcRvAoLsLsFcLc,sPsRsIsNcTnERcccnnssone COMPONENT.. 2220401-0003 2220380-0008 0414127-0001 2220555-0001 DESCRIPTINNcecescnsoscsncconnccscsancane UM CONNECTLUO G,R2, 5X{ 420 ANG EA CABLE CLAYP ASSY,.400 SEF TI- DRAWING IN. DIA. CARLE ACC FaA CONNECTOR, PLUG=36 CONTACTS EA LUG,BARE,45 DEGRFF,R4 SCRFW HOLF,LOCKING FA 2223107-0001 WIRE LIST PT TO PT PRL PTR CARLE ASSY EA 2265070-0001 SPEC, PRE-PRINTED CABLE MARKER FA 2220797-0012 2362997-0001 FERRULE, 4 175" SEE TI- DWG ASSEMBLY +PACK,CABLE FA FA 2223106-5001 B1U6L5K0-0C0A0B0LE~000ASSY,PARALLEL,PRINTER EA 12714/83 PART NUMBER RFYV 2223106-0002 G ITEM, QUANTITY. 0001 00001.000 00014 0002 00901.000 0006 00001.000 00064 0008 REF 0009 REF 0ol0 00001.000 0013 00000,000 0014 00001.000 0101 00001.000 NDESCRIPTIONcesaveeccncanssoscoccancasscne CABLE ASSY,PARALLEL,PRINTER/850 2 COMPONENT . . DESCeR cocY cosI essP asosT scnI ccaN cnaN scces (M 2220767-0002 2220380-0008 2220674-0001 2223107-0001 CONNECTOR, PLUG¢25 CONTACTS ,2-POW,22~26AG FA SEE T1- DRAWING P2 SEE TI- DRAWING CABLE CLAMP ASSY,.400 IN. DIA, CARLE ACC EA SEF TI- DRAWING CONNECTOR,RND CA T0 PANFL, PLUG,STL SHFELL FA SEE TI- DWG Pl SEE TI- DWG WIRE LIST PT TO PT PRL PYP CARLE ASSY EA 2265070-0001 SPEC, PRF-PRINTED CARLF MARKFR Ea 2220797-0012 FERRULE,.175TM FA SEE TI- DWG 0414127-0001 CONNECTOR, PLUG-36 CONTACTS FA 2220827-0003 CONNECTOR,COVER,CAP,DR HOOD EA SEE TI- DRAWING 2223106-5002 RULK CABLF ASSY PARALLFL EA 1620-0006-004 5-114 15t TARLE #2: RECOMMENDED PARTS LIST Note: This Parts List does not include incidental hardware. This hardware and any substitutions for the assemblies listed are at the discretfon of the vendor, but the completed cable meet the requirements set forth elsewhere in this drawing and must be approved by TI. Item Reference Desig. Vendor T1 part # Vendor Part # 5 Cable Beldon Corp. P.0O. Box 1331 Richmond, In, 47374 2210505-0007 9543 Amphenol Connector Div. Bunker Ramo Corp. 2801 South 25th Ave. Broadview, I1, 60133 2220674-0001 157-32360 AMP Iac. P.0. Box 3608 Harrisburg, Pa, 17105 2220767-0002 745496-2 2 Cable Clamp AMP Inc. P.0. Box 3608 2220380-0008 745173-3 Harrisburg, Pa, 17105 « 4 Marker, Cable W.H. Brady Co. 2210317-0801 SLPF-19319-4 2221 W. Campen Rd. P.0. Box 2131 Milwaukee, Wi, 53201 NOTE: Item #2 may be replaced with a foil EMI shield and thermoplastic shell per section #3. p f b 24 TexAs INIvNaRSeTORRATUIMD ENTS 0.4 o105 2590 OKWLN UNKERT ISSUE DATE 0 ATE 07-06-83 SI2 FSCM NO A 96214 DRAWING NO 2223106 scate NONE 12 A REV 5-113 [>=c0) y TABLE #1: WIRE LIST FOR CABLE 2223106 Vire # 1 2 3 4 5 6 7 8 9 10 1 12 13 14 15 16 17 18 19 20 21 22 23 24 215! Calor Rlack White Red Creen Orange Blue White / BRlack Red / Black Green / Black Orange / Black Blue / PRlack Black / White Red / White Green / White Blue / White Black / Red White / Red Orange / Red Blue / Red Red / Green Orange / Green Black / White / Red White / Black / Red Red / Black / White Green / Black / White P} Pin # L 2 3 4 5 6 7 8 9 10 11 12 13 14 32 31 36 33 19 <21 23 25 27 29 30 P2 Pin # 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 ~ 21 22 23 24 25 f e DWN GATE SiZE | FSCM NO DRAWING NO REv C KLUNKE RT 07-06-83 A 96214 2223106 G TEXAS INICNakSeToRRAUTIMD ENTS D115 Terss 25910 Fesre sy 2 scate NONE SHEET 11 5-112 0 | Fanoid G sueet (O 2223106 DRAWING NO 5111 scate IJONE Jv'f' 1.6 S3 A 96214 ZE FECM AT --=--i0"1570°20! e i e e G OO O i i e o) DATE RUMENTS 1SSUE DATE DwWN (NOTLVDTATINIGL "dWY1) 379YD Y3IONN 03¥NJ3S ANV 319vD ONNOYY G3ddviM 39 OL 11 W3LI (NOTLVIT4IINIAL S ¥IYNLIVANNYW)<~ Ay *90TE22Z WIGWNN Lyvd 11 `2d $1X3l B B S, ¥FUNLOVANNYIW¢) AJ¥ 901222 ¥ISWNN L¥Vd 11°Td "¥IINI¥d 137IV8vd 1x3L | v £ W3LT 907 ¥3070S A9 M3YIS dWv13 318YD 01 QILYNIWYIL 38 01 JYIM NIVYQ Td [2] TATEWISSY dWY1) 378YD 40 STI3HS WYTD Y¥3IANN Q30704 IYIM NIVYO 24 ¢ W3LT HLIM Q30NTONI SM3IYIS Y3INIVLIIY ANV SMIYIS dWY1d 3718YD 1 I 2 10314123dS 3SIMI3HIO SSIINN $S310N N Marhing The warling texts listed in Vigure #1 shall be (ixed on the cable using the marker described in TT drawing 2210317, Marbaicg method js optional. favirarmental \nhient temperaturo: Dperatine: 5 to 6N deprecs , Yor-operating: -30 to 70 deprees C. Relative humidity: iv to 90% i(non-coondensing) Apency Requirements Cable reels within the manufacturers facility per UL 83, UL 62, CSA 22.2 no 127, CSA no 299 requirments shall be marked and CSA 329a The cable assembly shall be UL listed under UL 478 for use with electronic data processing units and systems. Vendor 1is responsible for obttaining and maintaining UL approval of the cable assembly. All cab'es shall bear the UL listing mark. The manufacturers fdentification and date code shall appear on the jacket or molded connector housing portfon of the cable wherever convenient and clearly visable. The UL listing mark is to be placed within 6 inches of the connector marked Pl, QUALITY ASSURANCE PROVISIONS > Responsibility for Inspection Unless otherwise specified in thke contract or purchase order, the supplier is respoasible for the performance of all fas- pection requirements specified herein. Except as otherwise specified in the contract or order, the supplier may use his own or any other facilities suitable for the performance of the {nspection requirements specified herein, unless dfs-- approved by the procuring activity. The procuring activity reserved the right to perform any of the inspections set forth in the specification where such inspections are deemed necessary to assure supplies and services conform to prescribed requirements. It oWy DATE KLUNKERT 07-06-83 BN R A 96214 O AWING NO 2223106 REV c Trxas INSTRUMENTS 155UE DATE scate NONE SHEET 7 A 5-110 .2.2 .2.3 Connectors Materfal: Housing and covers for Pl will be metal, and thermoplastic overmolding, UL flammability rating 94V2 for or P2 hetter, CSA 356R stacdard UL 478, compinents. (NOTF: CSA certified in primarv circuits). and shall be UL recognized components are required only Cortacts: A1l contacts will be Gold Plated surfaces. Crimp-type plns shall be bkright the surface that the wire is crimped to. on thelr cating ti{n plated on Connector Current Rating: 5 Amps / Contact Contact Resistance after Durability Testing: 5.5 maximum. DNurabilfty testing shall consist of 50 tions and removals of mating connectors. wOhms fnser--- Assembly Shielding: Fach connector shall be continuously shielded to conform with FCC Part 15, Subpart J, concerning EMI emmis- sions of computing machines. This may be accomplished through the use of a metal shell to which the cable "drain" wire is attached by means of of foil surrounding it which solder lug, is soldered or through the use to hoth the connector body and the drain wire. If the foll method is used there nust be a protective plastic cover over 1t. Strain Relief: Both coanectors shall be be provided with strain relief through the use of either metal backshells or thermoplastic backshells. If metal backshells are used, provision must be made to insure that the clamp does not break the outer jacket of the cable. Dielectric Withstanding Voltage: 50-60 Hz. 1000 Volts RMS minimum, Mechanical: Table 2 are by the same etc. ), and If hardware other than the ones recommended in used, they must be secured to mating connectors method ( I.E. springclamps, machines screws, must be dimensionally equivalent. Voltage Rating: 300 VAC RMS for continuous use. g DwWh DATE KLUNKERT 07-06-83 SIZE | FSCM NO A 96214 DRAWING NQ 2223106 fAEV G TEXAS nLIoNkPSuTARTHUYMENTS 3 ax Taust 0.769:0 Freereraee 2scate NONE SHEET 6 5-109 3.0 RFYUIREMENTS ST Physical See Figure i1, Talle L and Table 2. 312 320! Materfals and Comstruction MM4osabstre7rhahap8eeatteleecealrridnandiifnovveaaitdevilbleirersdcso,CseenSpfplmAeieyhecnretnfiirmoit2fesa2naaiihn.ilfemne2esfe.dsnhee,ttecNcstoo,aennWaadaddnlh1ldei5mant4namw.idthawtoeerhintnrekthsmiiehaansrlegrtkxsmesalpaqpnnoteudsgsecibsseriarhdlffeaelailmxfleleopsdtnrootbsesnuocotirtrnhaeuecsohefcbtdlhlstiaoitptsssoahwstrrihsetsaiodrgclr,oehvfa,dsewrhniaawmctnlwiragolilat.pnlceegpkrre.,biraeeatnMliaasUafnbLsrlglkoewi,ng Cable UL Style 2464 Cable, capable of passing VW-1 Vertical Flame Test. All wire & cable material used must be UL recognized CSA certified, and must meet UL - VW-1 Flammability and standards., Capacitance between conductors: 30 picofarads / foot. Conductors: Tinned copper, standard lated by PVC 0.25 mm thick nominal. 24 AWG, (7 x 32), insu- Shield: wire. 100Z coverage, aluminum polyester, number 24 drain ` \.I\i~L\2 e owN DATE KLUNKFRT 07--0066--83 Si2E | FSCM NI A 96214 DRAWING NO 22 23106 REY G FExAs (NICoNuSraTnaRcUrnMENTS s 2 was Teas T sg 3scae NONE SMEET 5 6-108 ______ n CONVERSION CLART | ----------- Fommmemee KRB | INCHES | ---------------------- fomemme ¢ 0.25 } 0.010 | 0.5 | 0.02 | 3.18 | 0.125 | 102.0 +/- | 4.0 +/- | 51.0 | 210 | 1066.8 | 42.0 | ----------- Fommmm et 11823109..02 +/- || 724.80.0 +/- || 15.0 | 0.6 | ----------- dommmemmea ---K-IL-O-S----- t| ommmmmLBS | e m--a} 14 | 31 | THIS IS A COMPUTER GENERATED DOCUMENT, (_L)e-- 23 I 51 | DO NOT REVISE MANUALLY. CONTACT ----------- oot COMPUTER-AIDED-DOCUMENTATION GROUP. mmmmc--me e m e --ndm bbb e e b oo m b mp e m b eb e b e b REV. sTATUS | REV. | G| 6l 6l 6l ¢l ¢l ¢} ¢l ¢l el 6l 6t | I | -- | e e p1 mm | == ] OF SHEETS Fomme e e e o e b mm e e e m b mp e et b m o -- e | sHeeT!| 1) 2! 3] 4] s| el 71 81 gfrofrrir2y |+ | + | | | ------------ oo --b o bbb mt bbb o bbb b m-- - -- unless other- | DATE | Texas Instruments | wdiismeenssipoencsifiaedre|l in millimete tolerance: Ors| | CDWHNK_MD.UBNIHAEMHL____0065--0194--8822]] EANPGVR__MM..KKEENNDDFELL___0066--1100--8822]| Incorporated Data Systems Group | SI-METRIC angles +/- 1 | QA R.cAPAM__~~ 06-10-82]| 21 ppllaaccee ++//--0.25.=5| MRFELG__MSI.KBERIDWGOELNF___0066--1101--8822]} CABLE ASSEMBLY, PARALLEL, PRINTER s ¢ Trxas INSTRUMENTS oA oW KLUNKFRT FgsteoaTe 26910 540 DATE 07-06-83 SIZE | FSCM NO A 9621 4 scaie NONE A 5-107 DRAWING NO 2223106 SHEET REV G 1 oF 12 DB / SUGGESTED SOURCE{S) OF SUPPLY: 1. BELDEN CORPORATION P.0. BOX 1980 RICHMOND, INDIANA 47374 2. VICTOR ELECTRIC WIRE & CABLE CO. 618 MAIN ST. WEST WARWICK,R.I. 02893 TEXAS INSTRUMENTS PART NUMBER 2223105-0001 SOURCE 1 IF-4310 MANUFACTURER®S PART NUMBERS SOURCE 2 SOURCE 3 T80 Ti~4239.E {'ib TexaOsN COOIRNMaSnPTOTRRerAUnTMaoEENDNTS A 2223105 SHEET 3 IREV * 6-106 ROIRFMENTS: P+ ICAL. "TH FIGURE ] 3 CABLE FATICLSE CIFCORGETION S22 At CONSISTING OF 7 STRANDS OF #56 AWG PARE COPPLw WIRE OR 7 STRANDS OF =35 BARE COPPER COVERED SIFEL WiRY. SHELS CONSISTS OF 4 ENDS CF #36 AWG TINNED COPPER SRIRAL WRAPFED OR BRAIDED COPPER WIRE. INTERNAL TNSULATION CF POLYETHYLENE WITH QUTER JACKET AND CONNECTOR MOLDING TO BE L{GHT TAN IN COLOR MATCHING TI COLOR NUMBER 972939-21C1. CABLE ASSEMBLY TO MEET THE REQUIREMENTS OF UL AND CSA. 3.1.¢ MARKINGS PARTS OR WRAPPtR SHALL BE MARKED WITH TEXAS INSTRUMENTS PART NUMBER . 3H]1M3 IMPEDANCE: CABLE IMPEDANCE SHALL BE 755 NOMIMAL. 3.1.4 CONNECTORS: BOTH ENDS OF THE SHIELDED CABLE SHALL BE WITH VICTOR PC-103 PHONO PLUGS OR BELDEN STRAIGHT HANDLE PHONO PLUGS. TERMINATED EITHER STYLE PHG761 SHORT =alij TimezsoE B a1 210 2 B e i == CABLE DIA. 3.81 NOM FIGURE 1 [4 if. i TeExAs INSTRUMENTS INCORPORATED TO S Garan veanss " 5-105 [ 2223105 [REV] A SHEET 2 12/14/83 PART NUMBER REV 2223100-5001 R ITEN. QUANTITY, 0086 00000.000 00864 00868 12/14/83 PART NUMBER REV 2223100~8001 R ITEM. QUANTITY, 0001 00001.000 0002 REF List of Materlals VDIEDSECQRIPCTRIT OMCeOeNsTeRe{cLcLvFcRe,snAnUsTsDe- COMPONENT. 2210759-0001 DESCs sR eenI ncecP ocnT nsvsI ancO nnsaN nsens UM 1Cy5157,QUAD+2/1 LIME uV2-0LIST-S$157 BURN-IN SELFCT/MULTIPLEXER A VS-ULBISSTITT-UST1E57 BURN-IN FOR ITEM 49 V=LIST-S1S7 BURN-IN VDIENSECDRIPCRTTIDOCNOGMeToReOeLcLaEsRo/eSoPsAnRcEnScecccnonscnnae COMPONENT.. 2223100-0001 2231993-0001 DESCRIPTIONececetasseconscnsrssacnacaces VIDED CRT CONTROLLER 1254~3100-060 SERVICE PACK INDEFX-RMR UM FA EA 12714783 PART NUMBER REV 2223100-5001 R ITEM. QUANTITY. 0076 00764 00768 0077 00774 00000.000 00000.000 JorTTe oe7a 00784 00788 0079 0079A 00798 0080 0080A 00808 0081 0081A 00818 0082 00324 00828 0083 00834 00838 0084 00844 00848 0085 00854 00858 00000.000 00000.000 00.00.000 0C000.000 00000.000 00000, 000 0C070.000 00000.000 List of Materials DESCRIPTION.caccses VIDEN CRT COMTROLL COMPONENT.. DESCRIPTION:cecsasccscccacncasccccsacsss UM 2210649-0001 2210614-0001 2210749-0001 2210740-0001 2210621-0001 2210735-0001 2210738-0001 2210604~0001 2210674-0001 2210763-0001 IC+L5125,QUAD BUS BUFFER W/3-STATE OUTPU EA V- IST-L5125 BURN-IN u3o V-LIST-LS125 BURN-IN SUBSTITUTE FOR ITEM 17 V=L IST-LS125 BURN-IN 1C,LS20,.D6~UTAHLPUT NAND EA V-L1ST-LS20 BUPN-IN U3l V-LIST-LS20 BURN-IN SUBSTITUTE FOR ITFM 18 V=LIST-LS20 BURN-IN 1C+$S86+QUAN, 2-TNPUT EXCLUSTIVE OR A V-LIST-$86 BURN-IN u32 V-LIST-586 BURN-IN SUBSTITUTE FOR ITEM 19 V-L1ST-586 BURN~IN 1CoS10sTRIPLF,3-TNPUT POSITIVE AND A V=LIST-S10 BURN-IN u33 V-L157-510 BURN-(N SUBSTITUTE FOR ITEM 20 V=LTST-510 BURN-IN 1C+LS32,QUAD,2-TNPUT OR FaA V-LIST-1532 BURN-TIN U34 V-LIST-LS32 BURN-IN SUBSTITUTE V-LIST-L532 FOR BUIRTNEM-TN21 & 1Cy SO0, QUA2-DIN,PUT NAND A V-L1ST-500 BURN-IN = u3s V-LIST-500 BURN-IN = SUBSTITUTE FOR ITEM 22 V=L I5T-500 BURN-IN 1Cy S04, HEX INVERTERS V-LIST-S04 BURN-IN EA u3e V-LIST-504 BURN~IN SUBSTITUTE FOR 1TFM 23 V=LIST-S04 BURN-TN I1CoLSO4,HEX INVERTERS EA V-LIST-LS04% BURN-IN u3r V-LIST-LSO0% BURN-IN SUBSTITUTE FOR ITFM 24 V-LIST-LS04 BURN-IN IC,LS1744HEX,D~-TYPE RFG W/CNMMON CLR EA V-LIST-LS174 BURN-IN uls V=-LIST-LS1T74 BURN-IN SUBSTITUTE FOR ITFM 26 V-LIST-LS174 BURN-IN IC,SLT4HEX, FLIP-FLOP,SINGLE RATL OUTPUT EA V=L IST-S174 BURN-IN U39 V=LIST-S174 BURN-IN SUBSTITUTE FOR ITEM 47 V-LIST-S174 BURN-IN 5-103 12/14/83 PART NUMBFR REV 2223100-5001 R ITEM. QUANTITY, 0057C 0066 00000.000 00664 00668 0067 00000.000 00674 00678 0068 ¢0000.000 0068A 00688 0069 00000.000 0069A 00698 0070 00000.000 0070A 00708 0071 00000.000 00T1A 00718 0072 00000.000 Q072A 00728 0073 00734 00009.000 00738 0074 00000, 000 00744 00748 0075 00000,000 00754 anTsa List of Materials DESCRIPTION.ssesceovccanccsccnson VINEG CRT CONTROLLER, AUTO-INSERT COMPOMENT.. DESCRIPTINNe.vcocossoconcs esesecvscas UM 2210739-0001 2210660-C001 2210695-0001 2210721-0001 2210764-0001 2210694-0001 2210669-0001 2210662-0001 2219761-0001 2210631-0001 TIS AN -ASCNC7E4P5T0A8BNLE SUBSTITUTE f IC+ 508, QUAN, 2-INPUT PNSITIVE AND EA V-LIST-S08 BURN-IN u40 V-L1ST-508 BURN-IN SUBSTITUTE FOR ITEM ST V=L IST-508 RURN-IN IC,LS155,DUAL 2-LTNE TO &4-LINE DFCODFR EA V-LIST-LS155 BURN-IN ué V-LIST-LS155 BURN-IN SUBSTITUTE FOR (TEM 7 V-LIST-LS155 BURN-IN IC+L5245,0CTAL BUS, XCTVER,3ST.OUTPUT FA V-LIST-LS?45 BURN-IN u7,U8,U9 V-LIST-1L5245 BURN-IN SURSTITUTE FNR ITEM 8 V-LIST-LS245 BURN-IN 1C,L5374,0CTAL D-TYPE FLIP-FLOP EA V-LIST-15374 BURN-IN U10,ULL,U14,U15 V-LIST-LS374 BURN-IN SUBSTITUTE FOR ITEM 9 V-LIST-LS374 BURN-IN I1C+S175,QUAD,F/F,DOUBLE RATIL OUTPUT EA V-LIST-S175 BURN-IN Ul6,UL7,U27 V-LIST-S5175 RURN-IN SUBSTITUTF FOR ITFM 10 o V-LIST-S175 BRURN-IN T1C,LS244,0CTAL RUF/LINE DRIVER/RECETVER EA V-LIST-LS244 BAURN-IN u12,u13 V-LIST-LS244 BURN-IN SUBSTITUTE FOR [TEM 11 V-LIST-LS244 RBURN-IN IC,15166,8-BIT PARALLFL/SERIAL INPUT EA V-LIST-LS166 BURN-IN u19 V-LIST-LS166 AURN-TN SURSTITUTE FOR ITEM 12 V-LIST-LS166 BURN-IN 1CyLS157,0UAD 2-LINE TO 1-LINF DATA SELE EA V-LIST-LS157 u21,y22,u23 RURN-IN V=L1I5T-LS157 BURN-TN SURSTITUTE FOR ITFM 13 V-LIST-LS157 BURN-IN 1y 51634 SYNCHRONOUS 4-BIT COUMTFR A V=LIST-S163 BURN-TN u24 V-LIST-5163 BURN-IN SUBSTITUTE FOR ITEM 14 V=-LIST-$163 BURM-IN IC,L574,0UAL DO FLIP-FLOP W/PSET & CLR FA V-LIST-LS74 BURN-IN u28,u29 V-LIST-1L574 BURN-TN SUBSTITUTE FOR ITEM 16 V-LIST-1S74 BURN=-IN 5-102 12/14/83 List of Materials PART NUMBER REV 22:3100-5001 R DESCRIPTINNcocecscsovoscocvsssscssnssses VIDED CRT CONTRMLLER, AUTO-INSERT I1TEM. 00374 0039 00394 00398 0039¢C 0040 00404 00408 0040C 0047 00474 00478 0047C 0048 00484 0049 00494 00498 0049¢C 0059 i 00504 0055 00554 0056 00564 0057 00574 00578 QUANTITY, 00017.000 00015.000 00001.000 00001,000 00001.000 00001.000 00001.000 00003.000 00001.000 COMPONENT.. ` 0972763-0013 0972763-0025 0219402-7174 0972763-0001 0219402-7157 09729646~0079 0972946-0045 0972946-0065 0219402-7408 DESCRIPTIONcecescoccoscscocscsaoncsasces UM c1 CuCCCCC0CCCCTTT00C0TIIOO3OaSNIIOOIOICNTA1A303400012RE-R9R4-RR--REEAP8P046y44431TTMPHA,A,2,C222,,AW,WNCCCC262225CO£CCCCFCCOR1II3222231,RA2AAIAAA8KK9TT1-5---45CX-2-----A,O,OMFMMM4,6C,-=-CC-CCCCDRRCCCCCC4SSSSOCONOCO0S(2,3,1NNN1111N3C2223E333PSN0.2TTTT.0000587NIP372ZZZNT,4444L,50.555,,,TS55,555T4SSSSCOOCE0EEECA0CUUUUUU4S11L1L4U23111111B381111211SLTTT7O1F230U000L69,00004T4L44400U13FE333,,NC2FNNN4424S44,02Z22CCM9ZT272Z7C71S4N1,0100026O75005C505S5553V0001U00000,-VBAA0444AC0S,FV20TOCXF07IXL,11TTC1)SUE,CTREEARMAIMCI- C DIEL DTEL EA FA A EA EA u20 ITEM 86 (PN 2210759-0001) IS AN ACCEPTABLE SUBSTITUTE RRRRRRRRRTSSRTUT11OEOE1EIOEEIIO4N1TSHSS8HS-EE--HH0EE0TM,HROFTFFT1RIIIII6XKX-7X-6----,-~-RSSSRRDDRR311S1N(NN----5R..RP7N9T722022N904AAT445555KKSWW4SS0IISOO82NNB80BOOO2GGNN8NHHH1NMMM0735559% -%¥0.020..5221551 W W CARBON W CARBON CARBON FILM FILM FILM EA EA EA EA 5-101 TECHNICAL REFERENCE SCHEMATICS ANfi LOGIC DRAWINGS Section 6 SCHEHMATICS AND LOGIC DRAWINGS This section contains schematic and logic drawings applicable to the Texas Instruments Professional Computer. Title Motherboard, Logic Logic, Alphanumeric CRT Controller Logic, Option RAM Logic, Graphics Video Board Logic, Communications Board Logic, Video CRT Controller Logic, Speech Logic, Telephone Logic, 256/512k RAM Expansion Logic, 256k RAM Expansion TI Drawing No. 2223005 2223011 2223017 2223063 2223096 2223102 2232375 2232405 2234245 2234248 Page No. 6-3 6-8 6-11 6-14 6-18 6-20 6-24 6-29 6-24 6-40 6-1/2 Lol oPim T Omem Rt ' N | i 'i. | o b {[{ L | | | . = I it l il | I I pe TN Lt g e e ) = Bi=) w1 " [ s 3 w o M 1 . "o] din 2 e T "~ e L isb | E:S i 1w I CHey E 2 =83 - T o =e ] T2 0 o 'l 1L Ty n " e 29138 ST A - e s el ey wte 1% aLiSuN . e (T, g . i R = I A .A syR e e . J ANy - . b toee L5 M3E i toum! = I|¢:'\' AT R L S oo = gl i v = by tEE T SRR N " = i » 1=% ' pima` mpel WA AO RWi N e o " oy THT 50T0£222 | [r1TzS968r]--a z ~031(8130°31C9w007g 1A¥I0Re10 senanoinnriereene) sy £ (R o] meeame | P | TRz I i | ooy e etw2 1ot [FE = l s ° | . weruvin eo [sen | e = BOISSLNNS e u o0 < SININT3 QISNNT WP AE IO 2 1 o3 o3 = v ar- L i $NE MOTSNUIXI ¥ SHOU CUIOOAINLON o . 1ol =~3EEE 10, £0= % ~ 0 [] 2vL " »2&-«|1| oty ay | Exga S s oo0l or 1 CEi=218 0| @ = fl Bnh o » & « 4 o OO > e o ]ITM n E»&»&d o stisT&as SH§ T 0 S T 2004 OT RTeNPS | [3 ] i 5 b TS-ITe gfimfi& SooLezZ =a5&T I kg v ¥ s 102 !>~5m1`3- = A= D m .\_huM" h azre e 0!3)0N0fl. ' a0 g`- -u A o -tv.fi o g [ 9 "13 02 W3 Cuv §13 0L w3 w3awnr 20SNIO3yT % TI90N3C1T3H4VTATya0G2eNURdI0O004M3,S1°237AE3ST0T300L5SE7e ySUTeI3zH140I,NOSSNu3GDL0S3lB1aTu1Trp300eN3dDl4,SN@3 I z 1 ® a g i v ` a | < Sz ak.3q9823053 o5 % 3y i : ila § *[aaa 82 288338582 g§ t Fidfi2enavnanes % T - % n [ . ~ §oaEEERMRER --_-- e ---- 8 ppn Nyt & | - T e d G888 i § o I ® < 2223005 " ur o 9¥ovwzzllee wnoiwixgt wl 3] 815o8wm[wjLs[ose8:3aone31Ltldy N2 ¥S1VA4 GQVY IYV WNIISIAVIYAB E0Q 0T322T2 ASSSTY LNiEw % LonLns 90 e 6 WILRLNS 362N nzsws 0 ' [T [ == T B38833%3 82893V e % 1, A5 030 41 ooswe 13 o) ¢ 51N 4/4401-8 0B age B vaomn g V 58 & 2223005 s PROCESSOR o ; = d g < -- ni) @ e " = & © ! iag ~ ® Q = 83 i 3 & Q t o 6-7 l < NOIES UNLESS OTHERWISE SPECFKD: 2a31..5 "CRUwEA2c6SPeIRSCHTIrOOIeYROaSAnSUsSAERDRNEOATEON co.- 250m500e0c14¥i,,E5PDBOPNC2T0 PCT 1-1 ciB n 77,%a0+3w0-ci0035, g TeAR !) -S8R 5 - g & 4 B 8 | % 44%%44%#4# HIGHEST REFERDICE DESIGATONS USED REFERENCE DESIGMATORS NOT USED o] % 2223009 aeeiCATION AT FIETS e O OE SRt [ emns {@ruu s fo= CORQ_$-28-82 DCIOANGTRRAONLLELROGIC ALPMA CAT N_5-25-! Dlo6214] 22230=11T z 16§22 :.....r..M_m._..:: _ DUSISILNS. wSEAT2RRT 288388 W INSLISTON TR 85883385 F2gmneangs 288 K4 83883385 gg ERENRILELRD E 6-9 85033883 =l SRIIXIRE 2RRSRBRE 2223011 2s8wasiow fz] Swresasa-1 24338828 ER2ILBE 8ECeRzRRRERARLERENEZ sfl!!!flifll SRRIVBRE 5 SYBIRESR a =NRIVERE §§ ¥ agnggang 33 S2338RaEB Z2239N8 6-10 a l 6-11 : ] z TH s1o]geee, . 71T2o9~80 | v v 1 s 2TMR3y= mBET ==E= - btNoiviieeey T ~GB130° NO1T7S0M7UA`XLDo1 10 5 e ST SENIRo IMITK] SvEI] o] _memem | [T , oo GETe= TTL T ey e 2 T Sio s ! o ee ReIESENElE St ee e = = P * ] v 1z pgaor] Ag0x1 * MpL y AL1 1 5 e 1 LT1 nt": nt5-1>} !:Le ntt ks5 Al103 sdo(m1i5d) woootd0 0wtk© WOtyo WOWIq© MOOIyo MOOTd) MoOid© wonotod sd oot©y ase B}S 3| | = s | T TGIY....A\.x.T .. CTRLESAr Y [ =v 1 | i Loz | [ v 1 S 134 0D004°A 05 NS SWLINAD *C QRIS WO SSIWN SUON 9 I Z 1 8 weewlblog21a 5 y o Y £ 2 288 pzonager o 288 gz30a08> @ 28B.zyzaven 288 sznoavse ° 28Bapzazageni- 222 17 0 28.pzonaesnfs © | 288 gzazaees 288, 9zn39%2 .| - - 3 &8 szyna08n 288 gaveazan 28.9zy03992 & < 5 = S 8 gzynaeen 288 paonanun 288.gzenanea g 5 > i . o 2C.pzazaeen 288 gz02z04n 288.gzvnavee = = = mi 2888 .9zunap8s [ % 2885 gaonzeen . 28.9z02a08n Z o a o o 288.9z923982 288 gzanauen 288 magoaven" 3 o E 5 . 2¥B.zonzees `1288 gz00zwss 288.gagzavealr 5 RARRBRS.RR AR v 8a8 8.5 @ S = E = z a v ? o < 6-12 2223017 3 8| : £ H I i i i E | X ] oW£ |[=F §5|29E EoalS|7l [ é s 38| |~ | B-- 4 R4% E E g g sa5b| sse-d| o] % fiT s il e | u E E g £ ou5ak|| ctNab)| o] e B B g B o-k | on.b)| o] e E £ £ E o5t || sk5l ol o g B g B 5 || o.l o] e ass.s8gB | g Ea.sg H;sX g Hé.s! g g g g g o.o || oma5l|| o] onf g g & B ot5 || s a5f| o] enf T | 5 i fe-- L 8ld|s - EEH_E: E` M 3 E g:-- -- & & £ B wiYab || sa.ab| | oel|| e SB[ 5Bl & wBl| £ s £ TeA2 S8 U:.S n:fi g Z 8 15 8 23 zg£s2g I u 6-Gl14 o < oUNE 3223063 2223063 14,0003 { wsroans ~ i g aRAIIZ @ © © 2RR988, 3 - kO] WASvIyTE = 8583388Bcmun EE] 85883883 zuun > 85883883x0un IRAIABRE 2gRe3are, 3 JRRIIERE BE2RASEBRRBw IRAIAINE 2RAIRBRS, I IRAIZIRE §§3 2RRS88RE, J P 3 3 58 --; N igfl g Ta o"'.I ¥ 2 E8H8Y §ldyeauabit d, zeuabllb 6-15 Y] T ' £90£22Z | ou ,penPO95E .m 2 onsncigini avany 8-3)"m5: 1% £SISWOoEn NG Y a2 %2 sIsTa=SN ooy £ iz e SISTA"S NG Y 1t (9-NS0l )(-0'1°D8 A0y 191 6-16 T30 4 2223063 A0 CoO Freas Instaumonrs FERTE EFEH ABCD 2 288uB8ud 09288uBlvg 8 33 8 2zp2zeeeBEudlvg 8 s£¥ 8 ezuzzescBingly ~ @ ses 8 gzezzewsPiudly B k% 8 ezpzzeesiiuily o e2§ 8 2zgzaewaiully B eff g 2zoezeea¥luilvg 383 o 2zpezeeciuily 2z98 22t8ulfvg sE3% o 2zozzeeabiully sg ] gzozaeeniiuflva A-2) 6 2@,(0-7),50,(7-0) 6-17 oy 960£i 222w-w | [r1aza9T6]a ~037¥"N3O1Z190NL73ESDw/0IuN0T°uANADS1]0 )l ol <12 v oSeun gl o 2esTaImnNg tGININITE Q3%RNN v ] h s | ZZihrr== 9 |_....1 z £ | 8 e zuehian us `o NS -0 46U g --------2--17o01f00217 oL g1 --I--l--.--w--A'T0--Jo10--o.°0'51) L ----ae roo'nz THSIEUN QL e MO0 %17 Z# `oun -- THS `y-un 4V010°6 "D 26 -1 @ ------ Am0I0°0°0) THG A2 gL TTwweez.f-su.ann 01 0 THS Gann L St Ni'gy 2 A T 14 020200o©45 Ase 134 0a2n0Aw80©4S 139 oN nw4e05od 134 0an2041w80©45 134 oandaRAuod52t F= ----3 [ {o yo]9 93o 09 o T N A 05 n azt- ----> 1t 03 e otiey = 2~ © = AZte ----) 1 034 6-18 Ge ewsrst ¢§ ((0I7 8F9H5I00I5ENN3 | © X § ) tzeooems | v T TI Te s g ST T | | v f s *QILYINTI?0IL N1a0uNL D93179 Uv232/0E1Q3 SHO NI 3 iy `peu0t gwIny SNWA IMISISHY 2 1 ONIOWS ISMYIIO STIWN SN 9 . I Z 8 s ] T & | . _-- _ ] v } S | 9 . APSNGLULGIISNNGT W31)1hGTve 3v36 =# v al a sto 6aswntinemrw--ogi>sas 02 69 gy aUtLin7Lo64 W1 Y bo%o¢ v ooo = oy T 2o 1 o eYl wiq i%l w s e T = weoR e - ¢T g6aort "Z 6S9 TS. P2 i 2 -fllfl" vu [ - mIsoE e i 32| B & = = Cg o < o Lo"8 Fecx oSR o E T=» 034l A %|7«2 e a 2._. a2o"W l on a B sweswos LT vigp-8 ] 2 g o s waon T ¢ 2¥50PrNhm| .-a* o o nse £ ~$232% =N : o o - -- a ¢ | e o BTT3>35 ¢6 ooo a3&£Tt o0384 W 4 084 2 . 6-19 [ 222302 i g < ) T i! f N e21 £ els o MY || s "slt }é:l ng i<} {obf[afufu S Tl `:5 fg3 3 g ; T _N,.,.N..szzzz-fi::::a:; SIIIIIIIIIIIIITIFIGIRF --_-- 3 § 5.8 : ! H .5 % K R £ ,]R`c}?' B 15, bl {126 17 [ i ol Lil e o fe L KO a of -- e { ik i8 3 T £ @ gl " ! g'i` e -. `§ o g .- X_ 4. & 55 g RF- §§=§§ gggig 2 <l :`_: AN Il na N YRe2aR 3 334999333 TYIIIIIILIINY y §3- § 3 8 8 5%4 3 JJJJJHEIJJJHJJ{JJJF==EJ==£§J§§$1 S i 20l ~8 TET I PECZanencRRRAERNYTIRARRRALR2R,LR TTTTiTiTTRIciToTTTToTTNToTToTRes 6-20 1 BlF [ g 5`; ; )8 18 Il9| a v ! o i < » R&gz - g e . i " SUIILELE -- Szuzagens. < L ¥ el & | reswenses e HECLREREREURALRRLIIS| 3 o ol SUSINELE s 2 g 2RRIRIRE Szuzzpse8. 2RseRgEg | 3% 22 o ~ 38¥A|oEunEaEneEnge? o Q v & T = Q o 6-21 s432g8as wSzoR28828 < P1Z936O[af e s e » " wsra006 9 8 P e » n » ® o w ® ot ne: vus B ¥3 9 a o200 toisros "n Lo B©]»w] ® ot rvaswsions %5%00g 0P000 %20,0 10 Wy Ve B Do o ¥ Mo it [rife)¢le 6-22 J . s v ' e --cD ez e { s o 8 2 ¥ i @ 3 | i =] ® 5 9 n & cavouns=37533 o & 5 0 o 1] 4T3 Bas83ans |E2esasezzyzels 39939838 Bzwaagwceedie 3 gEé ~ ~E&H2RRLS, ETTLEE] 2/R33853 oi82 | < k-- 0 L ° vy [ ZgrgAgds | [2eRgReae | [Trdgag 2 8 8 953 |2 » a $83||2rReasly - ® Nt N/ 58 8 3 g ¥ v 53 3 3 S 401 X ] 2 SL ] EZ . E [BoZ NsGZ NQ), e ] ST HJ33d5 T - 21907 `WYHIVIQ T Be 0L IN- 1], ] o B[P e e =v Ry qn«w..! T T e s os v s e O VI VTgaYt + . £ N . 9 e [ rare ol Z L e S arer n TR T e l_l-..xlu ComLT ul.fl S Wen19s0 --0 S2SWLofN)2tS98s $OSIH2LN6S8u,nfl_ YOS W<L2NzSA S 1S, . $OSWLN£5S0 S3uvds ane ._. ang L °E95CDP6I1EN3uy7n2i612330£0951233/'82N939N9l2I106N59El22I0:B°90E52D¥2) == A5 AG- e ELdo'01ev2aP2'D71z0902982a1'4e95lE8dD0 owo -------- = £v N10876o) o A 6-24 A 7o | SEsoR 05505553l 3ISY3134 TWAYE0S Rel | E8e//5E2i7/%G|l siLaviI) G3613v9Gn4vNH) ONOINDFITWINHIDJ][ ¥8 = 1 = T i [ Ll 5cEeeze.f = | v il NOILIINNDD ON SILONI0 LON. ¥ %G1 'MGZ IYY SHOLSISIY Tp SO oy SMHl O Wi 3u¥ s So INTVA l 30NVISISIsY I2 QIII0TSS ISMHING SSIINN "SION s 1 9 T ¢ ® 8-0'tHs 8- TENS 8-8'EWS 8-0'SHS. S-¥'GHS 1-¥'GHS - 888---00g'''gSenHHsss 3 8- g8e'nEHS 8-- 2 005 TWLNS 0052 i coswenTs * 005 W2L5N0S O15¥L»NsS0 525, OLILL»N5Sn BEIIPLvNnS ASH DO3PIsNsSn OOIPLsN9nS YOSKIoNsSn 9n 003v25N3S0 ! 204 00.4bLiNsSn 4 sNe 0 21 0 PLSWLI9N9S0 QESTP8LNbS O102L0SMLtnowna] 440o A1M 02 C 4d 0'02t ¥0SIbL£NsSn YOS IPL£N5S1 1K1 OBOSWLNo3Sn 18--80''S5HHSS 6-25 20£29692n 80V, o'Iy A5 55502s5n 1SN) §%-50»2np1501 snl AGe 55-50z2nv1SNT NOYH WYHI0Ud T T ez | : AHOW3N WYHO0Hd v s s | 9 | ¢ [ ° | 8-8'PHS Y01S193Y 553500V AHONIN +¥ZLIMPLNNS 621STHLsNESn o 69ISTIWL»NESN PHZLIMPLNoiSf -Q'YHS 1 T T GEeeed | 6915 WLNS EN N 691SWIN2eSn ¥ 4 PLEL P &L X ¢ g | s eELHvLNS l £ | SW 9NsSh 015ewssn5Sn oI5 wens 22! ao1z ol YLb ELIMPI1N8R YLELINY, SNg SNSv93d 01§ WwLSNSgN H PLELIMYLsNsSn 2 o 1-g2ms 8-2d 8-g'sHS 218---eYddrHS s¥¥2S25 WeNunw v v 2Wv 1 e Sr2swins v i s [ 9 I z T e 6-26 | I Giezeee__ z | | v 4 s | _ 1H0d ANON3IA VNG $5-02vISaM)0 s5-0zvisnzln S5-02¥ISaMzIn $5-02r152A1n S5-02v15sM21n 55-02vISbHtI S5-0ZvISM1I20 55-0ZvISoAzIn ° 1 ¢ ] s ZEI1 vLzNsSn ZEvg2nssn® 2e3v25nNs" zeavens ' 5N VSIIPLNieSn ot-1d 221o-1dd El-td ri-td 1-Q'SHS. ) 1-91'-E9EHS)| 6-27 5S-0zvISML 55-02viSMBI0 §5-02viSNwIua $5-02K1SAaLn S5-02vISMsIin S5-0ZvI1SvMi1n 5S-0zv15M&In S5-0Z¥ISHaI0 [ St d | I v T s [ BS1 1P LoNeSn OSIAvL8NzSn 9SIIPLaNzSn e 1 z 1-0'EHS I ° 1-¥'2HS -2d 91-2d } 8-¥'vHS. 1-9°24S 1-2'2HS ' IHS 1-Fans o x 3 -2d 9-2d -1.00%3 S35 v2 1-¥'2HS -23003% ol Doownox 6-28 o »-2d 8- 9°2Hs. 004¥LN1sSn 2 ° 6OISILP1N4S 6625 WLNrSn YOSWLNEsSn 1y DOS WL8N5S0 601W 5LaNrSn 2LY05 BOISWIaNSls m o e __m._VA_ BOSWL0N9S| PLSIWMaLvN=hSo o ¥ ° s9y ASe ISSWLsNeSn' 1SS WIsNS 1S5 W LSNeSn 1S5 W, 950 LoNtS (2223 PISHIiNG *95k| PLSWLNSSN o o $9SHLoNS b S0ISWkLLLNvSi ° 9] T L SZeeeezaa] | I 2ESWL6NsSn -2d TMH T | 2 | S 0§ - 2S1o09I]v0Ne7Ot1HeJe,,"3.N1.v3y1o8v9TI9a90007] v OMLI18] NS-R, @) = = Ev & 4 |moSu50vi|inatosvzya ] s gt e0s e v 294 = 6-29 ---- TAHLSYT TI"HIS5O0Y7 m.uw YEL 1z 1028 413 N) 1 © ' 5 ]z -- *» |24 d d =iy db-- )% A2l eODTDL T A2l o 1 %ALSE - [ e o YISISWINS n YIS IPLNS 2n YISISWLINS g --» -4 2'-22re AZI- 3@ T TSAAySE A2l - QY 4Te=z5a 2 [ .fl 29-1d3M1 = T, ey¥£5S2UN'u9ZH5LS2I'sSv5I3 T| 3sT7o20s1id||Y . k:aTmemi!d. R 3 A EELY awng T 3TMM£0lY 294 A 6 YOSILNG o = b N L POSW2LN-S W ol 8] h GOISWLNoiSnf --Iw c3xm)%.P .H--& T ! ----z o08x7n3xo .~_.__| ZEISTHLNS < ddT57y 2 g%L0y 2 . fl Sro omy 780800" T |mEM0S0D" |T gmoogrh m"mw AL ooaos T| loase T am4o9o9r Th|easmdo | ans e ol EED 5 [ ty a5. o S Tromsa o T : 215WNS"0 g o%e0y1 = -6]] oo - SR1A0S 33003 4 S z F o a023 | Caner s WITF vys ) FE2 4O270D051 m s4d s S06L0s0tn o | =% T 000N __ 10155080583 | 3 3SV3734 WANO4 eX3 S | t-oe=eoly SRRSVEee=s53=0=2430375 Oo38 1Waiveys |[ =@¥ 1 T Lo GOvZE | [ v T S 7n] <NM O ioUnV 3dD[z R {+ DP[l4oi]s Lnoa [ A oron onoY 2 Le e %% 4. n10o011s T 2ASa5 a 2oflgeA> MNIAz El 224 o0 B _N_ ZZ[vl |8 Ase am8) L0S¥ES 5 = s | 9 $LSWoIlNS uu]_> vSin)907 0w¥ iT n S e Se .n_OwII" g0 | . M W 3305 o el -odoo oJliLT. o vismanozsn sauves SAHON0IN11IXIJNuM¥NODSSITNOWWAISVIIISWOUNKIVNSIISSIITSYT 2T WANIIS ISWEIMO SSITHN "SILON. z | @ T L[ So=veeez [| JPWoON s]so2igiwe=nv. _ ] v F | 9 | SHISWENS LS WLNS an i PLSILN YOS WL EN 00SWLNS - 0OSWINS 0! ys5wenssin SIS P LNS 20 83 SASWLINS £0d 0YSINN0I 02ELSAL T0YLNOD IIVIHILNI 00OLSHL T | S0pESs = S2SWLNS 8n o o PNl AS00SWLNS"n v S T BOSWLNS N 005 WINS"0 o ROSIMENS 1| veswens an ECISTWLNS e v 8 BEISWLIENzSn 'S YOSWLINS 0 S85TIPLNS sn 80STM 'N"W YOS W ZNS| 2n »OS5 W +OSIPEN2Sn OISTHINaSn oswinsan P »0s7 vnflw | S | o @ 7 & 2 A " a o S ® 8 a = > m 7 = & e & & o & SS3U0gY In5dv8 ° 6-30 31534 °F, aSe 91N9I3L4NOYL41HBSi)anY 1300 a200 34 x #IUIMPLA2N0 - 18040y JuvMAoEYLS 000LSML Y3LIIHS A TIsA3T Y344N8 IN4LNO I3Y IN10 HaLvaliony JELELIMYsLeNn L9ESWLNS 334 Jn1d o W o2Jy SEmAS: LS1S WW"ORLN e2-v2Le2 oSISWHLzN2Sn X 9 12 2150!w KsN 0 53 2/ IN00h0aLdSHL % 805K " 118X Jn10 e weE LR 8-0°ENS XYIN10 11--0@°'sSHHSS YLSILN0Sz N0 ¥1v0 dvLELIMYEIH £2n N1 GNYMNOD `viv0 &VNH-QXVM" 2 1-2'2HS 1-¥'2HS !, ao X2 ¥ YLSWL 6t HILYT SNIVLS xfl:uXvMWfl- »v 0 200 BsOnHYL S08 04 y31408 SALYLS THINL 6-31 oy 1 S0b 2627 - _ z ...ey!&».:.. e _ _ > ¥ o ! s | 4 I o v - 1531 3AVR 38VNOS 300 TYNY 8-6'EHS , | -v'sHS CInl SUSWINSanfi 2OHPLEN2!S Z00mpsnsen 7 200HYnLNS |a1sy 1-0'EHS ' v-0'sHs 0 e 8- 9'EHS -- " 13341 831714 SSvd M0 [ 990 o| o W - En 223 g T 40%08e5e T{«3mo' vio00L xor N ]--5] Ao 5%05 " TM - »20e7rLnT L0Ja osoeye eI 7 25 a 3 [ 3rvas 0o TS % AS An. I10614 ' 032TM3 9300w0E0N ¥ T I¥3N1OH41OYanyIH 3 k 300! =t %5 e v 930¢£0e2n Sw021zY XL 6LHASe 90{71Y3NNYNYH0D3-27)704H1ONI0VDON3WL1L1Y910 & T eco) % ASe --Om6m3meO-®n x8e6E4 e § ALINIT a2583 ¢2| 7y--oB 1o 00215 6 vXeO!u4is%gs'E w10 lfl3l~). / TnHM.k M-- b sv T o Rt NZIA oT y +t 2 -g'sHs 4n0 3NOL an -v1d L..E:.&S o YA NINY HINY 3dS 530 ) yig g -vid --] 4L3S 1214 1-2z'-; E2H1S0 Fiv1e207 NI T- A e 63 23 o3 0w6eYz § | o608t¥ FLYA851i32 .R yo 2813 @ ezsgoy _m ) s le 930£ve2n or v T w1 et o o vy [ " £oer o o~mPRSI g wnuv T5%e ngy vy oLS | 2= coozry PN g o3untnho0oA) ooyt | 9<a<%A|2|8wOmRb0m0b!w!bmmBm[mSbz£4&5> k SED 101y TNIJvO9BINJOIDR o qul_ ; 990+0e3n . 230 T o 1-9'EHS V 8-G'EHS 5N\ oY Ds 1 Y g a T I * + S 1 s [ z | 8 dBEIVSLsNeSn N _Iw _.m anot- 1-¥'ENS 2 IVIaS9 09 g4 SivEuS +-2'--vHS TG N1 133130 ONISSOYI 0Y3Z j As---332vn8 ul 8 YRST LEOEECNN E o vEMel Y I . 43131 1dMY 3NOL eA0%A wT0e0u1i4 wB00 3§3s5e8s 'It%.o0l081y_ 858YNZ oSwyor SN N [ v R melcm85?8vNZ15 e e nw" s64 vy 958vNz0 £ i YOOH 490 ¥330 i ; £E;NGEEN%N !onyv Y1 RS- s2y01 2 AS- vig¥nl fio«. |t P, s S vs062N2 028998 ¥ o Ve w5 9893y3 1L2- r 14S000 F: 5 4o X her o oy AGe = 1a)EEt T 2z ....... 2 A2l AZ)e ----> v-ar R obW /? F--=c2 -or m 2 2 w * S \ ---->1 1-9¢ Bl o o z-9r o o] vavons g { #m0y9 Y8r 9LN12y . vyeoy()w e 8A0SI ¥ M20s1] 2| " = 3, 4nA0E0E3F 2-r IMo--) .51 =3= = -5r E T -8 r-8'9HS. IR0 3dY _.("Mxm N3 8-¥'ENS LECLIU] N CE2Dz 089 154 , S --*290n002 9w S 9] L % 85 9525)01 wasxeod L5 s-sr Mo--) 9-5r 1 | I 50rZEee | v 1 s | 9 ¢ ° s WL IN 18], S-R,e B a- _ e - J { G g oot o | T v i i 21 T ] (110 1T QF W, ZT TR T - (SiTSs. isovs 8 e .- o 108 A"100 TM00 o 8E2 1 706023 M8o23 S 400 L %) e ¥ 3 10 ) aig0 ey #1100 % %100 =] 00 ] 0@03 8o2o37 d 0s 0 410v0 "o2 "o@ si»o.w3m 4] Mg 023 2*re a3 arre 3 rd Mol ELX 13 T l o 23 -- = -- 2012937 Hel 3*r6o mre8 943 derao 7 L a*r5e3 o + Mo@ _ am"rye 4%ro ) 3 mro )e rg anrwgIT SIS WLaNcSn nrSIeNs Yo #sn usm 6¢ 6-34 1= %50/, Wy tomsuosa | v -- : Te b = T : T ; T ¥1O3I615I3N' 0D520ON vSILSOHN0NISI-S0Hk ¥ SRHO K1 3¥¥ SINTYA IINVISISIY ki s _ s _ z T s QIS OISCWIIIINOEASESILNDN SUOND ETAR 3 A NS2S WIaNnS v . ° TM MZZSWIRiS MELSWEvNsSn w 0 REZIS WNveSlt = 1 S v 996207 ev3eznyn ot »Z-id 6i-1¢ NS LwNn, ) 6-35 -- =EGe 6-36 T o] Sylvid? »Hs e N @& vy 1 v dy s | ° 1 3 | ° THs H91pSHoL »9IbSH2L0 M #91521 FRETELn ERE Lw2n S1-PIPSHwLn S 9IPSA2Ln ¥ HS avdbrdd S1-pyIvSsAnL SH-Y9IPSwA2L0 Ens (3.3 6-37 S v Hs e T 6-39 515 £ SHS T oL maeee o J | @y 1 a1 | 2 LT)ET soveveer ___JevTsRagOreTnr v pruan-ief, S, & `NOIS-NY2I1X93G W"ySweNeSeVoE»8v2;o2d ] e or---- : oo T e =e 4 s ! . CRA BOIVNSISE, DWUTITY SO -- i - T T ] 4"1s0l0 " ¥100 ] 40w0af i _ " E.GF _ i mi05e937 "i[0 |_ 40093 TM02037 T T 11030 0EoJy 4"160903 Jr 0303 "o53 ame ¥ | 300193 _4*100303 ¥ Jvi&v9o %10[0 e ' | I T T m T E ¥ %o3 a5m5r3o 1 arc5o3e am5r9o amr)o TM1o83 05o3 "roe3 s 3 smro3 !' am»r3o | 2o1 "o) a0[ s~ 3 "13o so) 2 T ] ] S e e T 62| o X [ TN iAy _8veveceael | T v ot s [ ) (@A z A 05 I swuoved 1 ISWUIHIO T SSITN SAUON 8 1 | 8reveee 2 | 1 v Jk S | s ! L | POs 6-41 290 SI-rIPSAL il. + S | | o N 5=224 i 1 7 em 3 i I i 6-42 EETENw0t Si-p31vSHu,a X3 # 7 | : st-vawsnis-- A ¥ & 9 S voveAs_n[ . . uTf|-- |_: _.. 1 | I S1eRSoHrf= ' 2Hs 91e s 9 I e 1 ¥R,oer i s-vamsa1;0f TM oavr » T S1-$31PS¢A. | Li.l 8rereee ool S 9bSAs,8¢ S 9pER87 S PaNSA0_ [ RNs *2oSRmu;n._ S eaIrSH"r S1-¥I95AweLn S-eIvSR%; S-paS %]0 [ eeveee o J | S-991050@;n | v il s | S999918 wfl_ ° | v -1 ¢ | e TECHNICAL REFERENCE SYSTEM I/O MAP Appendix A SYSTEM I/0 MAP Address Motherbdoard: 00000 - 00001 00002 00003 Table A-1 System I/O Map Device Bit/Use U47 Latch U48 Input buffer U49 Latch US0 Latch NOWMLENO 3 DA WN U O N 0 haWwNO Speaker timer enable Timer 1 inter rupt enable Timer 2 inter rupt enable Single-densit y (FM) enable Track greater than 1/2 (TG43) Diskette side one enable (FS1bp-) Diskette mode Diskette mode control control (M1) (MO) Option 4 jumper E1-E2 Option jumper E3-E4 Option- jumper ES-E6 Parity interr upt pending Printer port BUSY Printer port paper out Printer port printer selected Printer port NO fault 7 Printer port data outputs LED i1 OFF LED 2 OFF LED 3 OFF Parity interr upt enable Printer port not auto feed Printer port not strobe Printer port not initialized TECHNICAL REFERENCE SYSTEM I/O MAP NOAOUNAWNKO b R WWN Table A-1 System Address Device 1/0 Map (Comtinued)- Bit/Use Motherboard(Continued): 00004 Usi Latch Piskette Digskette Diskette Diskette Diskette Diskette Diskette Diskette Drive Drive Drive Drive Drive Drive Drive Drive SELECT SELECT SELECT SELECT MOTOR MOTOR MOTOR MOTOR 00005~-0000F Reserved 00010 00011 U44 8251 USART U44 B82S1 USART Data Register Control Register 00012-00013 Reserved 00014 00015 00016 00017 00018 00019 00020 00021 00022 0023 00024-0002F U4S B8253 Timer Counter © U4s 8253 Timer Counter 1 U4S 8253 Timer U4S 8253 Timer Counter Control 2 register U46 B2SS9A Interrupt oy controller i U46 8259A Interrupt controller - FDC Command register or RAM FDC Track register FDC Sector register or RAM reset FDC Data register Reserved Winchester Controller Board: 00030 Winchester I/0 port Input: 0-7 Don't care. held for handshake Data is each cycle. Outpat: 0-7 Don't care. Data is latched til updated. TECHNICAL REFERENCE SYSTEM I/O MAP Table A-1 System 1/0 Map (Continued) Address 00031 Davice Winchester reset Bit/Use register Winchester Controller Board W N O Read: Data request Input/Output Command/Data Interrupt pending (Level 6) Write: 0-7 Don't care (Any write will do a RESET) (Continued): 00032 00033 Future Options: 00034-0003B 0003C-0003F 00040-0008F & Not used Interrupt Mask 0 Status interrupt enable 1 Data interrupt disable Reserved Local Area Net I/O Reserved » TECHNICAL REFERENCE SYSTEM I/O MAP Table A-1 System Address Device I/0 Map (Continued) Bit/Use Clock and Analog Interface: 000CO Clock/Analog Interface N A VWN o =N WA End of conversion (EOC)(Active HIGH) Not used (tied LOW) Lightpen interrupt latch ON Battery low Switch Switch Switch Switch 000C1 000C2 ¢oocCs 000Cso oooca 000CB 00o0CC 000CD 000CE O0COCF 000DO 000D1-000D7 ooobDs 000D9-000DF Do not allow light pen interrupt (tri-state signal) Allow light pen interrupt (Pass interrupt signal) Joystick port Xi (Current sense) Joystick port Y1 {Current sense) Joystick port X2 (Current sense) Joystick port Y2 (Current sense) Analog input 4 (SW4) (Voltage Analog input 3 sense) (SW3) (Voltage Analog input 2 sense) (SW2) (Voltage Analog input 1 sense) (SW1) Clock Control (Voltage sense) NOUhRWN K W N O 0 Address Bit Address Bit Address Bit Address Bit MSHMS832 MSMS5832 MSMS5832 MSKS5832 clock clock clock clock HOLD WRITE READ + or - 30 sec adjust Reserved Clock data (low nibble only) Reserved TECHNICAL REFEREKCE Table A-1 System /0 Map (Concluded') Address Device Bit/Use SYSTEM I/0 MA} Sync-Async Comm Board: O0OOEQG-000E3 000E4 OCOES 000E6 O00E7 COMM Port 1 IR1 OOOE8-000E8 000EC COCED COOEE O00EF COMM Port 2 IR2 O000F0~000F3 000F4 O0O0O0FS OO0O0OF6 O00O0F7 COMM Port 3 IR3 000F8-000FB 000FC O000FD COOFE OO0OFF COMM Port 4 IR4 00100-~003FF Interrupt Acknowledge CHB command CHB data CHA command CHA data Interrupt Acknowledge CHB command CHB data CHA command CHA data Interrupt Acknowledge CHB command CHB data CHA command CHA data Interrupt Acknowledge CHB Command CHB Data e CHA Command CHA Data Available for future products A-S/¢ TECHNICAL REFERENCE SYSTEM MEMORY MAP C Table B-1. System Memory Map, Concluded Address Devices DFOC1-DFOOF DFO10-DFOLF DF0O20-DFO2F DF030-DFO3F DF040-DF7FF DF800-DF8OF DF810 DF811l DFB12 DF813 DFB814-DFBLF DFB2¢C Other Peripherals: DF821-DFFFF ECQOO-E7FFF EB8COO0-F3FFF ROM Usage: F4000-FSFFF F6000-F7FFF F800C0-FSFFF FAOOO-FBFFF FCOOO-FDFFF FEQOO-FFFFF Miscellaneous input buffer Graphics RED palette latch, write only Graphics GRN palette latch, write only Graphics BLU palette latch, write only Reserved Attribute latch CRT controller address register, write only CRT Controller status register, read only CRT Controller address register, write only CRT Controller address register, write only Reserved Bit 7 Bit 6 Miscellaneous output latch, interrupt enable = Miscellaneous output latch, alphanumerics screen enable Reserved Reserved for speech storage RAM Reserved 8K ROM space(Clock/Analog Interface) 8K ROM space(Local Area Net Option Board) 8K ROM space(Winchester Controller) 8K ROM space(Reserved) 8K ROM space, 1 wait state (XUs2) (motherboard) 8K system ROM, 1 wait state (U63) (motherboard) TECHNICAL REFERENCE SYSTEM MEMORY MAP Appendix B SYSTEM MEMORY MAP Table B-1 System Memory Map Dynamic RAM: Address Q00CO-OFFFF 10000-1FFFF 20000-2FFFF 30000-3FFFF 40000-BFFFF Devices 64-kbytes motherboard RAM 64-kbytes expansion RAM board Bank 1 64-kbytes expansion RAM board Bank 2 64-kbytes expansion RAM board Bank 3 Expansion bus memory CRT Controller: CO0000-C7FFF CB000O-CFFFF DOOOOC-D7FFF D800CO-DDFFF DECOO-DE7FF DESOO-DEFFF DFO000 Graphics RAM Bank A Graphics RAM Bank B Graphics RAM Bank C Reserved Active character memory Phantom character memory Bit 0 Bit 1 Bit 2 Bit 3 2 Miscellaneous input buffer, BLUE feedback, read only Miscellaneous input buffer, RED feedback, read only Migscellaneous input buffer, GREEN feedback, read only Miscellaneous input buffer, interrupt pending, read only TECHNICAL REFERENCE CHARACTER SET Appendix C CHARACTER SET ACK BEL BS CAN CR DC1 BC2 DC3 DC4 *DEL DLE EM ENQ EOT ESC ETB ETX From Table C-1t USA standards ASCII Control Characters Institute Publication X3.4-1968 acknowledge bell backspace cancel carriage return device control 1 device control 2 device control 3 device control 4 delete data link escape end of medium enquiry end of transmission escape end of transmission end of text block FF FS GS HT LF NAK NUL RS SI so SOH « 8TX sSub SYN us vT form feed file separator group separator horizontal tabulation line feed negative acknowledge null record separator shift in shift out start of heading start of text substitute synchronous idle unit separator vertical tabulation * Not strictly a control character TECHNICAL REFERENCE Table C-2. Numeric Cross Reference for Character Sets CHARACTER SET Decimal 0 1 2 3 4 5 6 7 8 9 10 1 12 13 14 15 16 17 18 19 20 21 Hexadecimal 00 01 02 03 04 05 06 07 08 09 0A 08 oc 0D OF oF 10 1 12 13 1 15 Keystroke(s) CTRL2 CTRLA CTRLB CTRLC CTRLD CTRLE CTRLF CTRLG BBAACCCSKTKHSRISPLFPTHAA,,CCEE, CTRLI CTRLLICNTERRLEFJTE,UERDN, CTRLK CTRLL SHIFRCTETTRURLREMNT,,URN CTRLN CTRLO CTRLP CTRLQ CTALR CTRLS CTALT CTRLU ASCII Character NUL SOH STX ETX EOT ENQ ACK BEL BS HT LF VT FF CR ) st DLE DCi DC2 DC3 DC4 NAK Displayed Character Comments B B » » % & + & s 3 _ d Q F 3 It > -4 3 i q g TEGHNICAL REFERENCE CHARACTER S8BT Table C-2. Numeric Cross-Reference for Character Sets {Continued) Decimal 22 23 2 2 26 27 Hexadecimal 16 17 18 19 1A iB 28 1c 29 1D 30 1 31 1F 2 20 33 21 4 22 35 23 36 24 37 25 38 26 39 27 40 28 M 29 42 2A 43 28 Keystroke(s} CTRLV CTRLW CTRLX CTRLY CTRLZ CTRLI, ESC, SHIFTESC, CTRLESC CTRL\ CTRL] CTRLG CTRL -- CTRL SPACE, SPACE BAR, ALT SPACE, SHIFT SPACE ! - # $ % & ¥ ( } . + ASCH Character SYN ETB CAN EM SUB ESC Displayed Character - 3 1 J -+ 4 Comments FS | GS + RS A us Y SP ' Blank space . ! | Exclamation point = " Quotation marks # # Number, Pound $ $ Doltar sign % % Percent sign & Ampersand < - Apostrophe ( { Open parenthesis ) } Close parenthesis v 5 Asterisk + + Plus TECHMICAL REFERENCE CHARACTER SET Table C-2. Numeric Cross-Reference for Character Sets (Continued) Decimal 44 45 46 47 48 49 50 51 52 53 54 55 56 57 68 59 60 61 62 63 64 65 66 67 68 Hexadecimal 2C 2D 2E 2F 30 31 32 3 34 35 36 37 38 39 3A 38 3C 30 3E 3F 40 41 42 43 44 Keystrokel(s) , - / 0 1 2 3 4 5 6 7 8 9 A < = > ? @ A B C D ASCIl Character 0 - / 0 1 2 3 4 5 6 7 8 9 h < = > ? @ A B C ' D Displayed Character D - / 0 1 2 3 4 5 6 7 8 9 B < = > ? @ A B C D Comments Comma Minus, Hyphen Period, Decimal point Slash, Virgule Zero One Two Three Four Five Six Seven Eight Nine Colon Semicolon Less than Equals sign Greater than Question mark Commercial "`at" A (uppercase} B {uppercase} C (uppercase) D (uppercase) TECHNICAL REFERENCE CHARACTER BET Table C-2. Numeric Cross-Reference for Character Sets {Continued) Decimal 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 9N 92 93 Hexadecimal 45 46 47 43 49 4A 48 4Cc 4D 4E 4F 50. 51 52 53 54 55 56 57 58 59 5A 68 5C 5D Keystroke(s} E F G H | J K L M N 0 P a - R S T v v w X Y 4 { \ ] ASCll Character E F G H | J] K L M N o] P Q R S T U v w X Y Z ( l \ ] Displayad Character Comments E E {uppercase} F F {uppercase} G G (uppercase) H H {uppercase} | | (uppercase) J J (uppercase} K K {uppercase) L L (uppercase} M M-{uppercase) N N (uppercase) 0 O {uppercase} P _f'(uppercase) Q Ql(uppercase) R' R {uppercase) S S'{uppercase} T T {uppercase) U U: {uppercase} Vv V:(uppercase) w W {uppercase} X X {uppercase} Y Y {uppercase} z Z (uppercase) [ Open bracket \ Left slash ] Close bracket TECHNICAL REFERENCE CMARACTER SET Table C-2. Numeric Cross-Reference for Character Sets {Continued} Decimal 94 95 96 97 98 9 100 101 102 103 104 105 106 107 108 109 110 11 112 113 114 115 116 117 18 Hexadecimal SE 5F 60 61 62 63 64 65 66 67 68 69 6A 68 6C 6D 6E 6F 70 7 72 73 74 75 76 Keystroke(s} s M a b c d e f g h i je k | m n o p q r s t u v ASCl Character 2 > a b c d e f g h i j k | m n o P q r s t u v Displayed Character . Comments o Circumflex - Underline S Graves accent a a (lowercase) b b (lowercase) c ¢ (lowercase) d d (lowercase) e e (lowercase} f f {lowercase) g g (lowercase) h h (lowercase) i i (lowercase) i j (Io-wercase) k k (lowercase} i | {lowercase) m m {lowercase) n n {lowercase) o o {lowercase} P p (lowercase} q q (lowercase} r {lowercase) s s {lowercase) t t (lowercase) u u {lowercase) v v (lowercase) TECHNICAL REFERENCE CHARACTER SET Table C-2. Numeric Cross Reference for Character Sets (Continued) Decimal 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 Hexadecimal 77 78 79 7A 78 7C 70 7 7F 80 8t 82 83 84 85 86 87 88 89 8A 8B sc 8D 8E Keystrokels) w X y z { ! } ~ CTRL-- BACKSPACE ALT 128 ALT 129 ALT 130 ALT 131 ALT 132 ALT 133 ALT 134 ALT 135 ALT 136 ALT 137 ALT 138 ALT 139 ALT 140 ALT 141 ALT 142 ASCII Character w X Y z { | } ~ DEL Displayed Character w X y z { ! } ~ Comments w {lowercase} x {lowercase) y (lowercase) z {lowercase) Open brace Vertical rule, Bar Close brace Tilde ASCII DEL G U § 5 i 3 a § 8 g 3 T 1 3 A TECHNICAL REFERENCE CHARACTEBR SET Table C-2. Numeric Cross-Reference for Character Sets (Continued} Decimal 143 144 145 16 147 148 149 150 151 152 163 154 155¢ 156 157 158 159 160 161 162 163 164 165 166 167 Hexadecimal 8F %0 N 92 93 94 95 96 97 98 99 9A 98 9C 9D 9E 9F A0 Al A2 A3 A4 A5 A6 A7 Keystroke(s) ALT 143 ALT 144 ALT 145 ALT 146 ALT 147 ALT 148 ALT 149 ALT 150 ALT 151 ALT 152 ALT 153 ALT 154 ALT 155 ALT 156 ALT 157 ALT 158 ALT 159 ALT 160 ALT 161 ALT 162 ALT 163 ALT 164 ALT 165 ALT 166 ALT 167 ASCII Character ' Displayed Character A E 2 & 8 s 3 o U ¥ 0 U ¢ £ X P+ f 3 i g o rT i B u Comments . 2 TECHNICAL REFERENCE CHARACTER BETY Table C-2. Numeric Cross-Reference for Character Sets {Continued) Decimal 168 169 170 17 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 Hexadecimal A8 A9 AA AB AC AD AE AF BO B1 B2 B3 <« B4 B5 B6 B7 88 B9 BA BB BC BD BE BF co Keystroke(s) ALT 168 ALT 169 ALT 170 ALT 171 ALT 172 ALT 173 ALT 174 ALT 175 ALT 176 ALT 177 ALT 178 ALT 179 ALT 180 ALT 181 ALT 182 ALT 183 ALT 184 ALT 185 ALT 186 ALT 187 ALT 188 ALT 189 ALT 180 ALT 191 ALT 192 ASCII Character : Displayed Character £ 1 % % g < > Comments 1 ' Il 1 TECHNICAL REFERENCE CHARACTER SET Table C-2. Numeric Cross-Reference for Character Sets {Continued) Decimal 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 n 212 213 214 215 218 217 Hexadecimal c1 c2 C3 c4 C5 ce c7 c8 c9 CA CB cC co ° CE CF Do D1 D2 D3 D4 D5 D6 07 08 D9 Keystroke(s} ALT 193 ALT 194 ALT 185 ALT 196 ALT 197 ALT 198 ALT 199 ALT 200 ALT 201 ALT 202 ALT 203 ALT 204 ALT 205 ALT 206 ALT 207 ALT 208 ALT 209 ALT 210 ALT 211 ALT 212 ALT 213 ALT 214 ALT 215 ALT 216 ALT 217 ASClH Character Displayed Character i T Comments " . n ; TECHNICAL REFERENCE CHARACTER SET Table C-2. Numeric Cross-Reference for Character Sets (Continued) Decimal 218 219 220 21 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 Hexadecimal DA DB DC DD DE DF EO E1 E2 3 E4 E5 E6 . E7 E8 E9 EA EB . EC ED EE EF FO F1 F2 Keystroke(s) ALT 218 ALT 219 ALT 220 ALT 221 ALT 222 ALT 223 ALT 224 ALT 225 ALT 226 ALT 227 ALT 228 ALT 229 ALT 230 ALT 231 ALT 232 ALT 233 ALT 234 ALT 235 ALT 236 ALT 237 ALT 238 ALT 239 ALT 240 ALT 241 ALT 242 ASClI Character * Displayed Character « B r n z o u T ¢ 9 Q d © @ n = + > Comments £ TECHNICAL REFEREXNCE CHARACTER SET Table C-2. Numeric Cross-Reference for Character Set (Concluded) Decimal 243 244 245 248 247 248 248 250 251 252 253 254 255 « Hexadecimal F3 F4 F5 F6 F7 F8 F8 FA FB FC FD FE FF Keystroke{s) ALT 243 ALT 244 ALT 245 ALT 246 ALT 247 ALT 248 ALT 249 ALT 250 ALT 251 ALT 252 ALT 253 ALT 254 ALT 255 AsCH Character Displayed Character < r 2 = 2 ° . v n Z B Comments . TECHNICAL REFERENCE CURRENT REQUIREMENTS Appendix D CURRENT REQUIREMENTS This appendix contains information on the current allocations for the Texas Instruments Professional Computer. Current requirements for the options and the printed wiring boards are listed below. Total current available: * S Volt line 10.0 A * 12 Volt line 4.5 A * -5 Volt line 0.5 A Table D-1 Current Allocations Device Name Motherboard CRT Controller RAM Expansion Graphics Diskette Drive KWinchester Drive Winchester Controller Communications Modem Speech H OO MKEOGIMK WONNKFEFODODNWO 12 Volt Line 0.1 0.0 ¢.0 0.0 1.2 1.8 0.0 0.1 0.1 0.1 -12 Volt Line 0.0 .0 .0 0.0 c.0 0.0 0.0 0.1 0.1 .1 bD-1/2 M el ._I-: EERLMEC (lme - FRESl 2 :N| K A| i ¥ [ A e o~ setl |y S . - [ 3 = M e g4 by =P g¥1 ro prad PLt oy = L ) _ oy ] L SHaEPCE- o, . At RSelS e RN o T B = gy e | 4" AR oL' 1 -y N e + y ! TECHNICAL REFERENCE ASYNCHRONOUS COMMUNICATIONS SAMPLE PROGRANM OUT DX,AL LOOP INIA ; MHrite it to 8530 until ; all registers are programmed. ; ; Now to initialize channel B, ' MOV SI,OFFSET PARMTB ; sSI=Address of Chn B MOV CX,PARMBS g CX=Parameter table size. MOV DX ,0E4H ; DX=Port 1,Channel B INIB: LODS DS:BYTE PTR[SI] ; Get byte from OUT DX,AL ; Write it until all registers LOOP INIB ; are programmed. RET COMMEX ENDP SEJECT parm table. Command address. parameter table. TECHNICAL REFERENCE ASYNCHRONOUS COMMUNICATIONS SAMPLE PROGRAM TRk R AR R R R AR R AR R A A KRR R R AR AR R R KRR AR R R R AR KA KA R R AR KRR KR KRR R AR KR & 8 This area contains the initialization parameters for channels A and B ; of port 1. TR KR KRR KRR R R A KR AR ARk K AR AR AR K KRR R R AR R AR R AR KKK AR AR R KA R AR KA KRR KRRk kR ; ; Initialization parameters for channel A. PARMTA LABEL NEAR DB 09 ; Select WRS code. DB 110000008 ; Reset BS30. DB 11 ; Select WR1l code. DB 010100108 ; Rev clock=Baud rate generator. ; Xmt clock=Baud rate generator. DB 14 ; Select HR14. DB 00000011B ; Enable baud rate generator. DB 12 ; Select HWR12. DB 6 ; Baud rate (low byte)= 9600 baud. DB 13 ; Select HWR13. D8 O ; Baud rate (high byte)= 9600 baud. Da 1S5 ; Select HWR1S. DB O ; Disable external status interrupts. DB 1 DB O ; Select WR1. ; Disable all other interrupts. D8 3 ; Select HWR3. D8 010000018 ; Rcv=7 bits of data + parity bait. DB 4 ; Select WR4. DB 010001108 ; x16 clock input,l stop bit, ; even parity enabled. DB §° ; Select HRS. DB 101010108 ; Turn on DTR and RTS, ; Transmit enable, ; Xmt=7 bits of data + parity bit. PARMAS EQU $-PARMTA ; ' Initialization parameters for channel B. PARMTB DB 1S DB 00 DB 01 DB 00 PARMBS LABEL NEAR ; Select WR1S. ; Disable external ; Select WR1. ; Disable all other EQU $-PARMTB status interrupts. interrupts. SEJECT TECHNICAL REFERENCE ASYNCHRONOUS COMMUNICATIONS SAMPLE PROGRAM Appendix E ASYNCHRONOQUS COMMUNICATIONS SAMPLE PROGRAM Control and Status signals Listed below are the RS232-C control and status signals, with corresponding 8530 functions wused to control and monitor them. table is a summary of information available from the sync-async board schematic. the This comm Table E-1 RS232-~C Control and Status signals Rs232-C Pin Signal Number Data TermReaidy n(DTaR) l20 Request~to-Send (RTS) 4 Data Set Ready (DSR) 6 Data Carrier Detect (DCD) 8 Clear-To~Send (CTS) s Ring Indicator (RIX) 22 Speed Selector (CH) 11, 23 Speed Indicator (CI) 12 8530 Function praa RTSA DCpB DCDA = CTSA CTSB DTRB SYNCSB Accessed through ChaAn, nWRSe, lBit Channel A, WRS, Bit éhannel B, RRO, Bit Channel A, RRO, Bit Channel A, RRO, Bit Channel B, RRO, Bit Channel B, WRS, Bit Channel B, RRO, Bit TECHNICAL REFERENCE ASYNCHRONOUS COMMUNICATIONS SAMPLE PROGRAM $ERRORPRINT SXREF PR A AR A AR A R ARk kR Rk R AR KR A AR A A AR R A AR KA A R R AR R A R Rk kA AR A AR AR N AR AR R R AR A KRk A ; TITLE - COMMEX - Example of Async communications ; COMPUTER - 8088 ASSEMBLY LANGUAGE ; ABSTRACT -~ This a sample program showing typical initialization B of the TIPC communications board in asynchronous, polled mode. PRk Ak R R R AR kAR KRR R R R AR AR AR R AR R KRR AR R AR R AR A AR RN AR Rk kkhkkhk kAR XA KA X NAME COMMEX STITLE(COMMEX - ASYNC COMMUNICATIONS EXAMPLE) SEJECT TR R A AR AR R AR RN R AR R AR R A AR R AR AR AR AR A AR R AR R A A A KA AR AR R A AR R KRR AR ARk kR kR ; PUBLIC DEFINITIONS AR AR AR AR R A A A R A R AR A A KA AR KA R A A AR KA A AR R AR R AR A A KRR A AR RR AR AR AR AR KRR PUBLIC COMMEX SEJECT R AR KA AR AR R R R A KRR Ak R R AR A KR AR R R R Ak AR AR ARk AR AR KRR KA AR X R Ak kR AR A AR AR kR AR KR : LOCAL CONSTANTS - PR A A A AR AR R R KRR AR KRR AR R AR KRR AR AR AR R AR R A KA R AR A AR AR R AR AR AR KK Akt k bk kA k kA PI1CMDA EQU OE6H ; PORT 1, CHANNEL A COMMAND ADDRESS. P1CMDB EQU OE4H ; PORT 1, CHANNEL B8 COMMAND ADDRESS. $SEJECT E S BIOCODE SEGMENT BYTE PUBLIC ASSUME CS:BIOCODE,DS:BIOCODE kA A AT I AR AR AR KRR < A AR A AR AR R KRR KRR AR IR A AR A AR AR KRRk A AR Ak bk ; 8530 Initialization Routine This routine initializes Port 1 according to a table of initialization 3 parameters stored in PARMST. PARMST contains an image of the contents ; of the various 8530 registers. The contents of each register is pre- i ceeded by the number of the register itself. This number is used to 4 select the appropriate register on the 8530. ; This B B B initialization programs the port for asynchronous, polled operations where all interrupts from channel A (i.e., receive, transmit and external status interrupts) and channel B (i.e., external status interrupts) are disabled. The software is to poll read register RRO in channel A to determine when data has been received and whether transmission of data has completed. TRk K AR KRR AR AR R AR R Kk kKA AR A KRR AR KR KA R R kAR KKK kAR Rk AR AR A RR KR KRR COMMEX PROC NEAR ' ; First, the 8530 channel A is initialized. AR A RAAR KRR R KKK MOV MOV MOV INIA: SI,OFFSET PARMTA ; SI=Address of Chn A DX ,0E6H ; DX=Port 1,Channel A Command CX,PARMAS e CX=Parameter table size. LODS DS:BYTE PTR[SI] ; Get byte from parm table. address. parameter table. TECHNICAL REFERENCE ASYNCHRONOUS COMMUNICATIONS SAMPLE PROGRAM R R R R KA AR R R R R R A AR AR AR R R Kk 8530 Receive Character Routine kR R Rk A AR R AR Rk R R R KA AR AR R ARk k% This routine is called to read a single received character from the ; 8530 receive receive fifo. If no character is available in the fifo, i this routine waits until a character is received before returning to o the caller. TR KRR KA A kAR R A kR R R R R R R Rk kAR R AR R AR R AR AR R KRR AR AR KRR A AR A ARk READCH PROC NEAR MOV DX,0E6H ; DX=Port 1, Chn A, command address, TRYRAG: IN AL,DX ; Read RRO contents. AND AL,000000018B ,Q: Any characters JZ TRYRAG B No, try again. in rcv fifo ? MOV DX ,0E7H e Yes, DX=data port address. IN AL,DX ; AL=character received. RET READCH ENDP SEJECT kkkkk kK2 TECHNRICAL REFERENCE ASYNCHRONOUS COMMUNICATIONS SAMPLE PROGRAM KRR IR KRR KRR AR AR R R KR AR KRR AR AR AR R A A R AR AR A KRR AR A AR AR R AR R R KRR AA RN AR AR KAk 8530 Transmit Character Routine This routine is called to write & single character (in AL register) to the 8530 for transmission. I£ a character is currently being transmitted this routine waits until transmission of that character completes before attempting to transmit the next character. AR AR AR AR KRR KRR A AR KRR AR AR KR KA AR AR AR AR R kAR A KA AR kAR fRITEC PROC NEAR MOV DX ,0E6H ; DX=Port 1, Chn A, command address. RYXAG: IN AL,DX ; Read RRO contents. AND AL,00000100B ;Q: Character being transmitted ? JZ TRYXAG 8 Yes, try again. MOV DX ,0E7H 3 No, DX=data port address. OUT DX,AL ; AL=character received. RET fRITEC ENDP V\IOCODE ENDS R ARk ARk R kAR AR R R KA KAk AKX TECHNICAL REFERENCE MODEM SAMPLE ROUTINES: Appendix F MODEM SAMPLE ROUTINES RCNTL ARk AR A R R R AR R R R R ARk A AR AR KRR R RN R AR AR A kAR R AR AR RR AR AR ; RCNTL - This subroutine determines whether a modem is installed in port 1 and if so, activates the ' RCNTL signal to initiate the modem Control Mode. SRRk kA Rk kR AR R AR AR AR AR AR R R AR AR KRR AR AR AR AR AR AR AR Rk k RCNTL PROC NEAR MOV DX,00E4H ; DX = PORT 1 CHANNEL B ADDRESS. MoV AL,0S ; HWRS SELECT. ouT DX, AL ; SELECT REGISTER S. MOV AL,02 ; TURN ON RCNTL (RTS IN CHANNEL B). ouT DX, AL ; ; LOOP: RCNTL NOHW TO DETERMINE IF MOV MOV ouT IN TEST JZ RET ENDP DX ,00E6H AL, 10H DX, AL AL, DX AL,000100008B LoOoOP MODEM IS INSTALLED. ; DX = PORT 1 CHANNEL A ADDRESS. ; RESET EXTERNAL STATUS INTERRUPTS. ; < ; READ RRO. . ;Q: IS ACNTL (SYNCA) ACTIVE ? ; NO, CONTINUE TO LOOK FOR ACNTL. ; YES, RETURN TO CALLER IN CONTROL MODE. TECHNICAL REFERENCE MODEM SAMPLE ROUTINES DIAGST R AR AR R KRR R AR KRR R AR R R AR R KRR AR KRR R AR AR AR AR AR AR AR ; DIAGST - This routine requests the diagnostics status from the modem and returns the result in register AL. It is assumed that the Zilog 8530 has been previously initialized and that the modem has been placed in ; Control Mode. TR KRR R R R AR AR KRR RN KRR AR AR R AR A kAR Rk kA kkkk kA A XX AL L DIAGST PROC NEAR MoV DX ,00E7H ; DX = PORT 1, CHANNEL A DATA PORT ADDRESS. MOV AL,'D' ouT DX,AL ; AL = DIAGNOSTIC COMMAND CODE. REQUEST MODEM DIAGNOSTICS STATUS. LOOP: MOV IN TEST DX ,00E6H AL, DX AL,00000001B DX =PORT 1, CHANNEL A COMMAND ADDRESS. : READ CHANNEL A'S RRO. ;Q: HAS A CHARACTER ARRIVED FROM MODEM ? JZ LOOP MOV DX ,00E7H IN AL, DX ; NO, WAIT FOR COMMAND RESPONSE. ¢ YES, BX = PORT 1 DATA PORT ADDRESS. READ DATA FROM RCV FIFO. DIAGST RET ENDP ; RETURN WITH STATUS IN AL. TECHNICAL RE FERENCE MODEM SAMPLE ROUTINES DIALER PR R AR R A AR R KRR R R R AR AR R AR AR AN AR R AR KRR R AR ARk kX ; DIALER - This routine dials a typical phone number. It does not monitor the progress of the call and it assumes the Zilog 8530 has been previously initialized and that the modem has been placed in Control Mode. . . R . R DIALER The phone number to be dialed is contained in a buffer (phonum) and is terminated by a null,. KRR R R KRR R R kAR AR AR R AR AR R A KAk AR KRR KRR KRR K PROC NEAR MoV DX,00E7H ; DX = PORT 1, CHANNEL A DATA MoV DI ,OFFSET PHONUM ; DI=ADDRESS OF PHONE NUMBER MOV AL,'T* ;Use T for touch tone ouT DX, AL ;Transmit - command to modem PORT ADDRES: BUFFER. Nest send the strip of telephone numbers LOOP: ' SENDPT: ' ' ¢ LOOP1L: DIALER MoV AL,{DI} XOR AL, AL JoEuT SDXE,NDAPLT INC DI IMP LOOP MOV AL,'X' ouT DX, AL ; GET PHONE NUMBER DIGIT. ;Q: END OF PHONE NUMBER ? ; YES, SEND PHONE NUMBER TERMINATOR. ; NO, SEND DIGIT TO MODENM. ; POINT TO NEXT DIGIT. ; CONTINUE IN LOOP. ) ; AL = PHONE NUMBER TERMINATOR COMMAND. ; SEND TO MODEM. NOW TO WAIT FOR THE DIAL COMMAND COMPLETION. AL RETURNS THE STATUS OF THE DJIAL COMMAND. MOV DX ,00E6H ; DX =PORT 1, CHANNEL A COMMAND ADDRESS. IN AL,DX ; READ CHANNEL A'S RRO. TEST AL,00000001B ;Q: HAS A CHARACTER ARRIVED FROM MODEM ? JZ LOOP1 ;: NO, WAIT FOR COMMAND RESPONSE. MOV DX ,00E7H ; YES, DX = PORT 1 DATA PORT ADDRESS. IN AL, DX ; READ DATA FROM RCV FIFO. RET ENDP F-3/4 TECHNICAL REFERENCE BOOT ROUTINE AND SAMPLE ASSEMBLY CODE Appendix G BOOT ROUTINE AND SAMPLE ASSEMBLY CODE Appendix G gives a sample source program that could bdbe in the boot sector. This example is excerpted from the MS-DOS V1.1i0 boot sector. e me e ne ne we we TECHNICAL REFERENCE = 3 E L BOOT ROUTINE AND SAMPLE ASSEMBLY CODE SRR R R R KRR R R R R AR R R R R R A AR AR R AR AR R R AR AR R R R AR R R AR AR R AN R R k& TITLE - BOOT -~ SAMPLE BOOT ROUTINE FOR THE TI PROFESSIONAL COMPUTER ABSTRACT ~ This routine is responsible for loading the system files from the disk. This routine resides in the 'boot®' sector ;t***ii**l(ot*cr*aa*ct*ki*o*n*0 **OstCeOctGt*oO*rH**xb1)oto*t:oft*c*otdthee***di:ni*skrt*he*w*h*is*cyh*sttteim*s**RltOoxMatd*eadrn*d ta*ttth*ea*nb*s*oe*lxtuettc*eu*tre*d.********* NAME BOOT TITLE TIPC BOOT LOGIC) PAGE AR R ARk Ak Rk o PR KRR KRR Rk kR ; VERS EQU o REV - EQU o R kAR AR R kA AR K K AR AR KKk kAR R AR R R KRR AR KA KR KRR AR AR R KRR E R K& LOCAL CONSTANTS kKR kAR AR AR R R A R KA R R A kAR A A AR R AR R AR AR AR AR AR AR R AR AR kR ; Current version of BOOT logic . Revision level °R EqQu 0DH & (o] OAH + WINCHESTER disk DIT (Disk ; JITSTRC STRUC JITDIR DD 0 JITSEC DW S12 JITTRK D8 17 JITCYL DB 4 JITDSK DB 153 ) JITERR DB e L JITWRC DW -~ 64 JITPRC DW 64 JITSTP DB JITBUR DB DKW 100000008 i1 0000 JITSTRC ENDS PAGE Interface Table) equates ; Disk Interface Routine vector (dword) ; Sector size in bytes (word) ; Track size in sectors (byte) ; Cylinder size in tracks (byte) ; Disk size in cylinders (BYTE) ; Maximum number of error-retries ; reduced write current ; Write pre-comp threshold cylinder i Step option ; Error burst length ; reserved for expansion ROM BIOS interface vectors: ELINT EQU RTINT EQU EYINT EQU RTINT EQU AMINT EQU SKINT EQU LKINT EQU ONINT EQU 48H"' 49H 4AH 4BH 4CH . 4DH : 4EH 4FH ; System beeper I/0 and general ROM interface ; Screen /0 ; Keyboard [/0 ; Parallel port I/0 ; Analog Input/Clock I/0 ; Floppy disk 1/0 ; Time-of-day clock I/0 ;: System configuration TECHNICAL REFERENCE BOOT ROUTINE AND SAMPLE ASeSEMBLeY NTRGYeO1DS E ; v XA R e A [ R T eI TI L I X O I X T2 T O L L X RR L X XA 3 FIXED ROM DATA AREA - (absolute offsets from absolute 0) 2 T Aot ; These equations define the ROM communications area, containing. data;. ! 3 that must be accessed by both the ROM and user/appl;catipnflproqrams. This data is accessed from the ''user' program by setting DS . 5.0, 5 DSADDR EQU 4%60H ; (WORD) pointer to DS for System ROM,(RQOMDAT) DSSIZR EQU DSADDC EQU 4%60H+2 4%*61H ; (WORD) ; (WORD) size of DS for System ROM (RQ&DAT) pointer to DS for ROM..at BOMGOD: 0000 DSSIZ0 EQU 4*%*61H+2 ; (WORD) size of DS for ROM at ROHCQQ;QOOO DSADD2 EQU 4%62H ; (WORD) pointer to DS for ROM at ROMCQD:20Q0 DSS1Z2 EQU DSADD4 EQU 4%x62H+2 4%63H ; (HORD) ; (WORD) size of DS for ROM at ROMCOD:2000 pointer to DS for ROM at ROMCOD:4000 DSS1IZ4 EQU 4%*63H+2 ; (HORD) size of DS for ROM at ROMCOD:4000 DSADDE6 EQU 4%x64H ; (WORD) pointer to DS for ROM at RO&QQp:GOOO DSsSI1Z6 EQU 4%64H+2 ; (HORD) size of DS for ROM atfROHCODtfiOOO : DSADD8 EQU 4%6SH ; (WORD) pointer to BS for ROM at ROMCOD:8000 DsSsi1zs8 EQU 4%6SH+2 MEMSIZ EQU 4*66H ; DISK TDSR e OPERATIOe N CODES ; DKRSET EQU o ; (WORD) size of DS for ROM ai ROMCOD 8000 : ; (HORD) memory size (number of 16-byte blocks) R ee e e L T = t o eay ¥ ; Reset disk system, . drive parms must..be preset DKSTAT EQU 1 DKREAD EQU 2 DKWRIT EQU 3 DKVERF EQU 4 ; Get disk status in (al) ¢ ; Read sectors into memory oD ; Hrite memory to disk seckofi; ; Verify crc on disk sectors » a- - i 2 410 84 . DKVRFY EQU 6 DKSSTA EQU 7 DKFSET EQU 8 DKXSET EQU 8 DKRDIT EQU 10 DKKMOT EQU 11 DKBADC EQU 12 ; Verify memory against disk.;;ptors G YRS ; Get disk status for pre-retry. (if any) . - ; Set UNIT & standard DIT for A drive e ; Set UNIT & DIT address for a drive . - - ; Return DIT address for driyve N ot ; Turn off Floppy Disk Motors , O ; 0ld >= this is a bad command.. o ;***t********t********t*t**********************k*********t***k******g*}t***t ) e B 8 10 segment - defines load address and entry point for BIOS I0 SEGMENT AT 40H ASSUME Cs:IO ; absolute location 400H I0osyYs IosYs ; Io CODE PROC ENDP ENDS RSAECGEMENT ASSUME FAR AT 0000 CS:CODE, ; 10.8YS loaded here (40:000095: jaE & GA; 20D ot HT ; Absolute location DS:CODE, SS:CODE, ES:CODE 0000H : Jog s 10E Ues 104 ey foi yps Thiea V6 1 e NRE TECHRICAL REFERENCE BOOT ROUTINE AND SAMPLE ASSEMBLY CODE TR AR R R AR R R R R AR KRR R KRR AR AR AR R A AR AR R R A AR A AR AR R AR RRRRR AR A AR T h A b 5 Data area for ROM definitions Ak R R AR R R Ak Rk Ak kAR AR AR Ak kA AR Ak Ak AR R A AR R R AR A AR KRR KRR AR AR KRR KR KA Kk & `ORG OLDRMD ~ LABEL 400H HORD ; Initial location of ROM data area 1; 051z'2 `EQU ORG 7 1200H ; Number of sectors in I0.SYS ; (OLDRMD+7%512) ROMDAT LABEL ORG BYTE 1200H+13CH ; Location of rom data area MOVDST EQU TR AR KRR KRR AR ; SRR KRR Rk (ROKDAT-OLDRMD/1)6 R AR AR AN R AR AR A A R AR AR A R A R AR MODULE ENTRY kR kAR kR R AR R AR R A AR R AR R A AR RN R kR A POINT K AR AR AR R AR A kR Ak A kAR A AR A AR R AR AR KRR R KA AR AR AR KA KRR R AR AR A kAR AR AR KRR BOOT ; ORG PROC JIMP O0CO00H FAR - - 'BOOTST LT e ey B e R e ORG e iy OCOO03H ¢ 3 File access table - ; Entry point for boot logic gLy HEADER DATA AREA e ; Always U R start here e e se e Shows the loader where to find 10.SYS S 2 S Sl isls S s S IOSEC IOTRK IOHEADTM 7 i 3 . DSKTYP D8 8 DB 0 BB ""¢ "¢g " : : ¥ side 40 track load sector ; 1 side 40 track load track ; 1 side 40 track load head THE-FOLLOWINBGYT'E INDIC THA E TDREIVE MUST TYPE BE SET UP FOR WHICH BY THE FORMAT COMMAND TO THE DISK IS FORMATTED. TFHLEOP"PPYERMBIISSSKTITBYLPEE. VALUES ARE 0-3 WHICH CORRESPOND WITH THE DB e 00400 E s ; Disk formatted type QOODRV D;_ o 091_ ;.. iNcHESTER DIT ; Storage for boot drive iINDIT nf&§¥R¢_<>' rte gl ; 18 BYTES LONG ' =BT ma RETE eyt AR ;. SIGNON. DB.. . -GR,LF, 'BOOT. V' DB VERS/10+'0',',.V"E'RS MOD 10+'0' ,REV+'0" DB ' (ec) 1983 Texas Instruments, Inc.',0 number PR AR P PAGE o . KA R AR AR KRR KR KRR R A A AR NCLITHES LHLEEL i v4 i e rapnooari A AR AR AR A KA KRR R AR A KRR AR AR AR AR AR AR A AR KA KKK oisy = xQC"23 TECHNICAL REFERENCE ITATYHAEORT BOOT ROUTINE AND SAMPLE ASSEMBLY CODE > bw e £ ; DISK BOOT LOGIC address 400H) 1200H). This found, it can same manner as ROMDAT is mo ved from its initial - AVt AN locatxon (absolute to its worki ng location under MSDOS (abs oLute,addral code is call ed (FAR) by the ROM. If an error is : perform a RE Turn to let the ROM handle it in the, the other boot-time errors. X 8 INPUT: BL = Floppy drive from which to stack is set up below this code attempt the by the ROM boot 8; 0OTST: MOV SI,OFFSET SIGNON; Signon the boot sector CALL MSG TR - s Al % NiLdEeu 5 ; First, move the ROM data area out of the way. BOO2: PUSH MOV MOV MOV MOV MOV MOV OR JINZ suUB JMP ES AX,Cs DS ,AX ES ,AX BOODRYV, BL BX,DSADDS AX,[8Xx]) AX,AX BOO4 BX, 4 BOO2 ; Save the ROM's ES : Note that ¢S = CODE = COOOH) ; DS = CS = CODE = 00QOOH ; ES = CS = CODE = 0000H - ; Save boot drive £ e ; Point to last possible ; Get data pointer :Q: Data area in use? rom data area £ ; ¥: Jump and calc data length o Lp ; N: Point to next data area polnter ; And check it r 3 2l point BOO4: MOV SHL ADD sSuB MOV MOV MOV MOV ADD CL,4 AX,CL AX,[BXx+2] AX,offset CX,Ax SI,offset DI,offset BP,CX BP,DI ; ` ¢ OLDRMD; ; OLDRMD; ROMDAT; ; 1 Convert dsaddX pointer to absolute -addre And add Subtract in the last data area the original locaflon length Results in total length to.move- DS:SI = source for the. mnve . ES:DI = destination for the move Get length + ROMDAT of move into BP = lowest avaflable & memory MoV CHP JE : ADD ADD DEC DEC STD CLI REP CLD MoV BOOS: CMP DX,Ds:word DX,(offset BOO7 s1,CXx DI,cx s DI HOVSB BX,DSADDR ptr DSADDR ROMDAT/16) ; Pick up the ROMDAT pointer ; B Q: Has the (True if move already taken plac ROM is retry:ng the boo B g Y: N: Then Then skip the move do the `mové' thls txme ; ; ; i Do the move in reverse in case ROM area is larger O relative. O relative: [ khan move`&ength 2 £a o +; Protect the move ansa ;:: Do the -move -1 g Av ;:; RESET STRING DIRECTION i::; Set up the rest - start with DSA vord ptr [BX]},0000 ;7: Q! ROM'g DSADDx = zero ? G-S TEGHNICAL REFERENCE BOOT ROUTINE AND SAMPLE ASSEMBLY CODE BOO6 : e BOO7: e ADD CHMP I E ADD JIMP STI BOOSG word ptr [BX],MOVDST BX,DSADDS8 BOO7 BX, 4 SHORT BOOS H N: Not installed, go to next one ;;:; Y: Then adjust it e ::: Q: Are we all done ? XT Y: Continue with boot ol N: Point to the next ROM's DSADDx ;:, and loop for next one ;:: Shields down ] HERE ROMDAT HAS BEEN MOVED AND BP CONTAINS LOWEST AVAILABLE MEM ADDRESS ; TELL DSR ABOUT THIS DISK TYPE ; MOV DL, BOODRV ;: Drive number MOV AL, DSKTYP MOV AH,DKFSET : Get ; Set the disk formatted type the floppy DIT opcode INT DSKINT ; Go do it. ) Set up the WINCHESTER if it is installed. . © 100T20: MOV OR JZ PUSH MOV MOV MOV CALL Pop AX,DS:WORD PTR DSADD4 AX,AX BOOT20 ES - ES,AX SI,OFFSET WINDIT+4 AH,O ., (ES:DWORD ES PTR 0000 ;check for winchester :Q:; winchester installed? ; N; jump : Y, save Ds ;get winchester ROM ES ;get pointer to new DIT ;copy and «set new winchester ;call the ;retrieve winchester ES " ROM DIT Load I10.SYS first - 7 sectors (3.SK) loaded, have to If a disk error occurs, it returns to the caller the routine DKBOOT in for the error handling System ROM) . (the caller miss the ROM data is assumed to be area MoV MOV MOV Hov KoV INT JB MOV MOV JMP register JBOOT: POP BX,offset OLDRMD CX,word ptr IOSEC DH, IOHEAD DL, BOODRYV AX,DKREAD*256+I0SIZ DSKINT NOBOOT BL,DL AX,BP 108Ys AH contains an error code Transfer Starting .. and offset (ES already set) at proper track and sector head From boot disk. 7 sectors Select disk read function Disk DSR If error, die Tell BIOS init about the boot drive And, the lowest available address Else, go to BIOS init code to be reported by the ROM ES ; Restore original ES before ROM gets at it G-6 TECHNICAL REFERENCE BOOT ROUTINE AND SAMPLE ASSEMBLY 'CODE BOOT MOV RET ENDP DS ,DS:word ptr DSADDR ; And point DS at the nev flOHDAT FAR Return to DKBOOT v PAGE S **itk*t******************k*******k*****************t*************** 3 MSG - Output string of characters in the current ¢S to" the CRT The string should be terminated with a zero byte. . INPU T: SI = offset of string in current Cs B OUTP uT: (screen) khkhkkkk: ; USED: AX,SI : STAC K: MSGLl: MSG CODLEN CODFIL ` CODE 21 ] DH ENDS END CS:byte ptr [sI]; AL, AL ; MSG1 ] AH,CRTHTY CRTINT ; HMSGO : $-800T 8 $12-CODLEN-4 : CODFIL DUP (0) ; TR : 0000H Get the char : AL T Q: Last char? St N: Jump and print ft. - ¥: *%x RETURN #%% Else print it S0l And loop T R o LENGTH OF THE CODE STPOATCAEL SFPIALCLEER AVAIL FOR- coneo * g Disk Boot identifier SiF sector CRC (Calculaf!d = i X?t iy TV. T RS S VoK 5C ik `\o',"2 A% by J@EY`2u(G}stylility)< G~-7 5D wJeMizRs Hakncs C TECHRICAL REFERENCE BOOT ROUTINE AND SAMPLE ASSEMBLY CODE The following pages show a sample assembly code. ., @& 2048 byte ROM at address F400:6000. This code will set up DATASIZ EQU~ 30H ;ROMDS ;ROMDS ;ROMDS ROMDS :ROMDS EQU EQU EQU EQU EQU 184H 188H 18CH '192H 196H CODE SEGMENT AT OF400H ASSUME CS:CODE ORG 6000H ;length of required data area ;can be zero but must be multiple of 16 ;for ROM at F400:0000 ;for ROM at F400:2000 ifor ROM at F400:4000 ;for ROM at F400:6000 ;for ROM at F400:8000 (main board) ; ROM ' MSGBEG HEADER DH DHW DB DB DB DB MSGLEN EQU 2048 ENTRY MSGLEN ODH, OAH 'V1.23 XMPROM, example ROM ODH, OAH $-MSGBEG ;ROM size ;entry point address imessage length ;carriage iversion, return, line feed 6-character name, ; message ;carriage return, line feed ;: ENTRY POINT 3 ENTRY PUSH PUSH PUSH PUSH FOR POWERUP < BX DX SI Ds CODE ;save : ; g important registers ; ALLOCATE OPTION ROM DATA ' XOR AX,AX MOV DS ,AX MOV BX,180H AREA MOV MOV SHL ENT0O: ADD ABD CMP JINZ SHR MoV MOV AX,[8X) CL,4 AX,CL AX,[BX+2] BX,4 BX,ROMDS ENTGCO AX,CL [BX],AX [BX+2],DATASIZ IN RAM ;setup segment to point 3 to vector area ;check for RAM in use starting ; with system area ;get segment address ;convert to absolute ; for ROM address ;add in length of segment ;point to next ROMS RAM seg pointer iQ: is this the pointer for my ROM? ; N: continue adding up RAM usage ; Y: convert address to segment 9 store my segment address : and the segment length : SET UP MY i EACH TIME ' DS AS REQUIRED TO MY THIS ROM IS CALLED. DATA AREA. THIS CAN BE DONE TECHNICAL REFERENCE BOOT ROUTINE AND SAMPLE ASSEMBLY CODE IVLINSTIT MOV DS,CS: (WORD PTR ROMDS+0COOOH) Tt RS T " ;additional init coed as réguirad POP bs POP st POP DX POP BX ;retrieve o B ; the calling ROMS regs. o fig i .. .- ORG DW ENDS END 6000H+2048-2 ROMCRC ;address for the fiQfiECRC 3 Triwy . é-98/10 TECHNICAL REFERENCE SAMPLE INTERRUPT SERVICE ROUTINE Appendix H SAMPLE INTERRUPT SERVICE ROUTINE An ISR example, with the appropriate routines to install and remove it, follows. The source of the common interrupt exit routine and the code to count the number of outstanding interrupts (INTCTR) are also given. Using this code is not mandatory, but is recommended to maintain future compatibility. H-1 TRSHNISAY, REFRBENGE. SAMPLE INTERRUPT SERVICE ROUTINE . ~ ; Exit logic POP ES "POP BP " _PpOoPp SI DI POP bXx pop cX poP BX Restore environment "., "AMoChouLToIm % Nv.dom L AiXgHAXAL. ] ;. Disable interrupts Reset 8259 interrupt ; AX = 0000 controller 3 "xPDMoOwET QPCvY =ri~.'pDSs: ,Ax (byfé ptr Point to vector area INTCTR) ; Decrement interrupt : | §A5X .Cs:STKSAV+2 ; Restore original SsS:SP counter T, sp ,CS : srxg@y gy E2 T2: BT 3 P da% r iy Lk ; Restore original DS . ** INTERRUPT RETURN +*x INTSRV ENDP = - i TECHNICAL REFERENCE Example 3 SAMPLE INTQR&UPT SERVICAnEiuLRaOTUYTINE I;: NTINS PPRUOSCH ANXEAR PUSH BX o - i 23& gc , = V] PUSH MOV DS CS:DATSEG,DS = ' '; Set up CS-relative ;" the local DS poinferi 8 necessary b§¢°";° the g nly ; ; 5 &l;iF' `1rt efeisrenicnevoktehde- é? 19 has\ihen the Cfi; o Patch the interrupt vector to point to the Interrupt Service i Routine, saving the original vector. Tfixs ilrustrates the B `brute force' method of settlng and gef%xng Vecfors. o 8088 Operating Systems (e `'g. MS-DOS) have systefi call B accomplish this feat. THeir use is preferable, becauss `some s Operating Systems attempt to arbitrate vector usage. XOR AX,AX MOV Ds ,AX CLI ; Clear AX ; Ds <-- Q0000 ; Protect the vector operation N Pick up original vector i' MOV AX,DS:(word ptr (INTNUM*4)) MOV BX,DS:(word ptr (INTNUMXx4+2)) 4 8 Save original vector in local save area MOV CS:VECSAV,AX MOV CS:VECSAV+2,BX 8 Install vector to Interrupt Service Routine INTINS MOV MOV STI POP POP POP RET ENDP DS:(word ptr (INTNUMX4)),o0ffset INTSRV DS:(word ptr (INTNUM*4+2)),CS ; Interrupts OK again Ds BX AX ; k% RETURN #*x+% S ve ns . v we TECHNICAL REFERENCE SAMPLE INTERRUPT SERVICE ROUTIKE Exdipre &°°7 7 e e B e T 1-fir---9--- ----- R e B Interrupt Service Routine REMoval routine SO0 5 - fifififirfifl""'L ------------ e e e Ss s e bedie 'Pbsy e ANXEYAR 22 ng Ty ,n:;.-7 5 SSU`flx- SN 3 i uUs XOR AX,AX ; Clear AX MOV DS ,AX ; DS <-~ 0000 CLI iEas 2 i i ; Protect the vector operation Get original vector from local save; 2 fia b MoV' Hov') fa 1QBXX3,CCASSL::yVVIECCSS%AVVe`+32A » Byt R p Restore original -vector' area . S i INTREM INTSEG MOV, DS :¢vord BEr "( INTNUMY)4, )AX MOV DS:(word ptr (INTNUMx4+2)),BX STI ; Interrupts OK again POP Ds ; PPOOPP BX AX P RET ; *x% RETURN %%t ENDP TTrae s e z 1 Jmv e L ENRS . gqinc> b' "3a END int s vemann el nad B i Y. (& o gt nal 3 b5 ey T e oae Buen Mot ) > 12 sr AnpiS pkaooetil° woox RERTER Sos i ¥ 4 : 1 ' H-6 TECHNICAL REFERENCE SAMPLE INTERRUPT SERVICE RQUTINE This is the source for the comnmon interrupt exit routiine as"?3¥. e}):is in ROM. Any other common: exit routine installed-her@`Vill erfo;mflanu identical function. The user should use this exit 4% the xnutalled interrupt service routine will be running concurrently'{ith a zal time Operating System (for instance, during the exacutionkot an? the TI communication packages). Example S " AR R ¥zfi,.A2Al Ve o e 4 Common Interrupt Exit logic o i o KB ; = mend 103 - e 3 INPUT: ES:BX = SS:SP of the- interrupted code H o Interrupt stack contains saved ES,BX,AX. (ES''at top 8 of stack) CaVaLDIVIED.YE 2 5 Stack N of S inN terrupted codeecontazns saved g oo DS gkmeeEILL ey IR E ROHDAT SEGMENT BYTE PUBLIC " ROMDAT EXTRN EXTRN ENDS IXSSSV:HORD IXSPSVY:RORD gl 1 Al (e e o Temporary stpgfi_pobnror saveY;: S B Lfl AR U s RS `:; & `( 4`..` i .'.'».»,-; & R 2% - ROMCOD I: NTXIT SEGMENT ASSUME PROC BYTE PUSBLIC CS:ROMCOD, DS:ROMDAT FAR TSR X 'Oi LA "f; RLte e : CLI oMuOTV A1L8,H,2A0LH ; Disable interrupts o33 C g ; Reset 8255 interrupt4 controllé2r)- DEC_ CS:(byte ptr INTCTR+0COOOH) ; Decrement interrupt d counter (remember, this is in : ROM, so access to the vector o area is CS-relative) MOV DS ,Cs:(word ptr DSADDR+CCOOOH) ; Get ROM's DS MOV IXsSssV,Es Save SS,SP of original code MOV IXspsv,BX POP ES ; Restore commonly used registers POP BX B from interrupt stack POP AX MOV 8S,I1Xsssv ; Restore original Ss,sp MOV SP,IXSPSV POP Ds ; Restore DS from original stack INTXIT IRET ENDP ; *k% INTERRUPT RETURN #%#% ; ROMCOD ENDS END B H-7/8 TECHNICAL REFERENCE INDEX A abort timer: answer mode originate mode address: counter it decode . o . latch 5 s lines o o B multiplexer switch MUX switch generat register . valid bit o s address, logical addressing. o . AIOHWC . s g . ALB s o s . ALE P . alphanumeric: CRT decode - graphics. e o alternate character analog loopback arbitration s assigning alternate attribute: bits. hardware. interaction latch logic attributes. ion set track bit: correlations definitions position shift blanking 5 display blink o . blinking block buffer. buffered-step burst length bytes, byte: device contro command completion error status 1 block status Index-1 Cve g INDEX .3-29, .3~431, «2-42, TECHNICAL REFERENCE R 1/0 decoding . . o . 1/C ports . 5 x e . I1/0 wait states 2 = o K &;xboard: : mapping . queueing . system . a L . . . . . . . o J logical address, HIGH, MIDDLE, logic:: expansion memory control. . memory refresh . g o leng space received .2..:0:" lgopback . o o . . loss of carrier . . . LOW: logical address . . ¥ < M. - mask, interrupt = . o memory adddressing. % % memory control: `logice o o 5 S state machine a o o state machine, expansion, memory refresh logic . 0 MPFM . . S . MIDDLE logical address. . miscellaneous error codes . modem: responses s & o : software 0 . . . time-outs . . modified frequency modulatxon motherboard: `memory . o 3 memory addressing . . MRDC- . 5 . . . MREAD~ . g . : mu)tiplexer svitch . 3§ multiplexers . .- % % MHRITE~- 5 o x ` . N NMI- a & . no' response 3 . C & nonmaskable interrupt . : non---blinking Index-6 PyINDEX 2-15 S Jd-35, `3-39 2-21 rea : o tr ' N 1 w LW W NWWNN 1 . L2-31, . 2-30, T ' 3-23 3-22 2-20 2-20 2-58 2-58 2-22 3-32 2-58 2-58 3-22 2-58 1o2-43 N W b WWN an o w AaNN W N o TE&HN ICAL REFERENCE TiLhanoEy ' INDEX numeric. goprocessor - 5 .» . :i4 . N S Xy 2T Y odd sum a o g o 5 on~board EPROM/ROM. 3 ¢ operating system . 5 s output port S 5 5 4 OSC clock . . . - . 5 e . S . . 4 e ) . ., S S £ . e 5 . . . 0 o & e . . 2=22 . ihrat@--as S 34-2 W ~ig=-40 il 258 P g palette 5 . . 2 I palette number. d o 3 5 parallel printer port . g R parity generation and checking. parity PCLKIN generation . . and g checking, - , A phase-locked loop . pixel . A , h " Y " . g . pixel addressin o . 5 T pixels. plane . a . o . 0 . a . 5 . & . poll for controller request . port: data output . b a 5 2 input data o o o g a reget s b o o & 4 precompensation . 5 . & print screen & o 5 . o processor-clock d . 9 g processor, data o o r e program break . o o o g program pause . g . . T e ey 0 a . ¥t e 3e2Y a .3-28,23%31 el Ta o Lun Ly GR2+16,8423 S e G AR NN L 2n22 expansion a L . q y . femory - .7 .. Bsg'l S 4 . v 'R-58 q T N v96 sauaile Lelirdgl3eng . R . R . . 3-27 e . 3 . s . E . % . ., 2=4% eI =27, . s : ; 4-71 h; Z o 3 .y 3~40 < .13-40 5 - o v ..3440 a Ry le s £2-30 a il Bt tat . \14~57 . . ? . a . 24853 o S B LR A A S DolM sy it Ay LS s Ay e R RAM DIA)GNOSTICS . . 5 . o IR] A RAM DIAGNOSTICS command 0 o . . RAM, expansion. 4 a 5 3 o a raster graphics RDLB . . : e . P S . . . . . o L . READ command . S e . . s READ ECC BURST ERROR LENGTH command S 4 READ READ LONG command SECTOR BUFFER . o s command. S . o . : : RECALIBRATE DRIVE command . . o ' recovering data refresh: s . 0 s 2 5 e cycle = o o o o o . a logic . e 0 4 . . 4 . logic,. expagsion memory . s . . timer 4 o . . . . . 5 refreshing. 5 S . . o . . e Iy g S 2 S . S . A e o Lfnaw . o c . ' . = s A G s . S i . B3 Te gy A0 FigT LFaews . 3-46 . 3-67 . . e . o Gk e o . . Tk . . . \ TECHNICAL REFERENCE register assignments o register, controller status remote digital loopback request controller error sense "REQUEST SENSE STATUS command reset: detection circuit S line. o a E 8 EPOY. otV ot L resolution. g S reverse 0 = reverse video and cursor reverse-video . RFSH: ., * = 3 . ROM © .., . . S o ROM interface, system s ¢ scan rate . . g . screen display. . J screen/CPU arbitration. scrok¥ling . 5 G- sector buffer . s . sactor field description sector .interleaving - SEEK command . 5 . 16 3 sefd Winchester controller command. séisé, controller error separator e serval communicatxons d ser;al/parallel data conversion software: commands. 3 g "timeouts. . . spacé. received, long speaker 2 speaker ampli!;er 0 a stdarting screen display state machine . . state machine, expansion memory control s¥atic protection.. 5t status lines status register switch generation, CAS and address MUX. system ROM interface system timers and speaker T terminating resistor . terminal or software time-outs. TEST DRIVE READY o . TEST DRIVE READY command Index-8 - t- 1 LNDEX 3-39 3-40 3~23 4-72 3-46 2-12 2~-58 3-40 2-41 2-42 2-5S5 2-43 2-59 2-53 4-2 2-41 2-44 2-47 .2-43, 2-44 2-26 3-70 3-38 3-57 $-72 L 4-72 2-30 ~ = 2-31 3-22 3-69 3-45S TECHNICAL REFERENCE testing, command o o . . 2 timer, abort . . o . 2 i timers. . . 0 s 0 o v T time-outs, modem . . B s ' time-outs, terminal or software . 4 u underline . o s . . v vertical: . blanking. o s o S scan rate S o 5 S . synchronizing sigpal. o S . video: connector . 3 3 S . memory . 0 . s o ~ " W WAIT- . e B .. b . . Hinchester controller: » command .. . . . . . . . data . . . . o . . S disable data and status interrupt . . enable data and status interrupt.. cenable status interrupt o ,get and compare data get status 5 o . - poll for regquest . s . write data Winchester: . e o . S -disk system . o s . drive format . a e error codes . 0 o o 1/0 ports S o ROM S . . . wrap . s o e 5 o WRITE command . 6 5 9 Write data WRITE LONG to the Winchester command. o 8 contréllef write preconpensation circuit WRITE SECTOR BUFFER command : < IIRDBY o3 . 3-364 8rR2 L AR=L! B$d,n 22-5%5d6; 5 w2=84 "1Index-9/10 o - i 5 ¥ " . g 5 bapmmoa l,';r,q ; 3 2 `s 3 . . B : 8 B . dsaais 3N L= 3 ¥ 5 O ! 8 } . wir=l o a . omebom | w tlEENm si#viloe 10 lamimiad |, o -- < " b $ua3 eoi>l n v 7 n i acdi b8 r 8 .? I$8 . 3 7 F B A ATHT NEID Lheg B L . i . lsapie paizinedssNe 'l ' : f oA - -0 s o g '«..'-`;._snnb_"!'_ FII She . . 2 . . } ) S (1A i i i 2le20 § . v . - s . by 5 B 3 1 T 5 {gquinatal egvisie Lo N _ =l | pla o it 5 . dquansian esiste bhing Tl i ] = L . . itguvtednd o . . - B £3LH B0 n I . : 2 ] . dnm1od avE 1 17 i ; zeban SEETa o 1y @t . MEH" ¥ i - . - . . . - T ; ) . - - . - ) - . . . " . Gnogkgn fi ! 5 & e o . ) 2 qaitosdinon 5 5 dsdeadosniW ofd gof aiol ] 5 .o CBasmaes SR3CT L LI i 2 . 9 . diunizo nolissnsanconig =i oy basmnoo &3pikepdf 4.0.1