Apple A1601 Tablet Device User Manual ipad sign off taos 9 10 14
Apple Inc. Tablet Device ipad sign off taos 9 10 14
Apple >
iPad_User_Guide_Draft_9-10-14_RdSz_v1.0
DRAFT iPad User Guide For iOS 8 Software (October 2014) Apple Confidential DRAFT Contents 10 10 11 11 12 13 Chapter 1: iPad at a Glance 14 14 14 15 15 15 17 17 17 18 19 19 19 20 20 Chapter 2: Getting Started 21 21 24 25 27 30 31 32 32 34 34 34 37 37 38 38 Chapter 3: Basics iPad Overview Accessories Multi-Touch screen Sleep/Wake button Home button Volume buttons and the Side Switch SIM card tray Status icons Set up iPad Sign up for cellular service Connect to Wi-Fi Apple ID iCloud Set up other mail, contacts, and calendar accounts Manage content on your iOS devices Sync with iTunes Connect iPad to your computer Date and time International settings Your iPad name View this user guide on iPad Tips for using iOS 8 Use apps Continuity Customize iPad Type text Dictation Search Control Center #NGTVUCPF0QVK°ECVKQP%GPVGT Sounds and silence Do Not Disturb Sharing iCloud Drive 6TCPUHGT°NGU Personal Hotspot AirPlay Apple Confidential DRAFT 38 39 39 39 40 43 44 AirPrint Bluetooth devices Restrictions Privacy Security Charge and monitor the battery Travel with iPad 46 46 47 47 47 Chapter 4: Siri 48 48 49 50 50 51 Chapter 5: Messages 52 52 53 53 54 54 55 55 55 56 Chapter 6: Mail 57 57 58 58 59 60 60 61 62 62 62 Chapter 7: Safari 64 64 64 65 67 67 68 Chapter 8: Music Use Siri Tell Siri about yourself Make corrections Siri settings iMessage service Send and receive messages Manage conversations Share photos, videos, your location, and more Messages settings Write messages Get a sneak peek Finish a message later See important messages Attachments Work with multiple messages See and save addresses Print messages Mail settings Safari at a glance Search the web Browse the web Keep bookmarks Save a reading list for later Shared links and subscriptions Fill in forms Avoid clutter with Reader Privacy and security Safari settings Get music iTunes Radio Browse and play iCloud and iTunes Match Playlists Geniusâmade for you Contents Apple Confidential DRAFT 68 69 69 Siri Home Sharing Music settings 70 70 71 71 Chapter 9: FaceTime 72 72 72 73 74 74 Chapter 10: Calendar 75 75 76 76 77 77 79 79 81 81 81 Chapter 11: Photos 82 82 83 84 84 85 Chapter 12: Camera 86 86 86 87 87 Chapter 13: Contacts 88 88 89 Chapter 14: Clock 90 90 91 91 92 92 Chapter 15: Maps FaceTime at a glance Make and answer calls Manage calls Calendar at a glance Invitations Use multiple calendars Share iCloud calendars Calendar settings View photos and videos Organize photos and videos iCloud Photo Library (Beta) My Photo Stream iCloud Photo Sharing Other ways to share photos and videos Edit photos and trim videos Print photos Import photos and videos Photos settings Camera at a glance Take photos and videos HDR View, share, and print Camera settings Contacts at a glance Add contacts Unify contacts Contacts settings Clock at a glance Alarms and timers Find places Get more info Get directions 3D and Flyover Maps settings Contents Apple Confidential DRAFT 93 93 93 94 95 Chapter 16: Videos 96 96 96 Chapter 17: Notes 98 98 99 99 99 Chapter 18: Reminders Videos at a glance Add videos to your library Control playback Videos settings Notes at a glance Share notes in multiple accounts Reminders at a glance Scheduled reminders Location reminders Reminders settings 101 Chapter 19: Photo Booth 101 Take photos 102 Manage photos 103 Chapter 20: Game Center 103 Game Center at a glance 104 Play games with friends 104 Game Center settings 105 Chapter 21: Newsstand 106 106 107 108 108 Chapter 22: iTunes Store 110 110 110 111 112 Chapter 23: App Store 113 113 113 114 114 115 115 116 Chapter 24: iBooks 117 117 117 119 Chapter 25: Podcasts iTunes Store at a glance Browse or search Purchase, rent, or redeem iTunes Store settings App Store at a glance Find apps Purchase, redeem, and download App Store settings Get books Read a book Interact with multimedia Study notes and glossary terms Organize books Read PDFs iBooks settings Podcasts at a glance Get podcasts and episodes Control playback Contents Apple Confidential DRAFT 119 Organize your favorites into stations 120 Podcasts settings 121 121 122 122 133 134 134 134 134 135 135 135 135 135 135 135 136 137 137 137 137 138 141 143 Appendix A: Accessibility 144 144 144 144 144 Appendix B: iPad in Business Accessibility features Accessibility Shortcut VoiceOver Zoom Invert Colors and Grayscale Speak Selection Speak Screen Speak Auto-Text Large, bold, and high-contrast text Button Shapes Reduce screen motion 1PQĂUYKVEJNCDGNU Assignable tones Video Descriptions Hearing aids Mono audio and balance Subtitles and closed captions Siri Widescreen keyboards Guided Access Switch Control AssistiveTouch Accessibility in OS X iPad in the enterprise Mail, Contacts, and Calendar Network access Apps 146 Appendix C: International Keyboards 146 Use international keyboards 147 Special input methods 149 149 151 152 152 153 153 153 153 154 154 154 155 Appendix D: Safety, Handling, & Support Important safety information Important handling information iPad Support site Restart or reset iPad Reset iPad settings #PCRRFQGUP¨V°NNVJGUETGGP Onscreen keyboard doesnât appear Get information about your iPad Usage information Disabled iPad VPN settings 2TQ°NGUUGVVKPIU Contents Apple Confidential DRAFT 155 156 156 157 158 159 159 160 160 162 162 Back up iPad Update and restore iPad software Cellular settings Sound, music, and video Sell or give away iPad Learning more, service, and support FCC compliance statement Canadian regulatory statement Disposal and recycling information ENERGY STARÂŽ compliance statement Apple and the environment Contents Apple Confidential DRAFT iPad at a Glance iPad Overview This guide describes iOS 8 for: iPad 2 iPad (3rd generation and 4th generation) iPad mini, iPad mini with Retina display, and iPad mini with Retina display (2nd generation) iPad Air and iPad Air (2nd generation) iPad mini with Retina display (2nd generation) FaceTime HD camera Status bar App icons Multi-Touch display Home button/ Touch ID sensor Sleep/Wake button iSight camera Side Switch Headset jack Volume buttons Microphones Speakers Nano-SIM tray (cellular models) Lightning connector Apple Confidential DRAFT iPad Air (2nd generation) FaceTime HD camera Status bar App icons Multi-Touch display Home button/ Touch ID sensor Microphones Sleep/Wake button Headset jack iSight camera Volume buttons Nano-SIM tray (cellular models) Speakers Lightning connector Your features and apps may vary depending on the model of iPad you have, and on your NQECVKQPNCPIWCIGCPFECTTKGT6Q°PFQWVYJKEJHGCVWTGUCTGUWRRQTVGFKP[QWTCTGCUGG www.apple.com/ios/feature-availability. Note: Apps and services that send or receive data over a cellular network may incur additional fees. Contact your carrier for information about your iPad service plan and fees. Accessories The following accessories are included with iPad: Chapter 1 iPad at a Glance Apple Confidential DRAFT USB power adapter. Use with the Lightning to USB Cable or the 30-pin to USB Cable to charge the iPad battery. The size of your adapter depends on the iPad model and your region. Lightning to USB Cable. Use this to connect iPad (4th generation or later) or iPad mini to the USB power adapter or to your computer. Earlier iPad models use a 30-pin to USB Cable. Multi-Touch screen A few simple gesturesâtap, drag, swipe, and pinch/stretchâare all you need to use iPad and its apps. Sleep/Wake button You can lock iPad and put it to sleep when youâre not using it. Locking iPad puts the display to sleep, saves the battery, and prevents anything from happening if you touch the screen. You still IGV(CEG6KOGECNNUVGZVOGUUCIGUCNCTOUCPFPQVK°ECVKQPUCPFECPNKUVGPVQOWUKECPFCFLWUV the volume. Sleep/Wake button Lock iPad. Press the Sleep/Wake button. Unlock iPad. Press the Home button or the Sleep/Wake button, then drag the slider that appears onscreen. For additional security, you can require a passcode to unlock iPad. Go to Settings > Touch ID & Passcode (iPad models with Touch ID) or Settings > Passcode (other models). See Use a passcode with data protection on page 40. Turn iPad on. Hold down the Sleep/Wake button until the Apple logo appears. Chapter 1 iPad at a Glance 10 Apple Confidential DRAFT 6WTPK2CFQĂHold down the Sleep/Wake button for a few seconds until the slider appears onscreen, then drag the slider. If you donât touch the screen for two minutes, iPad locks itself. You can change how long iPad waits to lock itself, or set a passcode to unlock iPad. Set the auto-lock time. Go to Settings > General > Auto-Lock. Set a passcode. Go to Settings > Passcode. An iPad Smart Cover or iPad Smart Case, sold separately, can lock or unlock iPad for you (iPad 2 or later). Set your iPad Smart Cover or iPad Smart Case to lock and unlock iPad. Go to Settings > General, then turn on Lock/Unlock. Home button The Home button takes you back to the Home screen at any time. It also provides other convenient shortcuts. Go to the Home screen. Press the Home button. On the Home screen, tap an app to open it. See Start at home on page 21. See apps youâve opened. Double-click the Home button when iPad is unlocked, then swipe left or right. Use Siri (iPad 3rd generation or later). Press and hold the Home button. See Use Siri on page 46. ;QWECPCNUQWUGVJG*QOGDWVVQPVQVWTPCEEGUUKDKNKV[HGCVWTGUQPQTQĂ5GGAccessibility Shortcut on page 122. On iPad models with Touch ID, you can use the sensor in the Home button, instead of using your passcode or Apple ID password, to unlock iPad or make purchases in the iTunes Store, App Store, and iBooks Store. See Touch ID sensor on page 41. You can also use the Touch ID sensor for authentication when using Apple Pay to make a purchase from within an app. See Apple Pay on page 41. Volume buttons and the Side Switch 7UGVJG8QNWOGDWVVQPUVQCFLWUVVJGXQNWOGQHUQPIUCPFQVJGTOGFKCCPFQHCNGTVUCPFUQWPF GĂGEVU7UGVJG5KFG5YKVEJVQUKNGPEGCWFKQCNGTVUCPFPQVK°ECVKQPUQTVQRTGXGPVK2CFHTQO switching between portrait and landscape orientation. (On iPad models without a side switch, use the Control Center.) Side Switch Volume buttons Adjust the volume. Press the Volume buttons. Chapter 1 iPad at a Glance 11 Apple Confidential DRAFT Mute the sound: Press and hold the Volume Down button. Set a volume limit: Go to Settings > Music > Volume Limit. WARNING: For important information about avoiding hearing loss, see Important safety information on page 149. /WVGPQVK°ECVKQPUCNGTVUCPFUQWPFGĂGEVUSlide the Side Switch toward the Volume buttons. The Side Switch doesnât mute the audio from music, podcasts, movies, and TV shows. Use the Side Switch to lock the screen orientation. Go to Settings > General, then tap Lock Rotation. ;QWECPCNUQWUG&Q0QV&KUVWTDVQUKNGPEG(CEG6KOGECNNUCNGTVUCPFPQVK°ECVKQPU Set iPad to Do Not Disturb: Swipe up from the bottom edge of the screen to open Control Center, then tap &Q0QV&KUVWTDMGGRUCNGTVUCPFPQVK°ECVKQPUHTQOOCMKPICP[UQWPFUQT lighting up the screen when the screen is locked. Alarms, however, still sound. If the screen is WPNQEMGF&Q0QV&KUVWTDJCUPQGĂGEV 6QUEJGFWNGSWKGVJQWTUCNNQY(CEG6KOGECNNUHTQOURGEK°ERGQRNGQTCNNQYTGRGCVGF(CEG6KOG calls to ring through, go to Settings > Do Not Disturb. See Do Not Disturb on page 34. SIM card tray The SIM card in iPad Wi-Fi + Cellular models is used for your cellular data connection. If your SIM card isnât installed or if you change carriers, you may need to install or replace the SIM card. SIM eject tool SIM tray Nano-SIM card Open the SIM tray. +PUGTVC5+/GLGEVVQQN UQNFUGRCTCVGN[ KPVQVJGJQNGQPVJG5+/VTC[VJGP RTGUU°TON[CPFRWUJVJGVQQNUVTCKIJVKPWPVKNVJGVTC[RQRUQWV2WNNQWVVJG5+/VTC[VQKPUVCNNQT TGRNCEGVJG5+/ECTF+H[QWFQP¨VJCXGC5+/GLGEVVQQNVT[VJGGPFQHCUOCNNRCRGTENKR Important: A SIM card is required to use cellular services when connecting to GSM networks CPFUQOG%&/#PGVYQTMU;QWTK2CFKUUWDLGEVVQ[QWTYKTGNGUUUGTXKEGRTQXKFGT¨URQNKEKGUYJKEJ may include restrictions on switching service providers and roaming, even after conclusion of any required minimum service contract. Contact your wireless service provider for more details. Availability of cellular capabilities depends on the wireless network. For more information, see Cellular settings on page 156. Chapter 1 iPad at a Glance 12 Apple Confidential DRAFT Status icons The icons in the status bar at the top of the screen give information about iPad: Status icon What it means Wi-Fi iPad has a Wi-Fi Internet connection. The more bars, the stronger the connection. See Connect to Wi-Fi on page 15. Cell signal iPad (Wi-Fi + Cellular models) is in range of the cellular network. If thereâs no signal, âNo serviceâ appears. Airplane Mode Airplane Mode is onâyou canât access the Internet, or use BluetoothÂŽ devices. Non-wireless features are available. See Travel with iPad on page 44. LTE iPad (Wi-Fi + Cellular models) is connected to the Internet over a 4G LTE network. 4G iPad (Wi-Fi + Cellular models) is connected to the Internet over a 4G network. 3G iPad (Wi-Fi + Cellular models) is connected to the Internet over a 3G network. EDGE iPad (Wi-Fi + Cellular models) is connected to the Internet over an EDGE network. GPRS iPad (Wi-Fi + Cellular models) is connected to the Internet over a GPRS network. Do Not Disturb Do Not Disturb is turned on. See Do Not Disturb on page 34. Personal Hotspot iPad is providing a Personal Hotspot for other iOS devices. See Personal Hotspot on page 38. Syncing iPad is syncing with iTunes. See Sync with iTunes on page 17. Activity There is network or other activity. Some third-party apps use this icon to show app activity. VPN iPad is connected to a network using VPN. See Network access on page 144. Lock iPad is locked. See Sleep/Wake button on page 10. Alarm An alarm is set. See Chapter 14, Clock, on page 88. Screen orientation lock Screen orientation is locked. See Change the screen orientation on page 23. Location Services An app is using Location Services. See Privacy on page 39. BluetoothÂŽ Blue or White icon: Bluetooth is on and paired with a device, such as a headset or keyboard. Gray icon: Bluetooth is on and paired with a device, but the device is QWVQHTCPIGQTVWTPGFQĂ No icon: Bluetooth is not paired with a device. See Bluetooth devices on page 39. Bluetooth battery Shows the battery level of a supported paired Bluetooth device. Battery Shows the battery level or charging status. See Charge and monitor the battery on page 43. Chapter 1 iPad at a Glance 13 Apple Confidential DRAFT Getting Started Set up iPad ¡ WARNING: 6QCXQKFKPLWT[TGCFImportant safety information on page 149 before using iPad. Set up iPad. Turn on iPad, then follow the Setup Assistant. The Setup Assistant guides you through the setup process, including: Connecting to a Wi-Fi network Signing in with or creating a free Apple ID (needed for many features, including iCloud, FaceTime, the App Store, the iTunes Store, and more) Entering a passcode Setting up iCloud and iCloud Keychain Turning on recommended features, such as Location Services Activating iPad with your carrier (cellular models) During setup, you can copy your apps, settings, and content from another iPad by restoring from an iCloud backup or from iTunes. See Back up iPad on page 155. Note: Find My iPad is turned on when you sign in to iCloud. Activation Lock is engaged to help prevent anyone else from setting up your iPad, even if it is completely restored. Before you sell QTIKXGCYC[[QWTK2CF[QWUJQWNFTGUGVKVVQGTCUG[QWTRGTUQPCNEQPVGPVCPFVWTPQĂ#EVKXCVKQP Lock. See Sell or give away iPad on page 158. If you donât have access to a Wi-Fi Internet connection during setup, you can use your computerâs +PVGTPGVEQPPGEVKQP¤LWUVEQPPGEVK2CFVQ[QWTEQORWVGTYJGPRTQORVGFD[VJG5GVWR Assistant. For help connecting iPad to your computer, see Connect iPad to your computer on page 18. Sign up for cellular service If your iPad has an Apple LTE SIM card (available on iPad models with cellular and Touch ID), you can choose a carrier and sign up for cellular service right on iPad. Depending on your home carrier and your destination, you may also be able to travel abroad with iPad and sign up for cellular service with a carrier in the country youâre visiting. Not available in all areas and not all carriers are supported; contact your carrier for more information. Sign up for cellular service. Go to Settings > Cellular Data, then tap Set Up Cellular Data and follow the onscreen instructions. Set up cellular service in another country. You can avoid paying roaming fees by switching to another carrier when you travel abroad. Go to Settings > Cellular Data, tap Choose a Data Plan, then select the plan you want to use. Depending on your original carrier, you might need to purchase another Apple SIM card at an Apple Retail Store. 14 Apple Confidential DRAFT Connect to Wi-Fi If appears at the top of the screen, youâre connected to a Wi-Fi network, and iPad reconnects anytime you return to the same location. Join a Wi-Fi network or adjust Wi-Fi settings. Go to Settings > Wi-Fi. Choose a network: Tap one of the listed networks, then enter the password, if asked. Ask to join networks: Turn on Ask to Join Networks to be prompted when a Wi-Fi network KUCXCKNCDNG1VJGTYKUG[QWOWUVOCPWCNN[LQKPCPGVYQTMYJGPCRTGXKQWUN[WUGFPGVYQTM isnât available. Forget a network: Tap Join other network: Tap Other, then enter the name of the network. You need to know the network name, security type, and password. PGZVVQCPGVYQTM[QW¨XGLQKPGFDGHQTGVJGPVCR(QTIGVVJKU0GVYQTM Set up your own Wi-Fi network. +H[QWJCXGCPGYQTWPEQP°IWTGF#KT2QTVDCUGUVCVKQPVWTPGF on and within range, you can use iPad to set it up. Go to Settings > Wi-Fi, then look for âSet up an AirPort base station.â Tap your base station and the Setup Assistant does the rest. Manage your AirPort network. If iPad is connected to an AirPort base station, go to Settings > Wi-Fi, tap next to the network name, then tap âManage this Network.â If you havenât yet downloaded AirPort Utility, tap OK to open the App Store, then download it (this requires an Internet connection). Apple ID ;QWT#RRNG+&KUVJGCEEQWPV[QWWUGHQTLWUVCDQWVGXGT[VJKPI[QWFQYKVJ#RRNGKPENWFKPI storing your content in iCloud, downloading apps from the App Store, and buying music, movies, and TV shows from the iTunes Store. +H[QWCNTGCF[JCXGCP#RRNG+&WUGKVYJGP[QW°TUVUGVWRK2CFCPFYJGPGXGT[QWPGGFVQUKIP in to use an Apple service. If you donât already have an Apple ID, you can create one whenever youâre asked to sign in. You only need one Apple ID for everything you do with Apple. For more information, see appleid.apple.com. iCloud K%NQWFQĂGTUHTGGOCKNEQPVCEVUECNGPFCTCPFQVJGTHGCVWTGUVJCV[QWECPUGVWRUKORN[D[ signing in to iCloud with your Apple ID, then making sure that the features you want to use are turned on. Set up iCloud. Go to Settings > iCloud. Create an Apple ID if needed, or use your existing one. iCloud stores your photos and videos, documents, music, calendars, contacts, and more. Content stored in iCloud is pushed wirelessly to your other iOS devices and computers signed into iCloud with the same Apple ID. iCloud is available on devices with iOS 5 or later, on Mac computers with OS X Lion v10.7.5 or later, and on PCs with iCloud for Windows 4.0 (Windows 7 or Windows 8 is required). Note: iCloud may not be available in all areas, and iCloud features may vary by area. For more information, go to www.apple.com/icloud. Chapter 2 Getting Started 15 Apple Confidential DRAFT iCloud features include: Music, Movies, TV Shows, Apps, and Books: Automatically get iTunes purchases on all your devices set up with iCloud, or download previous iTunes music and TV show purchases for free, anytime. With an iTunes Match subscription, all your music, including music youâve imported from CDs or purchased somewhere other than the iTunes Store, can also be stored in iCloud and played on demand. See iCloud and iTunes Match on page 67. Download previous App Store and iBooks Store purchases to iPad for free, anytime. Photos: Use iCloud Photo Library (Beta) to store all your photos and videos in iCloud, and access them from any iOS 8 device using the same Apple ID. Use iCloud Photo Sharing to UJCTGRJQVQUCPFXKFGQUYKVJLWUVVJGRGQRNG[QWEJQQUGCPFNGVVJGOCFFRJQVQUXKFGQU and comments. See iCloud Photo Library (Beta) on page 76. See iCloud Photo Sharing on page 77. Family Sharing: Up to six family members can share their purchases from the iTunes Store, iBooks Store, and App Store. Pay for family purchases with the same credit card and approve kidsâ spending right from a parentâs device. Plus, share photos, a family calendar, and more. See Family Sharing on page 35. iCloud Drive: Safely store your presentations, spreadsheets, PDFs, images, and other documents in iCloud, and access them from your iPad, iPhone, iPod touch, Mac, or PC. See About iCloud Drive on page 37. Documents in the Cloud: For iCloud-enabled apps, keep documents and app data up to date across all your devices set up with iCloud. Mail, Contacts, Calendars: Keep your mail, contacts, calendars, notes, and reminders up to date across all your devices. Safari Tabs: See the tabs you have open on your other iOS devices and OS X computers. See Browse the web on page 58. Backup: Back up iPad to iCloud automatically when connected to power and Wi-Fi. See Back up iPad on page 155. Find My iPad: Locate your iPad on a map, display a message, play a sound, lock the screen, suspend your digital credit card accounts, or remotely wipe the data. Find My iPad includes #EVKXCVKQP.QEMYJKEJTGSWKTGU[QWT#RRNG+&CPFRCUUYQTFKPQTFGTVQVWTPQĂ(KPF/[ iPad or erase your device. Your Apple ID and password are also required before anyone can reactivate your iPad. See Find My iPad on page 43. Find My Friends: Keep track of your family and friends (when connected to a Wi-Fi or cellular network) using the Find My Friends app. Download the free app from the App Store. iCloud Keychain: Keep your saved passwords and credit card information up to date on your devices. See iCloud Keychain on page 42. You must have an iCloud account and be signed into iCloud to use Apple Pay. See Apple Pay on page 41. With iCloud, you get a free email account and 5 GB of storage for your mail, documents, photos, and backups. Your purchased music, apps, TV shows, and books, as well as your photo streams, donât count against your available space. Upgrade your iCloud storage. Go to Settings > iCloud > Storage, then tap Change Storage Plan. For information about upgrading your iCloud storage, see help.apple.com/icloud. View and download previous purchases, or get purchases shared by your family. iTunes Store: You can access your purchased songs and videos in the Music and Videos apps. Or, in the iTunes Store, tap Purchased . Chapter 2 Getting Started 16 Apple Confidential DRAFT App Store: Go to the App Store, then tap Purchased iBooks Store: Go to iBooks, tap Store, then tap Purchased Turn on Automatic Downloads for music, apps, or books. Go to Settings > iTunes & App Store. For more information about iCloud, see www.apple.com/icloud. For support information, see www.apple.com/support/icloud. Set up other mail, contacts, and calendar accounts iPad works with Microsoft Exchange, and many of the most popular Internet-based mail, contact, and calendar services. Set up another account. Go to Settings > Mail, Contacts, Calendars. You can add contacts using an LDAP or CardDAV account, if your company or organization supports it. See Add contacts on page 86. For information about setting up a Microsoft Exchange account in a corporate environment, see Mail, Contacts, and Calendar on page 144. Manage content on your iOS devices ;QWECPVTCPUHGTKPHQTOCVKQPCPF°NGUDGVYGGPK2CFCPF[QWTQVJGTK15FGXKEGUCPFEQORWVGTU using either iCloud or iTunes. iCloud stores your photos and videos, documents, music, calendars, contacts, and more. It all gets pushed wirelessly to your other iOS devices and computers, keeping everything up to date. See iCloud on page 15. iTunes syncs music, videos, photos, and more between your computer and iPad. Changes you make on one device are copied to the other when you sync. You can also use iTunes to EQR[C°NGVQK2CFHQTWUGYKVJCPCRRQTVQEQR[CFQEWOGPV[QW¨XGETGCVGFQPK2CFVQ[QWT computer. See Sync with iTunes on page 17, next. You can use iCloud or iTunes, or both, depending on your needs. For example, you can use iCloud Photo Stream to automatically keep your contacts and calendars up to date on all your devices, and use iTunes to sync music from your computer to iPad. Important: To avoid duplicates, keep contacts, calendars, and notes in sync using iCloud or iTunes, but not both. You can also choose to manually manage content from iTunes by selecting that option in the iPad Summary pane. Then you can drag songs or videos from your iTunes library to iPad in K6WPGU6JKUKUWUGHWNKH[QWTK6WPGUNKDTCT[EQPVCKPUOQTGKVGOUVJCPECP°VQP[QWTK2CF Note: If you use iTunes Match, you can manually manage only video. Sync with iTunes Syncing with iTunes copies information from your computer to iPad, and vice versa. You can sync by connecting iPad to your computer with the included USB cable, or you can set up iTunes to sync wirelessly using Wi-Fi. You can set iTunes to sync music, videos, apps, photos, and more. For help syncing iPad, open iTunes on your computer, choose Help > iTunes Help, then select Sync your iPod, iPhone, or iPad. Chapter 2 Getting Started 17 Apple Confidential DRAFT Sync wirelessly. Connect iPad to your computer using the included USB cable. In iTunes on your computer, select iPad, click Summary, then turn on âSync with this iPad over Wi-Fi.â If Wi-Fi syncing is turned on, iPad syncs when itâs connected to a power source, both iPad and your computer are on and connected to the same wireless network, and iTunes is open on your computer. Tips for syncing with iTunes on your computer %QPPGEVK2CFVQ[QWTEQORWVGTUGNGEVKVKPK6WPGUVJGPUGVQRVKQPUKPVJGFKĂGTGPVRCPGU If iPad doesnât appear in iTunes, make sure youâre using the latest version of iTunes, check that the included cable is correctly connected, and try restarting your computer. In the Summary pane, you can set iTunes to sync iPad automatically when itâs attached to your computer. To temporarily override this setting, hold down Command and Option (Mac) or Shift and Control (PC) until you see iPad appear in the iTunes window. If you want to encrypt the information stored on your computer when iTunes makes a backup, select âEncrypt iPad backupâ in the Summary pane. Encrypted backups are indicated by a lock icon , and a password is required to restore the backup. If you donât select this option, other passwords (such as those for mail accounts) arenât included in the backup and youâll have to reenter them if you use the backup to restore iPad. In the Info pane, when you sync mail accounts, only the settings are transferred from your computer to iPad. Changes you make to an account on iPad donât sync to your computer. In the Info pane, click Advanced to select options that let you replace the information on iPad with the information from your computer during the next sync. In the Music pane, you can sync music using your playlists. In the Photos pane, you can sync photos and videos from a supported app or folder on your computer. If you use iCloud to store your contacts, calendars, and bookmarks, donât also sync them to iPad using iTunes. Connect iPad to your computer Use the included USB cable to connect iPad to your computer. Connecting iPad to your computer lets you sync information, music, and other content with iTunes. You can also sync with iTunes wirelessly. See Sync with iTunes on page 17. To use iPad with your computer, you need: A Mac with a USB 2.0 or 3.0 port, or a PC with a USB 2.0 port, and one of the following operating systems: OS X version 10.6.8 or later Windows 8, Windows 7, Windows Vista, or Windows XP Home or Professional with Service Pack 3 or later Chapter 2 Getting Started 18 Apple Confidential DRAFT iTunes, available at www.itunes.com/download Unless iPad is actively syncing with your computer, you can disconnect it at any time. Look at the top of the iTunes screen on your computer or on iPad to see if syncing is in progress. If you disconnect iPad while itâs syncing, some data may not get synced until the next time you connect iPad to your computer. Date and time The date and time are usually set for you based on your locationâtake a look at the Lock screen to see if theyâre correct. Set whether iPad updates the date and time automatically. Go to Settings > General > Date & 6KOGVJGPVWTP5GV#WVQOCVKECNN[QPQTQĂ+H[QWUGVK2CFVQWRFCVGVJGVKOGCWVQOCVKECNN[KV gets the correct time over the network and updates it for the time zone youâre in. Some networks donât support network time, so in some areas iPad may not be able to automatically determine the local time. Set the date and time manually. )QVQ5GVVKPIU )GPGTCN &CVG6KOGVJGPVWTPQĂ5GV Automatically. Set whether iPad shows 24-hour time or 12-hour time. Go to Settings > General > Date & Time, VJGPVWTP*QWT6KOGQPQTQĂ *QWT6KOGOC[PQVDGCXCKNCDNGKPCNNCTGCU International settings Go to Settings > General > Language & Region to set: The language for iPad The preferred language order for apps and websites The region format The calendar format Advanced settings for dates, times, and numbers To add a keyboard for another language, go to Settings > General > Keyboard > Keyboards. For more information, see Use international keyboards on page 146. Your iPad name The name of your iPad is used by iTunes and iCloud. Change the name of your iPad. Go to Settings > General > About > Name. Chapter 2 Getting Started 19 Apple Confidential DRAFT View this user guide on iPad You can view the iPad User Guide on iPad in Safari, and in the iBooks app. View the user guide in Safari. In Safari, tap help.apple.com/ipad. , then tap the iPad User Guide bookmark. Or go to , then tap Add to Home Screen. Add an icon for the guide to the Home screen: Tap 8KGYVJGIWKFGKPCFKĂGTGPVNCPIWCIGTap Change Language at the bottom of the home page. View the user guide in iBooks. Open iBooks, then search for âiPad userâ in the iBooks Store. For more information about iBooks, see Chapter 24, iBooks, on page 113. Tips for using iOS 8 The Tips app helps you get the most from iPad. Get Tips. Open the Tips app. New tips are added weekly. )GVPQVK°GFYJGPPGYVKRUCTTKXG)QVQ5GVVKPIU 0QVK°ECVKQPU 6KRU Chapter 2 Getting Started 20 Apple Confidential DRAFT Basics Use apps All the apps that come with iPadâas well as the apps you download from the App Storeâare on the Home screen. Start at home Tap an app to open it. Press the Home button anytime to return to the Home screen. Swipe left or right to see other screens. Multitasking iPad helps you manage several tasks at the same time. View contacts and open apps. Double-click the Home button to reveal the multitasking screen. Swipe left or right to see more. To switch to another app, tap it. To connect with a recent contact, tap the contactâs picture or name, then tap your preferred method of communication. Drag an app up to close it. 21 Apple Confidential DRAFT Close an app. If an app isnât working properly, you can force it to quit. Drag the app up from the multitasking screen. Then try opening the app again. +H[QWJCXGNQVUQHCRRU[QWECPWUG5RQVNKIJVVQ°PFCPFQRGPVJGO2WNNFQYPVJGEGPVGTQH VJG*QOGUETGGPVQUGGVJGUGCTEJ°GNF5GGSpotlight Search on page 31. Look around Drag a list up or down to see more. Swipe to scroll quickly; touch the screen to stop it. Some lists JCXGCPKPFGZ¤VCRCNGVVGTVQLWORCJGCF Drag a photo, map, or webpage in any direction to see more. 6QSWKEMN[LWORVQVJGVQRQHCRCIGVCRVJGUVCVWUDCTCVVJGVQRQHVJGUETGGP Zoom in or out Spread a photo, webpage, or map for a close-upâthen pinch to zoom back out. In Photos, keep pinching to see the collection or album the photoâs in. Or double-tap a photo or webpage to zoom in, then double-tap again to zoom out. In Maps, FQWDNGVCRVQ\QQOKPVJGPVCRQPEGYKVJVYQ°PIGTUVQ\QQOQWV Multitasking gestures You can use multitasking gestures on iPad to return to the Home screen, reveal the multitasking display, or switch to another app. Chapter 3 Basics 22 Apple Confidential DRAFT Return to the Home screen. 2KPEJHQWTQT°XG°PIGTUVQIGVJGT Reveal the multitasking display. 5YKRGWRYKVJHQWTQT°XG°PIGTU Switch apps. 5YKRGNGHVQTTKIJVYKVJHQWTQT°XG°PIGTU 6WTPOWNVKVCUMKPIIGUVWTGUQPQTQĂGo to Settings > General > Multitasking Gestures. Change the screen orientation /CP[CRRUIKXG[QWCFKĂGTGPVXKGYYJGP[QWTQVCVGK2CF Lock the screen orientation. Swipe up from the bottom edge of the screen to open Control Center, then tap . The orientation lock icon appears in the status bar when the screen orientation is locked. ;QWECPCNUQUGVVJG5KFG5YKVEJVQNQEMVJGUETGGPQTKGPVCVKQPKPUVGCFQHUKNGPEKPIUQWPFGĂGEVU CPFPQVK°ECVKQPU)QVQ5GVVKPIU )GPGTCNVJGPWPFGTÂĽ7UG5KFG5YKVEJVQÂŚVCR.QEM4QVCVKQP App extensions Some apps let you extend the functionality of your apps on iPad. An app extension may appear CUCUJCTKPIQRVKQPCEVKQPQRVKQPCYKFIGVKP0QVK°ECVKQP%GPVGTC°NGRTQXKFGTQTCEWUVQO keyboard. For example, if you download Pinterest to iPad, Pinterest becomes another option for sharing when you click . Sharing options Action options App extensions can also help you edit a photo or video in your Photos app. For example, you can FQYPNQCFCRJQVQTGNCVGFCRRVJCVNGVU[QWCRRN[°NVGTUVQRJQVQUHTQO[QWT2JQVQUCRR Install app extensions. Download the app from the App Store, open the app, then follow the onscreen instructions. Chapter 3 Basics 23 Apple Confidential DRAFT 6WTPUJCTKPIQTCEVKQPQRVKQPUQPQTQĂTap , then tap More (drag options to the left if PGEGUUCT[ 6WTPQĂVJKTFRCTV[UJCTKPIQTCEVKQPQRVKQPU VJG[CTGQPD[FGHCWNV Organize sharing and action options. Tap , then tap More (drag icons to the left if necessary). Touch and drag to rearrange your options. (QTOQTGKPHQTOCVKQPCDQWV0QVK°ECVKQP%GPVGTYKFIGVUUGG0QVK°ECVKQP%GPVGT on page 33. For more information about Sharing options, see Share from apps on page 34. Continuity About Continuity features Continuity features connect iPad with your iPhone, iPod touch, and Mac so they can work together as one. You can start an email or document on iPad, for example, then pick up where [QWNGHVQĂQP[QWTK2QFVQWEJQT/CE1TNGVK2CFWUGK2JQPGVQOCMGRJQPGECNNUQTUGPF5/5 or MMS text messages. Continuity features require iOS 8 or OS X Yosemite, and work with iPhone 5 or later, iPod touch (5th generation) or later, iPad (4th generation) or later, and supported Mac computers. For more information, see support.apple.com/kb/HT6337. *CPFQĂ 2KEMWRQPQPGFGXKEGYJGTG[QWNGHVQĂQPCPQVJGT;QWECPWUG*CPFQĂYKVJ/CKN5CHCTK2CIGU Numbers, Keynote, Maps, Messages, Reminders, Calendar, Contacts, and even some third-party CRRU(QT*CPFQĂVQYQTM[QWTFGXKEGUOWUVDGUKIPGFKPVQK%NQWFWUKPIVJGUCOG#RRNG+&CPF they must be within Bluetooth range of one another (about 33 feet or 10 meters). Switch devices. Swipe up from the bottom-left edge of the Lock screen (where you see the appâs activity icon), or go to the multitasking screen, then tap the app. On your Mac, open the app you were using on your iOS device. &KUCDNG*CPFQĂQP[QWTFGXKEGU)QVQ5GVVKPIU )GPGTCN *CPFQĂ5WIIGUVGF#RRU &KUCDNG*CPFQĂQP[QWT/CE)QVQ5[UVGO2TGHGTGPEGU )GPGTCNVJGPVWTPQĂ#NNQY*CPFQĂ between this Mac and your devices set up with iCloud. Phone calls If your iPhone (with iOS 8) is nearby, you can make and receive phone calls on your other iOS devices and Mac computers. All devices must be on the same Wi-Fi network, and signed into FaceTime and iCloud using the same Apple ID. Make a phone call on iPad. Tap a phone number in Contacts, Calendar, or Safari. You can also tap a recent contact in the multitasking screen. Disable iPhone Cellular Calls. 1P[QWTK2JQPGIQVQ5GVVKPIU (CEG6KOGVJGPVWTPQĂK2JQPG Cellular Calls. Messages If your iPhone (with iOS 8) is signed into iMessage using the same Apple ID as your iPad, you can also send and receive SMS and MMS messages on your iPad. Charges may apply to the text messaging service for your iPhone. Chapter 3 Basics 24 Apple Confidential DRAFT Instant Hotspot You can use Instant Hotspot on your iPhone (with iOS 8) or iPad (cellular models with iOS 8) to provide Internet access to your other iOS devices and Mac computers (with iOS 8 or OS X Yosemite) that are signed into iCloud using the same Apple ID. Instant Hotspot uses your iPhone or iPad Personal Hotspot, without you having to enter a password or even turn on Personal Hotspot. Use Instant Hotspot. Go to Settings > Wi-Fi on your iOS device without cellular capabilities, then simply choose your iPhone or iPad network under Personal Hotspots. On your Mac, choose your iPhone or iPad network from your Wi-Fi settings. When youâre not using using the hotspot, your devices disconnect to save battery life. For more information about ways to set up a Personal Hotspot see Personal Hotspot on page 38. Note: This feature may not be available with all carriers. Additional fees may apply. Contact your carrier for more information. Customize iPad Arrange your apps Arrange apps. 6QWEJCPFJQNFCP[CRRQPVJG*QOGUETGGPWPVKNKVLKIINGUVJGPFTCICRRU CTQWPF&TCICPCRRVQVJGGFIGQHVJGUETGGPVQOQXGKVVQCFKĂGTGPV*QOGUETGGPQTVQVJG Dock at the bottom of the screen. Press the Home button to save your arrangement. Create a new Home screen. While arranging apps, drag an app to the right edge of the rightmost Home screen. The dots above the Dock show which of your Home screens youâre viewing. When iPad is connected to your computer, you can customize the Home screen using iTunes. In iTunes, select iPad, then click Apps. Start over. Go to Settings > General > Reset, then tap Reset Home Screen Layout to return the Home screen and apps to their original layout. Folders are removed and the original wallpaper is restored. Chapter 3 Basics 25 Apple Confidential DRAFT Organize with folders Create a folder. While arranging apps, drag one app onto another. Tap the name of the folder to TGPCOGKV&TCICRRUVQCFFQTTGOQXGVJGO2TGUUVJG*QOGDWVVQPYJGP[QW°PKUJ You can have multiple pages of apps in a folder. Delete a folder. Drag out all the appsâthe folder is deleted automatically. Change the wallpaper Wallpaper settings let you set an image or photo as wallpaper for the Lock screen or Home screen. You can choose from dynamic and still images. Change the wallpaper. Go to Settings > Wallpaper > Choose a New Wallpaper. When choosing an image for new wallpaper, the Perspective Zoom button determines whether your selected wallpaper is zoomed. For wallpaper you already set, go to the Wallpaper setting, then tap the image of the Lock screen or Home screen to see the Perspective Zoom button. Note: The Perspective Zoom button doesnât appear if Reduce Motion (in Accessibility settings) is turned on. See Reduce screen motion on page 135. Chapter 3 Basics 26 Apple Confidential DRAFT Adjust the screen brightness Dim the screen to extend battery life, or use Auto-Brightness. Adjust the screen brightness. Go to Settings > Display & Brightness, then drag the slider. If Auto$TKIJVPGUUKUQPK2CFCFLWUVUVJGUETGGPDTKIJVPGUUHQTEWTTGPVNKIJVEQPFKVKQPUWUKPIVJGDWKNVKP CODKGPVNKIJVUGPUQT;QWECPCNUQCFLWUVVJGDTKIJVPGUUKP%QPVTQN%GPVGT Type text The onscreen keyboard lets you enter text when needed. Enter text 6CRCVGZV°GNFVQUGGVJGQPUETGGPMG[DQCTFVJGPVCRNGVVGTUVQV[RG+H[QWVQWEJVJGYTQPI MG[[QWECPUNKFG[QWT°PIGTVQVJGEQTTGEVMG[6JGNGVVGTKUP¨VGPVGTGFWPVKN[QWTGNGCUG[QWT °PIGTHTQOVJGMG[ Chapter 3 Basics 27 Apple Confidential DRAFT Tap Shift to type uppercase, or touch the Shift key and slide to a letter. Double-tap Shift for caps or the Symbol key lock. To enter numbers, punctuation, or symbols, tap the Number key . If you havenât added any keyboards, tap VQUYKVEJVQVJGGOQLKMG[DQCTF+H[QWJCXG several keyboards, tap to switch to the last one you used. Continue tapping to access other enabled keyboards, or touch and hold VJGPUNKFGVQEJQQUGCFKĂGTGPVMG[DQCTF6QSWKEMN[ GPFCUGPVGPEGYKVJCRGTKQFCPFCURCEGLWUVFQWDNGVCRVJGURCEGDCT Enter accented letters or other alternate characters. Touch and hold a key, then slide to choose one of the options. Hide the onscreen keyboard. Tap the Keyboard key If you see a word underlined in red, tap it to see suggested corrections. If the word you want doesnât appear, type the correction. As you write, QuickType uses predictive text to anticipate your next word. Tap a word to choose it, or accept a highlighted prediction by entering a space or punctuation. When you tap a QuickType word, a space appears after the word. If you enter a comma, period, or other RWPEVWCVKQPVJGURCEGKUFGNGVGF4GLGEVCUWIIGUVKQPD[VCRRKPI[QWTQTKIKPCNYQTF UJQYPCUC QuickType option with quotation marks). Hide predictive text. Pull down QuickType suggestions. Pull them back up when you want them to reappear. 6WTPQĂRTGFKEVKXGVGZVTouch and hold or , then slide to Predictive. +H[QWVWTPQĂ3WKEM6[RGK2CFOC[UVKNNEQTTGEVOKUURGNNKPIUCPFCPVKEKRCVG[QWTPGZVYQTF #EEGRVCUWIIGUVKQPD[GPVGTKPICURCEGQTRWPEVWCVKQPQTD[VCRRKPITGVWTP6QTGLGEVC UWIIGUVKQPVCRVJGÂĽZÂŚ+H[QWTGLGEVVJGUCOGUWIIGUVKQPCHGYVKOGUK2CFUVQRUUWIIGUVKPIKV Set options for typing or add keyboards. Go to Settings > General > Keyboard. You can also use an Apple Wireless Keyboard to enter text. See Use an Apple Wireless Keyboard on page 29. To dictate instead of typing, see Dictation on page 30. Chapter 3 Basics 28 Apple Confidential DRAFT Edit text Revise text. Touch and hold the text to show the magnifying glass, then drag to position the insertion point. Select text. Tap the insertion point to display the selection options. Or double-tap a word to select it. Drag the grab points to select more or less text. In read-only documents, such as webpages, touch and hold to select a word. Grab points You can cut, copy, or paste over selected text. With some apps, you can also get bold, italic, or WPFGTNKPGFVGZV VCR$+7 IGVVJGFG°PKVKQPQHCYQTFQTJCXGK2CFUWIIGUVCPCNVGTPCVKXG;QW may need to tap to see all the options. Undo the last edit. Shake iPad, then tap Undo. Justify text. Select the text, then tap the left or right arrow (not always available). Save keystrokes #UJQTVEWVNGVU[QWGPVGTCYQTFQTRJTCUGD[V[RKPILWUVCHGYEJCTCEVGTU(QTGZCORNGV[RG âomwâ to enter âOn my way!â That oneâs already set up for you, but you can also add your own. Create a shortcut. Go to Settings > General > Keyboard, then tap Shortcuts. Have a word or phrase you use and donât want it corrected? Create a shortcut, but leave the 5JQTVEWV°GNFDNCPM Use iCloud to keep your personal dictionary up to date on your other devices. Go to Settings > iCloud, then turn on iCloud Drive or Documents & Data. Use an Apple Wireless Keyboard You can use an Apple Wireless Keyboard (available separately) to enter text on your iPad. The MG[DQCTFEQPPGEVUXKC$NWGVQQVJUQ[QWOWUV°TUVRCKTKVYKVJK2CF Note: The Apple Wireless Keyboard may not support keyboard features that are on your device. For example, it doesnât anticipate your next word or automatically correct misspelled words. Pair an Apple Wireless Keyboard with iPad. Turn on the keyboard, go to Settings > Bluetooth and turn on Bluetooth, then tap the keyboard when it appears in the Devices list. Chapter 3 Basics 29 Apple Confidential DRAFT Once itâs paired, the keyboard reconnects to iPad whenever itâs in rangeâup to about 33 feet (10 meters). When itâs connected, the onscreen keyboard doesnât appear. Save your batteries. 6WTPQĂ$NWGVQQVJCPFVJGYKTGNGUUMG[DQCTFYJGPPQVKPWUG;QWECPVWTP QĂ$NWGVQQVJ KP%QPVTQN%GPVGT6QVWTPQĂVJGMG[DQCTFJQNFFQYPVJG1PQĂUYKVEJWPVKNVJG ITGGPNKIJVIQGUQĂ Unpair a wireless keyboard. Go to Settings > Bluetooth, tap tap âForget this Device.â next to the keyboard name, then See Bluetooth devices on page 39. Add or change keyboards ;QWECPVWTPV[RKPIHGCVWTGUUWEJCUURGNNEJGEMKPIQPQTQĂCFFMG[DQCTFUHQTYTKVKPIKP FKĂGTGPVNCPIWCIGUCPFEJCPIGVJGNC[QWVQH[QWTQPUETGGPMG[DQCTFQT#RRNG9KTGNGUU Keyboard. Set typing features. Go to Settings > General > Keyboard. Add a keyboard for another language. Go to Settings > General > Keyboard > Keyboards > Add New Keyboard. Switch keyboards. If you havenât added any keyboards, tap VQUYKVEJVQVJGGOQLKMG[DQCTF to switch to the last one you used. Continue tapping to If you have several keyboards, tap access other enabled keyboards, or touch and hold VJGPUNKFGVQEJQQUGCFKĂGTGPVMG[DQCTF For information about international keyboards, see Use international keyboards on page 146. Change the keyboard layout. Go to Settings > General > Keyboard > Keyboards, select a keyboard, then choose a layout. Keyboard layouts On iPad, you can type with a split keyboard thatâs at the bottom of the screen, or undocked and in the middle of the screen. Adjust the keyboard. Touch and hold , then: Use a split keyboard: 5NKFG[QWT°PIGTVQ5RNKVVJGPTGNGCUG1TURTGCFVJGMG[DQCTFCRCTVHTQO the middle. Move the keyboard to the middle of the screen: 5NKFG[QWT°PIGTVQ7PFQEMVJGPTGNGCUG Return to a full keyboard: 5NKFG[QWT°PIGTVQ&QEMCPF/GTIGVJGPTGNGCUG Return a full keyboard to the bottom of the screen: 5NKFG[QWT°PIGTVQ&QEMVJGPTGNGCUG 6WTP5RNKV-G[DQCTFQPQTQĂGo to Settings > General > Keyboard > Split Keyboard. Dictation If you like, you can dictate instead of typing. Make sure Siri is turned on (in Settings > General > Siri) and iPad is connected to the Internet. Even if Siri isnât supported in your preferred language, turning Siri on may enable dictation in your preferred language when you use international keyboards. See Use international keyboards on page 146. Chapter 3 Basics 30 Apple Confidential DRAFT Note: Dictation may not be available in all languages or in all areas, and features may vary. Cellular data charges may apply. Dictate text. Tap QPVJGK2CFMG[DQCTFVJGPURGCM9JGP[QW°PKUJVCR&QPG Tap to begin dictation. Add text. Tap CICKPCPFEQPVKPWGFKEVCVKPI6QKPUGTVVGZVVCRVQRNCEGVJGKPUGTVKQPRQKPV°TUV You can also replace selected text by dictating. Add punctuation or format text. Say the punctuation or format. For example, âDear Mary comma the check is in the mail exclamation markâ becomes âDear Mary, the check is in the mail!â Punctuation and formatting commands include: quote ⌠end quote new paragraph new line capâto capitalize the next word ECRUQPÂECRUQäVQECRKVCNK\GVJG°TUVEJCTCEVGTQHGCEJYQTF all capsâto make the next word all uppercase CNNECRUQPÂCNNECRUQäVQOCMGVJGGPENQUGFYQTFUCNNWRRGTECUG PQECRUQPÂPQECRUQäVQOCMGVJGGPENQUGFYQTFUCNNNQYGTECUG PQURCEGQPÂPQURCEGQäVQTWPCUGTKGUQHYQTFUVQIGVJGT smileyâto insert :-) frownyâto insert :-( winkyâto insert ;-) Search Search apps /CP[CRRUKPENWFGCUGCTEJ°GNFYJGTG[QWECPV[RGVQ°PFUQOGVJKPIYKVJKPVJGCRR(QT GZCORNGKPVJG/CRUCRR[QWECPUGCTEJHQTCURGEK°ENQECVKQP Spotlight Search Spotlight Search not only searches your iPad, but also shows suggestions from the App Store and the Internet. You may see suggestions for movie showtimes, nearby locations, and more. Search iPad. &TCIFQYPVJGOKFFNGQHCP[*QOGUETGGPVQTGXGCNVJGUGCTEJ°GNF4GUWNVUQEEWT as you type; to hide the keyboard and see more results on the screen, tap Search. Tap an item in the list to open it. Chapter 3 Basics 31 Apple Confidential DRAFT ;QWECPWUG5RQVNKIJV5GCTEJVQ°PFCPFQRGPCRRUVQQ Choose which apps and content are searched. Go to Settings > General > Spotlight Search, then tap to deselect apps or content. To change the search order, touch and drag to a new position. Limit Spotlight Search to your iPad. Go to Settings > General > Spotlight Search, then tap Spotlight Suggestions to deselect it. 6WTPQĂ.QECVKQP5GTXKEGUHQT5RQVNKIJV5WIIGUVKQPUGo to Settings > Privacy > Location 5GTXKEGU6CR5[UVGO5GTXKEGUVJGPVWTPQĂ5RQVNKIJV5WIIGUVKQPU Control Center Control Center gives you instant access to the camera, calculator, AirPlay, and other handy HGCVWTGU;QWECPCNUQCFLWUVVJGDTKIJVPGUUNQEMVJGUETGGPKPRQTVTCKVQTKGPVCVKQPVWTPYKTGNGUU UGTXKEGUQPQTQĂCPFVWTPQP#KT&TQR(QTOQTGKPHQTOCVKQPCDQWV#KT&TQRUGGAirDrop on page 35. Open Control Center. Swipe up from the bottom edge of any screen (even the Lock screen). Open the currently playing audio app. Tap the song title. Close Control Center. Swipe down, tap the top of the screen, or press the Home button. 6WTPQĂCEEGUUVQ%QPVTQN%GPVGTKPCRRUQTQPVJG.QEMUETGGPGo to Settings > Control Center. #NGTVUCPF0QVK°ECVKQP%GPVGT Alerts #NGTVUNGV[QWMPQYCDQWVKORQTVCPVGXGPVU6JG[ECPCRRGCTDTKGÂą[CVVJGVQRQHVJGUETGGPQT remain in the center of the screen until you acknowledge them. Chapter 3 Basics 32 Apple Confidential DRAFT Some apps may include a badge on their Home screen icon, to let you know how many new items awaitâfor example, the number of new email messages. If thereâs a problemâsuch as a message that couldnât be sentâan exclamation mark appears on the badge. On a folder, a PWODGTGFDCFIGKPFKECVGUVJGVQVCNPWODGTQHPQVK°ECVKQPUHQTCNNVJGCRRUKPUKFG Alerts can also appear on the Lock screen. Respond to an alert without leaving your current app. Pull down on the alert when it appears at the top of your screen. Note: This feature works with text and email messages, calendar invitations, and more. Respond to an alert when iPad is locked. Swipe the alert from right to left. Silence your alerts. Go to Settings > Do Not Disturb. Set sounds. Go to Settings > Sounds. 0QVK°ECVKQP%GPVGT 0QVK°ECVKQP%GPVGTEQNNGEVU[QWTPQVK°ECVKQPUKPQPGRNCEGUQ[QWECPTGXKGYVJGOYJGPGXGT youâre ready. View details about your dayâsuch as the weather forecast, appointments, birthdays, stock quotes, and even a quick summary of whatâs coming up tomorrow. Tap the 0QVK°ECVKQPUVCDVQTGXKGYCNN[QWTCNGTVU 1RGP0QVK°ECVKQP%GPVGTSwipe down from the top edge of the screen. Set Today options. To choose what information appears, tap the Edit key at the end of your information on the Today tab. Tap + or â to add or remove information. To arrange the order of , then drag it to a new position. your information, touch 5GVPQVK°ECVKQPQRVKQPU)QVQ5GVVKPIU 0QVK°ECVKQPU6CRCPCRRVQUGVKVUPQVK°ECVKQPQRVKQPU (QTGZCORNGEJQQUGVQXKGYCPQVK°ECVKQPHTQOVJG.QEMUETGGP;QWECPCNUQVCR'FKVVQCTTCPIG VJGQTFGTQHCRRPQVK°ECVKQPU6QWEJ , then drag it to a new position. Chapter 3 Basics 33 Apple Confidential DRAFT %JQQUGYJGVJGTVQUJQY6QFC[CPF0QVK°ECVKQPU8KGYQPCNQEMGFUETGGPGo to Settings > Touch ID & Passcode (iPad models with Touch ID) or Settings > Passcode (other models), then choose whether to allow access when locked. %NQUG0QVK°ECVKQP%GPVGTSwipe up, or press the Home button. Sounds and silence ;QWECPEJCPIGQTVWTPQĂVJGUQWPFUK2CFRNC[UYJGP[QWIGVC(CEG6KOGECNNVGZVOGUUCIG email, tweet, Facebook post, reminder, or other event. Set sound options. Go to Settings > Sounds for options such as alert tones and ringtones, and ringer and alert volumes. +H[QWYCPVVQVGORQTCTKN[UKNGPEGKPEQOKPI(CEG6KOGECNNUCNGTVUCPFUQWPFGĂGEVUUGGVJG following section. Do Not Disturb Do Not Disturb is an easy way to silence iPad, whether youâre going to dinner or to sleep. It keeps FaceTime calls and alerts from making any sounds or lighting up the screen. Turn on Do Not Disturb. Swipe up from the bottom edge of the screen to open Control Center, then tap . When Do Not Disturb is on, appears in the status bar. Note: Alarms still sound, even when Do Not Disturb is on. To make sure iPad stays silent, turn KVQĂ %QP°IWTG&Q0QV&KUVWTDGo to Settings > Do Not Disturb. You can schedule quiet hours, allow FaceTime calls from your Favorites or groups of contacts, and allow repeated FaceTime calls to ring through for those emergency situations. You can also set whether Do Not Disturb silences iPad only when itâs locked, or even when itâs unlocked. Sharing Share from apps In many apps, you can tap Share or to choose how to share your information. The choices vary depending on the app youâre using. Additional options may appear if youâve downloaded apps with sharing options. For more information, see App extensions on page 23. Use Twitter, Facebook, Flickr, Vimeo or other third-party apps with sharing options. Sign in to your account in Settings. The third-party sharing buttons take you to the appropriate setting if youâre not yet signed in. %WUVQOK\GVJGFKĂGTGPVYC[U[QWUJCTGXKGYCPFQTICPK\G[QWTKPHQTOCVKQPTap the More to move items to new positions. button, then touch and drag Chapter 3 Basics 34 Apple Confidential DRAFT AirDrop Use AirDrop AirDrop lets you share your photos, videos, websites, locations, and other items wirelessly with other nearby devices (iOS 7 or later). With iOS 8, you can share with Mac computers that have OS X Yosemite installed. AirDrop transfers information using Wi-Fi and Bluetooth. To use AirDrop, you need to be signed into iCloud using your Apple ID, and must be on the same Wi-Fi network, or within approximately 33 feet (10 meters) of the other device. Transfers are encrypted for security. Share an item using AirDrop. Tap Share , tap AirDrop, then tap the name of a nearby AirDrop WUGT#KT&TQRKUCNUQCXCKNCDNGKP%QPVTQN%GPVGT¤LWUVUYKRGWRHTQOVJGDQVVQOGFIGQH the screen. Receive AirDrop items from others. Swipe up from the bottom edge of the screen to open Control Center. Tap AirDrop, then choose to receive items from Contacts only or from Everyone. You can accept or decline each request as it arrives. Family Sharing With Family Sharing, up to six family members can share their iTunes Store, iBooks Store, and App Store purchases, a family calendar, and family photos, all without sharing accounts. 1PGCFWNVKP[QWTJQWUGJQNF¤VJGHCOKN[QTICPK\GT¤KPXKVGUHCOKN[OGODGTUVQLQKPVJGHCOKN[ group and agrees to pay for any iTunes Store, iBooks Store, and App Store purchases those family members initiate while part of the family group. Once set up, family members get immediate access to each otherâs music, movies, TV shows, books, and eligible apps. In addition, family members can easily share photos in a shared family album, add events to a family calendar, share their location with other family members, and even help locate another family memberâs missing device. Children under 13 can participate in Family Sharing, too. As a parent or legal guardian, the family organizer can provide parental consent for a child to have his or her own Apple ID, and create it on the childâs behalf. Once the account is created, itâs added to the family group automatically. Family Sharing requires you to sign in to iCloud with your Apple ID. You will also be asked to EQP°TOVJG#RRNG+&[QWWUGHQTVJGK6WPGU5VQTGK$QQMU5VQTGCPF#RR5VQTG+VKUCXCKNCDNGQP devices with iOS 8, Mac computers with OS X Yosemite, and PCs with iCloud for Windows 4.0. You can be part of only one family group at a time. Set up Family Sharing. Go to Settings > iCloud > Set Up Family Sharing. Follow the onscreen KPUVTWEVKQPUVQUGVWR(COKN[5JCTKPICUVJGHCOKN[QTICPK\GTVJGPKPXKVGHCOKN[OGODGTUVQLQKP Chapter 3 Basics 35 Apple Confidential DRAFT Create an Apple ID for a child. Tap Settings > iCloud > Family, scroll to the bottom of the screen, then tap Create an Apple ID for a child. Accept an invitation to Family Sharing. Make sure you are signed into iCloud, and that you can accept a Family Sharing invitation from your iOS device (iOS 8 required), Mac (OS X Yosemite required), or PC (iCloud for Windows 4.0 required). Or, if the organizer is nearby during the setup process, he or she can simply ask you to enter the Apple ID and password you use for iCloud. Access shared iTunes Store, iBooks Store, and App Store purchases. Open iTunes Store, iBooks Store, or App Store, tap Purchased, then choose a family member from the menu that appears. When a family member initiates a purchase, it is billed directly to the family organizerâs account. Once purchased, the item is added to the initiating family memberâs account and is shared with the rest of the family. If Family Sharing is ever disabled, each person keeps the items they chose to purchaseâeven if they were paid for by the family organizer. Turn on Ask to Buy. The family organizer can require young family members to request approval for purchases or free downloads. Go to Settings > iCloud > Family, then tap the personâs name. Note: Age restrictions for Ask to Buy vary by area. In the United States, the family organizer can enable Ask to Buy for any family member under age 18; for children under age 13, itâs enabled by default. Hide your iTunes Store, iBooks Store, and App Store purchases. Open iTunes on your computer, then click iTunes Store. Under Quick Links, click Purchased, then choose the content type (for example, Music or Movies). Hover over the item you want to hide, then click . To make purchases visible again, return to Quick Links, then click Account. Scroll down to iTunes in the Cloud, then click Manage (to the right of Hidden Purchases). Share photos or videos with family members. When you set up Family Sharing, a shared album called âFamilyâ is automatically created in the Photos app on all family membersâ devices. To share a photo or video with family members, open the Photos app, then view a photo or video or select multiple photos or videos. Tap , tap iCloud Photo Sharing, add comments, then share to your shared family album. See iCloud Photo Sharing on page 77. Add an event to the family calendar. When you set up Family Sharing, a shared calendar called âFamilyâ is automatically created in the Calendar app on all family membersâ devices. To add a family event, open the Calendar app, create an event, then choose to add the event to the family calendar. See Share iCloud calendars on page 74. Chapter 3 Basics 36 Apple Confidential DRAFT Set up a family reminder. When you set up Family Sharing, a shared list is automatically created in the Reminders app on all family membersâ devices. To add a reminder to the family list, open the Reminders app, tap the family list, then add a reminder to the list. See Reminders at a glance on page 98. Share your location with family members. Family members can share their location by tapping 5GVVKPIU K%NQWF 5JCTG/[.QECVKQP WPFGT#FXCPEGF 6Q°PFCHCOKN[OGODGT¨UNQECVKQP use the Find My Friends app (download it for free from the App Store). Or, use the Messages app (iOS 8 required). For more information about using Messages to share or view locations, see Share photos, videos, your location, and more on page 50. Keep track of your familyâs devices. If family members have enabled Share My Location in iCloud, you can help them locate missing devices. Open Find My iPhone on your device or at iCloud.com. For more information, see Find My iPad on page 43. Leave Family Sharing. Go to Settings > iCloud > Family, then tap Leave Family Sharing. If you are the organizer, go to Settings > iCloud > Family, tap your name, then tap Stop Family Sharing. iCloud Drive About iCloud Drive iCloud Drive stores your presentations, spreadsheets, PDFs, images, and other kinds of documents in iCloud so you can access these documents from any of your devices set up YKVJK%NQWF+VCNNQYU[QWTCRRUVQUJCTGFQEWOGPVUUQ[QWECPYQTMQPVJGUCOG°NGCETQUU multiple apps. iCloud Drive works with devices using iOS 8, Mac computers using OS X Yosemite, PCs with iCloud for Windows 4.0, or through iCloud.com. To access iCloud Drive, you must be signed into iCloud using your Apple ID. iCloud Drive works with supported apps including Pages, Numbers, Keynote, GarageBand, and some third-party apps. Set up iCloud Drive You can set up iCloud Drive using Setup Assistant when you install iOS 8, or you can set it up later in Settings. iCloud Drive is an upgrade to Documents & Data. When you upgrade to iCloud Drive, your documents are copied to iCloud Drive and become available on your devices using iCloud Drive. You wonât be able to access the documents stored in iCloud Drive on your other devices until they are also upgraded to iOS 8 or OS X Yosemite. For more information about upgrading to iCloud Drive, see support.apple.com/kb/HT6345. Set up iCloud Drive. Go to Settings > iCloud > iCloud Drive, turn on iCloud Drive, then follow the onscreen instructions. 6TCPUHGT°NGU 6JGTGCTGUGXGTCNYC[UVQVTCPUHGT°NGUDGVYGGPK2CFCPF[QWTEQORWVGTQTQVJGTK15FGXKEG 6TCPUHGT°NGUWUKPIK6WPGUConnect iPad to your computer using the included cable. In iTunes on your computer, select iPad, then click Apps. Use the File Sharing section to transfer documents DGVYGGPK2CFCPF[QWTEQORWVGT#RRUVJCVUWRRQTV°NGUJCTKPICRRGCTKPVJG#RRUNKUV6Q FGNGVGC°NGUGNGEVKVKPVJG&QEWOGPVUNKUVVJGPRTGUUVJG&GNGVGMG[ ;QWECPCNUQXKGY°NGUTGEGKXGFCUGOCKNCVVCEJOGPVUQPK2CF 9KVJUQOGCRRU[QWECPVTCPUHGT°NGUWUKPI#KT&TQR5GGAirDrop on page 35. Chapter 3 Basics 37 Apple Confidential DRAFT Personal Hotspot Use Personal Hotspot to share your iPad (Wi-Fi + Cellular models) Internet connection. Computers can share your Internet connection using Wi-Fi, Bluetooth, or a USB cable. Other iOS devices can share the connection using Wi-Fi. Personal Hotspot works only if iPad is connected to the Internet over the cellular data network. Note: This feature may not be available with all carriers. Additional fees may apply. Contact your carrier for more information. Share an Internet connection. Go to Settings > Cellular Data, then tap Personal Hotspotâif it appearsâto set up the service with your carrier. After you turn on Personal Hotspot, other devices can connect in the following ways: Wi-Fi: On the device, choose your iPad in the list of available Wi-Fi networks. USB: Connect your iPad to your computer using the cable that came with it. In your EQORWVGT¨U0GVYQTMRTGHGTGPEGUEJQQUGK2CFVJGPEQP°IWTGVJGPGVYQTMUGVVKPIU Bluetooth: On iPad, go to Settings > Bluetooth, then turn on Bluetooth. To pair and connect iPad with your device, refer to the documentation that came with your device. Note: When a device is connected, a blue band appears at the top of the iPad screen. The appears in the status bar of iOS devices using Personal Hotspot. Personal Hotspot icon Change the Wi-Fi password for iPad. Go to Settings > Personal Hotspot > Wi-Fi Password, then enter a password of at least eight characters. Monitor your cellular data network usage. Go to Settings > Cellular. See Cellular settings on page 156. AirPlay Use AirPlay to stream music, photos, and video wirelessly to Apple TV and other AirPlay-enabled devices. If you donât see your AirPlay-enabled devices when you tap , you may also need to make sure everything is on the same Wi-Fi network. Display the AirPlay controls. Swipe up from the bottom edge of the screen to open Control Center, then tap . Stream content. Tap , then choose the device you want to stream to. Switch back to iPad. Tap , then choose iPad. Mirror the iPad screen on a TV. Tap , choose an Apple TV, then tap Mirroring. A blue bar appears at the top of the iPad screen when AirPlay mirroring is turned on. ;QWECPCNUQEQPPGEVK2CFVQC68RTQLGEVQTQTQVJGTGZVGTPCNFKURNC[WUKPIVJGCRRTQRTKCVG Apple cable or adapter. See support.apple.com/kb/HT4108. AirPrint Use AirPrint to print wirelessly to an AirPrint-enabled printer from apps such as Mail, Photos, and Safari. Many apps available on the App Store also support AirPrint. iPad and the printer must be on the same Wi-Fi network. For more information about AirPrint, see support.apple.com/kb/HT4356. Print a document. Tap or (depending on the app youâre using). Chapter 3 Basics 38 Apple Confidential DRAFT See the status of a print job. Double-click the Home button, then tap Print Center. The badge on the icon shows how many documents are in the queue. Cancel a job. Select it in the Print Center, then tap Cancel Printing. Bluetooth devices You can use Bluetooth devices with iPad, such as stereo headphones or an Apple Wireless -G[DQCTF(QTUWRRQTVGF$NWGVQQVJRTQ°NGUIQVQsupport.apple.com/kb/HT3647. WARNING: For important information about avoiding hearing loss and avoiding distractions that could lead to dangerous situations, see Important safety information on page 149. Note: 6JGWUGQHEGTVCKPCEEGUUQTKGUYKVJK2CFOC[CĂGEVYKTGNGUURGTHQTOCPEG0QVCNNK2JQPG and iPod touch accessories are fully compatible with iPad. Turning on airplane mode may eliminate audio interference between iPad and an accessory. Reorienting or relocating iPad and the connected accessory may improve wireless performance. Turn on Bluetooth. Go to Settings > Bluetooth. Connect to a Bluetooth device. Tap the device in the Devices list, then follow the onscreen instructions to connect to it. See the documentation that came with the device for information about Bluetooth pairing. For information about using an Apple Wireless Keyboard, see Use an Apple Wireless Keyboard on page 29. iPad must be within about 33 feet (10 meters) of the Bluetooth device. Return audio output to iPad. 6WTPQĂQTWPRCKTVJGFGXKEGVWTPQĂ$NWGVQQVJKP5GVVKPIU Bluetooth, or use AirPlay to switch audio output to iPad. See AirPlay on page 38. Audio output returns to iPad if the Bluetooth device moves out of range. next to the device, then tap âForget this Unpair a device. Go to Settings > Bluetooth, tap Device.â If you donât see the Devices list, make sure Bluetooth is on. Restrictions You can set restrictions for some apps, and for purchased content. For example, parents can restrict explicit music from appearing in playlists, or disallow changes to certain settings. Use restrictions to prevent the use of certain apps, the installation of new apps, or changes to accounts or the volume limit. Turn on restrictions. Go to Settings > General > Restrictions, then tap Enable Restrictions. Youâll DGCUMGFVQFG°PGCTGUVTKEVKQPURCUUEQFGVJCV¨UPGEGUUCT[KPQTFGTVQEJCPIGVJGUGVVKPIU[QW OCMG6JKUECPDGFKĂGTGPVVJCPVJGRCUUEQFGHQTWPNQEMKPIK2CF Important: If you forget your restrictions passcode, you must restore the iPad software. See Restore iPad on page 156. Privacy Privacy settings let you see and control which apps and system services have access to Location Services, and to contacts, calendars, reminders, and photos. Chapter 3 Basics 39 Apple Confidential DRAFT Location Services lets location-based apps such as Maps, Weather, and Camera gather and use data indicating your location. Your approximate location is determined using available information from local Wi-Fi networks, if you have Wi-Fi turned on. The location data collected D[#RRNGKUP¨VEQNNGEVGFKPCHQTOVJCVRGTUQPCNN[KFGPVK°GU[QW9JGPCPCRRKUWUKPI.QECVKQP Services, appears in the status bar. 6WTP.QECVKQP5GTXKEGUQPQTQĂ)QVQ5GVVKPIU 2TKXCE[ .QECVKQP5GTXKEGU;QWECPVWTPKVQĂ HQTUQOGQTHQTCNNCRRUCPFUGTXKEGU+H[QWVWTPQĂ.QECVKQP5GTXKEGU[QW¨TGRTQORVGFVQVWTPKV on again the next time an app or service tries to use it. 6WTP.QECVKQP5GTXKEGUQĂHQTU[UVGOUGTXKEGUSeveral system services, such as location-based CFUWUG.QECVKQP5GTXKEGU6QUGGVJGKTUVCVWUVWTPVJGOQPQTQĂQTUJQY in the status bar when these services use your location, go to Settings > Privacy > Location Services > System Services. 6WTPQĂCEEGUUVQRTKXCVGKPHQTOCVKQPGo to Settings > Privacy. You can see which apps and features have requested and been granted access to the following information: Contacts Calendar Reminders Photos Bluetooth Sharing Microphone Camera HomeKit Motion Activity Twitter Facebook ;QWECPVWTPQĂGCEJCRR¨UCEEGUUVQGCEJECVGIQT[QHKPHQTOCVKQP4GXKGYVJGVGTOUCPFRTKXCE[ policy for each third-party app to understand how it uses the data itâs requesting. For more information, see support.apple.com/kb/HT6338. Security Security features help protect the information on your iPad from being accessed by others. Use a passcode with data protection For better security, you can set a passcode that must be entered each time you turn on or wake up iPad. Set a passcode. Go to Settings > Touch ID & Passcode (iPad models with Touch ID) or Settings > Passcode (other models), then set a 4-digit passcode. Setting a passcode turns on data protection, using your passcode as a key to encrypt Mail messages and attachments stored on iPad, using 256-bit AES encryption. (Other apps may also use data protection.) Increase security. 6WTPQĂ5KORNG2CUUEQFGCPFWUGCNQPIGTRCUUEQFG6QGPVGTCRCUUEQFGVJCV¨U a combination of numbers and letters, you use the keyboard. If you prefer to unlock iPad using the numeric keypad, set up a longer passcode using numbers only. Chapter 3 Basics 40 Apple Confidential DRAFT #FF°PIGTRTKPVUCPFUGVQRVKQPUHQTVJG6QWEJ+&UGPUQT(iPad models with Touch ID) Go to Settings > Touch ID & Passcode. See Touch ID sensor on page 41. Allow access to features when iPad is locked. Go to Settings > Touch ID & Passcode (iPad models with Touch ID) or Settings > Passcode (other models). Optional features include: Today (see 0QVK°ECVKQP%GPVGT on page 33) 0QVK°ECVKQPU8KGY UGG0QVK°ECVKQP%GPVGT on page 33) Siri (if enabled, see Siri settings on page 47) Allow access to Control Center when iPad is locked. Go to Settings > Control Center. See Control Center on page 32. Erase data after ten failed passcode attempts. Go to Settings > Touch ID & Passcode (iPad models with Touch ID) or Settings > Passcode (other models), then tap Erase Data. After ten failed passcode attempts, all settings are reset, and all your information and media are erased by removing the encryption key to the data. If you forget your passcode, you must restore the iPad software. See Restore iPad on page 156. Touch ID sensor 1PK2CFOQFGNUYKVJ6QWEJ+&[QWECPWUGC°PIGTRTKPVKPUVGCFQH Entering your passcode to unlock iPhone Using your Apple ID password to make purchases in the iTunes Store, App Store, or iBooks Store Providing credit card info when making a purchase in an app that supports Apple Pay Set up the Touch ID sensor. Go to Settings > Touch ID & Passcode. Set whether you want to WUGC°PIGTRTKPVVQWPNQEMK2CFCPFVQOCMGRWTEJCUGU6CR#FFC(KPIGTRTKPVVJGPHQNNQYVJG QPUETGGPKPUVTWEVKQPU;QWECPCFFOQTGVJCPQPG°PIGTRTKPV [QWTVJWODCPFHQTG°PIGTHQT example, or one for your spouse). Note: +H[QWVWTPK2CFQĂCHVGTUGVVKPIWRVJG6QWEJ+&UGPUQT[QW¨NNDGCUMGFVQEQP°TO[QWT RCUUEQFGYJGP[QWVWTPK2CFDCEMQPCPFWPNQEMKVVJG°TUVVKOG;QW¨NNCNUQDGCUMGFHQT[QWT #RRNG+&RCUUYQTFHQTVJG°TUVRWTEJCUG[QWOCMGKPVJGK6WPGU5VQTG#RR5VQTGQTK$QQMU5VQTG &GNGVGC°PIGTRTKPV6CRVJG°PIGTRTKPVVJGPVCR&GNGVG(KPIGTRTKPV+H[QWJCXGOQTGVJCPQPG °PIGTRTKPVVQWEJVJG*QOGDWVVQPVQ°PFQWVYJKEJ°PIGTRTKPVKVKU 0COGC°PIGTRTKPV6CRVJG°PIGTRTKPVVJGPGPVGTCPCOGUWEJCUÂĽ6JWODÂŚ Use the Touch ID sensor to unlock iPad. 6QWEJVJG*QOGDWVVQPYKVJC°PIGT[QW¨XGCFFGFKP Settings. You can unlock iPad from either the Lock screen or the Passcode screen. Use the Touch ID sensor to make a purchase in the iTunes Store, App Store, or iBooks Store. When purchasing from the iTunes Store, App Store, or iBooks Store, follow the prompts to enable RWTEJCUGUYKVJ[QWT°PIGTRTKPV1TIQVQ5GVVKPIU 6QWEJ+&2CUUEQFGVJGPVWTPQPK6WPGU App Store. Use the Touch ID sensor to make a purchase in an app that supports Apple Pay. Go to Settings > Touch ID & Passcode to ensure that Apple Pay is enabled with your Touch ID. For more information, see Apple Pay below. Apple Pay On iPad models with Touch ID, you can use Apple Pay to make payments in supported apps. These apps sell physical goods and services such as apparel, electronics, health and beauty products, tickets, reservations, and more. Chapter 3 Basics 41 Apple Confidential DRAFT Set up Apple Pay. You can set up Apple Pay with the Setup Assistant when you install iOS 8, or you can set it up later in Settings. Go to Settings > Passbook & Apple Pay and enter information for up to eight supported credit or debit cards, your shipping and billing details, and your contact information. When you add a card to use with Apple Pay, the card issuer determines if your card is eligible to be added and may ask you to provide additional information to complete VJGXGTK°ECVKQPRTQEGUU Note: Many U.S. credit and debit cards can be used with Apple Pay. Go to support.apple.com/kb/HT6288 for the current list of available card issuers. Pay using Apple Pay. When buying things in third-party apps, look for the Apple Pay option. Tap the Apple Pay button, then review the information that appears (for example, the card youâre using for the payment, your email, and the shipping method), and make any changes before using Touch ID or your passcode to complete the purchase. View Apple Pay activity. Your Apple Pay activity will appear on the statement you receive from your card issuer. You can also view Apple Pay activity on supported cards by going to Settings > Passbook & Apple Pay. Suspend and remove cards. You have several options for removing or suspending credit and debit cards. To remove a credit or debit card from Apple Pay go to Settings > Passbook & Apple Pay, tap an existing credit or debit card, then scroll to the bottom and tap Remove card. If your iPad is lost or stolen, and you have enabled Find My iPhone, you can use it to help you locate and secure your iPadâincluding suspending the use of your credit and debit cards with Apple Pay. See Find My iPad on page 43. You can also log into your account at iCloud.com and remove your cards in Settings, or call the card issuers to remove or suspend your cards. iCloud Keychain iCloud Keychain keeps your Safari website user names and passwords, credit card information, and Wi-Fi network information up to date. iCloud Keychain works on all your approved devices (iOS 7 or later) and Mac computers (OS X Mavericks or later). iCloud Keychain works with Safari Password Generator and AutoFill. When youâre setting up a new account, Safari Password Generator suggests unique, hard-to-guess passwords. You can use AutoFill to have iPad enter your user name and password info, making login easy. See Fill in forms on page 61. Note: Some websites do not support AutoFill. iCloud Keychain is secured with 256-bit AES encryption during storage and transmission, and cannot be read by Apple. Set up iCloud Keychain. Go to Settings > iCloud > Keychain. Turn on iCloud Keychain, then follow the onscreen instructions. If youâve set up iCloud Keychain on other devices, you need to approve use of iCloud Keychain from one of those devices, or use your iCloud Security Code. Important: Your iCloud Security Code cannot be retrieved by Apple. If you forget your security code, youâll have to start over and set up your iCloud Keychain again. Set up AutoFill. Go to Settings > Safari > Passwords & AutoFill. Make sure Names and Passwords, and Credit Cards, are turned on (theyâre on by default). To add credit card info, tap Saved Credit Cards. The security code for your credit card is not savedâyou have to enter that manually. 6QCWVQOCVKECNN[°NNKPPCOGURCUUYQTFUQTETGFKVECTFKPHQQPUKVGUVJCVUWRRQTVKVVCRCVGZV °GNFVJGPVCR#WVQ(KNN Chapter 3 Basics 42 Apple Confidential DRAFT To protect your personal information, set a passcode if you turn on iCloud Keychain and AutoFill. Limit Ad Tracking Restrict or reset Ad Tracking. Go to Settings > Privacy > Advertising. Turn on Limit Ad Tracking VQRTGXGPVCRRUHTQOCEEGUUKPI[QWTK2CFCFXGTVKUKPIKFGPVK°GT(QTOQTGKPHQTOCVKQPVCR#DQWV Advertising & Privacy. Find My iPad Find My iPad can help you locate and secure your iPad using the free Find My iPhone app (available in the App Store) on another iPad, iPhone, or iPod touch, or using a Mac or PC web browser signed into YYYKENQWFEQO°PF. Find My iPhone includes Activation Lock, which is designed to prevent anyone else from using your iPad if you ever lose it. Your Apple ID and RCUUYQTFCTGTGSWKTGFVQVWTPQĂ(KPF/[K2CFQTVQGTCUGCPFTGCEVKXCVG[QWTK2CF Turn on Find My iPad. Go to Settings > iCloud > Find My iPad. Important: To use these features, Find My iPad must be turned on before your iPad is lost. iPad must be able to connect to the Internet for you to locate and secure the device. Use Find My iPhone. Open the Find My iPhone app on an iOS device, or go to YYYKENQWFEQO°PF on your computer. Sign in, then select your device. Play Sound: Play a sound at full volume for two minutes, even if the ringer is set to silent. Lost Mode: Immediately lock your missing iPad with a passcode and send it a message displaying a contact number. iPad also tracks and reports its location, so you can see where itâs been when you check the Find My iPhone app. Lost Mode also suspends the use of your credit and debit cards with Apple Pay (iPad models with Touch ID). See Apple Pay on page 41. Erase iPad: Protect your privacy by erasing all the information and media on your iPad and restoring it to its original factory settings. Note: Before selling or giving away your iPad, you should erase it completely to remove all of [QWTRGTUQPCNFCVCCPFVWTPQĂ(KPF/[K2CFVQGPUWTGVJGPGZVQYPGTECPCEVKXCVGCPFWUGVJG device normally. Go to Settings > General > Reset > Erase All Content and Settings. See Sell or give away iPad on page 158. Charge and monitor the battery iPad has an internal, lithium-ion rechargeable battery. For more information about the batteryâ including tips for maximizing battery lifeâsee www.apple.com/batteries. WARNING: For important safety information about the battery and charging iPad, see Important safety information on page 149. Chapter 3 Basics 43 Apple Confidential DRAFT Charge the battery. The best way to charge the iPad battery is to connect iPad to a power outlet using the included cable and USB power adapter. iPad may also charge slowly when you connect it to a USB 2.0 port on your computer. If your Mac or PC doesnât provide enough power to charge iPad, a âNot Chargingâ message appears in the status bar. Important: The iPad battery may drain instead of charge if iPad is connected to a computer VJCV¨UVWTPGFQĂQTKUKPUNGGRQTUVCPFD[OQFGVQC75$JWDQTVQVJG75$RQTVQPCMG[DQCTF See proportion of battery used by each app. Tap Settings > General > Usage, then tap Battery Usage. The battery icon in the upper-right corner of the status bar shows the battery level or charging status. Display the percentage of battery charge. Go to Settings > General > Usage, then turn on Battery Percentage. Important: If iPad is very low on power, it may display an image of a nearly depleted battery, indicating that iPad needs to charge for up to twenty minutes before you can use it. If iPad is extremely low on power, the display may be blank for up to two minutes before the low-battery image appears. Rechargeable batteries have a limited number of charge cycles and may eventually need to be replaced. The iPad battery isnât user replaceable; it can be replaced only by an authorized service provider. See www.apple.com/batteries/replacement-and-recycling/. Travel with iPad Your airline carrier may let you keep your iPad turned on if you switch to Airplane Modeâlisten for an announcement after boarding, or ask a member of the crew. Wi-Fi and Bluetooth are VWTPGFQĂKP#KTRNCPG/QFGUQ[QWECP¨VOCMGQTTGEGKXG(CEG6KOGECNNUQTWUGHGCVWTGUVJCV require wireless communication. You can listen to music, play games, watch videos, or use other apps that donât require Internet access. If your airline allows it, you can turn Wi-Fi or Bluetooth back on, even while in Airplane Mode. Turn on Airplane Mode. Swipe up from the bottom edge of the screen to open Control Center, then tap ;QWECPCNUQVWTP#KTRNCPG/QFGQPQTQĂKP5GVVKPIU9JGPCKTRNCPGOQFGKUQP appears in the status bar at the top of the screen. ;QWECPCNUQVWTP9K(KCPF$NWGVQQVJQPQTQĂKP%QPVTQN%GPVGT5GGControl Center on page 32. Chapter 3 Basics 44 Apple Confidential DRAFT When you travel abroad, you may be able to sign up for cellular service with a carrier in the country youâre visiting, right from your iPad (available on iPad models with cellular and Touch ID). For more information see Sign up for cellular service on page 14. Chapter 3 Basics 45 Apple Confidential DRAFT Siri Use Siri Siri lets you speak to iPad to send messages, schedule meetings, make FaceTime calls, and much more. Siri understands natural speech, so you donât have to learn special commands or keywords. Ask Siri anything, from âset the timer for 3 minutesâ to âwhat movies are showing tonight?â Open apps, and turn features like Airplane Mode, Bluetooth, Do Not Disturb, and VoiceOver on QTQĂ5KTKKUITGCVHQTMGGRKPI[QWWRFCVGFYKVJVJGNCVGUVURQTVUKPHQJGNRKPI[QWFGEKFGQPC restaurant, and searching the iTunes Store or App Store for purchases. Note: To use Siri, iPad must be connected to the Internet. See Connect to Wi-Fi on page 15. Cellular charges may apply. Summon Siri. Press and hold the Home button until Siri beeps, then make your request. Control when Siri listens. Instead of letting Siri notice when you stop talking, you can continue VQJQNFFQYPVJG*QOGDWVVQPYJKNG[QWURGCMVJGPTGNGCUGKVYJGP[QW°PKUJ Hands-free Siri. With iPad connected to a power source, you can use Siri hands free. Instead of pressing the Home button, say âHey Siriâ to get Siriâs attention, then make your request. To turn ÂĽ*G[5KTKÂŚQPQTQĂIQVQ5GVVKPIU )GPGTCN 5KTK #NNQYÂĽ*G[5KTKÂŚ If youâre using a headset, you can use the center or call button in place of the Home button. 6LUL¡VUHVSRQVH 2IWHQ\RXFDQWDSWKH VFUHHQIRUDGGLWLRQDO LQIRRUIXUWKHUDFWLRQ Tap to speak to Siri. For hints, ask Siri âwhat can you do,â or tap Depending on your request, the onscreen response from Siri often includes information or images that you can tap for additional detail, or to perform some other action like searching the web or opening a related app. 46 Apple Confidential DRAFT Change the voice gender for Siri. Go to Settings > General > Siri (may not be available in all areas). Adjust the volume for Siri. Use the volume buttons while youâre interacting with Siri. Tell Siri about yourself If you tell Siri about yourselfâincluding things like your home and work addresses, and your relationshipsâyou can get personalized service like, âremind me to call my wifeâ or âget directions to home.â Tell Siri who you are. Fill out your contact card in Contacts, go to Settings > General > Siri > My Info, then tap your contact card. Note: Siri uses Location Services when your requests require knowing your location. See Privacy on page 39. Make corrections Want to cancel that last command? Say âcancel,â tap the Siri icon, or press the Home button. If Siri doesnât get something right, you can tap to edit your request. Or tap again, then clarify your request verbally. Siri settings To set options for Siri, go to Settings > General > Siri. Options include: 6WTPKPI5KTKQPQTQĂ 6WTPKPI8QKEG#EVKXCVKQPQPQTQĂ Language Voice gender (may not be available in all areas) Voice feedback My Info card Prevent access to Siri when iPad is locked. Go to Settings > Touch ID & Passcode (iPad models with Touch ID) or Settings > Passcode (other models). You can also disable Siri by turning on restrictions. See Restrictions on page 39. Chapter 4 Siri 47 Apple Confidential DRAFT Messages iMessage service With the Messages app and the built-in iMessage feature, you can send text messages over Wi-Fi to others using iOS 5 or later, or OS X Mountain Lion or later. Messages can include photos, videos, and other info. You can see when people are typing, and let them know when youâve read their messages. If youâre signed into iMessage using the same Apple ID on other iOS devices or a Mac (OS X Mavericks or later), you can start a conversation on one device and continue it on another. For security, messages you send with iMessage are encrypted before theyâre sent. If you have an iPhone (iOS 8) signed into iMessage using the same Apple ID, you can also send and receive SMS and MMS messages on your iPad. Charges may apply to the text messaging service for your iPhone. WARNING: For important information about avoiding distractions that could lead to dangerous situations, see Important safety information on page 149. Note: Cellular data charges or additional fees may apply for you, and for the iPhone and iPad users you exchange messages with over their cellular data network. 48 Apple Confidential DRAFT Send and receive messages Tap the compose button to start a new conversation. Get info, make a voice or FaceTime call, share your location, or mute notifications. Blue indicates an iMessage conversation. Send a photo or video. Add your voice to the conversation. Start a conversation. Tap , then enter a phone number or email address, or tap , then choose a contact. You can also start a conversation by tapping a phone number in Contacts, Calendar, or Safari, or from a recent contact in the multitasking screen. appears if a message canât be sent. Tap the alert in a conversation to try Note: An alert sending the message again. Resume a conversation. Tap the conversation in the Messages list. Hide the keyboard. Tap in the lower-right corner. Use picture characters. Go to Settings > General > Keyboard > Keyboards > Add New Keyboard, VJGPVCR'OQLKVQOCMGVJCVMG[DQCTFCXCKNCDNG6JGPYJKNGV[RKPICOGUUCIGVCR to bring up VJG'OQLKMG[DQCTF5GGSpecial input methods on page 147. Tap to Talk. Touch and hold swipe left. to record a message, then swipe up to send it. To delete it, To save space, Tap to Talk audio messages that you receive are deleted automatically two minutes after you listen to them, unless you tap Keep. To keep them automatically, go to Settings > Messages > Expire (under Audio Messages), then tap Never. See what time a message was sent or received. Drag any bubble to the left. See a personâs contact info. In a conversation, tap Details, then tap perform actions, such as making a FaceTime call. Send messages to a group. Tap . Tap the info items to , then enter multiple recipients. Give a group a name. While viewing the conversation, tap Details, drag down, then enter the PCOGKPVJG5WDLGEVNKPG Add someone to a group. 6CRVJG6Q°GNFVJGPVCR#FF%QPVCEV Leave a group. Tap Details, then tap Leave this Conversation. Keep it quiet. 6CR&GVCKNUVJGPVWTPQP&Q0QV&KUVWTDVQOWVGPQVK°ECVKQPUHQTVJGEQPXGTUCVKQP Chapter 5 Messages 49 Apple Confidential DRAFT Block unwanted messages. On a contact card, tap Block this Caller. You can see someoneâs contact card while viewing a message by tapping Details, then tapping . You can also block callers in Settings > Messages > Blocked. You wonât receive FaceTime calls or text messages from blocked callers. For more information about blocking calls, see support.apple.com/kb/HT5845. Manage conversations Conversations are saved in the Messages list. A blue dot conversation to view or continue it. indicates unread messages. Tap a Forward a message or attachment. Touch and hold a message or attachment, tap More, select additional items if desired, then tap Delete a message or attachment. Touch and hold a message or attachment, tap More, select additional items if desired, then tap . Delete a conversation. In the Messages list, swipe the conversation from right to left, then tap Delete. Search conversations. +PVJG/GUUCIGUNKUVVCRVJGVQRQHVJGUETGGPVQFKURNC[VJGUGCTEJ°GNF then enter the text youâre looking for. You can also search conversations from the Home screen. See Spotlight Search on page 31. Share photos, videos, your location, and more You can send photos, videos, locations, contact info, and voice memos. The size limit of attachments is determined by your service providerâiPad compresses photo and video attachments if necessary. or to take a Quickly take and send a photo or video. Touch and hold . Then slide to photo or video. Photos are sent immediately. Tap to preview your video. To send your Video Message, tap . To save space, Video Messages that you receive are deleted automatically two minutes after you view them, unless you tap Keep. To keep them automatically, go to Settings > Messages > Expire (under Video Messages), then tap Never. Send photos and videos from your Photos library. Tap . Recent shots are right there; tap Photo Library for older ones. Select the items you want to send. View attachments. While viewing a conversation, tap Details. Attachments are shown in reverse chronological order at the bottom of the screen. Tap an attachment to see it in full screen. In fullto view the attachments as a list. screen mode, tap Chapter 5 Messages 50 Apple Confidential DRAFT Send your current location. Tap Details, then tap Send My Current Location to send a map that shows where you are. Share your location. Tap Details, tap Share My Location, then specify the length of time. The person youâre texting can see your location by tapping Details. To turn Share My Location on QTQĂQTVQUGNGEVVJGFGXKEGVJCVFGVGTOKPGU[QWTNQECVKQPIQVQ5GVVKPIU K%NQWF 5JCTG/[ Location (under Advanced). Send items from another app. In the other app, tap Share or , then tap Message. Share, save, or print an attachment. Tap the attachment, then tap Copy a photo or video. Touch and hold the attachment, then tap Copy. Messages settings Go to Settings > Messages, where you can: 6WTPK/GUUCIGQPQTQĂ Notify others when youâve read their messages Specify phone numbers, Apple IDs, and email addresses to use with Messages 5JQYVJG5WDLGEV°GNF Block unwanted messages Set how long to keep messages Manage the expiration of audio messages and video messages created within Messages (audio or video attachments created outside of Messages are kept until you delete them manually) /CPCIGPQVK°ECVKQPUHQTOGUUCIGUSee 0QVK°ECVKQP%GPVGT on page 33. Set the alert sound for incoming text messages. See Sounds and silence on page 34. Chapter 5 Messages 51 Apple Confidential DRAFT Mail Write messages Mail lets you access your email accounts, on the go. WARNING: For important information about avoiding distractions that could lead to dangerous situations, see Important safety information on page 149. Change mailboxes or accounts. Search for messages. Delete, move, or mark multiple messages. Compose a message. Change the preview length in Settings > Mail, Contacts, Calendars. Insert a photo or video. Tap the insertion point, then tap Insert Photo or Video. Also see Edit text on page 29. Quote some text when you reply. Tap the insertion point, then select the text you want to include. Tap VJGPVCR4GRN[;QWECPVWTPQĂVJGKPFGPVCVKQPQHVJGSWQVGFVGZVKP5GVVKPIU Mail, Contacts, Calendars > Increase Quote Level. 5GPFCOGUUCIGHTQOCFKĂGTGPVCEEQWPV6CRVJG(TQO°GNFVQEJQQUGCPCEEQWPV 52 Apple Confidential DRAFT Change a recipient from Cc to Bcc. #HVGT[QWGPVGTTGEKRKGPVU[QWECPFTCIVJGOHTQOQPG°GNF to another or change their order. Mark addresses outside certain domains. When youâre addressing a message to a recipient thatâs not in your organizationâs domain, Mail can color the recipientâs name red to alert you. Go VQ5GVVKPIU /CKN%QPVCEVU%CNGPFCTU /CTM#FFTGUUGUVJGPFG°PGVJGFQOCKPUVJCV[QWFQ not want marked. You can enter multiple domains separated by commas, such as âapple.com, example.org.â Get a sneak peek See a longer preview. Go to Settings > Mail, Contacts, Calendars > Preview. You can show up to °XGNKPGU Is this message for me? Turn on Settings > Mail, Contacts, Calendars > Show To/Cc Label. If VJGNCDGNUC[U%EKPUVGCFQH6Q[QWYGTGLWUVEQRKGF;QWECPCNUQWUGVJG6Q%EOCKNDQZYJKEJ gathers all mail addressed to you. To show it, tap Edit while viewing the Mailboxes list. Finish a message later Look at another message while youâre writing one. Swipe down on the title bar of a message youâre writing. When youâre ready to return to your message, tap its title at the bottom of the UETGGP+H[QWJCXGOQTGVJCPQPGOGUUCIGYCKVKPIVQDG°PKUJGFVCRVJGDQVVQOQHVJGUETGGP to see them all. Save a draft for later. +H[QW¨TGYTKVKPICOGUUCIGCPFYCPVVQ°PKUJKVNCVGTVCR%CPEGNVJGPVCR Save Draft. To get it back, touch and hold Compose. 9KVJ15:;QUGOKVG[QWECPCNUQJCPFQĂWP°PKUJGFOGUUCIGUYKVJ[QWT/CE5GGAbout Continuity features on page 24. Chapter 6 Mail 53 Apple Confidential DRAFT See important messages Mark person as a VIP. )GVPQVK°GFQHTGRNKGUVQCOGUUCIGQTVJTGCFTap , then tap Notify Me. While youâre writing a message, you can also tap KPVJG5WDLGEV°GNF6QEJCPIGJQYPQVK°ECVKQPUCRRGCTIQVQ 5GVVKPIU 0QVK°ECVKQPU /CKN 6JTGCF0QVK°ECVKQPU Gather important messages. Add important people to your VIP list, so all their messages appear in the VIP mailbox. Tap the senderâs name in a message, then tap Add to VIP. To change how PQVK°ECVKQPUCRRGCTIQVQ5GVVKPIU 0QVK°ECVKQPU /CKN 8+2 )GVPQVK°GFQHKORQTVCPVOGUUCIGU0QVK°ECVKQP%GPVGTNGVU[QWMPQYYJGP[QWTGEGKXG OGUUCIGUKPHCXQTKVGOCKNDQZGUQTOGUUCIGUHTQO[QWT8+2U)QVQ5GVVKPIU 0QVK°ECVKQP Center > Mail. (NCICOGUUCIGUQ[QWECP°PFKVNCVGTTap while reading the message. You can change the CRRGCTCPEGQHVJGÂąCIIGFOGUUCIGKPFKECVQTKP5GVVKPIU /CKN%QPVCEVU%CNGPFCTU (NCI5V[NG To see the Flagged smart mailbox, tap Edit while viewing the Mailboxes list, then tap Flagged. Search for a message. 5ETQNNVQQTVCRVJGVQRQHVJGOGUUCIGNKUVVQTGXGCNVJGUGCTEJ°GNF 5GCTEJKPINQQMUCVVJGCFFTGUU°GNFUVJGUWDLGEVCPFVJGOGUUCIGDQF[6QUGCTEJOWNVKRNG accounts at once, search from a smart mailbox, such as All Sent. Search by timeframe. 5ETQNNVQQTVCRVJGVQRQHVJGOGUUCIGNKUVVQTGXGCNVJGUGCTEJ°GNF VJGPV[RGUQOGVJKPINKMGÂĽ(GDTWCT[OGGVKPIÂŚVQ°PFCNNOGUUCIGUHTQO(GDTWCT[YKVJVJGYQTF âmeeting.â Search by message state. 6Q°PFCNNÂąCIIGFWPTGCFOGUUCIGUHTQORGQRNGKP[QWT8+2NKUVV[RG ÂĽÂąCIWPTGCFXKRÂŚ;QWECPCNUQUGCTEJHQTQVJGTOGUUCIGCVVTKDWVGUUWEJCUÂĽCVVCEJOGPVÂŚ Junk be gone! Tap YJKNG[QW¨TGTGCFKPICOGUUCIGVJGPVCR/QXGVQ,WPMVQ°NGKVKPVJG,WPM folder. If you accidentally move a message, shake iPad immediately to undo. Make a favorite mailbox. Favorite mailboxes appear at the top of the Mailboxes list. To add a favorite, view the Mailboxes list, then tap Edit. Tap Add Mailbox, then select the mailbox to add. ;QW¨NNCNUQIGVRWUJPQVK°ECVKQPUHQT[QWTHCXQTKVGOCKNDQZGU Show draft messages from all of your accounts. While viewing the Mailboxes list, tap Edit, tap Add Mailbox, then turn on the All Drafts mailbox. Attachments Save a photo or video to Photos. Touch and hold the photo or video until a menu appears, then tap Save Image. Open an attachment with another app. Touch and hold the attachment until a menu appears, then tap the app you want to use to open the attachment. Some attachments automatically show a banner with buttons you can use to open other apps. Chapter 6 Mail 54 Apple Confidential DRAFT See messages with attachments. The Attachments mailbox shows messages with attachments from all accounts. To add it, view the Mailboxes list, then tap Edit. Work with multiple messages Delete, mark, or move a message. While viewing a list of messages, swipe a message to the left VQTGXGCNCOGPWQHCEVKQPU5YKRGCNNVJGYC[VQVJGNGHVVQUGNGEVVJG°TUVCEVKQP;QWECPCNUQ swipe a message to the right to reveal another action. Choose the actions you want to appear in Settings > Mail, Contacts, Calendars > Swipe Options. Delete, move, or mark multiple messages. While viewing a list of messages, tap Edit. Select some messages, then choose an action. If you make a mistake, shake iPad immediately to undo. Organize your mail with mailboxes. Tap Edit in the mailboxes list to create a new one, or rename or delete one. (Some built-in mailboxes canât be changed.) There are several smart mailboxes, such as Unread, that show messages from all your accounts. Tap the ones you want to use. Recover a deleted message. Open the message in the accountâs Trash mailbox, then tap and OQXGVJGOGUUCIG1TKH[QWLWUVFGNGVGFKVUJCMGK2CFVQWPFQ6QUGGFGNGVGFOGUUCIGUKPCNN your accounts, add the Trash smart mailbox. To add it, tap Edit in the mailboxes list, then select it from the list. Archive instead of delete. Instead of deleting messages, you can archive them so theyâre still around if you need them. Select Archive Mailbox in Settings > Mail, Contacts, Calendars > account name > Account > Advanced. To delete a message instead of archiving it, touch and hold , then tap Delete. Stash your trash. You can set how long deleted messages stay in the Trash mailbox. Go to Settings > Mail, Contacts, Calendars > account name > Account > Advanced. See and save addresses Mark person as a VIP. Add someone to Contacts or make them a VIP. Tap the personâs name or email address, then tap Add to VIP. You can also add their address to a new or existing contact. See who received a message. 9JKNGXKGYKPIVJGOGUUCIGVCR/QTGKPVJG6Q°GNF Print messages Print a message. Tap , then tap Print. Chapter 6 Mail 55 Apple Confidential DRAFT Print an attachment or picture. Tap to view it, tap , then choose Print. See AirPrint on page 38. Mail settings Go to Settings > Mail, Contacts, Calendars, where you can: %TGCVGCFKĂGTGPVOCKNUKIPCVWTGHQTGCEJCEEQWPV Add mail accounts 5GV1WVQH1ĂEGTGRNKGUHQT'ZEJCPIGGOCKNCEEQWPVU Bcc yourself on every message you send Turn on Organize by Thread to group related messages together 6WTPQĂEQP°TOCVKQPHQTFGNGVKPICOGUUCIG 6WTPQĂ2WUJFGNKXGT[QHPGYOGUUCIGUVQUCXGQPDCVVGT[RQYGT 6GORQTCTKN[VWTPQĂCPCEEQWPV Chapter 6 Mail 56 Apple Confidential DRAFT Safari Safari at a glance Use Safari on iPad to browse the web, use Reading List to collect webpages to read later, and add page icons to the Home screen for quick access. Use iCloud to see pages you have open on other devices, and to keep your bookmarks, history, and reading list up to date on your other devices. See your bookmarks, reading list, and shared links. Enter a web address or search item, or get quick access to your Favorites. View open tabs. Your open tabs Open a new tab. Share, print, and more. To zoom, double tap an item or pinch. 57 Apple Confidential DRAFT Search the web Spotlight Search showing results in the App Store (QWHUZKDW\RX¡UH searching for, then tap Go. Or tap a suggestion. Tap to search the current page. Search the web. 'PVGTC74.QTUGCTEJVGTOKPVJGUOCTVUGCTEJ°GNFCVVJGVQRQHVJGRCIGVJGP tap a search suggestion, or tap Go on the keyboard to search for exactly what you typed. If you FQP¨VYCPVVQUGGUWIIGUVGFUGCTEJVGTOUIQVQ5GVVKPIU 5CHCTKVJGP WPFGT5GCTEJ VWTPQĂ Search Engine Suggestions. Quickly search a site youâve visited before. Enter the name of the site, followed by your search term. For example, enter âwiki einsteinâ to search Wikipedia for âeinstein.â Go to Settings > Safari > 3WKEM9GDUKVG5GCTEJVQVWTPVJKUHGCVWTGQPQTQĂ Have your favorites top the list. Select them at Settings > Safari > Favorites. Search the page. Scroll to the bottom of the suggested results list, then tap the entry under On This Page. Tap in the bottom left to see the next occurrence on the page. To search the RCIGHQTCFKĂGTGPVVGTOGPVGTKVKPVJG°GNFCVVJGDQVVQOQHVJGRCIG6QEQPVKPWGDTQYUKPI tap Done. Choose your search tool. Go to Settings > Safari > Search Engine. Browse the web Touch and hold a link to see these options. Look before you leap. To see the URL of a link before you go there, touch and hold the link. Open a link in a new tab. Touch and hold the link, then tap Open in New Tab. If youâd like to UYKVEJVQCPGYVCDYJGP[QWQRGPKVIQVQ5GVVKPIU 5CHCTKVJGPVWTPQĂ1RGP0GY6CDU in Background. Browse open tabs. Tap QTRKPEJYKVJVJTGG°PIGTUVQXKGYCNN[QWTQRGPVCDU+H[QWJCXG several open tabs, tabs for the same site are stacked. To close a tab, tap in the upper-left corner, or swipe the tab to the left. To return to a single tab, tap a tab, tap Done, or spread VJTGG°PIGTU Chapter 7 Safari 58 Apple Confidential DRAFT View tabs open on your other devices. If you turn on Safari in Settings > iCloud, you can view tabs that you have open on your other devices. Tap , then scroll to the lists at the bottom of the page. Close a tab. Tap on the tab. View recently closed tabs. Touch and hold Get back to the top. Tap the top edge of the screen to quickly return to the top of a long page. See more. Turn iPad to landscape orientation. See the latest. Tap PGZVVQVJGCFFTGUUKPVJGUGCTEJ°GNFVQWRFCVGVJGRCIG See a tabâs history. Touch and hold or . View the desktop version of a site. If you want to see the full desktop version of a site instead of VJGOQDKNGXGTUKQPVCRVJGUGCTEJ°GNFRWNNFQYPVJGFKURNC[QH[QWTHCXQTKVGUVJGPVCR4GSWGUV Desktop Site. Keep bookmarks Bookmark the current page. Tap View your bookmarks. Tap (or touch and hold , then tap ), then tap Add Bookmark. Get organized. To create a folder for bookmarks, tap , then tap Edit. %JQQUGYJKEJHCXQTKVGUCRRGCTYJGP[QWVCRVJGUGCTEJ°GNFGo to Settings > Safari > Favorites. Bookmarks bar on your Mac? Turn on Settings > iCloud > Safari if you want items from the bookmarks bar in Safari on your Mac to appear in Favorites on iPad. Save an icon for the current page on your Home screen. Tap The icon appears only on the device where you create it. , then tap Add to Home Screen. Chapter 7 Safari 59 Apple Confidential DRAFT Save a reading list for later Save interesting items in your reading list so you can return to them later. You can read pages in your reading list even when youâre not connected to the Internet. Add the current page to your reading list. Tap , then tap Add to Reading List. Add a linked page without opening it. Touch and hold the link, then tap Add to Reading List. View your reading list. Tap , then tap Delete something from your reading list. Swipe left on the item in your reading list. Donât want to use cellular data to download reading list items? 6WTPQĂ5GVVKPIU 5CHCTK 7UG Cellular Data. Shared links and subscriptions You can view links shared from social media, such as Twitter, or feeds from your subscriptions. View shared links and subscriptions. Tap , then tap Subscribe to a feed. Go to a site that provides a subscription feed, tap .KPMUVJGPEQP°TOD[VCRRKPI#FFVQ5JCTGF.KPMU , tap Add to Shared Delete a subscription. Tap , tap , tap Subscriptions below the list of your shared links, then tap next to the subscription you want to delete. Chapter 7 Safari 60 Apple Confidential DRAFT Spread the news. Tap Tap to share with someone nearby using AirDrop. Other sharing options Fill in forms Whether youâre logging in to a website, signing up for a service, or making a purchase, you can °NNKPCYGDHQTOWUKPIVJGQPUETGGPMG[DQCTFQTJCXG5CHCTK°NNKVKPHQT[QWWUKPI#WVQ(KNN Tap AutoFill instead of typing your contact info. Tired of always having to log in? When youâre asked if you want to save the password for the UKVGVCR;GU6JGPGZVVKOG[QWXKUKV[QWTWUGTPCOGCPFRCUUYQTFYKNNDG°NNGFKPHQT[QW Fill in a form. 6CRCP[°GNFVQDTKPIWRVJGQPUETGGPMG[DQCTF6CR or OQXGHTQO°GNFVQ°GNF above the keyboard to Fill it in automatically. )QVQ5GVVKPIU 5CHCTK 2CUUYQTFU#WVQ°NNVJGPVWTPQP7UG%QPVCEV +PHQ6JGPVCR#WVQ(KNNCDQXGVJGQPUETGGPMG[DQCTFYJGP[QW¨TG°NNKPIKPVJGHQTO0QVCNN websites support AutoFill. Add a credit card for purchases. )QVQ5GVVKPIU 5CHCTK 2CUUYQTFU#WVQ°NN 5CXGF%TGFKV Cards > Add Credit Card. To enter the information without typing it, tap Use Camera, then hold K2CFCDQXGVJGECTFUQVJCVVJGKOCIGQHVJGECTF°VUKPVJGHTCOG;QWECPCNUQCFFCETGFKV ECTFD[CEEGRVKPIYJGP5CHCTKQĂGTUVQUCXGKVYJGP[QWOCMGCPQPNKPGRWTEJCUG5GGiCloud Keychain on page 42. Use your credit card information. Look for the AutoFill Credit Card button above the onscreen MG[DQCTFYJGPGXGT[QW¨TGKPCETGFKVECTF°GNF;QWTECTF¨UUGEWTKV[EQFGKUP¨VUVQTGFUQ[QWUVKNN enter that yourself. If youâre not using a passcode for iPad, you might want to start; see Use a passcode with data protection on page 40. Submit the form. Tap Go, Search, or the link on the webpage. Chapter 7 Safari 61 Apple Confidential DRAFT Avoid clutter with Reader Use Safari Reader to focus on a pageâs primary content. Tap to view the page in Reader. Focus on content. Tap CVVJGNGHVGPFQHVJGCFFTGUU°GNF+H[QWFQP¨VUGGVJGKEQPTGCFGTKUP¨V available for the page youâre looking at. 5JCTGLWUVVJGIQQFUVWĂ6QUJCTGLWUVVJGCTVKENGVGZVCPFCNKPMVQKVVCR page in Reader. while viewing the Return to the full page. 6CRVJGTGCFGTKEQPKPVJGCFFTGUU°GNFCICKP Privacy and security ;QWECPCFLWUV5CHCTKUGVVKPIUVQMGGR[QWTDTQYUKPICEVKXKVKGUVQ[QWTUGNHCPFRTQVGEV[QWTUGNH from malicious websites. 9CPVVQMGGRCNQYRTQ°NG!Turn on Settings > Safari > Do Not Track. Safari will ask websites you visit not to track your browsing, but bewareâa website can choose not to honor the request. Control cookies. Go to Settings > Safari > Block Cookies. To remove cookies already on iPad, go to Settings > Safari > Clear History and Website Data. Let Safari create secure passwords and store them for you. 6CRVJGRCUUYQTF°GNFYJGP ETGCVKPICPGYCEEQWPVCPF5CHCTKYKNNQĂGTVQETGCVGCRCUUYQTFHQT[QW Erase your browsing history and data from iPad. Go to Settings > Safari > Clear History, and Settings > Safari > Clear History and Website Data. Visit sites without making history. Tap , then tap Private. Sites you visit wonât appear in iCloud Tabs or be added to History on your iPad. To put away your private sites, tap , then tap Private again. You can close the pages, or keep them for viewing the next time you use Private Browsing Mode. Watch for suspicious websites. Turn on Settings > Safari > Fraudulent Website Warning. Safari settings Go to Settings > Safari, where you can: Choose your search engine Provide AutoFill information Choose which favorites are displayed when you search Have new tabs open in the background Chapter 7 Safari 62 Apple Confidential DRAFT Display your Favorites at the top of the page Block pop-ups Tighten privacy and security Clear your history, cookies, and data Chapter 7 Safari 63 Apple Confidential DRAFT Music Get music Get music and other audio content onto iPad: Purchase music from the iTunes Store: Go to iTunes Store. While browsing playlists and albums in Music, you can tap Store. See Chapter 22, iTunes Store, on page 106. iCloud: Get access to all your iTunes songs, no matter which device you used to purchase them. Use iTunes Match to include CDs and other music you import. See iCloud and iTunes Match on page 67. Family Sharing: To download songs purchased by other members of your family, go to iTunes Store, tap More, tap Purchased, then choose a family member. See Family Sharing on page 35. Sync content with iTunes on your computer: See Sync with iTunes on page 17. WARNING: For important information about avoiding hearing loss, see Important safety information on page 149. iTunes Radio (GCVWTGFUVCVKQPURTQXKFGCITGCVYC[VQGZRNQTGCPFGPLQ[PGYOWUKEKPCXCTKGV[QHIGPTGU;QW can also create your own custom stations, based on your pick of artist, song, or genre. See iCloud and iTunes Match on page 67. 64 Apple Confidential DRAFT Note: iTunes Radio may not be available in all areas. For more information about iTunes Radio, see support.apple.com/kb/HT5848. Create, share, fine-tune, rename, or delete a station. Play more like this song, never play it, or add it to your wish list. Skip to the next song. Options for browsing your music library When you pick a station and play a song, the Now Playing screen shows the album art and the playback controls. Tap VQ°PFQWVOQTGETGCVGCPGYUVCVKQP°PGVWPGVJGUVCVKQPQTUJCTGKV See Share from apps on page 34. Create a station based on an artist, genre, or song. Tap New on the iTunes Radio screen. Or tap Create when browsing or playing music from your library. Edit your stations. Tap Edit. You can include or exclude other artists, songs, or genres, or delete a station. +PÂąWGPEGWREQOKPIUQPIUGNGEVKQPUTap , then tap Play More Like This or Never Play This Song. You can also add the song to your iTunes Wish List. Skip to the next song. Tap . You can skip a limited number of songs per hour. See the songs youâve played, or view your wishlist. Tap History, then tap Played or Wishlist. You can purchase songs for your library. Tap a song to preview it. Purchase songs for your personal library. Tap the price button. Share a station you created. While playing the station, tap , then tap Share Station. Browse and play Browse your music by playlist, artist, song, or other category. For additional browse options, tap More, if it appears in the lower-right corner. Tap any song to play it. You can listen to audio from the built-in speakers, from headphones attached to the headset LCEMQTHTQOYKTGNGUU$NWGVQQVJUVGTGQJGCFRJQPGURCKTGFYKVJK2CF+HJGCFRJQPGUCTGCVVCEJGF or paired, no sound comes from the speakers. Rearrange the browse buttons. Tap More (if itâs visible), tap Edit, then drag a button onto the one you want to replace. Chapter 8 Music 65 Apple Confidential DRAFT The Now Playing screen provides playback controls and shows you whatâs playing. Track list Back Tap to create a Genius Playlist or an iTunes Radio station. Playhead Volume Skip to any point in a song. &TCIVJGRNC[JGCF5NQYFQYPVJGUETWDTCVGD[UNKFKPI[QWT°PIGT down the screen. 5JWĂG6CR5JWĂGQPVJG0QY2NC[KPIUETGGPVQRNC[[QWTVWPGUKPTCPFQOQTFGT See all tracks from the album containing the current song. Tap . To play a track, tap it. Search music. 9JKNGDTQYUKPIFTCIFQYPVQTGXGCNVJGUGCTEJ°GNFCVVJGVQRQHVJGUETGGPVJGP enter your search text. You can also search audio content from the Home screen. See Spotlight Search on page 31. Rate a song for smart playlists in iTunes. Tap the screen to reveal the rating dots, then tap a dot to assign a rating. Display lyrics. If youâve added lyrics to the song, tap the album cover to see them. To add lyrics, use the songâs Info window in iTunes on your computer, then sync the song to iPad. Get audio controls from the Lock screen or when using another app. Swipe up from the bottom edge of the screen to open Control Center. See Control Center on page 32. Chapter 8 Music 66 Apple Confidential DRAFT Play music on AirPlay speakers or Apple TV. Open Control Center, then tap page 38. . See AirPlay on iCloud and iTunes Match With iCloud, you can access all of the music you purchase in the iTunes Store on all of your icon shows the songs you have in iCloud. Just click a song to play it. devices. The Automatically download music purchased on another device. Go to Settings > iTunes & App Store, sign in using your Apple ID, then turn on Music under Automatic Downloads. Download music if youâre going somewhere you wonât have Wi-Fi. Click next to the songs youâll want to play. Or download entire albums and playlists. You can also download previous purchases in the iTunes Storeâtap More, tap Purchased, then tap Music. Remove a song thatâs been downloaded. Swipe left, then tap Delete. The song is removed from iPad, but remains available from iCloud. View only music thatâs downloaded. Go to Settings > iTunes & App Store. Under Show All, turn QĂ/WUKE With an iTunes Match subscription, you can store all your music in iCloud (up to 25,000 songs)â even songs you imported from CDs. Note: iTunes Match may not be available in all areas. See support.apple.com/kb/HT5085. Subscribe to iTunes Match. Go to Settings > iTunes & App Store > Subscribe to iTunes Match. See www.apple.com/itunes/itunes-match. Turn on iTunes Match. Go to Settings > iTunes & App Store > App Store. Sign in if you havenât already. Playlists Create playlists to organize your music. View Playlists, tap New Playlist near the top of the list, then enter a title. Tap to add songs or videos. Edit a playlist. Select the playlist, then tap Edit. Chapter 8 Music 67 Apple Confidential DRAFT Add more songs: Tap Delete a song: Tap from iPad. Change the song order: Drag , then tap Remove. Deleting a song from a playlist doesnât delete it New and changed playlists are copied to your iTunes library the next time you sync iPad with your computer, or through iCloud if youâve subscribed to iTunes Match. Clear or delete a playlist you created on iPad. Select the playlist, then tap Clear or Delete. Remove a song from iPad. Tap Songs, swipe the song, then tap Delete. The song is deleted from iPad, but not from your iTunes library on your Mac or PC, or from iCloud. Geniusâmade for you A Genius playlist is a collection of songs from your library that go together. Genius is a free service, but it requires an Apple ID. A Genius Mix is a selection of songs of the same kind of music, re-created from your library each time you listen to the mix. Turn on Genius. Tap Playlists, tap Genius Playlist, then tap Turn On Genius. Browse and play Genius Mixes. 6CR)GPKWU VCR/QTG°TUVKH)GPKWUKUP¨VXKUKDNG 5YKRGVQXKGY additional mixes. To play a mix, tap . Make a Genius playlist. View Playlists, then tap Genius Playlist and choose a song. Or from the Now Playing screen, tap Create, then tap Genius Playlist. 4GRNCEGVJGRNC[NKUVWUKPICFKĂGTGPVUQPITap New, then pick a song. Refresh the playlist: Tap Refresh. Save the playlist: Tap Save. The playlist is saved with the title of the song you picked, and marked by . If you subscribe to iTunes Match, your Genius playlists are stored in iCloud. Genius playlists created on iPad are copied to your computer when you sync with iTunes. Note: Once a Genius playlist is synced to iTunes, you canât delete it directly from iPad. Use iTunes to edit the playlist name, stop syncing, or delete the playlist. Delete a saved Genius playlist. Tap the Genius playlist, then tap Delete. Siri You can use Siri (iPad 3rd generation or later) to control music playback. See Use Siri on page 46. Use Siri to play music. Press and hold the Home button. Play or pause music: Say âplayâ or âplay music.â To pause, say âpause,â âpause music,â or âstop.â You can also say ânext songâ or âprevious song.â Play an album, artist, or playlist: Say âplay,â then say âalbum,â âartist,â or âplaylistâ and the name. 5JWĂGVJGEWTTGPVRNC[NKUV5C[ÂĽUJWĂGÂŚ Find out more about the current song: Say âwhatâs playing,â âwho sings this song,â or âwho is this song by.â Use Genius to play similar songs: Say âGeniusâ or âplay more songs like this.â Chapter 8 Music 68 Apple Confidential DRAFT Home Sharing Home Sharing lets you play music, movies, and TV shows from the iTunes library on your Mac or PC. iPad and your computer must be on the same Wi-Fi network. Note: Home Sharing requires iTunes 10.2 or later, available at www.itunes.com/download. Bonus content, such as digital booklets and iTunes Extras, canât be shared. Play music from your iTunes library on iPad. 1 In iTunes on your computer, choose File > Home Sharing > Turn On Home Sharing. Log in, then click Create Home Share. 2 On iPad, go to Settings > Music, then log in to Home Sharing using the same Apple ID and password. 3 In Music, tap More, then tap Shared and choose your computerâs library. Return to content on iPad. Tap Shared, then choose My iPad. Music settings Go to Settings > Music to set options for Music, including: Sound Check (to normalize the volume level of your audio content) Equalization (EQ) Note: '3UGVVKPIUCĂGEVCNNUQWPFQWVRWVKPENWFKPIVJGJGCFUGVLCEMCPF#KT2NC[6JGUG generally apply only to music played from the Music app. The Late Night setting compresses the dynamic range of the audio output, reducing the volume of loud passages and increasing the volume of quiet passages. You might want to use this setting when listening to music on an airplane or in some other noisy environment. The Late Night setting applies to all audio outputâvideo as well as music. Grouping by album artist Set the volume limit. Go to Settings > Music > Volume Limit. Note: In some European Union (EU) countries, iPad may indicate when youâre setting the volume above the EU recommended level for hearing safety. To increase the volume beyond this level, [QWOC[PGGFVQDTKGÂą[TGNGCUGVJGXQNWOGEQPVTQN6QNKOKVVJGOCZKOWOJGCFUGVXQNWOGVQ this level, go to Settings > Music > Volume Limit, then turn on EU Volume Limit. Prevent changes to the volume limit. Go to Settings > General > Restrictions > Volume Limit, then tap Donât Allow Changes. Chapter 8 Music 69 Apple Confidential DRAFT FaceTime FaceTime at a glance Use FaceTime to make video or audio calls to other iOS devices or computers that support FaceTime. The FaceTime camera lets you talk face-to-face; switch to the rear iSight camera to share what you see around you. Note: FaceTime may not be available in all areas. On iPad Wi-Fi + Cellular models, you can make FaceTime calls over a cellular data connection. Cellular data charges may apply. See Cellular settings on page 156. Drag your image to any corner. Switch between cameras. Mute (you can hear and see; the caller can see but not hear). 9KVJC9K(KEQPPGEVKQPCPFCP#RRNG+&[QWECPOCMGCPFTGEGKXG(CEG6KOGECNNU °TUVUKIPKP using your Apple ID, or create a new account). 70 Apple Confidential DRAFT Make and answer calls Make a FaceTime call. Make sure FaceTime is turned on in Settings > FaceTime. Tap FaceTime, to make VJGPV[RGVJGPCOGQTPWODGT[QWYCPVVQECNNKPVJGGPVT[°GNFCVVJGVQRNGHV6CR a video call, or tap to make a FaceTime audio call. Or tap to open Contacts and start your call from there. Tap an icon to start a FaceTime call. Use your voice to start the call. Press and hold the Home button, then say âFaceTime,â followed by the name of the person to call. Want to call again? Tap FaceTime to see your call history in the left panel. Tap Audio or Video VQTG°PG[QWTUGCTEJVJGPVCRCPCOGQTPWODGTVQECNNCICKP6CR to open the name or number in Contacts. Swipe to the left, then tap Delete to delete the name or number from your call history. Canât take a call right now? When a FaceTime call comes in, you can answer, decline, or choose another option. Set up a reminder to return the call later. Send the caller a text message. See the whole gang. Rotate iPad to use FaceTime in landscape orientation. To avoid unwanted orientation changes, lock iPad in portrait orientation. See Change the screen orientation on page 23. Manage calls Multitask during a call. Press the Home button, then tap an app icon. You can still talk with your friend, but you canât see each other. To return to the video, tap the green bar at the top of the screen. Juggle calls. FaceTime calls arenât forwarded. If another call comes in while youâre on a FaceTime call, you can either end the FaceTime call and answer the incoming call, decline the incoming call, or reply with a text message. You can use call waiting with FaceTime audio calls only. Use call waiting for audio calls. If youâre on a FaceTime audio call and another call comes in, you ECPFGENKPGVJGECNNGPFVJG°TUVECNNCPFCEEGRVVJGPGYQPGQTRWVVJG°TUVECNNQPJQNFCPF respond to the new call. Add multiple callers. While on a FaceTime audio call, you can add another person to the EQPXGTUCVKQP2WVVJG°TUVECNNQPJQNFVJGPVCR to add another FaceTime audio call. Block unwanted callers. Go to Settings > FaceTime > Blocked > Add New. You wonât receive FaceTime calls or text messages from blocked callers. For more information about blocking calls, see support.apple.com/kb/HT5845. 1VJGTQRVKQPUKP5GVVKPIUNGV[QWVWTP(CEG6KOGQPQTQĂURGEKH[CRJQPGPWODGT#RRNG+&QT email address to use with FaceTime, and set your caller ID. Chapter 9 FaceTime 71 Apple Confidential DRAFT 10 Calendar Calendar at a glance Change views. Search for events. View invitations. Change calendars or accounts. Add an event. Tap VJGP°NNKPVJGGXGPVFGVCKNU+H[QWCFFCNQECVKQPCPFEJQQUG#NGTV 6KOG to leave, Calendar reminds you of the event based on the current travel time to get there. Search for events. Tap VJGPGPVGTVGZVKPVJGUGCTEJ°GNF6JGVKVNGUKPXKVGGUNQECVKQPUCPF notes for the calendars youâre viewing are searched. Change your view. Tap Day, Week, Month, or Year. Tap Week or Day view, pinch to zoom in or out. to view upcoming events as a list. In next to the calendar, then choose a color Change the color of a calendar. Tap Calendars, tap from the list. For some calendar accounts, such as Google, the color is set by the server. Adjust an event. 6QWEJCPFJQNFVJGGXGPVVJGPCFLWUVVJGITCDRQKPVUQTFTCIKVVQCPGYVKOG Invitations iCloud, Microsoft Exchange, and some CalDAV servers let you send and receive meeting invitations. 72 Apple Confidential DRAFT to pick Invite others to an event. Tap an event, tap Edit, then tap Invitees. Type names, or tap RGQRNGHTQO%QPVCEVU+H[QWFQP¨VYCPVVQDGPQVK°GFYJGPUQOGQPGFGENKPGUCOGGVKPIIQVQ Settings > Mail, Contacts, Calendar > Show Invitee Declines. RSVP. Tap an event youâve been invited to, or tap Inbox, then tap an invitation. If you add comments (which may not be available for all calendars), your comments can be seen by the organizer but not by other attendees. To see events youâve declined, tap Calendars, then turn on Show Declined Events. Schedule a meeting without blocking your schedule. Tap the event, tap Availability, then tap âfree.â If itâs an event you created, tap âShow Asâ and then tap âfree.â The event stays on your calendar, but it doesnât appear as busy to others who send you invitations. Quickly send an email to attendees. Tap the event, tap Invitees, then tap Use multiple calendars Select which calendars to view. Turn on Facebook events in Settings > Facebook. Turn on iCloud, Google, Exchange, or Yahoo! calendars. Go to Settings > Mail, Contacts, Calendars, tap an account, then turn on Calendar. Subscribe to a calendar. Go to Settings > Mail, Contacts, Calendars, then tap Add Account. Tap 1VJGTVJGPVCR#FF5WDUETKDGF%CNGPFCT'PVGTVJG74.QHVJGKEU°NGVQUWDUETKDGVQ;QWECP also subscribe to an iCalendar (.ics) calendar by tapping a link to the calendar. Add a CalDAV account. Go to Settings > Mail, Contacts, Calendars, tap Add Account, then tap Other. Under Calendars, tap Add CalDAV Account. View the Birthdays calendar. Tap Calendars, then tap Birthdays to include birthdays from Contacts with your events. If youâve set up a Facebook account, you can also include your Facebook friendsâ birthdays. View the Holidays calendar. Tap Calendars, then tap Holidays to included national holidays with your events. See multiple calendars at once. Tap Calendars, then select the calendars you want to view. Move an event to another calendar. Tap the event, tap Edit, then select a calendar to move it to. Chapter 10 Calendar 73 Apple Confidential DRAFT Share iCloud calendars With Family Sharing, a calendar shared with all the members of your family is created automatically. See Family Sharing on page 35. You can also share an iCloud calendar with other iCloud users. When you share a calendar, others can see it, and you can let them add or change events. You can also share a read-only version that anyone can view. Create an iCloud calendar. Tap Calendars, tap Edit, then tap Add Calendar in the iCloud section. Share an iCloud calendar. Tap Calendars, tap Edit, then tap the iCloud calendar you want to share. Tap Add Person, then enter a name, or tap to browse your Contacts. Those you invite TGEGKXGCPGOCKNKPXKVCVKQPVQLQKPVJGECNGPFCTDWVVJG[PGGFCPK%NQWFCEEQWPVKPQTFGT to accept. Change a personâs access to a shared calendar. Tap Calendars, tap Edit, tap the shared calendar, VJGPVCRVJGRGTUQP;QWECPVWTPQĂVJGKTCDKNKV[VQGFKVVJGECNGPFCTTGUGPFVJGKPXKVCVKQPVQ LQKPVJGECNGPFCTQTUVQRUJCTKPIVJGECNGPFCTYKVJVJGO 6WTPQĂPQVK°ECVKQPUHQTUJCTGFECNGPFCTU9JGPUQOGQPGOQFK°GUCUJCTGFECNGPFCT[QW¨TG PQVK°GFQHVJGEJCPIG6QVWTPQĂPQVK°ECVKQPUHQTUJCTGFECNGPFCTUIQVQ5GVVKPIU /CKN Contacts, Calendars > Shared Calendar Alerts. Share a read-only calendar with anyone. Tap Calendars, tap Edit, then tap the iCloud calendar you want to share. Turn on Public Calendar, then tap Share Link to copy or send the URL for your calendar. Anyone can use the URL to subscribe to the calendar using a compatible app. Calendar settings 6JGTGCTGUGXGTCNUGVVKPIUKP5GVVKPIU /CKN%QPVCEVU%CNGPFCTUVJCVCĂGEV%CNGPFCTCPF[QWT calendar accounts. These include: Syncing of past events (future events are always synced) Alert tone played for new meeting invitations Default calendar for new events Default time for alerts 6KOG\QPGUWRRQTVVQUJQYFCVGUCPFVKOGUWUKPICFKĂGTGPVVKOG\QPG Which day starts the week Display of Chinese, Hebrew, or Islamic dates Chapter 10 Calendar 74 Apple Confidential DRAFT 11 Photos View photos and videos Photos lets you view the photos and videos that you: Took on iPad Have in your iCloud Photo Library (Beta) (see iCloud Photo Library (Beta) on page 76) Received from others in shared albums (see iCloud Photo Sharing on page 77) Synced from your computer (see Sync with iTunes on page 17) Saved from an email, text message, webpage, or screenshot Tap to view full screen. View your photos and videos. Tap Photos. Photos automatically organizes your photos and videos by year, by collection, and by moment. To quickly browse the photos in a collection or year, touch and hold for a moment, then drag. By default, Photos displays a representative subset of your photos when you view by year QTD[EQNNGEVKQP6QUGGCNN[QWTRJQVQUIQVQ5GVVKPIU 2JQVQU%COGTCVJGPVWTPQĂ Summarize Photos. View by location. While viewing by year or by collection, tap . Photos and videos that include location information appear on a map, showing where they were taken. While viewing a photo or video, tap to show and hide the controls. Swipe left or right to go forward or backward. Search photos. From Albums or Photos, tap to search by date (month and year), or place (city and state). Search also keeps your Recent Searches on hand and gives you a list of suggested searches. 75 Apple Confidential DRAFT Zoom in or out. Double-tap, or pinch and spread a photo. When you zoom in, you can drag to see other parts of the photo. Play a video. Tap 6QVQIINGDGVYGGPHWNNUETGGPCPF°VVQUETGGPFQWDNGVCRVJGFKURNC[ Play a slideshow. While viewing a photo, tap , then tap Slideshow. Select options, then tap Start Slideshow. To stop the slideshow, tap the screen. To set other slideshow options, go to Settings > Photos & Camera. To stream a slideshow or video to a TV, see AirPlay on page 38. Organize photos and videos Mark your favorites. While viewing a photo, tap to automatically add it to the Favorites album. A photo can be part of another album as well as Favorites. Create a new album. Tap Albums, tap to add to the album, then tap Done. , enter a name, then tap Save. Select photos and videos Add items to an existing album. While viewing thumbnails, tap Select, select items, tap Add To, then select the album. Manage albums. While viewing your album list, tap Edit. Rename an album: Select the album, then enter a new name. Rearrange albums: Touch, then drag the album to another location. Delete an album: Tap . With iCloud Photo Library (Beta), you can manage all your albums from any iOS 8 device set up with iCloud Photo Library (Beta). Hide photos you want to keep but not show. Touch and hold a photo, then choose Hide. The photo is moved to the Hidden album. Touch and hold a hidden photo to Unhide it. Note: If you use iCloud Photo Library (Beta), albums are stored in iCloud and are accessible on any iOS 8 device using the same Apple ID. See iCloud Photo Library (Beta), below. iCloud Photo Library (Beta) iCloud Photo Library (Beta) gives you access to your photos and videos at iCloud.com and from any supported iOS 8 device set up with iCloud. You can make changes to photos and videos in the Photos app, preserve both the original and edited versions, and see the changes updated across your devices (see Edit photos and trim videos on page 79). Store as many photos and videos as your iCloud storage plan allows. Turn on iCloud Photo Library (Beta). Go to Settings > iCloud > Photos. Or go to Settings > Photos & Camera. Then tap Start Using Beta. Keep all your photos and videos in full-resolution on iPad. Your full-resolution originals are kept on iPad by default (Settings > iCloud > Photos > Download and Keep Originals). You can choose to optimize your iPad storage by keeping lighter-weight versions, perfect for viewing, on iPad. Download a full-resolution photo or video. Pinch to zoom in to 100%, or tap Edit. Note: To use iCloud Photo Library (Beta), iPad must be connected to Wi-Fi. On iPad cellular models, you can download up to 100 MB at a time, using a cellular connection. Chapter 11 Photos 76 Apple Confidential DRAFT If your uploaded photos and videos exceed your storage plan, you can upgrade your iCloud storage. Go to Settings > iCloud > Storage > Change Storage Plan to learn about the available options. My Photo Stream Photos you take are automatically added to My Photo Stream when you leave the Camera app and iPad is connected to Wi-Fi. All photos added to your Recently Added albumâincluding screenshots and photos saved from email, for exampleâappear in My Photo Stream. Photos added to My Photo Stream on your other devices appear in your Recently Added album on iPad. iOS devices can keep up to 1000 of your most recent photos in My Photo Stream; your computer can download all My Photo Stream photos, if you want to keep them permanently. View the recent photos you took with iPad on your other devices, automatically. My Photo Stream is turned on automatically if you use iCloud Photo Library (Beta). To turn My Photo 5VTGCOQĂQTQPIQVQ5GVVKPIU 2JQVQU%COGTC /[2JQVQ5VTGCOQT5GVVKPIU K%NQWF Photos > My Photo Stream. Note: Photos stored in iCloud count against your total iCloud storage, but photos uploaded to My Photo Stream donât count additionally against your iCloud storage. Manage My Photo Stream contents. In your My Photo Stream album, tap Select. Save your best shots on iPad: Select the photos, then tap Add To. Share, print, or copy: Select the photos, then tap Delete photos: Select the photos, then tap Note: Although deleted photos are removed from My Photo Stream on all your devices, the original photos remain in Photos on the device on which they were originally taken. Photos that you save to another album on a device or computer are also not deleted. See support.apple.com/kb/HT4486. iCloud Photo Sharing With iCloud Photo Sharing, you can create albums of photos and videos to share, and subscribe to other peopleâs shared albums. You can invite others using iCloud Photo Sharing (iOS 6 or later or OS X Mountain Lion or later) to view your albums, and they can leave comments if they wish. If theyâre using iOS 7 or OS X Mavericks or later, they can add their own photos and videos. You can also publish your album to a website for anyone to view. Chapter 11 Photos 77 Apple Confidential DRAFT Note: To use iCloud Photo Sharing, iPad must be connected to Wi-Fi. iCloud Photo Sharing works over both Wi-Fi and cellular networks. Cellular data charges may apply. See Usage information on page 154. Create new shared albums or add photos to existing ones. Turn on iCloud Photo Sharing. Go to Settings > iCloud > Photos. Or go to Settings > Photos & Camera. Share photos and videos. While viewing a photo or video, or when youâve selected multiple photos or videos, tap , tap iCloud Photo Sharing, add comments, then share to an existing shared album or select a new one. You can invite people to view your shared album using their email address or the mobile phone number they use for iMessage. Enable a public website. Select the shared album, tap People, then turn on Public Website. Tap Share Link if you want to announce the site. Add items to a shared album. View a shared album, tap add a comment, then tap Post. , select items, then tap Done. You can Delete photos from a shared album. Select the shared album, tap Select, select the photos or videos you want to delete, then tap . You must be the owner of the shared album, or the owner of the photo. Delete comments from a shared album. Select the photo or video that contains the comment. Touch and hold the comment, then tap Delete. You must be the owner of the shared album, or the owner of the comment. Rename a shared album. Tap Shared, tap Edit, then tap the name and enter a new one. #FFQTTGOQXGUWDUETKDGTUQTVWTP0QVK°ECVKQPUQPQTQĂSelect the shared album, then tap People. Subscribe to a shared album. When you receive an invitation, tap the Shared tab Accept. You can also accept an invitation in an email. , then tap Add items to a shared album you subscribed to. View the shared album, then tap items, then tap Done. You can add a comment, then tap Post. . Select See your Family album. When Family Sharing is set up, a shared album called âFamilyâ is automatically created in Photos on all family membersâ devices. Everyone in the family can EQPVTKDWVGRJQVQUXKFGQUCPFEQOOGPVUVQVJGCNDWOCPFDGPQVK°GFYJGPGXGTUQOGVJKPI new is added. For more information about setting up Family Sharing, see Family Sharing on page 35. Chapter 11 Photos 78 Apple Confidential DRAFT Other ways to share photos and videos You can share photos and videos in Mail or Messages, or through other apps you install. Share or copy a photo or video. View a photo or video, then tap screen to show the controls. . If you donât see , tap the Tap More in Sharing to turn on the apps you want to use for sharing. The size limit of attachments is determined by your service provider. iPad may compress photo and video attachments, if necessary. You can also copy a photo or video, then paste it into an email or text message (MMS or iMessage). Share or copy multiple photos and videos. While viewing by moment, tap Share. Save or share a photo or video you receive. Email: Tap to download it if necessary, then touch and hold the item to see sharing and other options. Text message: Tap the item in the conversation, then tap Photos and videos that you receive in messages or save from a webpage are saved to your Recently Added album in Photos. Edit photos and trim videos You can edit photos right on iPad. If your photos are stored in iCloud, your edits are updated across all your devices set up with iCloud, and both your original and edited versions are saved. If you delete a photo, itâs deleted from all your devices and iCloud. Photo app extensions can provide special editing options. See App extensions on page 23. Edit a photo. View the photo full screen, tap Edit, then tap one of the tools. To edit a photo not taken with iPad, tap the photo, tap Edit, then tap Duplicate and Edit. improves a photoâs exposure, contrast, saturation, and other qualities. Auto-enhance With the Remove Red-eye tool , tap each eye that needs correcting. Chapter 11 Photos 79 Apple Confidential DRAFT Tap , and Photos suggests an optimal crop, but you can drag the corners of the grid tool to set your own crop. Move the wheel to tilt or straighten the photo. Tap Auto to align the photo with the horizon, and tap Reset to undo alignment changes. Tap to rotate the photo 90 degrees. Tap to choose a standard crop ratio, such as 2:3 or Square. Rotate photo. Move the wheel to tilt or straighten. Choose a standard photo format. 2JQVQ°NVGTU NGV[QWCRRN[FKĂGTGPVEQNQTGĂGEVUUWEJCU/QPQQT%JTQOG 6CR#FLWUVOGPVU to set Light, Color, and B&W (black & white) options. Tap the down arrow, then tap PGZVVQ.KIJV%QNQTQT$9VQEJQQUGVJGGNGOGPV[QWYCPVVQCFLWUV/QXGVJG UNKFGTVQVJGFGUKTGFGĂGEV Compare with the original photo. Touch and hold the photo to view the original. Release to see your edits. Donât like the results? Tap Cancel, then tap Discard Changes. Tap Done to save changes. Revert to original. After you edit a photo and save your edits, you can revert to the original image. Tap the image, tap Edit, then tap Revert. Trim a video. Tap the screen to display the controls, drag either end of the frame viewer, then tap Trim. Important: If you choose Trim Original, the trimmed frames are permanently deleted from the original video. If you choose Save as New Clip, a new trimmed video clip is saved in your Videos CNDWOCPFVJGQTKIKPCNXKFGQKUWPCĂGEVGF Chapter 11 Photos 80 Apple Confidential DRAFT Print photos Print to an AirPrint-enabled printer: , then tap Print. Print a single photo: Tap Print multiple photos: While viewing a photo album, tap Select, select the photos, tap tap Print. , then See AirPrint on page 38. Import photos and videos You can import photos and videos directly from a digital camera, from another iOS device with a camera, or from an SD memory card. For iPad (4th generation or later) or iPad mini, use the Lightning to SD Card Camera Reader or the Lightning to USB Camera Adapter (both sold separately). For earlier iPad models, use the iPad Camera Connection Kit (sold separately), which includes both an SD card reader and a camera connector. Import photos: 1 Insert the SD card reader or camera connector into the iPad Lightning connector or 30-pin dock connector. Use an SD memory card: Insert the card in the slot on the SD card reader. Donât force the card KPVQVJGUNQVKV°VUQPN[QPGYC[ Connect a camera or iOS device: Use the USB cable that came with the camera or iOS device, and connect it to the USB port on the camera connector. If youâre using an iOS device, make sure itâs turned on and unlocked. To connect a camera, make sure the camera is turned on and in transfer mode. For more information, see the documentation that came with the camera. 2 Unlock iPad. 3 The Photos app opens and displays the photos and videos available for importing. 4 Select the photos and videos to import. Import all items: Tap Import All. Import just some items: Tap the items you want to import (a checkmark appears for each), tap Import, then tap Import Selected. 5 After the photos are imported, keep or delete the photos and videos on the card, camera, or iOS device. 6 Disconnect the SD card reader or camera connector. #PGYGXGPVKPVJG.CUV+ORQTVCNDWOEQPVCKPUCNNVJGRJQVQU[QWLWUVKORQTVGF To transfer the photos to your computer, connect iPad to your computer and import the images with a photo application such as iPhoto or Adobe Elements. Photos settings Settings for Photos are in Settings > Photos & Camera. These include: iCloud Photo Library (Beta), My Photo Stream, iCloud Photo Sharing, and Upload Burst Photos Photos Tab Slideshow Camera Grid HDR (High Dynamic Range) Chapter 11 Photos 81 Apple Confidential DRAFT 12 Camera Camera at a glance Quick! Get the camera! (TQOVJG.QEMUETGGPLWUVUYKRG edge of the screen to open Control Center, then tap . up. Or swipe up from the bottom Note: When you open Camera from the Lock screen, you can view and edit photos and videos you take while the device is locked by tapping the thumbnail at the lower-left corner of the UETGGP6QUJCTGRJQVQUCPFXKFGQU°TUVWPNQEMK2CF With iPad, you can take both still photos and videos using the front FaceTime camera or the back camera. 6ZLWFKEHWZHHQFDPHUDV 7XUQRQ+'5 7DNHDSKRWR View the photos and YLGHRV\RX¡YHWDNHQ 82 Apple Confidential DRAFT Take photos and videos %COGTCQĂGTUUGXGTCNOQFGUYJKEJNGV[QWUJQQVUVKNNUUSWCTGHQTOCVRJQVQUVKOGNCRUGXKFGQU and panoramas. Choose a mode. Drag up or down, or tap the camera mode labels to choose Time-Lapse, Video, Photo, Square, or Pano. Take a photo. Choose Photo, then tap the Take Picture button or press either volume button. Take Burst shots: (iPad Air (2nd generation or later)) Touch and hold the Take Picture button to VCMGTCRKF°TGRJQVQUKPDWTUVU CXCKNCDNGYJKNGKP5SWCTGQT2JQVQOQFG 6JGUJWVVGTUQWPF KUFKĂGTGPVCPFVJGEQWPVGTUJQYUJQYOCP[UJQVU[QW¨XGVCMGPWPVKN[QWNKHV[QWT°PIGT To see the suggested shots and select the photos you want to keep, tap the thumbnail, then tap Select. The gray dot(s) mark the suggested photos. To copy a photo from the burst as a separate photo in your Bursts album in Photos, tap the circle in the lower-right corner of the photo. To delete the burst of photos, tap it, then tap . #RRN[C°NVGTTap VQCRRN[FKĂGTGPVEQNQTGĂGEVUUWEJCU/QPQQT%JTQOG6QVWTPQĂC °NVGTVCR VJGPVCR0QPG;QWECPCNUQCRRN[C°NVGTNCVGTYJGP[QWGFKVVJGRJQVQ5GGEdit photos and trim videos on page 79. #TGEVCPINGDTKGÂą[CRRGCTUYJGTGVJGGZRQUWTGKUUGV9JGP[QWRJQVQITCRJRGQRNGHCEG detection (iPad 3rd generation or later) balances the exposure across up to 10 faces. A rectangle appears for each face detected. Exposure is automatic, but you can set the exposure manually for the next shot by tapping an QDLGEVQTCTGCQPVJGUETGGP9KVJCPK5KIJVECOGTCVCRRKPIVJGUETGGPUGVUVJGHQEWUCPFVJG GZRQUWTGCPFHCEGFGVGEVKQPKUVGORQTCTKN[VWTPGFQĂ6QNQEMVJGGZRQUWTGCPFHQEWUVQWEJ and hold until the rectangle pulses. Take as many photos as you want. When you tap the screen again, the automatic settings and face detection turn back on. Adjust the exposure. Touch and hold until you see WRQTFQYPVQCFLWUVVJGGZRQUWTG next to the exposure rectangle, then slide Take a panorama photo. (iSight camera) Choose Pano, tap the Take Picture button, then pan UNQYN[KPVJGFKTGEVKQPQHVJGCTTQY6QRCPKPVJGQVJGTFKTGEVKQP°TUVVCRVJGCTTQY6QRCP XGTVKECNN[°TUVTQVCVGK2CFVQNCPFUECRGQTKGPVCVKQP;QWECPTGXGTUGVJGFKTGEVKQPQHCXGTVKECNRCP too. Chapter 12 Camera 83 Apple Confidential DRAFT Capture an experience with time-lapse. Choose Time-Lapse, set up iPad where you want, then VCRVJG4GEQTF6KOG.CRUG8KFGQDWVVQPVQUVCTVECRVWTKPICUWPUGVCÂąQYGTQRGPKPIQTQVJGT experiences over a period of time. Tap the Record Time-Lapse Video button again to stop. The time-lapse photos are compiled into a short video that you can watch and share. Shoot some video. Choose Video, then tap the Record Video button or press either volume button to start and stop recording. Video records at 30 fps (frames per second). Take it slow. (iPad Air (2nd generation)) Choose Slo-Mo to shoot slow motion video at 120 fps. You can set which section to play back in slow motion when you edit the video. Set the slow-motion section of a video. Tap the thumbnail, then use the vertical bars beneath the frame viewer to set the section you want to play back in slow motion. Zoom in or out. (iSight camera) Pinch and spread the image on the screen. With iPad Air and iPad mini with Retina display, zooming works in video mode as well as photo mode. If Location Services is turned on, photos and videos are tagged with location data that can be used by apps and photo-sharing websites. See Privacy on page 39. Use the capture timer to put yourself in the shot. Avoid âcamera shakeâ or add yourself to a RKEVWTGD[WUKPIVJGECRVWTGVKOGT6QKPENWFG[QWTUGNH°TUVUVCDKNK\GK2CFCPFHTCOG[QWTUJQV Tap , tap 3s (seconds) or 10s, then tap the Take Picture button. Want to capture whatâs displayed on your screen? Simultaneously press and release the Sleep/ Wake and Home buttons. The screenshot is added to your Recently Added album in Photos. Make it better. You can edit photos and trim videos, right on iPad. See Edit photos and trim videos on page 79. HDR HDR (High Dynamic Range) helps you get great shots, even in high-contrast situations. The best RCTVUQHVJTGGSWKEMUJQVUVCMGPCVFKĂGTGPVGZRQUWTGU NQPIPQTOCNCPFUJQTV CTGDNGPFGF together into a single photo. Use HDR. K5KIJVECOGTCQPK2CFTFIGPGTCVKQPQTNCVGT 6CR*&46JGÂąCUJKUVGORQTCTKN[VWTPGF QĂ(QTDGUVTGUWNVUMGGRDQVJK2CFCPFVJGUWDLGEVUVKNN Keep the normal photo in addition to the HDR version. Go to Settings > Photos & Camera > Keep Normal Photo. Both the normal and HDR versions of the photo appear in Photos. HDR versions of photos in your Camera Roll are marked with âHDRâ in the corner. View, share, and print Photos and videos you take are saved in Photos. With iCloud Photo Library (Beta) turned on, all new photos and videos are automatically uploaded and available in Photos on all your iOS 8 devices set up with iCloud Photo Library (Beta). Anything shared with My Photo Stream appears in the Recently Added album in Photos. See iCloud Photo Library (Beta) and My Photo Stream on page 77. View your photos. Tap the thumbnail image, then swipe left or right to see the photos youâve taken recently. Tap All Photos to see everything in the Photos app. Tap the screen to show or hide the controls. Get sharing and printing options. Tap . See Share from apps on page 34. Chapter 12 Camera 84 Apple Confidential DRAFT Upload photos and videos to your computer. Use iCloud Photo Library (Beta) to upload photos and videos from your iPad to iCloud and access them on your iOS 8 devices signed in to iCloud Photo Library (Beta) using the same Apple ID. See iCloud Photo Sharing on page 77. Sync photos and videos to iPad from your Mac. Use the Photos settings pane in iTunes. See Sync with iTunes on page 17. Camera settings Go to Settings > Photos & Camera for camera options, which include: iCloud Photo Library (Beta), My Photo Stream, and iCloud Photo Sharing Slideshow Grid HDR #FLWUVVJGXQNWOGQHVJGUJWVVGTUQWPFYKVJVJG4KPIGTCPF#NGTVUUGVVKPIUKP5GVVKPIU 5QWPFU Or mute the sound using the Ring/Silent switch. (In some countries muting is disabled.) Chapter 12 Camera 85 Apple Confidential DRAFT 13 Contacts Contacts at a glance iPad lets you access and edit your contact lists from personal, business, and other accounts. Open in Messages. Open in FaceTime. Open in Maps. Set your My Info card for Safari, Siri, and other apps. Go to Settings > Mail, Contacts, Calendars, then tap My Info and select the contact card with your name and information. Let Siri know whoâs who. 9JKNGGFKVKPI[QWT/[+PHQECTFVCR#FF4GNCVGF0COGVQFG°PG relationships you want Siri to know about, so you can say things like âsend a message to my sister.â You can also add relationships using Siri. Say, for example, âJohn Appleseed is my brother.â Find a contact. 7UGVJGUGCTEJ°GNFCVVJGVQRQHVJGEQPVCEVUNKUV;QWECPCNUQUGCTEJ[QWT contacts using Spotlight Search (see Spotlight Search on page 31). Share a contact. Tap a contact, then tap Share Contact. See Share from apps on page 34. Change a label. +HC°GNFJCUVJGYTQPINCDGNUWEJCU*QOGKPUVGCFQH9QTMVCR'FKV6JGPVCR the label and choose one from the list, or tap Custom Field to create one of your own. #FF[QWTHTKGPFU¨UQEKCNRTQ°NGU9JKNGXKGYKPICEQPVCEVVCR'FKVVJGPVCRÂĽCFFUQEKCNRTQ°NGÂŚ You can add Twitter, Facebook, LinkedIn, Flickr, Myspace, and Sina Weibo accounts, or create a custom entry. Delete a contact. Go to the contactâs card, then tap Edit. Scroll down, then tap Delete Contact. Add contacts Besides entering contacts, you can: Use your iCloud contacts: Go to Settings > iCloud, then turn on Contacts. 86 Apple Confidential DRAFT Import your Facebook Friends: Go to Settings > Facebook, then turn on Contacts in the âAllow These Apps to Use Your Accountsâ list. This creates a Facebook group in Contacts. Use your Google contacts: Go to Settings > Mail, Contacts, Calendars, tap your Google account, then turn on Contacts. Access a Microsoft Exchange Global Address List: Go to Settings > Mail, Contacts, Calendars, tap your Exchange account, then turn on Contacts. Set up an LDAP or CardDAV account to access business or school directories: Go to Settings > Mail, Contacts, Calendars > Add Account > Other. Tap Add LDAP account or Add CardDAV account, then enter the account information. Sync contacts from your computer, Yahoo!, or Google: In iTunes on your computer, turn on contact syncing in the device info pane. For information, see iTunes Help. Import contacts from a vCard: Tap a .vcf attachment in an email or message. Search a directory. Tap Groups, tap the GAL, CardDAV, or LDAP directory you want to search, then enter your search. To save a personâs info to your contacts, tap Add Contact. Show or hide a group. Tap Groups, then select the groups you want to see. This button appears only if you have more than one source of contacts. Update your contacts using Twitter, Facebook, and Sina Weibo. Go to Settings > Twitter, Settings > Facebook, or Settings > Sina Weibo, then tap Update Contacts. This updates contact photos and social media account names in Contacts. Unify contacts When you have contacts from multiple sources, you might have multiple entries for the same person. To keep redundant contacts from appearing in your All Contacts list, contacts from FKĂGTGPVUQWTEGUVJCVJCXGVJGUCOGPCOGCTGNKPMGFCPFFKURNC[GFCUCUKPINGWPK°GFEQPVCEV. 9JGP[QWXKGYCWPK°GFEQPVCEVVJGVKVNG7PK°GF+PHQCRRGCTU Unify contacts. If two entries for the same person arenât linked automatically, you can unify them manually. Edit one of the contacts, then tap Link Contact and choose the other contact to link to. .KPMGFEQPVCEVUCTGP¨VOGTIGF+H[QWEJCPIGQTCFFKPHQTOCVKQPKPCWPK°GFEQPVCEVVJG changes are copied to each source account where that information already exists. +H[QWNKPMEQPVCEVUYKVJFKĂGTGPV°TUVQTNCUVPCOGUVJGPCOGUQPVJGKPFKXKFWCNECTFUYQP¨V EJCPIGDWVQPN[QPGPCOGCRRGCTUQPVJGWPK°GFECTF6QEJQQUGYJKEJPCOGCRRGCTUYJGP [QWXKGYVJGWPK°GFECTFVCR'FKVVCRVJGNKPMGFECTFYKVJVJGPCOG[QWRTGHGTVJGPVCR7UG 6JKU0COG(QT7PK°GF%CTF Contacts settings To change Contacts settings, go to Settings > Mail, Contacts, Calendars, where you can: Change how contacts are sorted &KURNC[EQPVCEVUD[°TUVQTNCUVPCOG Change how long names are shortened in lists Choose to show recent contacts in the multitasking screen Set a default account for new contacts Set your My Info card Chapter 13 Contacts 87 Apple Confidential DRAFT 14 Clock Clock at a glance 6JG°TUVENQEMFKURNC[UVJGVKOGDCUGFQP[QWTNQECVKQPYJGP[QWUGVWRK2CF#FFQVJGTENQEMU VQUJQYVJGVKOGKPQVJGTOCLQTEKVKGUCPFVKOG\QPGU Delete clocks or change their order. Add a clock. View clocks, set an alarm, time an event, or set a timer. 88 Apple Confidential DRAFT Alarms and timers Want iPad to wake you? Tap Alarm, then tap give the alarm a name (like âGood morningâ). . Set your wake-up time and other options, then View and change alarms. Add an alarm. Turn the alarm on/off. Selected alarm Additional alarm Keep track of time. Use the stopwatch to keep time, record lap times, or set a timer to alert you YJGPVKOG¨UWR+H[QW¨TGUQHVDQKNKPICPGIILWUVVGNN5KTKVQÂĽ5GVVJGVKOGTHQTOKPWVGUÂŚ Want to fall asleep to music or a podcast? Tap Timer, tap When Timer Ends, then choose Stop Playing at the bottom. Get quick access to clock features. Swipe up from the bottom edge of the screen to open Control Center, then tap . You can access Timer from Control Center even when iPad is locked. You can also navigate to the other clock features. Chapter 14 Clock 89 Apple Confidential DRAFT 15 Maps Find places WARNING: For important information about navigation and avoiding distractions that could lead to dangerous situations, see Important safety information on page 149. See also Privacy on page 39. Get directions. Enter a search. Quick driving directions Get more info. Tap a pin to display the info banner. Double-tap to zoom in; tap with two fingers to zoom out. Or pinch. Choose the view, drop a pin, or show traffic. Show your current location. /QXGCTQWPF/CRUD[FTCIIKPIVJGUETGGP6QHCEGCFKĂGTGPVFKTGEVKQPTQVCVGYKVJVYQ°PIGTU To return to north, tap the compass in the upper right. Zoom in or out. &QWDNGVCRYKVJQPG°PIGTVQ\QQOKPCPFVCRYKVJVYQ°PIGTUVQ\QQO outâor pinch and spread. The scale appears in the upper left while zooming, or if you touch the UETGGPYKVJVYQ°PIGTU6QEJCPIGJQYFKUVCPEGKUUJQYP OKNGUQTMKNQOGVGTU IQVQ5GVVKPIU Maps. Search for a location. 6CRVJGUGCTEJ°GNF;QWECPUGCTEJHQTCNQECVKQPKPFKĂGTGPVYC[U(QT example: Intersection (â8th and marketâ) Area (âgreenwich villageâ) 90 Apple Confidential DRAFT Landmark (âguggenheimâ) Zip code Business (âmovies,â ârestaurants san francisco ca,â âapple inc new yorkâ) Maps may also list recent locations, searches, or directions that you can choose from. Find the location of a contact, or of a favorite or recent search. Tap Favorites. Choose your view. Tap , then choose Standard, Hybrid, or Satellite. Manually mark a location. Touch and hold the map until the dropped pin appears. Get more info Get info about a location. Tap a pin to display its banner, then tap . Info might include Yelp reviews and photos, a webpage link, directions, and more. To share the location, add the location to your Favorites, or use another app you install, tap Get directions Note: To get directions, iPad must be connected to the Internet. To get directions involving your current location, Location Services must also be on. Get directions. Tap Directions, enter the starting and ending locations, then tap Route. Or, choose a location or a route from the list, if available. Tap to select driving or walking directions, or to use an app for public or other modes of transportation such as Uber. If a location banner is showing, directions to that location from your current location appear. To IGVQVJGTFKTGEVKQPUVCRVJGUGCTEJ°GNF If multiple routes appear, tap the one you want to take. Hear turn-by-turn directions (iPad Wi-Fi + Cellular): Tap Start. Maps follows your progress and speaks turn-by-turn directions to your destination. To show or hide the controls, tap the screen. If iPad auto-locks, Maps stays onscreen and continues to announce instructions. You can also open another app and continue to get turn-by-turn directions. To return to Maps, tap the banner across the top of the screen. 9KVJVWTPD[VWTPFKTGEVKQPUPKIJVOQFGCWVQOCVKECNN[CFLWUVUVJGUETGGPKOCIGHQTGCUKGT viewing at night. View turn-by-turn directions (iPad Wi-Fi only): Tap Start, then swipe left to see the next instruction. See the route overview: Tap Overview. View the directions as a list: Tap List Steps. Stop turn-by-turn directions: Tap End. Or ask Siri to âstop navigating.â on the banner of your destination. Tap to Get directions from your current location. Tap select driving or walking directions, or to use an app for public or other modes of transportation. Use Maps on your Mac to get directions. Open Maps on your Mac (OS X Mavericks or later), get directions for your trip, then choose File > Share > Send to your device. Your Mac and iPad must both be signed into iCloud using the same Apple ID. (KPFQWVCDQWVVTCĂEEQPFKVKQPUTap VJGPVCR5JQY6TCĂE1TCPIGFQVUUJQYUNQYFQYPU CPFTGFFQVUUJQYUVQRCPFIQVTCĂE6QUGGCPKPEKFGPVTGRQTVVCRCOCTMGT Chapter 15 Maps 91 Apple Confidential DRAFT Report a problem. Tap , then tap Report a Problem. 3D and Flyover With 3D and Flyover, on iPad 3rd generation or later, you can see three-dimensional views and GXGPÂą[QXGTOCP[QHVJGYQTNF¨UOCLQTEKVKGU View 3D map. Tap VJGPVCR5JQY&/CR1TFTCIVYQ°PIGTUWRMaps. Settings include: Navigation voice volume (iPad Wi-Fi + Cellular) Distances in miles or kilometers /CRNCDGNUCNYC[UCRRGCTKPVJGNCPIWCIGURGEK°GFKP5GVVKPIU )GPGTCN +PVGTPCVKQPCN Language Chapter 15 Maps 92 Apple Confidential DRAFT 16 Videos Videos at a glance Open the Videos app to watch movies, TV shows, and music videos. To watch video podcasts, open the Podcasts appâsee Podcasts at a glance on page 117. To watch videos you record using Camera on iPad, open the Photos app. $GGWR\RXUOLEUDU\ &KRRVHDFDWHJRU\ 7DSWRSOD\ 7KLVYLGHRKDVQ¡WEHHQ GRZQORDGHGWRL3DG WARNING: For important information about avoiding hearing loss, see Important safety information on page 149. Add videos to your library Buy or rent videos from the iTunes Store. Tap Store in the Videos app, or open the iTunes Store app on iPad, then tap Movies or TV Shows. The iTunes Store is not available in all areas. See Chapter 22, iTunes Store, on page 106. Transfer videos from your computer. Connect iPad, then sync videos from iTunes on your computer. See Sync with iTunes on page 17. 93 Apple Confidential DRAFT Stream videos from your computer to iPad. Turn on Home Sharing in iTunes on your computer. Then, on iPad, go to Settings > Videos and enter the Apple ID and password you use for Home Sharing on your computer. Then open Videos on iPad and tap Shared at the top of the list of videos. Convert a video to work with iPad. If you try to sync a video from iTunes and a message says the video canât play on iPad, try converting the video. Select the video in iTunes on your computer and choose File > Create New Version > Create iPad or Apple TV Version. Then sync the converted video to iPad. Delete a video from iPad. Tap Edit in the upper right of your collection, then tap on the video on your video thumbnailsâthose videos thumbnail. If you donât see the Edit button, look for havenât been downloaded to iPad, so you canât delete them. To delete an individual episode of a series, tap the series, then swipe left on the episode in the Episodes list. Deleting a video (other than a rented movie) from iPad doesnât delete it from the iTunes library on your computer or from your purchased videos in iCloud, and you can sync the video or download it to iPad again later. If you donât want to sync a deleted video back to iPad, set iTunes to not sync the video. See Sync with iTunes on page 17. Important: If you delete a rented movie from iPad, itâs deleted permanently and cannot be transferred back to your computer. Control playback Drag to adjust the volume. Drag to skip forward or back. Tap to show or hide the controls. Select audio language, subtitles, or closed captions. Watch on a TV with Apple TV. The Grand Budapest Hotel°PZH]HPSHISLVUP;\ULZ ;OL.YHUK)\KHWLZ[/V[LS°Â;.)/33*;^LU[PL[O*LU[\Y`-V_-PST *VYWVYH[PVUHUK;:.,U[LY[HPUTLU[-PUHUJL33*(SSYPNO[ZYLZLY]LK 5ECNGVJGXKFGQVQ°NNVJGUETGGPQT°VVQVJGUETGGPTap or . Or double-tap the video. If [QWFQP¨VUGGVJGUECNKPIEQPVTQNU[QWTXKFGQCNTGCF[°VUVJGUETGGPRGTHGEVN[ Start over from the beginning. If the video contains chapters, drag the playhead along the scrubber bar all the way to the left. If there are no chapters, tap . or . You can also press the center button or Skip to the next or previous chapter. Tap equivalent on a compatible headset two times (skip to next) or three times (skip to previous). or . Or drag the playhead left or right. Move your Rewind or fast-forward. Touch and hold °PIGTVQYCTFVJGDQVVQOQHVJGUETGGPCU[QWFTCIHQT°PGTEQPVTQN Chapter 16 Videos 94 Apple Confidential DRAFT 5GNGEVCFKĂGTGPVCWFKQNCPIWCIG+HVJGXKFGQQĂGTUQVJGTNCPIWCIGUVCR language from the Audio list. Show subtitles or closed captions. Tap , then choose a 0QVCNNXKFGQUQĂGTUWDVKVNGUQTENQUGFECRVKQPU Customize the appearance of closed captions. Go to Settings > General > Accessibility > Subtitles & Captioning. Want to see closed captions and subtitles for the deaf and hard of hearing? Go to Settings > General > Accessibility > Subtitles & Captioning, then turn on Closed Captions + SDH. Watch the video on a TV. Tap AirPlay on page 38. . For more about AirPlay and other ways to connect, see Videos settings Go to Settings > Videos, where you can: Choose where to resume playback the next time you open a video Choose to show only videos on iPad Log in to Home Sharing Chapter 16 Videos 95 Apple Confidential DRAFT 17 Notes Notes at a glance Type notes on iPad, and iCloud makes them available on your other iOS devices and Mac computers. You can also read and create notes in other accounts, such as Gmail or Yahoo!. Tap a note to view it. Delete the note. Print or share the note. Add a new note. Tap the text to edit it. See your notes on your other devices. If you use icloud.com, me.com, or mac.com for iCloud, go to Settings > iCloud, then turn on Notes. If you use Gmail or another IMAP account for iCloud, go to Settings > Mail, Contacts, Calendars, then turn on Notes for the account. Your notes appear on all your iOS devices and Mac computers that use the same Apple ID. See just the note. Use iPad in portrait orientation. To see the notes list again in portrait orientation, swipe from left to right. Search for a note. 6CRVJG5GCTEJ°GNFCVVJGVQRQHVJGPQVGUNKUVVJGPV[RGYJCV[QW¨TGNQQMKPI HQT;QWECPCNUQUGCTEJHQTPQVGUHTQOVJG*QOGUETGGP¤LWUVFTCIFQYPKPVJGOKFFNGQH the screen. Share or print a note. Tap or AirDrop. Delete a note. Tap at the bottom of the note. You can share via Messages, Mail, , or swipe left over the note in the notes list. Share notes in multiple accounts Share notes with other accounts. You can share notes with other accounts, such as Google, Yahoo!, or AOL. Go to Settings > Mail, Contacts, Calendars, add the account if itâs not already there, then turn on Notes for the account. 96 Apple Confidential DRAFT %TGCVGCPQVGKPCURGEK°ECEEQWPVTap Accounts and select the account, then tap FQP¨VUGGVJG#EEQWPVUDWVVQPVCRVJG0QVGUDWVVQP°TUV . If you Choose the default account for new notes. Go to Settings > Notes. See all the notes in an account. Tap Accounts at the top of the notes list, then choose the account. Chapter 17 Notes 97 Apple Confidential DRAFT 18 Reminders Reminders at a glance Reminders lets you keep track of all the things you need to do. Mark the reminder as completed. Scheduled items Add a reminder. Add a list. Add a reminder. Tap a list, then tap a blank line. Share a list. Tap a list, then tap Edit. Tap Sharing, then tap Add Person. The people you share with also need to be iCloud users. After they accept your invitation to share the list, youâll all be able to add, delete, and mark items as completed. Family members can also share a list. See Family Sharing on page 35. Delete a list. While viewing a list, tap Edit, then tap Delete List. Delete a reminder. Swipe the reminder left, then tap Delete. Change the order of lists or reminders. Tap Edit, then touch and move the item. What list was that in? 9JGP[QWGPVGTVGZVKPVJGUGCTEJ°GNFTGOKPFGTUKPCNNNKUVUCTGUGCTEJGF by the reminder name. You can also use Siri to search reminders. For example say, âFind the reminder about milk.â 9KVJ15:;QUGOKVG[QWECPJCPFQĂTGOKPFGTU[QW¨TGGFKVKPIDGVYGGP[QWT/CECPFK2CF5GG About Continuity features on page 24. 98 Apple Confidential DRAFT Scheduled reminders Scheduled reminders notify you when theyâre due. Scheduled reminder Schedule a reminder. While editing a reminder, tap , then turn on âRemind me on a day.â Tap Alarm to set the date and time. Tap Repeat to schedule the reminder for regularly occurring intervals. See all scheduled reminders. Tap Scheduled to show the list of reminders that have a due date. Donât bother me now. ;QWECPVWTPQĂ4GOKPFGTUPQVK°ECVKQPUKP5GVVKPIU 0QVK°ECVKQPU6Q UKNGPEGPQVK°ECVKQPUVGORQTCTKN[VWTPQP&Q0QV&KUVWTD Location reminders On iPad Wi-Fi + Cellular models, Reminders can alert you when you arrive at or leave a location. Find an address. Adjust the geofence. Be reminded when you arrive at or leave a location. While editing a reminder, tap , then turn on âRemind me at a location.â Tap Location, then choose a location from the list or enter CPCFFTGUU#HVGT[QWFG°PGCNQECVKQP[QWECPFTCIVQEJCPIGVJGUK\GQHVJGIGQHGPEGQPVJG map, which sets the approximate distance at which youâre reminded. You canât save a location reminder in Outlook or Microsoft Exchange calendars. Add common locations to your My Info card. When you set a location reminder, locations in the list include addresses from your My Info card in Contacts. Add your work, home, and other favorite addresses to your card for easy access in Reminders. Reminders settings Go to Settings > Reminders, where you can: Set a default list for new reminders Sync past reminders Chapter 18 Reminders 99 Apple Confidential DRAFT Keep your reminders up to date on other devices. Go to Settings > iCloud, then turn on Reminders. To keep up to date with Reminders on OS X, turn on iCloud on your Mac, too. Some other types of accounts, such as Exchange, also support Reminders. Go to Settings > Mail, Contacts, Calendars, then turn on Reminders for the accounts you want to use. Chapter 18 Reminders 100 Apple Confidential DRAFT 19 Photo Booth Take photos +V¨UGCU[VQVCMGCRJQVQYKVJ2JQVQ$QQVJCPFURKEGKVWRYKVJGĂGEVU Tap an option to change the effect. Tap the center image to return to Normal view. When you take a photo, iPad makes a shutter sound. You can use the volume buttons on the side of iPad to control the volume of the shutter sound, or mute it by setting the Side Switch to silent. See Volume buttons and the Side Switch on page 11. Note: +PUQOGTGIKQPUUQWPFGĂGEVUCTGRNC[GFGXGPKHVJG5KFG5YKVEJKUUGVVQUKNGPV Take a photo. Aim iPad and tap the shutter button. 5GNGEVCPGĂGEVTap VJGPVCRVJGGĂGEV[QWYCPV %JCPIGCFKUVQTVKQPGĂGEV&TCI[QWT°PIGTCETQUUVJGUETGGP Alter a distortion: Pinch, swipe, or rotate the image. What have you done? Tap the thumbnail of your last shot. To display the controls again, tap the screen. Switch between cameras. Tap at the bottom of the screen. 101 Apple Confidential DRAFT Manage photos The photos you take with Photo Booth are saved to your Recently Added album in the Photos app on iPad. Delete a photo. Select a thumbnail, then tap Share or copy a photo. Tap a thumbnail, tap Twitter, or Facebook) or Copy. , then tap a share option (Message, Mail, iCloud, View photos in the Photos app. In Photos, tap Photos, then tap Today, or tap Albums, then Recently Added, then tap a thumbnail. To see the next or previous photo, swipe left or right. See View photos and videos on page 75. Share photos on all iOS devices. If you use iCloud Photo Library (Beta), you can share your photos across all your iOS 8 devices using the same Apple ID. See iCloud Photo Library (Beta) on page 76. Upload photos to your computer. Connect iPad to your computer using the included USB cable. Mac: Select the photos to upload, then click the Import or Download button in iPhoto or other supported photo application on your computer. PC: Follow the instructions that came with your photo application. If you delete the photos from iPad when you upload them to your computer, theyâre removed from Photos. You can use the Photos settings pane in iTunes to sync photos to the Photos app on iPad. Chapter 19 Photo Booth 102 Apple Confidential DRAFT 20 Game Center Game Center at a glance Game Center lets you play your favorite games with friends who have an iOS device or a Mac (OS X Mountain Lion or later). You must be connected to the Internet to use Game Center. WARNING: (QTKORQTVCPVKPHQTOCVKQPCDQWVCXQKFKPITGRGVKVKXGOQVKQPKPLWTKGUUGGImportant safety information on page 149. 6HHZKR¡VWKHEHVW Find someone to play against. Play, share, or remove this game. Explore game goals. Is it your turn? Declare your status or change your photo. ,W¡VRQ Choose a game. Invite friends to play. Get started. Open Game Center. If you see your nickname at the top of the screen, youâre already signed in. Otherwise, youâll be asked for your Apple ID and password. Get some games. Tap Games, then tap a recommended game, browse for games in the App Store (look for Supports Game Center in the game details), or get a game one of your friends has. See Play games with friends on page 104. Play! Tap Games, choose a game, tap in the upper right, then tap Play. Sign out? No need to sign out when you quit Game Center, but if you want to, go to Settings > Game Center, then tap your Apple ID. 103 Apple Confidential DRAFT Play games with friends Invite friends to a multiplayer game. Tap Friends, choose a friend, choose a game, then tap in the upper right. If the game allows or requires additional players, choose the players to invite, then tap Next. Send your invitation, then wait for the others to accept. When everyone is ready, start the game. If a friend isnât available or doesnât respond, you can tap Auto-Match to have )COG%GPVGT°PFCPQVJGTRNC[GTHQT[QWQTVCR+PXKVG(TKGPFVQKPXKVGUQOGQPGGNUG Send a friend request. Tap Friends, tap , then enter your friendâs email address or Game Center nickname. To browse your contacts, tap . (To add several friends with one request, type Return after each address.) Or, tap any player you see anywhere in Game Center. Challenge someone to outdo you. Tap one of your scores or achievements, then tap Challenge Friends. What are your friends playing and how are they doing? Tap Friends, tap your friendâs name, then tap the Games or Points bubble. Want to purchase a game your friend has? Tap Friends, then tap your friendâs name. Tap their Games bubble, tap the game in the list, then tap in the upper right. Make new friends. To see a list of your friendâs friends, tap Friends, tap your friendâs name, then tap their Friends bubble. Unfriend a friend. Tap Friends, tap the friendâs name, then tap in the upper right. Keep your email address private. 6WTPQĂ2WDNKE2TQ°NGKP[QWT)COG%GPVGTCEEQWPVUGVVKPIU See Game Center settings on page 104. 6WTPQĂOWNVKRNC[GTCEVKXKV[QTHTKGPFTGSWGUVUGo to Settings > General > Restrictions, then VWTPQĂ/WNVKRNC[GT)COGUQT#FFKPI(TKGPFU+HVJGUYKVEJGUCTGFKOOGFVCR'PCDNG4GUVTKEVKQPU CVVJGVQR°TUV Keep it friendly. 6QTGRQTVQĂGPUKXGQTKPCRRTQRTKCVGDGJCXKQTVCR(TKGPFUVCRVJGRGTUQP¨UPCOG tap in the upper right, then tap Report a Problem. Game Center settings Go to Settings > Game Center, where you can: Sign out (tap your Apple ID) Allow invites .GVPGCTD[RNC[GTU°PF[QW 'FKV[QWT)COG%GPVGTRTQ°NG VCR[QWTPKEMPCOG Get friend recommendations from Contacts or Facebook 5RGEKH[YJKEJPQVK°ECVKQPU[QWYCPVHQT)COG%GPVGT)QVQ5GVVKPIU 0QVK°ECVKQPU )COG %GPVGT+H)COG%GPVGTFQGUP¨VCRRGCTVWTPQP0QVK°ECVKQPU Change restrictions for Game Center. Go to Settings > General > Restrictions. Chapter 20 Game Center 104 Apple Confidential DRAFT 21 Newsstand Newsstand organizes your magazine and newspaper apps, and automatically updates them when iPad is connected to Wi-Fi. Touch and hold a publication to rearrange. Find Newsstand apps. Note: You need an Internet connection and an Apple ID to download Newsstand apps, but you can read downloaded content without an Internet connection. Newsstand is not available in all areas. Find Newsstand apps. While viewing the shelf, tap Store. When you purchase a Newsstand app, itâs added to the shelf. After the app is downloaded, open it to view its issues and subscription options. Subscriptions are In-App purchases, billed to your Apple ID account. 6WTPQĂCWVQOCVKEWRFCVGU#RRUWRFCVGCWVQOCVKECNN[QXGT9K(KWPNGUU[QWVWTPQĂVJGQRVKQP in Settings > General > Background App Refresh. 105 Apple Confidential DRAFT 22 iTunes Store iTunes Store at a glance Use the iTunes Store to add music, movies, TV shows, and more to iPad. Browse Download purchases again. Change categories. Note: You need an Internet connection and an Apple ID to use the iTunes Store. The iTunes Store is not available in all areas. 106 Apple Confidential DRAFT Browse or search Browse by category or genre. Tap one of the categories (Music, Movies, TV, or Audiobooks). Tap Genres to see a list of genres to choose from. Tap a genre to see more about it. If you know what youâre looking for, tap Search. You can tap a search term thatâs trending COQPIQVJGTK6WPGUWUGTUQTGPVGTKPHQKPVJGUGCTEJ°GNFVJGPVCR5GCTEJQPVJGMG[DQCTF Access family membersâ purchases. With Family Sharing turned on, you can view and download songs, TV shows, and movies purchased by other family members. Tap Purchased, tap your name or My Purchases, then select a family member from the menu. Find it with Siri. Siri can search for items and make purchases in the iTunes Store. For example, you can say âGet a new ring toneâ or âPurchase song name by band name.â You can ask Siri to download a podcast or redeem a gift card. For best results, say âpurchaseâ instead of âbuyâ at the beginning of a Siri command. Ask Siri to tag it. When you hear music playing around you, ask Siri âWhat song is playing?â Siri tells you what the song is and gives you an easy way to purchase it. It also saves it to the Siri tab in the iTunes Store so you can buy it later. Tap Music, tap , then tap the Siri tab to see a list of tagged songs available for preview or purchase. Tap to see your Wish List and recommendations. Chapter 22 iTunes Store 107 Apple Confidential DRAFT Discover great new music on iTunes Radio. When you listen to iTunes Radio, songs you play appear in the Radio tab in the iTunes Store so you can preview or purchase them. Tap Music, tap , then tap Radio. Preview a song or video. Tap it. Add to your Wish List. When you hear something you hope to buy from the iTunes Store, tap , then tap Add to Wish List. To view your Wish List in the iTunes Store, tap Music, Movies, or TV Shows, tap , then tap Wish List. Purchase, rent, or redeem Tap an itemâs price (or tap Free), then tap again to buy it. If you see instead of a price, youâve already purchased the item and you can download it again without a charge. Approve purchases with Family Sharing. With Family Sharing set up, the family organizer can review and approve purchases made by family members under the age of 18. For example, if 2CTGPV)WCTFKCP #UMVQ$W[KUUGVHQTURGEK°EOKPQTHCOKN[OGODGTUYJGPVJQUGOGODGTUVT[ to make a purchase, a message is sent to the family organizer for approval. For more information about setting up Family Sharing, see Family Sharing on page 35. Note: Age restrictions for Ask to Buy vary by area. In the United States, the family organizer can enable Ask to Buy for any family member under age 18; for children under age 13, itâs enabled by default. Hide individual purchases. Using iTunes on a computer, family members can hide any of their purchases so other family members canât view or download them. For more information, see Family Sharing on page 35. Use a gift card or code. Tap a category (for example, Music), scroll to the bottom, then tap Redeem. Or tell Siri âRedeem an iTunes Store gift card.â Send a gift. View the item you want to give, tap , then tap Gift. Or tap one of the categories (Music, Movies, or TV Shows), scroll to the bottom, then tap Send Gift to send an iTunes gift EGTVK°ECVGVQUQOGQPG Bought something on another device? Go to Settings > iTunes & App Store to set up automatic downloads on your iPad. You can always view your purchased music, movies, and TV shows in VJGK6WPGU5VQTG LWUVVCR2WTEJCUGF Watch your time with rentals. In some areas, you can rent movies. You have 30 days to begin watching a rented movie. After you start watching it, you can play it as many times as you want in the allotted time (24 hours in the U.S. iTunes Store; 48 hours in other countries). Once your timeâs up, the movie is deleted. Rentals canât be transferred to another device; however, you can use AirPlay and Apple TV to view a rental on your television. iTunes Store settings To set options for the iTunes Store, go to Settings > iTunes & App Store. View or edit your account. Tap your Apple ID, then tap View Apple ID and log in. To change your RCUUYQTFVCRVJG#RRNG+&°GNFVJGPVCRVJG2CUUYQTF°GNF 5KIPKPYKVJCFKĂGTGPV#RRNG+&Tap your account name, then tap Sign Out. You can then enter CFKĂGTGPV#RRNG+& Chapter 22 iTunes Store 108 Apple Confidential DRAFT Subscribe to or turn on iTunes Match. You can subscribe to iTunes Match, a service that stores your music and more in iCloud. See iCloud and iTunes Match on page 67. If youâre a subscriber, tap iTunes Match to access your music on iPad from anywhere. Tap âLearn moreâ for more information about iTunes Match. Turn on automatic downloads. Tap Music, Books, or Updates. Content updates automatically QXGT9K(KWPNGUU[QWVWTPQĂVJGQRVKQPKP#WVQOCVKE&QYPNQCFU Chapter 22 iTunes Store 109 Apple Confidential DRAFT 23 App Store App Store at a glance 7UGVJG#RR5VQTGVQDTQYUGRWTEJCUGCPFFQYPNQCFCRRUURGEK°ECNN[FGUKIPGFHQTK2CFQT HQTK2JQPGCPFK2QFVQWEJ;QWTCRRUWRFCVGCWVQOCVKECNN[QXGT9K(K WPNGUU[QWVWTPQĂVJKU feature), so you can keep up with the latest improvements and features. See your Wish List and other suggestions for you. Download purchases again. Note: You need an Internet connection and an Apple ID to use the App Store. The App Store is not available in all areas. Find apps If you know what youâre looking for, tap Search. Or tap Categories to browse by type of app. #UM5KTKVQ°PFKVSiri can search for items and make purchases in the App Store. For example, tell Siri to âFind apps by Appleâ or âPurchase app name.â Access family membersâ apps. With Family Sharing turned on, you can view and download apps purchased by other family members. Tap Purchased, tap your name or My Purchases, then select a family member from the menu. For more information, see Family Sharing on page 35. Want to tell a friend about an app? Find the app, tap from apps on page 34. , then choose the method. See Share 110 Apple Confidential DRAFT Use Wish List. To track an app you might want to purchase later, tap tap Add to Wish List. See your Wish List. After you add items to your Wish List, tap on the app page, then on the Purchased screen. Search apps by category. Tap Explore, then tap Categories to focus on the apps you want, for GZCORNG'FWECVKQP/GFKECNQT5RQTVU6CRUWDECVGIQTKGUVQHWTVJGTTG°PG[QWTTGUWNVU What apps are being used nearby? 6CR'ZRNQTGVQ°PFQWVVJGOQUVRQRWNCTCRRUQVJGTUCTQWPF you are using (Location Services must be on in Settings > Privacy > Location Services). Try this at a museum, sporting event, or when youâre traveling, to dig deeper into your experience. Check out apps in your areas of interest. Tap to learn more, download, or purchase. Purchase, redeem, and download Tap the appâs price, then tap Buy to purchase it. If itâs free, tap Free, then tap Install. If you see instead of a price, youâve already purchased the app and you can download it again, free of charge. While the app is downloading or updating, its icon appears on the Home screen with a progress indicator. Approve purchases with Family Sharing. With Family Sharing set up, the family organizer can review and approve purchases made by other family members under the age of 18 (age limit OC[XCT[FGRGPFKPIQPEQWPVT[ (QTGZCORNGKH2CTGPV)WCTFKCP #UMVQ$W[KUUGVHQTURGEK°E minor family members, when those members try to make a purchase, a message is sent to the family organizer for approval. For more information about setting up Family Sharing, see Family Sharing on page 35. Chapter 23 App Store 111 Apple Confidential DRAFT Note: Age restrictions for Ask to Buy vary by area. In the United States, the family organizer can enable Ask to Buy for any family member under age 18; for children under age 13, itâs enabled by default. Find out more about the requested app. Hide individual purchases. Using iTunes on a computer, family members can hide any of their purchases so other family members canât view or download them. For more information, see Family Sharing on page 35. Use a gift card or code. Tap Featured, scroll to the bottom, then tap Redeem. Or tell Siri âRedeem an iTunes Store gift card.â Send a gift. View the item you want to give, tap , then tap Gift. Or tap Featured, scroll to the DQVVQOVJGPVCR5GPF)KHVVQUGPFCPK6WPGUIKHVEGTVK°ECVGVQUQOGQPG Restrict in-app purchases. Many apps provide extra content or enhancements for a fee. To limit purchases that can be made from within an app, go to Settings > General > Restrictions (make sure Restrictions is enabled), then set options (for example, restrict by age rating or require a RCUUYQTFKOOGFKCVGN[QTGXGT[OKPWVGU ;QWECPVWTPQĂ+P#RR2WTEJCUGUVQRTGXGPVCNN purchases. See Restrictions on page 39. Delete an app. 6QWEJCPFJQNFVJGCRRKEQPQPVJG*QOGUETGGPWPVKNVJGKEQPLKIINGUVJGPVCR 9JGP[QW°PKUJRTGUUVJG*QOGDWVVQP;QWECP¨VFGNGVGDWKNVKPCRRU&GNGVKPICPCRRCNUQ deletes its data. You can download any app youâve purchased from the App Store again, free of charge. For information about erasing all of your apps, data, and settings, see Reset iPad settings on page 153. App Store settings To set options for App Store, go to Settings > iTunes & App Store. View or edit your account. Tap your Apple ID, then tap View Apple ID and log in. To change your RCUUYQTFVCRVJG#RRNG+&°GNFVJGPVCRVJG2CUUYQTF°GNF 5KIPKPWUKPICFKĂGTGPV#RRNG+&Tap your account name, then tap Sign Out. Then enter the other Apple ID. 6WTPQĂCWVQOCVKEFQYPNQCFUTap Apps in Automatic Downloads. Apps update automatically QXGT9K(KWPNGUU[QWVWTPQĂVJGQRVKQP Download apps using the cellular network (Wi-Fi + Cellular models). Turn on Use Cellular Data. Downloading apps over the cellular network may incur carrier charges. See Cellular settings on page 156. Newsstand apps update only over Wi-Fi. Chapter 23 App Store 112 Apple Confidential DRAFT 24 iBooks Get books Get books from the iBooks Store. In iBooks, use the buttons at the bottom of the screen to access the iBooks Store. Tap Featured to browse the latest releases, or Top Charts to view the OQUVRQRWNCT6Q°PFCURGEK°EDQQMVCRVJG5GCTEJ°GNFVJCVCRRGCTUCHVGT[QWCEEGUUVJG iBooks Store. Read a book Contents, bookmarks, and notes Bookmark Search in book. Go to a page. Open a book. Tap the book you want to read. If you donât see it in on the bookshelf, swipe left or right to see other collections. Show the controls. Tap near the center of a page. Not all books have the same controls, but some of the things you can do include searching, viewing the table of contents, and sharing what youâre reading. Close a book. Tap Library, or pinch the page. Enlarge an image. Double-tap the image. In some books, touch and hold to display a magnifying glass you can use to view an image. 113 Apple Confidential DRAFT )QVQCURGEK°ERCIGUse the page navigation controls at the bottom of the screen. Or, tap and enter a page number, then tap the page number in the search results. )GVCFG°PKVKQP&QWDNGVCRCYQTFVJGPVCR&G°PGKPVJGOGPWVJCVCRRGCTU&G°PKVKQPUCTGP¨V available for all languages. Remember your place. Tap to add a bookmark, or tap again to remove it. You can have multiple bookmarksâto see them all, tap , then tap Bookmarks. You donât need to add a DQQMOCTMYJGP[QWENQUGVJGDQQMDGECWUGK$QQMUTGOGODGTUYJGTG[QWNGHVQĂ Remember the good parts. Some books let you add notes and highlights. To add a highlight, VQWEJCPFJQNFCYQTFVJGPOQXG[QWT°PIGTVQFTCYVJGJKIJNKIJV6QCFFCPQVGFQWDNGVCRC YQTFVQUGNGEVKVOQXGVJGITCDRQKPVUVQCFLWUVVJGUGNGEVKQPVJGPVCR0QVGQT*KIJNKIJVKPVJG , then tap Notes. menu that appears. To see all the notes and highlights youâve made, tap Share the good parts. Tap some highlighted text, then, in the menu that appears, tap . If the book is from the iBooks Store, a link to the book is included automatically. (Sharing may not be available in all regions.) Share a link to a book. Tap near the center of a page to display the controls, then tap then tap Share Book. . Tap Change the way a book looks. Some books let you change the font, font size, and color of the page. (Tap ;QWECPEJCPIGLWUVK°ECVKQPCPFJ[RJGPCVKQPKP5GVVKPIU K$QQMU6JGUGUGVVKPIU apply to all books that support them. Brightness Page color Turn off pagination. Change the brightness. Tap . If you donât see , tap °TUV Dim the screen when itâs dark. Turn on Auto-Night Theme to automatically change the bookshelf, page color, and brightness when using iBooks in low-light conditions. (Not all books support Auto-Night Theme.) Interact with multimedia Some books have interactive elements, such as movies, diagrams, presentations, galleries, and &QDLGEVU6QKPVGTCEVYKVJCOWNVKOGFKCQDLGEVVCRUYKRGQTRKPEJKV6QXKGYCPGNGOGPVHWNN UETGGPURTGCFVYQ°PIGTU9JGP[QW°PKUJRKPEJVQENQUGKV Study notes and glossary terms In books that support it, you can review all of your highlights and notes as study cards. Chapter 24 iBooks 114 Apple Confidential DRAFT See all your notes. Tap in that chapter. Delete notes. Tap . You can search your notes, or tap a chapter to see notes youâve made , select some notes, then tap Delete. Review your notes as study cards. Tap Study Cards. Swipe to move between cards. Tap Flip Card to see its back. 5JWĂG[QWTUVWF[ECTFUTap VJGPVWTPQP5JWĂG Study glossary terms. If a book includes a glossary, tap study cards. to include those words in your Organize books Change views. View collections. Sort the list. Download from iCloud. View on the iBooks Store View books by title or cover. Tap or Organize your books with collections. Tap Select, then select some books to move them into a collection. To edit or create collections, tap the name of the current collection (at the top of the screen). Some built-in collections, such as PDFs, canât be renamed or deleted. Rearrange books. While viewing books by cover, touch and hold a cover then drag it to a new location. While viewing books by title, sort the list using the buttons at the top of the screen. The All Books collection is automatically arranged for you; switch to another collection if you want to manually arrange your books. Search for a book. 2WNNFQYPVQTGXGCNVJG5GCTEJ°GNFCVVJGVQRQHVJGUETGGP5GCTEJKPINQQMU for the title and the authorâs name. Hide purchased books you havenât downloaded. Tap the name of the current collection (at the top of the screen), then turn on Hide iCloud Books. Read PDFs Sync a PDF. On a Mac, add the PDF to iBooks for OS X, then open iTunes, select the PDF, then sync. In iTunes on your Windows computer, choose File > Add to Library, select the PDF, then sync. See iTunes Help for more info about syncing. Chapter 24 iBooks 115 Apple Confidential DRAFT Add a PDF email attachment to iBooks. Open the email message, then touch and hold its PDF attachment. Choose âOpen in iBooksâ from the menu that appears. Print a PDF. With the PDF open, tap then choose Print. Youâll need an AirPrint-compatible printer. For more about AirPrint, see AirPrint on page 38. Email a PDF. With the PDF open, tap , then choose Email. iBooks settings Go to Settings > iBooks, where you can: Sync collections and bookmarks (including notes and current page information) with your other devices. Display online content within a book. Some books might access video or audio thatâs stored on the web. Change the direction pages turn when you tap in the left margin. Chapter 24 iBooks 116 Apple Confidential DRAFT 25 Podcasts Podcasts at a glance Open the Podcasts app, then browse, subscribe to, and play your favorite audio or video podcasts on iPad. Delete or rearrange podcasts. New episodes Tap a podcast to view and play episodes. Swipe down to update or search. See your subscriptions and downloaded podcasts. Organize and automatically update your favorites. Browse for podcasts. Get podcasts and episodes Discover more podcasts. Tap Featured or Top Charts at the bottom of the screen. Search for new podcasts. Tap Search at the bottom of the screen. Search your library. Tap My Podcasts, then swipe down in the center of the screen to reveal the 5GCTEJ°GNF 117 Apple Confidential DRAFT Preview or stream an episode. Tap the podcast, then tap an episode. View unplayed episodes. View available episodes. Subscribe or adjust subscription preferences. Download the episode. Select episodes to mark, delete, or save. Get more info. Tap open them in Safari. to get episode details. Tap any link in podcast or episode descriptions to Find new episodes. 6CR7PRNC[GFVQ°PFGRKUQFGU[QWJCXGP¨V[GVJGCTF Browse episodes. Tap Feed to see episodes available to download or stream. Download an episode to iPad. Tap next to the episode. Get new episodes as they are released. Subscribe to the podcast. If youâre browsing Featured podcasts or Top Charts, tap the podcast, then tap Subscribe. If youâve already downloaded episodes, tap My Podcasts, tap the podcast, tap Settings at the top of the episode list, then turn on Subscription. Save episodes. Tap a saved episode. next to an episode, then tap Save Episode. Tap Delete Download to delete Chapter 25 Podcasts 118 Apple Confidential DRAFT Control playback Tap to speed up or slow down. See a list of episodes. Tap to see more info. Drag to skip forward or back. Tap to start over, or double-tap to go to the previous episode. Skip to the next episode. See podcast info while you listen. Tap the podcast image on the Now Playing screen. Skip forward or back with greater accuracy. /QXG[QWT°PIGTVQYCTFVJGVQRQHVJGUETGGPCU you drag the playhead left or right. When youâre close to the playback controls, you can scan quickly through the entire episode. When youâre close to the top of the screen, you can scan one second at a time. Use your voice. 6GNN5KTKVQRNC[CXCKNCDNGRQFECUVGRKUQFGUQTURGEK°ERQFECUVUQTUVCVKQPU(QT example, say âPlay podcasts,â âPlay Freakonomics Radio.â Organize your favorites into stations Delete or rearrange stations or podcasts. Download the episode. Play the latest episode. Organize selected podcasts and episodes into stations. Organize your favorite podcasts into custom stations, and update episodes automatically across all your devices. Chapter 25 Podcasts 119 Apple Confidential DRAFT 2WNNVQIGVJGTGRKUQFGUHTQOFKĂGTGPVRQFECUVUAdd episodes to your On-The-Go station. Tap next to any episode in your library. You can My Stations, tap On-The-Go, then tap Add. Or tap also touch and hold any episode, then tap Add to On-The-Go. Create a station. Tap My Stations, then tap Change the order of the station list or the podcasts in a station. Tap My Stations, tap Edit above the station list or the episode list, then drag up or down. Change the playback order for episodes in a station. Tap the station, then tap Settings. Rearrange your podcast library. Tap My Podcasts, tap list view in the upper right, tap Edit, then drag up or down. .KUVQNFGUVGRKUQFGU°TUVTap My Podcasts, tap a podcast, then tap Settings. Play podcasts from the station list. Tap next to the station name. Podcasts settings Go to Settings > Podcasts, where you can: Choose to keep your podcast subscriptions up to date on all your devices. Choose how frequently Podcasts checks your subscriptions for new episodes. Have episodes downloaded automatically. %JQQUGYJGVJGTVQMGGRGRKUQFGUCHVGT[QW°PKUJVJGO Chapter 25 Podcasts 120 Apple Confidential A Accessibility Accessibility features K2CFQĂGTUOCP[CEEGUUKDKNKV[HGCVWTGU Vision % VoiceOver Support for braille displays Zoom Invert Colors and Grayscale Speak Selection Speak Screen Speak Auto-Text Large, bold, and high-contrast text Button Shapes Reduce screen motion 1PQĂUYKVEJNCDGNU Assignable tones Video Descriptions Hearing Hearing aids Mono audio and balance Subtitles and closed captions Interaction Siri Widescreen keyboards Guided Access Switch Control AssistiveTouch Turn on accessibility features. Go to Settings > General > Accessibility, or use the Accessibility Shortcut. See Accessibility Shortcut on page 122. With your voice, you can also use Siri to open apps, invert colors, read the screen in some apps, and work with VoiceOver. For information, see Use Siri on page 46. 7UGK6WPGUQP[QWTEQORWVGTVQEQP°IWTGCEEGUUKDKNKV[QPK2CFYou can choose some accessibility options in iTunes on your computer. Connect iPad to your computer, then select K2CFKPVJGK6WPGUFGXKEGNKUV%NKEM5WOOCT[VJGPENKEM%QP°IWTG#EEGUUKDKNKV[CVVJGDQVVQOQH the Summary screen. 121 Apple Confidential Appendix DRAFT DRAFT For more information about iPad accessibility features, go to www.apple.com/accessibility. Accessibility Shortcut Use the Accessibility Shortcut. Press the Home button quickly three times to turn any of these HGCVWTGUQPQTQĂ VoiceOver Invert Colors Grayscale Zoom Switch Control AssistiveTouch Guided Access (The shortcut starts Guided Access if itâs already turned on. See Guided Access on page 137.) Hearing Aid Control (if you have paired Made for iPhone hearing aids) Choose the features you want to control. Go to Settings > General > Accessibility > Accessibility Shortcut, then select the accessibility features you use. Not so fast. To slow down the triple-click speed, go to Settings > General > Accessibility > Homeclick Speed. (This also slows down double-clicks.) VoiceOver VoiceOver describes aloud what appears onscreen, so you can use iPad without seeing it. VoiceOver tells you about each item on the screen as you select it. The VoiceOver cursor (a rectangle) encloses the item and VoiceOver speaks its name or describes it. 6QWEJVJGUETGGPQTFTCI[QWT°PIGTQXGTKVVQJGCTVJGKVGOUQPVJGUETGGP9JGP[QWUGNGEV text, VoiceOver reads the text. If you turn on Speak Hints, VoiceOver may tell you the name of the item and provide instructionsâfor example, âdouble-tap to open.â To interact with items, such as buttons and links, use the gestures described in Learn VoiceOver gestures on page 125. 9JGP[QWIQVQCPGYUETGGP8QKEG1XGTRNC[UCUQWPFVJGPUGNGEVUCPFURGCMUVJG°TUVKVGO on the screen (typically in the upper-left corner). VoiceOver also lets you know when the display changes to landscape or portrait orientation, and when the screen becomes dimmed or locked. Note: 8QKEG1XGTURGCMUKPVJGNCPIWCIGURGEK°GFKP5GVVKPIU )GPGTCN .CPIWCIG4GIKQP VoiceOver is available in many languages, but not all. VoiceOver basics Important: VoiceOver changes the gestures you use to control iPad. When VoiceOver is on, you OWUVWUG8QKEG1XGTIGUVWTGU¤GXGPVQVWTP8QKEG1XGTQĂ 6WTP8QKEG1XGTQPQTQĂGo to Settings > General > Accessibility > VoiceOver, or use the Accessibility Shortcut. See Accessibility Shortcut on page 122. Explore. &TCI[QWT°PIGTQXGTVJGUETGGP8QKEG1XGTURGCMUGCEJKVGO[QWVQWEJ.KHV[QWT°PIGT to leave an item selected. Select an item: 6CRKVQTNKHV[QWT°PIGTYJKNGFTCIIKPIQXGTKV Appendix A Accessibility 122 Apple Confidential DRAFT Select the next or previous item: 5YKRGTKIJVQTNGHVYKVJQPG°PIGT+VGOQTFGTKUNGHVVQTKIJV top-to-bottom. Select the item above or below: Set the rotor to Vertical Navigation, then swipe up or down YKVJQPG°PIGT+H[QWFQP¨V°PF8GTVKECN0CXKICVKQPKPVJGTQVQT[QWECPCFFKVUGGUse the VoiceOver rotor on page 126. 5GNGEVVJG°TUVQTNCUVKVGOQPVJGUETGGP6CRYKVJHQWT°PIGTUCVVJGVQRQTDQVVQOQH the screen. Select an item by name: 6TKRNGVCRYKVJVYQ°PIGTUCP[YJGTGQPVJGUETGGPVQQRGPVJG+VGO %JQQUGT6JGPV[RGCPCOGKPVJGUGCTEJ°GNFQTUYKRGTKIJVQTNGHVVQOQXGVJTQWIJVJGNKUV alphabetically, or tap the table index to the right of the list and swipe up or down to move quickly through the list of items. Or use handwriting to select an item by writing its name; see 9TKVGYKVJ[QWT°PIGT on page 128. To dismiss the Item Chooser without making a selection, FQCVYQ°PIGTUETWD OQXGVYQ°PIGTUDCEMCPFHQTVJVJTGGVKOGUSWKEMN[OCMKPICÂĽ\ÂŚ %JCPIGCPKVGO¨UPCOGUQKV¨UGCUKGTVQ°PFSelect the item, then double-tap and hold with two °PIGTUCP[YJGTGQPVJGUETGGP Speak the text of the selected item: Set the rotor to characters or words, then swipe down or up YKVJQPG°PIGT 6WTPURQMGPJKPVUQPQTQĂGo to Settings > General > Accessibility > VoiceOver > Speak Hints. Use phonetic spelling: Go to Settings > General > Accessibility > VoiceOver > Phonetic Feedback. Speak the entire screen from the top: 5YKRGWRYKVJVYQ°PIGTU Speak from the current item to the bottom of the screen: 5YKRGFQYPYKVJVYQ°PIGTU Pause speaking: 6CRQPEGYKVJVYQ°PIGTU6CRCICKPYKVJVYQ°PIGTUVQTGUWOG5RGCMKPI resumes when you select another item. Mute VoiceOver: &QWDNGVCRYKVJVJTGG°PIGTU4GRGCVVQWPOWVG+H[QW¨TGWUKPICPGZVGTPCN keyboard, press the Control key. 5KNGPEGUQWPFGĂGEVU6WTPQĂ5GVVKPIU )GPGTCN #EEGUUKDKNKV[ 8QKEG1XGT 7UG 5QWPF'ĂGEVU Use a larger VoiceOver cursor. Turn on Settings > General > Accessibility > VoiceOver > Large Cursor. Adjust the speaking voice. ;QWECPCFLWUVVJG8QKEG1XGTURGCMKPIXQKEG Change the volume: Use the volume buttons on iPad. You can also add volume to the rotor, VJGPUYKRGWRCPFFQYPVQCFLWUVUGGUse the VoiceOver rotor on page 126. Change the speech rate: Go to Settings > General > Accessibility > VoiceOver, then drag the Speaking Rate slider. You can also set the rotor to Speech Rate, then swipe up or down VQCFLWUV Use pitch change: 8QKEG1XGTWUGUCJKIJGTRKVEJYJGPURGCMKPIVJG°TUVKVGOQHCITQWR UWEJ as a list or table) and a lower pitch when speaking the last item of a group. Go to Settings > General > Accessibility > VoiceOver > Use Pitch Change. Speak punctuation: Set the rotor to Punctuation, then swipe up or down to to select how much you want to hear. Control audio ducking: To choose whether audio thatâs playing is turned down while VoiceOver speaks, set the rotor to Audio Ducking, then swipe up or down. Change the language for iPad: Go to Settings > General > Language & Region. VoiceOver RTQPWPEKCVKQPQHUQOGNCPIWCIGUKUCĂGEVGFD[VJG4GIKQP(QTOCV[QWEJQQUGVJGTG Appendix A Accessibility 123 Apple Confidential DRAFT Change pronunciation: Set the rotor to Language, then swipe up or down. Language is available in the rotor only if you add a language at Settings > General > Accessibility > VoiceOver > Speech > Rotor Languages. Choose which dialects are available in the rotor: Go to Settings > General > Accessibility > 8QKEG1XGT 5RGGEJ 4QVQT.CPIWCIGU6QCFLWUVXQKEGSWCNKV[QTURGCMKPITCVGVCR next to the language. To remove languages from the rotor or change their order, tap Edit, tap the up or down, then tap Done. delete button or drag the Reorder button Set the default dialect for the current iPad language: Go to Settings > General > Accessibility > VoiceOver > Speech. Download an enhanced quality reading voice: Go to Settings > General > Accessibility > VoiceOver > Speech, tap a language, then tap Enhanced Quality. If youâre using English, you can choose to download Alex (869 MB), the same high-quality U.S. English voice used for VoiceOver on Mac computers. Use iPad with VoiceOver Unlock iPad. Press either the Home button or the Sleep/Wake button, swipe to select the Unlock button, then double-tap the screen. Enter your passcode silently. To avoid having your passcode spoken as you enter it, use handwriting to enter it; see 9TKVGYKVJ[QWT°PIGT on page 128. Open an app, toggle a switch, or tap an item. Select the item, then double-tap the screen. Double-tap the selected item. Triple-tap the screen. Adjust a slider. 5GNGEVVJGUNKFGTVJGPUYKRGWRQTFQYPYKVJQPG°PIGT Use a standard gesture. &QWDNGVCRCPFJQNF[QWT°PIGTQPVJGUETGGPWPVKN[QWJGCTVJTGG TKUKPIVQPGUVJGPOCMGVJGIGUVWTG9JGP[QWNKHV[QWT°PIGT8QKEG1XGTIGUVWTGUTGUWOG(QT GZCORNGVQFTCICXQNWOGUNKFGTYKVJ[QWT°PIGTKPUVGCFQHUYKRKPIWRCPFFQYPUGNGEVVJG slider, double-tap and hold, wait for the three tones, then slide left or right. Scroll a list or area of the screen. 5YKRGWRQTFQYPYKVJVJTGG°PIGTU Scroll continuously through a list: Double-tap and hold until you hear three rising tones, then drag up or down. Use the list index: Some lists have an alphabetical table index along the right side. Select the index, then swipe up or down to move through the index. You can also double-tap, hold, then UNKFG[QWT°PIGTWRQTFQYP Reorder a list: You can change the order of items in some lists, such as the Rotor items in Accessibility settings. Select to the right side of an item, double-tap and hold until you hear three rising tones, then drag up or down. 1RGP0QVK°ECVKQP%GPVGT5GNGEVCP[KVGOKPVJGUVCVWUDCTVJGPUYKRGFQYPYKVJVJTGG°PIGTU 6QFKUOKUUFQCVYQ°PIGTUETWD OQXGVYQ°PIGTUDCEMCPFHQTVJVJTGGVKOGUSWKEMN[OCMKPIC âzâ). Open Control Center. 5GNGEVCP[KVGOKPVJGUVCVWUDCTVJGPUYKRGWRYKVJVJTGG°PIGTU6Q FKUOKUU%QPVTQN%GPVGTFQCVYQ°PIGTUETWD Switch apps. &QWDNGENKEMVJG*QOGDWVVQPVQUGGQRGPCRRUUYKRGNGHVQTTKIJVYKVJQPG°PIGT to select an app, then double-tap to switch to it. Or, set the rotor to Actions while viewing open apps, then swipe up or down. Appendix A Accessibility 124 Apple Confidential DRAFT Rearrange your Home screen. Select an icon on the Home screen, double-tap and hold, then FTCI.KHV[QWT°PIGTYJGPVJGKEQPKUKPKVUPGYNQECVKQP&TCICPKEQPVQVJGGFIGQHVJGUETGGP to move it to another Home screen. You can continue to select and move items until you press the Home button. Speak iPad status information. Tap the status bar at the top of the screen, then swipe left or right to hear information about the time, battery state, Wi-Fi signal strength, and more. 5RGCMPQVK°ECVKQPUGo to Settings > General > Accessibility > VoiceOver, then turn on Always 5RGCM0QVK°ECVKQPU0QVK°ECVKQPUKPENWFKPIVJGVGZVQHKPEQOKPIVGZVOGUUCIGUCTGURQMGP CUVJG[QEEWTGXGPKHK2CFKUNQEMGF7PCEMPQYNGFIGFPQVK°ECVKQPUCTGTGRGCVGFYJGP[QW unlock iPad. 6WTPVJGUETGGPEWTVCKPQPQTQĂ6TKRNGVCRYKVJVJTGG°PIGTU9JGPVJGUETGGPEWTVCKPKUQPVJG UETGGPEQPVGPVUCTGCEVKXGGXGPVJQWIJVJGFKURNC[KUVWTPGFQĂ Learn VoiceOver gestures 9JGP8QKEG1XGTKUQPUVCPFCTFVQWEJUETGGPIGUVWTGUJCXGFKĂGTGPVGĂGEVUCPFCFFKVKQPCN gestures let you move around the screen and control individual items. VoiceOver gestures KPENWFGVYQVJTGGCPFHQWT°PIGTVCRUCPFUYKRGU(QTDGUVTGUWNVUWUKPIOWNVK°PIGTIGUVWTGU TGNCZCPFNGV[QWT°PIGTUVQWEJVJGUETGGPYKVJUQOGURCEGDGVYGGPVJGO ;QWECPWUGFKĂGTGPVVGEJPKSWGUVQGPVGTCRCTVKEWNCT8QKEG1XGTIGUVWTG(QTGZCORNG[QWECP RGTHQTOCVYQ°PIGTVCRWUKPIVYQ°PIGTUHTQOQPGJCPFQTQPG°PIGTHTQOGCEJJCPF;QW can even use your thumbs. Many use a split-tap gesture: instead of selecting an item and doubleVCRRKPIVQWEJCPFJQNFCPKVGOYKVJQPG°PIGTVJGPVCRVJGUETGGPYKVJCPQVJGT°PIGT 6T[FKĂGTGPVVGEJPKSWGUVQFKUEQXGTYJKEJYQTMUDGUVHQT[QW+HCIGUVWTGFQGUP¨VYQTMVT[C quicker movement, especially for a double-tap or swipe gesture. To swipe, try brushing the UETGGPSWKEMN[YKVJ[QWT°PIGTQT°PIGTU In VoiceOver settings, you can enter a special area where you can practice VoiceOver gestures YKVJQWVCĂGEVKPIK2CFQTKVUUGVVKPIU Practice VoiceOver gestures. Go to Settings > General > Accessibility > VoiceOver, then tap 8QKEG1XGT2TCEVKEG9JGP[QW°PKUJRTCEVKEKPIVCR&QPG+H[QWFQP¨VUGGVJG8QKEG1XGT2TCEVKEG button, make sure VoiceOver is turned on. Here are some key VoiceOver gestures: Navigate and read Tap: Select and speak the item. Swipe right or left: Select the next or previous item. Swipe up or down: Depends on the rotor setting. See Use the VoiceOver rotor on page 126. 6YQ°PIGTUYKRGWRRead all from the top of the screen. 6YQ°PIGTUYKRGFQYPRead all from the current position. 6YQ°PIGTVCRStop or resume speaking. 6YQ°PIGTUETWD/QXGVYQ°PIGTUDCEMCPFHQTVJVJTGGVKOGUSWKEMN[ OCMKPICÂĽ\ÂŚ VQFKUOKUU an alert or go back to the previous screen. 6JTGG°PIGTUYKRGWRQTFQYPScroll one page at a time. 6JTGG°PIGTUYKRGTKIJVQTNGHVGo to the next or previous page (on the Home screen, for example). Appendix A Accessibility 125 Apple Confidential DRAFT 6JTGG°PIGTVCRSpeak additional information, such as position within a list or whether text is selected. (QWT°PIGTVCRCVVQRQHUETGGP5GNGEVVJG°TUVKVGOQPVJGRCIG (QWT°PIGTVCRCVDQVVQOQHUETGGPSelect the last item on the page. Activate Double-tap: Activate the selected item. Triple-tap: Double-tap an item. Split-tap: As an alternative to selecting an item and double-tapping to activate it, touch and JQNFCPKVGOYKVJQPG°PIGTVJGPVCRVJGUETGGPYKVJCPQVJGT Double-tap and hold (1 second) + standard gesture: Use a standard gesture. The double-tap and hold gesture tells iPad to interpret the next gesture as standard. For example, you can doubleVCRCPFJQNFVJGPYKVJQWVNKHVKPI[QWT°PIGTFTCI[QWT°PIGTVQUNKFGCUYKVEJ 6YQ°PIGTFQWDNGVCRPlay or pause in Music, Videos, or Photos. Take a photo in Camera. Start or pause recording in Camera. Start or stop the stopwatch. 6YQ°PIGTFQWDNGVCRCPFJQNFRelabel the selected item. 6YQ°PIGTVTKRNGVCROpen the Item Chooser. 6JTGG°PIGTFQWDNGVCRMute or unmute VoiceOver. 6JTGG°PIGTVTKRNGVCR6WTPVJGUETGGPEWTVCKPQPQTQĂ Use the VoiceOver rotor Use the rotor to choose what happens when you swipe up or down with VoiceOver turned on, or to select special input methods such as Braille Screen Input or Handwriting. Operate the rotor. 4QVCVGVYQ°PIGTUQPVJGK2CFUETGGPCTQWPFCRQKPVDGVYGGPVJGO Choose your rotor options. Go to Settings > General > Accessibility > VoiceOver > Rotor, then select the options you want to include in the rotor. 6JGCXCKNCDNGTQVQTQRVKQPUCPFVJGKTGĂGEVUFGRGPFQPYJCV[QW¨TGFQKPI(QTGZCORNGKH[QW¨TG reading an email, you can use the rotor to switch between hearing text spoken word-by-word or character-by-character when you swipe up or down. If youâre browsing a webpage, you can set VJGTQVQTVQURGCMCNNVJGVGZV GKVJGTYQTFD[YQTFQTEJCTCEVGTD[EJCTCEVGT QTVQLWORHTQO one item to another of a certain type, such as headers or links. 9JGP[QWWUGCP#RRNG9KTGNGUU-G[DQCTFVQEQPVTQN8QKEG1XGTVJGTQVQTNGVU[QWCFLWUVUGVVKPIU such as volume, speech rate, use of pitch or phonetics, typing echo, and reading of punctuation. See Use VoiceOver with an Apple Wireless Keyboard on page 129. Use the onscreen keyboard 9JGP[QWCEVKXCVGCPGFKVCDNGVGZV°GNFVJGQPUETGGPMG[DQCTFCRRGCTU WPNGUU[QWJCXGCP Apple Wireless Keyboard attached). #EVKXCVGCVGZV°GNF5GNGEVVJGVGZV°GNFVJGPFQWDNGVCR6JGKPUGTVKQPRQKPVCPFVJGQPUETGGP keyboard appear. Enter text. Type characters using the onscreen keyboard: Appendix A Accessibility 126 Apple Confidential DRAFT Standard typing: Select a key on the keyboard by swiping left or right, then double-tap to GPVGTVJGEJCTCEVGT1TOQXG[QWT°PIGTCTQWPFVJGMG[DQCTFVQUGNGEVCMG[CPFYJKNG EQPVKPWKPIVQVQWEJVJGMG[YKVJQPG°PIGTVCRVJGUETGGPYKVJCPQVJGT°PIGT8QKEG1XGT speaks the key when itâs selected, and again when the character is entered. Touch typing: 6QWEJCMG[QPVJGMG[DQCTFVQUGNGEVKVVJGPNKHV[QWT°PIGTVQGPVGTVJG EJCTCEVGT+H[QWVQWEJVJGYTQPIMG[UNKFG[QWT°PIGTVQVJGMG[[QWYCPV8QKEG1XGT speaks the character for each key as you touch it, but doesnât enter a character until you lift [QWT°PIGT Direct Touch typing: 8QKEG1XGTKUFKUCDNGFHQTVJGMG[DQCTFQPN[UQ[QWECPV[RGLWUVCU[QWFQ YJGP8QKEG1XGTKUQĂ Choose typing style: Go to Settings > General > Accessibility > VoiceOver > Typing Style. Or, set the rotor to Typing Mode, then swipe up or down. Move the insertion point. Swipe up or down to move the insertion point forward or backward in the text. Use the rotor to choose whether you want to move the insertion point by character, by YQTFQTD[NKPG6QLWORVQVJGDGIKPPKPIQTGPFFQWDNGVCRVJGVGZV VoiceOver makes a sound when the insertion point moves, and speaks the character, word, or line that the insertion point moves across. When moving forward by words, the insertion point is placed at the end of each word, before the space or punctuation that follows. When moving backward, the insertion point is placed at the end of the preceding word, before the space or punctuation that follows it. Move the insertion point past the punctuation at the end of a word or sentence. Use the rotor to switch back to character mode. When moving the insertion point by line, VoiceOver speaks each line as you move across it. When moving forward, the insertion point is placed at the beginning of the next line (except when you reach the last line of a paragraph, when the insertion point is moved to the end of the NKPGLWUVURQMGP 9JGPOQXKPIDCEMYCTFVJGKPUGTVKQPRQKPVKURNCEGFCVVJGDGIKPPKPIQHVJG line thatâs spoken. Change typing feedback. Go to Settings > General > Accessibility > VoiceOver > Typing Feedback. Use phonetics in typing feedback. Go to Settings > General > Accessibility > VoiceOver > 2JQPGVKE(GGFDCEM6GZVKUTGCFEJCTCEVGTD[EJCTCEVGT8QKEG1XGT°TUVURGCMUVJGEJCTCEVGTVJGP its phonetic equivalentâfor example, âfâ and then âfoxtrot.â Delete a character. Use with any of the VoiceOver typing styles. VoiceOver speaks each character as itâs deleted. If Use Pitch Change is turned on, VoiceOver speaks deleted characters in a lower pitch. Select text. Set the rotor to Edit, swipe up or down to choose Select or Select All, then doubletap. If you chose Select, the word closest to the insertion point is selected when you doubleVCR6QKPETGCUGQTFGETGCUGVJGUGNGEVKQPFQCVYQ°PIGTUETWDVQFKUOKUUVJGRQRWROGPW then pinch. Cut, copy, or paste. Set the rotor to Edit, select the text, swipe up or down to choose Cut, Copy, or Paste, then double-tap. Undo. Shake iPad, swipe left or right to choose the action to undo, then double-tap. Enter an accented character. In standard typing style, select the plain character, then double-tap and hold until you hear a sound indicating alternate characters have appeared. Drag left or right VQUGNGEVCPFJGCTVJGEJQKEGU4GNGCUG[QWT°PIGTVQGPVGTVJGEWTTGPVUGNGEVKQP+PVQWEJV[RKPI style, touch and hold a character until the alternate characters appear. Appendix A Accessibility 127 Apple Confidential DRAFT Change the keyboard language. Set the rotor to Language, then swipe up or down. Choose ÂĽFGHCWNVNCPIWCIGÂŚVQWUGVJGNCPIWCIGURGEK°GFKP.CPIWCIG4GIKQPUGVVKPIU6JG.CPIWCIG rotor item appears only if you select more than one language in Settings > General > Accessibility > VoiceOver > Speech. 9TKVGYKVJ[QWT°PIGT *CPFYTKVKPIOQFGNGVU[QWGPVGTVGZVD[YTKVKPIEJCTCEVGTUQPVJGUETGGPYKVJ[QWT°PIGT+P addition to normal text entry, use handwriting mode to enter your iPad passcode silently or open apps from the Home screen. Enter handwriting mode. Use the rotor to select Handwriting. If Handwriting isnât in the rotor, go to Settings > General > Accessibility > VoiceOver > Rotor, then add it. Choose a character type. 5YKRGWRQTFQYPYKVJVJTGG°PIGTUVQEJQQUGNQYGTECUGPWODGTU uppercase, or punctuation. Hear the currently selected character type. 6CRYKVJVJTGG°PIGTU Enter a character. 6TCEGVJGEJCTCEVGTQPVJGUETGGPYKVJ[QWT°PIGT Enter a space. 5YKRGTKIJVYKVJVYQ°PIGTU Go to a new line. 5YKRGTKIJVYKVJVJTGG°PIGTU Delete the character before the insertion point. 5YKRGNGHVYKVJVYQ°PIGTU Select an item on the Home screen. Start writing the name of the item. If there are multiple OCVEJGUEQPVKPWGVQURGNNVJGPCOGWPVKNKVKUWPKSWGQTUYKRGWRQTFQYPYKVJVYQ°PIGTUVQ choose from the current matches. Enter your passcode silently. Set the rotor to Handwriting on the passcode screen, then write the characters of your passcode. Use a table index to skip through a long list. Select the table index to the right of the table (for example, next to your Contacts list or in the VoiceOver Item Chooser), then write the letter. Set the rotor to a web browsing element type. 9TKVGVJG°TUVNGVVGTQHCRCIGGNGOGPVV[RG(QT example, write âlâ to have up or down swipes skip to links, or âhâ to skip to headings. Exit handwriting mode. &QCVYQ°PIGTUETWDQTVWTPVJGTQVQTVQCFKĂGTGPVUGNGEVKQP Type onscreen braille 9KVJ$TCKNNG5ETGGP+PRWVGPCDNGF[QWECPWUG[QWT°PIGTUVQGPVGTFQVFQVQTEQPVTCEVGF DTCKNNGEQFGUFKTGEVN[QPVJGK2CFUETGGP6CREQFGUYKVJK2CFNC[KPIÂąCVKPHTQPVQH[QW VCDNGVQR OQFG QTJQNFK2CFYKVJVJGUETGGPHCEKPICYC[UQ[QWT°PIGTUEWTNDCEMVQVCRVJGUETGGP (screen away mode). Turn on Braille Screen Input. 7UGVJGTQVQTVQUGNGEV$TCKNNG5ETGGP+PRWV+H[QWFQP¨V°PFKVKPVJG rotor, go to Settings > General > Accessibility > VoiceOver > Rotor, then add it. Enter braille codes. 2NCEGK2CFÂąCVKPHTQPVQH[QWQTJQNFKVYKVJVJGUETGGPHCEKPICYC[VJGPVCR VJGUETGGPYKVJQPGQTUGXGTCN°PIGTUCVVJGUCOGVKOG Adjust entry dot positions. 6QOQXGVJGGPVT[FQVUVQOCVEJ[QWTPCVWTCN°PIGTRQUKVKQPU FQWDNGVCRUKZQTGKIJV°PIGTUCVVJGUCOGVKOG Switch between 6-dot, 8-dot, and contracted braille. 5YKRGVQVJGTKIJVYKVJVJTGG°PIGTU6QUGV the default, go to Settings > General > Accessibility > VoiceOver > Braille > Braille Screen Input. Enter a space. 5YKRGTKIJVYKVJQPG°PIGT +PUETGGPCYC[OQFGUYKRGVQyour right.) Delete the previous character. 5YKRGNGHVYKVJQPG°PIGT Appendix A Accessibility 128 Apple Confidential DRAFT Move to a new line (typing) or launch app (Home screen). 5YKRGTKIJVYKVJVYQ°PIGTU Cycle through spelling suggestions. 5YKRGWRQTFQYPYKVJQPG°PIGT Select an item on the Home screen. Start entering the name of the item. If there are multiple OCVEJGUEQPVKPWGVQURGNNVJGPCOGWPVKNKVKUWPKSWGQTUYKRGWRQTFQYPYKVJQPG°PIGTVQ select a partial match. Launch the selected app. 5YKRGTKIJVYKVJVYQ°PIGTU Translate immediately (when contractions are enabled). 5YKRGFQYPYKVJVYQ°PIGTU Stop entering braille. &QCVYQ°PIGTUETWDQTUGVVJGTQVQTVQCPQVJGTUGVVKPI Use VoiceOver with an Apple Wireless Keyboard You can control VoiceOver using an Apple Wireless Keyboard paired with iPad. See Bluetooth devices on page 39. Use VoiceOver keyboard commands to navigate the screen, select items, read screen contents, CFLWUVVJGTQVQTCPFRGTHQTOQVJGT8QKEG1XGTCEVKQPU/QUVEQOOCPFUWUGVJG%QPVTQN1RVKQP key combination, abbreviated in the list that follows as âVO.â You can use VoiceOver Help to learn the keyboard layout and the actions associated with various key combinations. VoiceOver Help speaks keys and keyboard commands as you type them, without performing the associated action. VoiceOver keyboard commands VO = Control-Option Turn on VoiceOver help: VOâK 6WTPQĂ8QKEG1XGTJGNREscape Select the next or previous item: VOâRight Arrow or VOâLeft Arrow Double-tap to activate the selected item: VOâSpace bar Press the Home button: VOâH Touch and hold the selected item: VOâShiftâM Move to the status bar: VOâM Read from the current position: VOâA Read from the top: VOâB Pause or resume reading: Control Copy the last spoken text to the clipboard: VOâShiftâC Search for text: VOâF Mute or unmute VoiceOver: VOâS 1RGP0QVK°ECVKQP%GPVGTFnâVOâUp Arrow Open Control Center: FnâVOâDown Arrow Open the Item Chooser: VOâI Change the label of the selected item: VOâ/ &QWDNGVCRYKVJVYQ°PIGTU VOââ-â Adjust the rotor: Use Quick Nav (see below) Swipe up or down: VOâUp Arrow or VOâDown Arrow Adjust the speech rotor: VOâCommandâLeft Arrow or VOâCommandâRight Arrow Appendix A Accessibility 129 Apple Confidential DRAFT #FLWUVVJGUGVVKPIURGEK°GFD[VJGURGGEJTQVQT VOâCommandâUp Arrow or VOâCommandâ Down Arrow 6WTPVJGUETGGPEWTVCKPQPQTQĂ VOâShiftâS Return to the previous screen: Escape Switch apps: CommandâTab or CommandâShiftâTab Quick Nav Turn on Quick Nav to control VoiceOver using the arrow keys. 6WTP3WKEM0CXQPQTQĂ Left ArrowâRight Arrow Select the next or previous item: Right Arrow or Left Arrow 5GNGEVVJGPGZVQTRTGXKQWUKVGOURGEK°GFD[VJGTQVQT Up Arrow or Down Arrow 5GNGEVVJG°TUVQTNCUVKVGO ControlâUp Arrow or ControlâDown Arrow Tap an item: Up ArrowâDown Arrow Scroll up, down, left, or right: OptionâUp Arrow, OptionâDown Arrow, OptionâLeft Arrow, or OptionâRight Arrow Adjust the rotor: Up ArrowâLeft Arrow or Up ArrowâRight Arrow Single-letter Quick Nav for the web When you view a webpage with Quick Nav enabled, you can use the following keys on the keyboard to navigate the page quickly. Typing the key moves to the next item of the indicated type. To move to the previous item, hold the Shift key as you type the letter. Heading: H Link: L 6GZV°GNF R Button: B Form control: C Image: I Table: T Static text: S ARIA landmark: W List: X Item of the same type: M Level 1 heading: 1 Level 2 heading: 2 Level 3 heading: 3 Level 4 heading: 4 Level 5 heading: 5 Level 6 heading: 6 Text editing 7UGVJGUGEQOOCPFU YKVJ3WKEM0CXVWTPGFQĂ VQYQTMYKVJVGZV8QKEG1XGTTGCFUVJGVGZVCU you move the insertion point. Go forward or back one character: Right Arrow or Left Arrow Go forward or back one word: OptionâRight Arrow or OptionâLeft Arrow Go up or down one line: Up Arrow or Down Arrow Appendix A Accessibility 130 Apple Confidential DRAFT Go to the beginning or end of the line: CommandâLeft Arrow or CommandâDown Arrow Go to the beginning or end of the paragraph: OptionâUp Arrow or OptionâDown Arrow Go to the previous or next paragraph: OptionâUp Arrow or OptionâDown Arrow )QVQVJGVQRQTDQVVQOQHVJGVGZV°GNFCommandâUp Arrow or CommandâDown Arrow Select text as you move: Shift + any of the insertion point movement commands above Select all text: CommandâA Copy, cut, or paste the selected text: CommandâC, CommandâX, or CommandâV Undo or redo last change: CommandâZ or ShiftâCommandâZ Support for braille displays You can use a Bluetooth braille display to read VoiceOver output, and you can use a braille display with input keys and other controls to control iPad when VoiceOver is turned on. For a list of supported braille displays, go to www.apple.com/accessibility/ios/braille-display.html. Connect a braille display. Turn on the display, then go to Settings > General > Bluetooth and turn on Bluetooth. Then go to Settings > General > Accessibility > VoiceOver > Braille and choose the display. Adjust Braille settings. Go to Settings > General > Accessibility > VoiceOver > Braille, where you can: Choose contracted, uncontracted eight-dot, or uncontracted six-dot braille input or output Turn on the status cell and choose its location Turn on Nemeth code for equations Display the onscreen keyboard Choose to have the page turned automatically when panning %JCPIGVJGDTCKNNGVTCPUNCVKQPHTQO7PK°GF'PINKUJ For information about common braille commands for VoiceOver navigation, and for information URGEK°EVQEGTVCKPFKURNC[UIQVQsupport.apple.com/kb/HT4400. Set the language for VoiceOver. Go to Settings > General > Language & Region. If you change the language for iPad, you may need to reset the language for VoiceOver and your braille display. You can set the leftmost or rightmost cell of your braille display to provide system status and other information: Announcement History contains an unread message The current Announcement History message hasnât been read VoiceOver speech is muted The iPad battery is low (less than 20% charge) iPad is in landscape orientation 6JGUETGGPFKURNC[KUVWTPGFQĂ The current line contains additional text to the left The current line contains additional text to the right Set the leftmost or rightmost cell to display status information. Go to Settings > General > Accessibility > VoiceOver > Braille > Status Cell, then tap Left or Right. Appendix A Accessibility 131 Apple Confidential DRAFT See an expanded description of the status cell. On your braille display, press the status cellâs router button. Read math equations VoiceOver can read aloud math equations encoded using: MathML on the web MathML or LaTeX in iBooks Author Hear an equation. Have VoiceOver read the text as usual. VoiceOver says âmathâ before it starts reading an equation. Explore the equation. Double tap the selected equation to display it full screen and move through it one element at a time. Swipe left or right to read elements of the equation. Use the rotor to select Symbols, Small Expressions, Medium Expressions, or Large Expressions, then swipe up or down to hear the next element of that size. You can continue to double-tap the selected element to âdrill downâ into the equation to focus on the selected element, then swipe left or right, up or down to read one part at a time. Equations read by VoiceOver can also be output to a braille device using Nemeth code, as well CUVJGEQFGUWUGFD[7PK°GF'PINKUJ$TCKNNG$TKVKUJ'PINKUJ(TGPEJCPF)TGGM5GGSupport for braille displays on page 131. Use VoiceOver with Safari Search the web. 5GNGEVVJGUGCTEJ°GNFGPVGT[QWTUGCTEJVJGPUYKRGTKIJVQTNGHVVQOQXGFQYP or up the list of suggested search phrases. Then double-tap the screen to search the web using the selected phrase. Skip to the next page element of a particular type. Set the rotor to the element type, then swipe up or down. Set the rotor options for web browsing. Go to Settings > General > Accessibility > VoiceOver > Rotor. Tap to select or deselect options, or drag up to reposition an item. Skip images while navigating. Go to Settings > General > Accessibility > VoiceOver > Navigate Images. You can choose to skip all images or only those without descriptions. Reduce page clutter for easier reading and navigation. Select the Reader item in the Safari CFFTGUU°GNF PQVCXCKNCDNGHQTCNNRCIGU If you pair an Apple Wireless Keyboard with iPad, you can use single-key Quick Nav commands to navigate webpages. See Use VoiceOver with an Apple Wireless Keyboard on page 129. Use VoiceOver with Maps With VoiceOver, you can zoom in or out, select a pin, or get information about a location. Explore the map. &TCI[QWT°PIGTCTQWPFVJGUETGGPQTUYKRGNGHVQTTKIJVVQOQXGVQ another item. Zoom in or out. 5GNGEVVJGOCRUGVVJGTQVQTVQ General > Accessibility > Zoom. Or use the Accessibility Shortcutâsee Accessibility Shortcut on page 122. Zoom in or out. 9KVJ Accessibility > Zoom > Maximum Zoom Level. Pan to see more. &TCIVJGUETGGPYKVJVJTGG°PIGTU1TJQNF[QWT°PIGTPGCTVJGGFIGQHVJG UETGGPVQRCPVQVJCVUKFG/QXG[QWT°PIGTENQUGTVQVJGGFIGVQRCPOQTGSWKEMN[1TKH[QW have detached the Zoom Controller, drag it. Switch between Full Screen Zoom and Window Zoom. 6TKRNGVCRYKVJVJTGG°PIGTUVJGPVCR Window Zoom or Full Screen Zoom in the zoom controls that appear. To choose the mode thatâs used when you turn on Zoom, go to Settings > General > Accessibility > Zoom > Zoom Region. Resize the zoom window (Window Zoom). 6TKRNGVCRYKVJVJTGG°PIGTUVCR4GUK\G.GPUVJGP drag any of the round handles that appear. Move the zoom window (Window Zoom). Drag the handle at the bottom of the zoom window. Show the zoom controller. Turn on Settings > General > Accessibility > Zoom > Show Controller. 1TVTKRNGVCRYKVJVJTGG°PIGTUVJGPEJQQUG5JQY%QPVTQNNGTKPVJG\QQOEQPVTQNUVJCVCRRGCT With the Zoom Controls button showing, you can double-tap it to zoom in or out, or single-tap it to display the zoom controls. To move the button, tap and hold it, then drag it to a new location. Have Zoom track your selections or the text insertion point. Go to Settings > General > Accessibility > Zoom > Follow Focus. Then, for example, if you use VoiceOver, turning on this option causes the zoom window to magnify each element on the screen as you select it using a swipe in VoiceOver. Appendix A Accessibility 133 Apple Confidential DRAFT Zoom in on your typing without magnifying the keyboard. Go to Settings > General > #EEGUUKDKNKV[ General > Accessibility > Invert Colors. See the screen in grayscale. Go to Settings > General > Accessibility > Grayscale. 6WTPQPDQVJGĂGEVUVQUGGKPXGTVGFITC[UECNG;QWECPCNUQCRRN[VJGUGGĂGEVUVQLWUVVJG contents of the zoom windowâsee Zoom on page 133. Speak Selection 'XGPYKVJ8QKEG1XGTVWTPGFQĂ[QWECPJCXGK2CFTGCFCNQWFCP[VGZV[QWUGNGEV Turn on Speak Selection. Go to Settings > General > Accessibility > Speak Selection. There you can also: #FLWUVVJGURGCMKPITCVG Choose to have individual words highlighted as theyâre read Have text read to you. Select the text, then tap Speak. You can also have iPad read the entire screen to youâsee Speak Screen on page 134. Speak Screen iPad can read the contents of the screen to you, even if you donât use VoiceOver. Turn on Speak Screen. Turn on Settings > General > Accessibility > Speech > Speak Screen. Have iPad speak the screen. 5YKRGFQYPHTQOVJGVQRQHVJGUETGGPYKVJVYQ°PIGTUQTCUM5KTK VQÂĽURGCMUETGGPÂŚ7UGVJGEQPVTQNUVJCVCRRGCTVQRCWUGURGCMKPIQTCFLWUVVJGTCVG Highlight whatâs being spoken. Turn on Highlight Content, below the Speak Screen switch when itâs turned on. ;QWECPCNUQJCXGK2CFTGCFLWUVVGZV[QWUGNGEV¤UGGSpeak Selection, above. Speak Auto-Text Speak Auto-text speaks the text corrections and suggestions iPad makes when you type. 6WTP5RGCM#WVQVGZVQPQTQĂGo to Settings > General > Accessibility > Speak Auto-text. Speak Auto-text also works with VoiceOver and Zoom. Appendix A Accessibility 134 Apple Confidential DRAFT Large, bold, and high-contrast text Display larger text in apps such as Settings, Calendar, Contacts, Mail, Messages, and Notes. )QVQ5GVVKPIU )GPGTCN 6GZV5K\GVJGPCFLWUVVJGUNKFGT(QTGXGPNCTIGTVGZVIQVQ5GVVKPIU General > Accessibility > Larger Text, then turn on Larger Accessibility Sizes. Display bolder text for items on iPad. Go to Settings > General > Accessibility, then turn on Bold Text. Increase the contrast of text where possible. Go to Settings > General > Accessibility, then turn on Increase Contrast. Button Shapes iPad can add a colored background shape or an underline to buttons so theyâre easier to see. Emphasize buttons. Go to Settings > General > Accessibility > Button Shapes. Reduce screen motion ;QWECPUVQRVJGOQXGOGPVQHUQOGUETGGPGNGOGPVUHQTGZCORNGVJGRCTCNNCZGĂGEVQHKEQPU and alerts against the wallpaper, or motion transitions. Reduce motion. Go to Settings > General > Accessibility, then turn on Reduce Motion. 1PQĂUYKVEJNCDGNU 6QOCMGKVGCUKGTVQUGGYJGVJGTCUGVVKPIKUQPQTQĂ[QWECPJCXGK2CFUJQYCPCFFKVKQPCNNCDGN QPQPQĂUYKVEJGU Add switch-setting labels. )QVQ5GVVKPIU )GPGTCN #EEGUUKDKNKV[VJGPVWTPQP1P1Ă.CDGNU Assignable tones You can assign distinctive ringtones to people in your contacts list for audible FaceTime caller ID. You can also assign distinct tones to alert you of a variety of other events, including new voicemail, new mail, sent mail, Tweet, Facebook Post, and reminders. See Sounds and silence on page 34. You can purchase ringtones from the iTunes Store on iPad. See Chapter 22, iTunes Store, on page 106. Video Descriptions Video descriptions provide an audible description of video scenes. If you have a video that includes video descriptions, iPad can play them for you. Turn on Video Descriptions. Go to Settings > General > Accessibility > Video Descriptions. Hearing aids If you have Made for iPhone hearing aids (compatible with iPad 4th generation or later and K2CFOKPK [QWECPWUGK2CFVQCFLWUVVJGKTUGVVKPIUUVTGCOCWFKQQTWUGK2CFCUCTGOQVGOKE Appendix A Accessibility 135 Apple Confidential DRAFT Pair with iPad. If your hearing aids arenât listed in Settings > General > Accessibility > Hearing Aids, you need to pair them with iPad. To start, open the battery door on each hearing aid. Next, on iPad, go to Settings > Bluetooth and make sure Bluetooth is turned on. Then go to Settings > General > Accessibility > Hearing Aids. Close the battery doors on your hearing aids and wait until their name appears in the list of devices (this could take a minute). When the name appears, tap it and respond to the pairing request. 9JGPRCKTKPIKU°PKUJGF[QWJGCTCUGTKGUQHDGGRUCPFCVQPGCPFCEJGEMOCTMCRRGCTUPGZVVQ the hearing aids in the Devices list. Pairing can take as long as 60 secondsâdonât try to stream CWFKQQTQVJGTYKUGWUGVJGJGCTKPICKFUWPVKNRCKTKPIKU°PKUJGF You should only need to pair once (and your audiologist might do it for you). After that, each time you turn your hearing aids back on, they reconnect to iPad. Adjust hearing aid settings and view status. Go to Settings > General > Accessibility > Hearing Aids, or choose Hearing Aids from the Accessibility Shortcut. See Accessibility Shortcut on page 122. Hearing aid settings appear only after you pair your hearing aids with iPad. For shortcut access from the Lock screen, go to Settings > General > Accessibility > Hearing Aids > Control on Lock Screen. Use the settings to: Check hearing aid battery status. #FLWUVCODKGPVOKETQRJQPGXQNWOGCPFGSWCNK\CVKQP Choose which hearing aids (left, right, or both) receive streaming audio. Control Live Listen. Stream audio to your hearing aids. Stream audio from Siri, Music, Videos, and more, by choosing your hearing aids from the AirPlay menu . Use iPad as a remote microphone. You can use Live Listen to stream sound from the microphone in iPad to your hearing aids. This can help you hear better in some situations by positioning iPad nearer the sound source. Triple-click the Home button, choose Hearing Aids, then tap Start Live Listen. Use your hearing aids with more than one iOS device. If you pair your hearing aid with more than one iOS device (both an iPhone and iPad, for example), the connection for your hearing aids automatically switches from one to the other when you do something that generates audio on the other device, or when you receive a phone call on iPhone. Changes you make to hearing aid settings on one device are automatically sent to your other iOS devices. To take advantage of this, all of the devices must be on the same Wi-Fi network and signed into iCloud using the same Apple ID. Mono audio and balance Mono Audio combines the sound from the left and right channels into a mono signal played on both channels. This way you can hear everything with either ear, or through both ears with one channel set louder. 6WTP/QPQ#WFKQQPQTQĂGo to Settings > General > Accessibility > Mono Audio. Adjust the balance. Go to Settings > General > Accessibility, then drag the Left Right Stereo Balance slider. Appendix A Accessibility 136 Apple Confidential DRAFT Subtitles and closed captions The Videos app includes an Alternate Track button you can tap to choose subtitles and ECRVKQPUQĂGTGFD[VJGXKFGQ[QW¨TGYCVEJKPI5VCPFCTFUWDVKVNGUCPFECRVKQPUCTGWUWCNN[NKUVGF but if you prefer special accessible captions, such as subtitles for the deaf and hard of hearing (SDH), you can set iPad to list them instead if theyâre available. Prefer accessible subtitles and closed captions for the hard of hearing in the list of available subtitles and captions. Turn on Settings > General > Accessibility > Subtitles & Captioning > Closed Captions + SDH. This also turns on subtitles and captions in the Videos app. Choose from available subtitles and captions. In Videos, tap while watching a video. Customize your subtitles and captions. Go to Settings > General > Accessibility > Subtitles & Captioning > Style, where you can choose an existing caption style or create a new style based on your choice of: Font, size, and color Background color and opacity Text opacity, edge style, and highlight Not all video content includes closed captions. Siri 9KVJ5KTK[QWECPFQVJKPIUUWEJCUQRGPKPICRRULWUVD[CUMKPICPF8QKEG1XGTECPTGCF5KTK responses to you. For information, see Use Siri on page 46. Widescreen keyboards All built-in iPad apps show a larger onscreen keyboard when you rotate iPad to landscape view. You can also type using an Apple Wireless Keyboard. Guided Access Guided Access helps someone using iPad to stay focused on a task. Guided Access limits iPad to a single app, and lets you control which app features are available. Use Guided Access to: Temporarily restrict iPad to a particular app Disable areas of the screen that arenât relevant to a task, or areas where an accidental gesture might cause a distraction Limit how long someone can use an app Disable the iPad hardware buttons Use Guided Access. Go to Settings > General > Accessibility > Guided Access, where you can: 6WTP)WKFGF#EEGUUQPQTQĂ Tap Passcode Settings to set a passcode that controls the use of Guided Access (preventing someone from leaving a session), and turn on Touch ID (as a way to end Guided Access) Tap Time Limits to set a sound or have the remaining Guided Access time spoken before time ends Set whether other accessibility shortcuts are available during a session Start a Guided Access session. After turning on Guided Access, open the app, then triple-click VJG*QOGDWVVQP#FLWUVUGVVKPIUHQTVJGUGUUKQPVJGPENKEM5VCTV Appendix A Accessibility 137 Apple Confidential DRAFT Disable app controls and areas of the app screen: Draw a circle or rectangle around any part QHVJGUETGGP[QWYCPVVQFKUCDNG&TCIVJGOCUMKPVQRQUKVKQPQTWUGVJGJCPFNGUVQCFLWUV itâs size. Enable the Sleep/Wake button and Volume buttons: Tap Options below Hardware Buttons. Keep iPad from switching from portrait to landscape or from responding to other motions: Tap 1RVKQPUCPFVWTPQĂ/QVKQP Prevent typing: 6CR1RVKQPUCPFVWTPQĂ-G[DQCTFU Ignore all screen touches: 6WTPQĂ6QWEJCVVJGDQVVQOQHVJGUETGGP Set a session time limit: Tap Time Limit Options at the bottom of the screen. End the session. Triple-click the Home button, then enter the Guided Access passcode, or use Touch ID (if enabled). Switch Control Switch Control lets you control iPad using a single switch or multiple switches. Use any of several methods to perform actions such as selecting, tapping, dragging, typing, and even free-hand drawing. The basic technique is to use a switch to select an item or location on the screen, and VJGPWUGVJGUCOG QTFKĂGTGPV UYKVEJVQEJQQUGCPCEVKQPVQRGTHQTOQPVJCVKVGOQTNQECVKQP Three basic methods are: Item scanning (default),YJKEJJKIJNKIJVUFKĂGTGPVKVGOUQPVJGUETGGPWPVKN[QWUGNGEVQPG Point scanning, which lets you use scanning crosshairs to pick a screen location. Manual selection, which lets you move from item to item on demand (requires multiple switches). Whichever method you use, when you select an individual item (rather than a group), a menu appears so you can choose how to act on the selected item (tap, drag, or pinch, for example). +H[QWWUGOWNVKRNGUYKVEJGU[QWECPUGVWRGCEJUYKVEJVQRGTHQTOCURGEK°ECEVKQPCPF customize your item selection method. For example, instead of automatically scanning screen items, you can set up switches to move to the next or previous item on demand. ;QWECPCFLWUVVJGDGJCXKQTQH5YKVEJ%QPVTQNKPCXCTKGV[QHYC[UVQUWKV[QWTURGEK°EPGGFU and style. Add a switch and turn on Switch Control You can use any of these as a switch: An external adaptive switch. Choose from a variety of popular USB or Bluetooth switches. The iPad screen. Tap the screen to trigger the switch. The iPad FaceTime camera. Move your head to trigger the switch. You can use the camera as two switches; one when you move your head to the left, and the other when you move your head to the right. Add a switch and choose its action. Go to Settings > General > Accessibility > Switch Control > Switches. If you use only one switch, it is your Select Item switch by default. If youâre adding an external switch, you need to connect it to iPad before it will appear in the list of available switches. Follow the instructions that came with the switch. If it connects using Bluetooth, you need to pair it with iPadâturn on the switch, go to Settings > Bluetooth, tap the switch, then follow the onscreen instructions. For more information, see Bluetooth devices on page 39. Appendix A Accessibility 138 Apple Confidential DRAFT Turn on Switch Control. Go to Settings > General > Accessibility > Switch Control, or use the Accessibility Shortcutâsee Accessibility Shortcut on page 122. 6WTPQĂ5YKVEJ%QPVTQNUse any scanning method to select and tap Settings > General > Accessibility > Switch Control. Or, triple-click the Home button. Basic techniques Whether you use item scanning or point scanning, the Switch Control basics are the same. Select an item. Trigger your Select Item switch when the item is highlighted (item scanning) or under the crosshairs (point scanning). Perform an action on the selected item. Choose a command from the control menu that appears when you select the item. The layout of the menu depends on whether you use Auto Tap. 9KVJ#WVQ6CRQĂ The control menu includes only the Tap button and the More button (two dots at the bottom). If youâre in a scrollable area of the screen, a Scroll button also appears. To tap the highlighted item, trigger your Select Item button when Tap is highlighted. To see additional action buttons, choose More at the bottom of the menu. If you have multiple UYKVEJGU[QWECPUGVQPGWRURGEK°ECNN[HQTVCRRKPI With Auto Tap on: To tap the item, do nothingâthe item is automatically tapped when the Auto Tap interval expires (0.75 seconds if you havenât changed it). To see the control menu, trigger your Select Item button before the Auto Tap interval expires. The control menu skips the Tap button and goes right to the full set of action buttons. Turn on Auto Tap. Go to Settings > General > Accessibility > Switch Control > Auto Tap. To tap an KVGOYKVJ#WVQ6CRQPLWUVYCKVHQTVJG#WVQ6CRKPVGTXCNVQRCUU Dismiss the control menu without choosing an action. Tap while the original item is highlighted and all the icons in the control menu are dimmed. Or, choose Escape from the control menu. The menu goes away after cycling the number of times you specify at Settings > General > Accessibility > Switch Control > Loops. Perform screen gestures. Choose Gestures from the control menu. Scroll the screen. Select an item in a scrollable part of the screen, then: 9KVJ#WVQ6CRQĂ Select the Scroll Down button (next to the Tap button) in the control menu. Or, for more scrolling options, select More, then select Scroll. With Auto Tap on: Select Scroll from the control menu. If many actions are available, you might JCXGVQUGNGEV/QTG°TUV Tap the Home button. Select Home in the control menu. Perform other hardware actions. Select any item, then select Device from the menu that appears. Use the menu to mimic these actions: Double-click the Home button for multitasking 1RGP0QVK°ECVKQP%GPVGTQT%QPVTQN%GPVGT Press the Sleep/Wake button to lock iPad Rotate iPad Flip the Side Switch to mute iPad volume Press the Volume buttons Hold down the Home button to open Siri Triple-click the Home button Appendix A Accessibility 139 Apple Confidential DRAFT Shake iPad Press the Home and Sleep/Wake buttons simultaneously to take a screenshot 5YKRGFQYPHTQOVJGVQRYKVJVYQ°PIGTUVQURGCMVJGUETGGP KH[QWJCXG5RGCM5ETGGP turned on) Item scanning Item scanning alternately highlights each item or group of items on the entire screen until you trigger your Select Item switch. If there are many items, Switch Control highlights them in groups. When you select a group, highlighting continues with the items in the group. When you °PCNN[UGNGEVCWPKSWGKVGOUECPPKPIUVQRUCPFVJGEQPVTQNOGPWCRRGCTU+VGOUECPPKPIKUVJG FGHCWNVYJGP[QW°TUVVWTPQP5YKVEJ%QPVTQN Select an item or enter a group. Watch (or listen) as items are highlighted. When the item you want to control (or the group containing the item) is highlighted, trigger your Select Item switch. Work your way down the hierarchy of items until you select the individual item you want to control. Back out of a group. Trigger your Select Item switch when the dashed highlight around the group or item appears. Dismiss the menu without performing an action. Trigger your Select Item switch when the item itself is highlighted. Or, choose Escape from the control menu. Hear the names of items as they are highlighted. Turn on Settings > General > Accessibility > Switch Control > Speech. Or, select Settings from the control menu, then select Speech On. Slow down the scanning. Go to Settings > General > Accessibility > Switch Control > Auto Scanning Time. Point scanning Point scanning lets you select an item on the screen by pinpointing it with scanning crosshairs. Switch to point scanning. Use item scanning to select Point Mode from the control menu. The vertical crosshair appears when you close the menu. Select an item. Trigger your Select Item switch when the item you want is within the broad, JQTK\QPVCNUECPPKPIDCPFVJGPVTKIIGTCICKPYJGPVJG°PGUECPPKPINKPGKUQPVJGKVGO4GRGCV for vertical scanning. 4G°PG[QWTUGNGEVKQPRQKPV%JQQUG4G°PG5GNGEVKQPHTQOVJGEQPVTQNOGPW Return to item scanning. Choose Item Mode from the control menu. Manual selection You can select a screen item directly using dedicated switches instead of having iPad alternately highlight every item. Stop scanning and highlight items yourself. Add switches in addition to your Select Item switch to perform the Move To Next Item and Move To Previous Item actions. (You can use the iPad FaceTime camera with head-left and head-right movements for these switches.) When youâve CFFGFVJGUYKVEJGUVWTPQĂ5GVVKPIU )GPGTCN #EEGUUKDKNKV[ 5YKVEJ%QPVTQN #WVQ5ECPPKPI Important: &QP¨VVWTPQĂ#WVQ5ECPPKPIKH[QWWUGQPN[QPGUYKVEJ;QWPGGFCVNGCUVVYQQPGVQ move to an item and a second to select the item. Settings and adjustments Adjust basic settings. Go to Settings > General > Accessibility > Switch Control, where you can: Appendix A Accessibility 140 Apple Confidential DRAFT Add switches and specify their function 6WTPQĂCWVQUECPPKPI QPN[KH[QW¨XGCFFGFCÂĽ/QXGVQ0GZV+VGOÂŚUYKVEJ #FLWUVJQYTCRKFN[KVGOUCTGUECPPGF 5GVUECPPKPIVQRCWUGQPVJG°TUVKVGOKPCITQWR Choose how many times to cycle through the screen before hiding Switch Control 6WTP#WVQ6CRQPQTQĂCPFUGVVJGKPVGTXCNHQTRGTHQTOKPICUGEQPFUYKVEJCEVKQPVQUJQYVJG control menu Set whether a movement action is repeated when you hold down a switch, and how long to wait before repeating Set whether and how long you need to hold a switch down before itâs accepted as a switch action Have Switch Control ignore accidental repeated switch triggers #FLWUVVJGRQKPVUECPPKPIURGGF 6WTPQPUQWPFGĂGEVUQTJCXGKVGOUTGCFCNQWFCUVJG[CTGUECPPGF Choose what to include in the Switch Control menu Set whether items should be grouped while item scanning /CMGVJGUGNGEVKQPEWTUQTNCTIGTQTCFKĂGTGPVEQNQT Save custom gestures to the control menu (in Gestures > Saved) Fine-tune Switch Control. Choose Settings from the control menu to: #FLWUVUECPPKPIURGGF Change the location of the control menu Switch between item scan mode and point scan mode Choose whether point scan mode displays crosshairs or a grid Reverse the scanning direction 6WTPUQWPFQTURGGEJCEEQORCPKOGPVQPQTQĂ 6WTPQĂITQWRUVQUECPKVGOUQPGCVCVKOG AssistiveTouch #UUKUVKXG6QWEJJGNRU[QWWUGK2CFKH[QWJCXGFKĂEWNV[VQWEJKPIVJGUETGGPQTRTGUUKPIVJG DWVVQPU;QWECPWUG#UUKUVKXG6QWEJYKVJQWVCP[CEEGUUQT[VQRGTHQTOIGUVWTGUVJCVCTGFKĂEWNV HQT[QW;QWCNUQECPWUGCEQORCVKDNGCFCRVKXGCEEGUUQT[ UWEJCUCLQ[UVKEM VQIGVJGTYKVJ AssistiveTouch to control iPad. 6JG#UUKUVKXG6QWEJOGPWNGVU[QWRGTHQTOCEVKQPUUWEJCUVJGUGD[LWUVVCRRKPI QTVJG equivalent on your accessory): Press the Home button Summon Siri 2GTHQTOOWNVK°PIGTIGUVWTGU #EEGUU%QPVTQN%GPVGTQT0QVK°ECVKQP%GPVGT #FLWUVK2CFXQNWOG Shake iPad Capture a screenshot Appendix A Accessibility 141 Apple Confidential DRAFT Turn on AssistiveTouch. Go to Settings > General > Accessibility > AssistiveTouch, or use the Accessibility Shortcut. See Accessibility Shortcut on page 122. When AssistiveTouch is on, the ÂąQCVKPIOGPWDWVVQPCRRGCTUQPVJGUETGGP Show or hide the menu. 6CRVJGÂąQCVKPIOGPWDWVVQPQTENKEMVJGUGEQPFCT[DWVVQPQP your accessory. Simulate pressing the Home button. Tap the menu button, then tap Home. Lock or rotate the screen, adjust iPad volume, or simulate shaking iPad. Tap the menu button, then tap Device. 2GTHQTOCUYKRGQTFTCIVJCVWUGUQT°PIGTUTap the menu button, then tap Device, More, then Gestures. Tap the number of digits needed for the gesture. When the corresponding circles appear on the screen, swipe or drag in the direction required by the gesture. When you °PKUJVCRVJGOGPWDWVVQP Perform a pinch gesture. Tap the menu button, tap Favorites, then tap Pinch. When the pinch circles appear, touch anywhere on the screen to move the pinch circles, then drag the pinch EKTENGUKPQTQWVVQRGTHQTOCRKPEJIGUVWTG9JGP[QW°PKUJVCRVJGOGPWDWVVQP Create your own gesture. You can add your own favorite gestures to the control menu (for GZCORNGVCRCPFJQNFQTVYQ°PIGTTQVCVKQP 6CRVJGOGPWDWVVQPVCR(CXQTKVGUVJGPVCRCP empty gesture placeholder. Or go to Settings > General > Accessibility > AssistiveTouch > Create New Gesture. Example 1: To create the rotation gesture, go to Settings > General > Accessibility > AssistiveTouch > Create New Gesture. On the gesture recording screen that prompts you to VQWEJVQETGCVGCIGUVWTGTQVCVGVYQ°PIGTUQPVJGK2CFUETGGPCTQWPFCRQKPVDGVYGGPVJGO ;QWECPFQVJKUYKVJCUKPING°PIGTQTUV[NWU¤LWUVETGCVGGCEJCTEUGRCTCVGN[QPGCHVGTVJG other.) If it doesnât turn out quite right, tap Cancel, then try again. When it looks right, tap Save, then give the gesture a nameâmaybe âRotate 90.â Then, to rotate the view in Maps, for example, open Maps, tap the AssistiveTouch menu button, and choose Rotate 90 from Favorites. When VJGDNWGEKTENGUTGRTGUGPVKPIVJGUVCTVKPI°PIGTRQUKVKQPUCRRGCTFTCIVJGOVQVJGRQKPVCTQWPF which you want to rotate the map, then release. You might want to create several gestures with FKĂGTGPVFGITGGUQHTQVCVKQP Example 2: Letâs create the touch and hold gesture that you use to start rearranging icons on [QWT*QOGUETGGP6JKUVKOGQPVJGIGUVWTGTGEQTFKPIUETGGPJQNFFQYP[QWT°PIGTKPQPGURQV WPVKNVJGTGEQTFKPIRTQITGUUDCTTGCEJGUJCNHYC[VJGPNKHV[QWT°PIGT$GECTGHWNPQVVQOQXG [QWT°PIGTYJKNGTGEQTFKPIQTVJGIGUVWTGYKNNDGTGEQTFGFCUCFTCI6CR5CXGCPFPCOGVJG gesture. To use the gesture, tap the AssistiveTouch menu button and choose your gesture from Favorites. When the blue circle representing your touch appears, drag it over a Home screen icon and release. If you record a sequence of taps or drags, theyâre all played back at the same time. For example, WUKPIQPG°PIGTQTUV[NWUVQTGEQTFHQWTUGRCTCVGUGSWGPVKCNVCRUCVHQWTNQECVKQPUQPVJGUETGGP ETGCVGUCUKOWNVCPGQWUHQWT°PIGTVCR Exit a menu without performing a gesture. Tap anywhere outside the menu. To return to the previous menu, tap the arrow in the middle of the menu. Move the menu button. Drag it anywhere along the edge of the screen. Adjust your accessory tracking speed. Go to Settings > General > Accessibility > AssistiveTouch > Touch speed. Hide the menu button (with accessory attached). Go to Settings > General > Accessibility > AssistiveTouch > Always Show Menu. Appendix A Accessibility 142 Apple Confidential DRAFT Accessibility in OS X Take advantage of the accessibility features in OS X when you use iTunes to sync information and content from your iTunes library to iPad. In the Finder, choose Help > Help Center (or Help > Mac Help in OS X Yosemite), then search for âaccessibility.â For more information about iPad and OS X accessibility features, go to www.apple.com/accessibility. Appendix A Accessibility 143 Apple Confidential iPad in Business iPad in the enterprise With support for secure access to corporate networks, directories, and Microsoft Exchange, iPad is ready to go to work. For detailed information about using iPad in business, go to www.apple.com/ipad/business. Mail, Contacts, and Calendar To use iPad with your work accounts, you need to know the settings your organization requires. If you received your iPad from your organization, the settings and apps you need might already be installed. If itâs your own iPad, your system administrator may provide you with the settings for you to enter, or they may have you connect to a mobile device management server that installs the settings and apps you should have. Organizational settings and accounts are typically in EQP°IWTCVKQPRTQ°NGU. You might be asked to KPUVCNNCEQP°IWTCVKQPRTQ°NGVJCVYCUUGPVVQ[QWKPCPGOCKNQTQPGVJCV[QWPGGFVQFQYPNQCF HTQOCYGDRCIG9JGP[QWQRGPVJG°NGK2CFCUMUHQT[QWTRGTOKUUKQPVQKPUVCNNVJGRTQ°NGCPF displays information about what it contains. +POQUVECUGUYJGP[QWKPUVCNNCEQP°IWTCVKQPRTQ°NGVJCVUGVUWRCPCEEQWPVHQT[QWUQOGK2CF settings canât be changed. For example, your organization might turn on Auto-Lock and require you to set a passcode in order to protect the information in the accounts you access. ;QWECPUGG[QWTRTQ°NGUKP5GVVKPIU )GPGTCN 2TQ°NGU+H[QWFGNGVGCRTQ°NGCNNQHVJGUGVVKPIU CPFCEEQWPVUCUUQEKCVGFYKVJVJGRTQ°NGCTGCNUQTGOQXGFKPENWFKPICP[EWUVQOCRRU[QWT QTICPK\CVKQPRTQXKFGFQTJCF[QWFQYPNQCF+H[QWPGGFCRCUUEQFGVQTGOQXGCRTQ°NGEQPVCEV your system administrator. Network access A VPN (virtual private network) provides secure access over the Internet to private resources, such as your organizationâs network. You may need to install a VPN app from the App Store VJCVEQP°IWTGU[QWTK2CFVQCEEGUUCRCTVKEWNCTPGVYQTM%QPVCEV[QWTU[UVGOCFOKPKUVTCVQTHQT information about any apps and settings you need. Apps In addition to the built-in apps and the ones you get from the App Store, your organization may want you to have certain other apps. They might provide you with a pre-paid redemption code for the App Store. When you download an app using a redemption code, you own it, even though your organization purchased it for you. 144 Apple Confidential Appendix DRAFT DRAFT Your organization can also purchase App Store app licenses that are assigned to you for a period of time, but which the organization retains. Youâll be invited to participate in your organizationâs program in order to access these apps. After you enroll with your Apple ID, youâre prompted to KPUVCNNVJGUGCRRUCUVJG[¨TGCUUKIPGFVQ[QW;QWECPCNUQ°PFVJGOKP[QWT2WTEJCUGFNKUVKPVJG App Store. An app you receive this way is removed if the organization assigns it to someone else. Your organization might also develop custom apps that arenât in the App Store. You install them from a webpage or, if your organization uses mobile device management, you receive a PQVK°ECVKQPCUMKPI[QWVQKPUVCNNVJGOQXGTVJGCKT6JGUGCRRUDGNQPIVQ[QWTQTICPK\CVKQPCPF VJG[OC[DGTGOQXGFQTUVQRYQTMKPIKH[QWFGNGVGCEQP°IWTCVKQPRTQ°NGQTFKUUQEKCVGK2CF from the mobile device management server. Appendix B iPad in Business 145 Apple Confidential International Keyboards +PVGTPCVKQPCNMG[DQCTFUNGV[QWV[RGVGZVKPOCP[FKĂGTGPVNCPIWCIGUKPENWFKPI#UKCPNCPIWCIGU and languages written from right to left. Use international keyboards +PVGTPCVKQPCNMG[DQCTFUNGV[QWV[RGVGZVKPOCP[FKĂGTGPVNCPIWCIGUKPENWFKPI#UKCP languages and languages written from right to left. For a list of supported keyboards, go to www.apple.com/ipad, choose your iPad, click Tech Specs, then scroll to Languages. Manage keyboards. Go to Settings > General > Keyboard > Keyboards. Add a keyboard: Tap Add New Keyboard, then choose a keyboard from the list. Repeat to add more keyboards. Remove a keyboard: Tap Edit, tap then tap Done. Edit your keyboard list: Tap Edit, then drag then tap Done. next to the keyboard you want to remove, tap Delete, next to a keyboard to a new place in the list, 6QGPVGTVGZVKPCFKĂGTGPVNCPIWCIGUYKVEJMG[DQCTFU to show all your enabled Switch keyboards while typing. Touch and hold the Globe key MG[DQCTFU6QEJQQUGCMG[DQCTFUNKFG[QWT°PIGTVQVJGPCOGQHVJGMG[DQCTFVJGPTGNGCUG6JG appears only if you enable more than one keyboard. Globe key ;QWECPCNUQLWUVVCR . When you tap , the name of the newly activated keyboard appears DTKGÂą[%QPVKPWGVCRRKPIVQCEEGUUQVJGTGPCDNGFMG[DQCTFU Many keyboards provide letters, numbers, and symbols that arenât visible on the keyboard. Enter accented letters or other characters. Touch and hold the related letter, number, or symbol, then slide to choose a variant. For example: On a Thai keyboard: Choose native numbers by touching and holding the related Arabic number. On a Chinese, Japanese, or Arabic keyboard: Suggested characters or candidates appear at the top of the keyboard. Tap a candidate to enter it, or swipe left to see more candidates. Use the extended suggested candidate list. Tap the up arrow on the right to view the full candidate list. Scroll the list: Swipe up or down. Return to the short list: Tap the down arrow. When using certain Chinese or Japanese keyboards, you can create a shortcut for word and input pairs. The shortcut is added to your personal dictionary. When you type a shortcut while using a supported keyboard, the paired word or input is substituted for the shortcut. 146 Apple Confidential Appendix DRAFT DRAFT 6WTPUJQTVEWVUQPQTQĂGo to Settings > General > Keyboard > Shortcuts. Shortcuts are available for: 5KORNK°GF%JKPGUGPinyin Traditional Chinese: Pinyin and Zhuyin Japanese: 4QOCLKCPF-G[ Reset your personal dictionary. Go to Settings > General > Reset > Reset Keyboard Dictionary. All custom words and shortcuts are deleted, and the keyboard dictionary returns to its default state. Special input methods ;QWECPWUGMG[DQCTFUVQGPVGTUQOGNCPIWCIGUKPFKĂGTGPVYC[U#HGYGZCORNGUCTG%JKPGUG %CPILKGCPF9WDKJWC,CRCPGUG-CPCCPF(CEGOCTMU;QWECPCNUQWUG[QWT°PIGTQTCUV[NWUVQ write Chinese characters on the screen. Build Chinese characters from the component Cangjie keys. As you type, suggested EJCTCEVGTUCRRGCT6CRCEJCTCEVGTVQEJQQUGKVQTEQPVKPWGV[RKPIWRVQ°XGEQORQPGPVUVQUGG more options. Build Chinese Wubihua (stroke) characters. Use the keypad to build Chinese characters using WRVQ°XGUVTQMGUKPVJGEQTTGEVYTKVKPIUGSWGPEGJQTK\QPVCNXGTVKECNNGHVHCNNKPITKIJVHCNNKPICPF hook. For example, the Chinese character ੢ (circle) should begin with the vertical stroke äš. As you type, suggested Chinese characters appear (the most commonly used characters CRRGCT°TUV 6CRCEJCTCEVGTVQEJQQUGKV If youâre not sure of the correct stroke, enter an asterisk (*). To see more character options, type another stroke, or scroll through the character list. Tap the match key (ˤŕ¨) to show only characters that match exactly what you typed. Write Chinese characters. 9TKVG%JKPGUGEJCTCEVGTUFKTGEVN[QPVJGUETGGPYKVJ[QWT°PIGTYJGP 5KORNK°GFQT6TCFKVKQPCN%JKPGUGJCPFYTKVKPIKPRWVKUVWTPGFQP#U[QWYTKVGEJCTCEVGTUVTQMGU K2CFTGEQIPK\GUVJGOCPFUJQYUOCVEJKPIEJCTCEVGTUKPCNKUVYKVJVJGENQUGUVOCVEJ°TUV9JGP you choose a character, its likely follow-on characters appear in the list as additional choices. Matching characters Appendix C International Keyboards Apple Confidential 147 DRAFT You can type some complex characters, such as ä (part of the name for the Hong Kong International Airport), by writing two or more component characters in sequence. Tap the character to replace the characters you typed. Roman characters are also recognized. Type Japanese kana. Use the Kana keypad to select syllables. For more syllable options, tap the arrow key and select another syllable or word from the window. Type Japanese romaji. 7UGVJG4QOCLKMG[DQCTFVQV[RGU[NNCDNGU#NVGTPCVKXGEJQKEGUCRRGCT along the top of the keyboard; tap one to type it. For more syllable options, drag the list to the left or tap the arrow key. Type facemarks or emoticons. Use the Japanese Kana keyboard and tap the Use the Japanese Romaji keyboard (QWERTY-Japanese layout): Tap key. Or you can: , then tap the 7UGVJG%JKPGUG 5KORNK°GFQT6TCFKVKQPCN 2KP[KPQT 6TCFKVKQPCN General > About > Legal > RF Exposure or visit www.apple.com/legal/rfexposure. Appendix D Safety, Handling, & Support Apple Confidential 150 DRAFT Radio frequency interference Observe signs and notices that prohibit or restrict the use of mobile devices (for example, in healthcare facilities or blasting areas). Although iPad is designed, tested, and manufactured to comply with regulations governing radio frequency emissions, such GOKUUKQPUHTQOK2CFECPPGICVKXGN[CĂGEVVJGQRGTCVKQPQHQVJGTGNGEVTQPKEGSWKROGPVECWUKPI VJGOVQOCNHWPEVKQP6WTPQĂK2CFQTWUG#KTRNCPG/QFGVQVWTPQĂVJGK2CFYKTGNGUUVTCPUOKVVGTU when use is prohibited, such as while traveling in aircraft, or when asked to do so by authorities. Medical device interference iPad contains components and radios that emit electromagnetic °GNFUK2CFCNUQEQPVCKPUOCIPGVUCNQPIVJGNGHVGFIGQHVJGFGXKEGCPFQPVJGTKIJVUKFGQHVJG HTQPVINCUUYJKEJOC[KPVGTHGTGYKVJRCEGOCMGTUFG°DTKNNCVQTUQTQVJGTOGFKECNFGXKEGU6JG K2CF5OCTV%QXGTCPFK2CF5OCTV%CUGCNUQEQPVCKPOCIPGVU6JGUGGNGEVTQOCIPGVKE°GNFUCPF OCIPGVUOC[KPVGTHGTGYKVJRCEGOCMGTUFG°DTKNNCVQTUQTQVJGTOGFKECNFGXKEGU/CKPVCKPCUCHG distance of separation between your medical device and iPad, the iPad Smart Cover, and the iPad 5OCTV%CUG%QPUWNV[QWTRJ[UKEKCPCPFOGFKECNFGXKEGOCPWHCEVWTGTHQTKPHQTOCVKQPURGEK°EVQ your medical device. If you suspect iPad is interfering with your pacemaker or any other medical device, stop using iPad. Not a medical device iPad is not designed or intended for use in the diagnosis of disease or other conditions, or in the cure, mitigation, treatment, or prevention of disease. Medical conditions +H[QWJCXGCP[OGFKECNEQPFKVKQPVJCV[QWDGNKGXGEQWNFDGCĂGEVGFD[K2CF (for example, seizures, blackouts, eyestrain, or headaches), consult with your physician prior to using iPad. Explosive atmospheres Do not charge or use iPad in any area with a potentially explosive atmosphere, such as at a fueling area, or in areas where the air contains chemicals or particles (such as grain, dust, or metal powders). Obey all signs and instructions. Repetitive motion When you perform repetitive activities such as typing or playing games on iPad, you may experience discomfort in your hands, arms, wrists, shoulders, neck, or other parts of your body. If you experience discomfort, stop using iPad and consult a physician. High-consequence activities This device is not intended for use where the failure of the device EQWNFNGCFVQFGCVJRGTUQPCNKPLWT[QTUGXGTGGPXKTQPOGPVCNFCOCIG Choking hazard Some iPad accessories may present a choking hazard to small children. Keep these accessories away from small children. Important handling information Cleaning Clean iPad immediately if it comes in contact with anything that may cause stainsâ such as dirt, ink, makeup, or lotions. To clean: &KUEQPPGEVCNNECDNGUCPFVWTPK2CFQĂ RTGUUCPFJQNFVJG5NGGR9CMGDWVVQPVJGPUNKFGVJG onscreen slider). Use a soft, lint-free cloth. Avoid getting moisture in openings. Donât use cleaning products or compressed air. 6JGHTQPVQHK2CFKUOCFGQHINCUUYKVJC°PIGTRTKPVTGUKUVCPVQNGQRJQDKE QKNTGRGNNCPV EQCVKPI This coating wears over time with normal usage. Cleaning products and abrasive materials will further diminish the coating, and may scratch the glass. Appendix D Safety, Handling, & Support Apple Confidential 151 DRAFT Using connectors, ports, and buttons Never force a connector into a port or apply excessive pressure to a button, because this may cause damage that is not covered under the warranty. If VJGEQPPGEVQTCPFRQTVFQP¨VLQKPYKVJTGCUQPCDNGGCUGVJG[RTQDCDN[FQP¨VOCVEJ%JGEMHQT obstructions and make sure that the connector matches the port and that you have positioned the connector correctly in relation to the port. Lightning to USB Cable Discoloration of the Lightning connector after regular use is normal. Dirt, debris, and exposure to moisture may cause discoloration. If your Lightning cable or connector become warm during use or your iPad wonât charge or sync, disconnect it from your computer or power adapter and clean the Lightning connector with a soft, dry, lint-free cloth. Do not use liquids or cleaning products when cleaning the Lightning connector. Certain usage patterns can contribute to the fraying or breaking of cables. The Lightning to USB %CDNGNKMGCP[QVJGTOGVCNYKTGQTECDNGKUUWDLGEVVQDGEQOKPIYGCMQTDTKVVNGKHTGRGCVGFN[DGPV in the same spot. Aim for gentle curves instead of angles in the cable. Regularly inspect the cable CPFEQPPGEVQTHQTCP[MKPMUDTGCMUDGPFUQTQVJGTFCOCIG5JQWNF[QW°PFCP[UWEJFCOCIG discontinue use of the Lightning to USB Cable. Operating temperature iPad is designed to work in ambient temperatures between 32° and 95° F (0° and 35° C) and stored in temperatures between -4° and 113° F (-20° and 45° C). iPad can be damaged and battery life shortened if stored or operated outside of these temperature ranges. Avoid exposing iPad to dramatic changes in temperature or humidity. When youâre using iPad or charging the battery, it is normal for iPad to get warm. If the interior temperature of iPad exceeds normal operating temperatures (for example, in a hot car or in direct sunlight for extended periods of time), you may experience the following as it attempts to regulate its temperature: iPad stops charging. The screen dims. A temperature warning screen appears. Some apps may close. Important: You may not be able to use iPad while the temperature warning screen is displayed. If iPad canât regulate its internal temperature, it goes into deep sleep mode until it cools. Move iPad to a cooler location out of direct sunlight and wait a few minutes before trying to use iPad again. For more information, see support.apple.com/kb/HT2101. iPad Support site Comprehensive support information is available online at www.apple.com/support/ipad. To contact Apple for personalized support (not available in all areas), see www.apple.com/support/contact. Restart or reset iPad If something isnât working right, try restarting iPad, forcing an app to quit, or resetting iPad. Restart iPad. *QNFFQYPVJG5NGGR9CMGDWVVQPWPVKNVJGUNKFGTCRRGCTU5NKFG[QWT°PIGTCETQUU VJGUNKFGTVQVWTPQĂK2CF6QVWTPK2CFDCEMQPJQNFFQYPVJG5NGGR9CMGDWVVQPWPVKNVJG Apple logo appears. Appendix D Safety, Handling, & Support Apple Confidential 152 DRAFT iPad may be low on power. Connect iPad to the USB power adapter to charge. See Charge and monitor the battery on page 43. Force an app to quit. Hold down the Sleep/Wake button on top of iPad for a few seconds until a red slider appears, then hold down the Home button until the app closes. +H[QWECP¨VVWTPQĂK2CFQTKHVJGRTQDNGOEQPVKPWGU[QWOC[PGGFVQTGUGVK2CF&QVJKUQPN[KH youâre unable to restart iPad. Reset iPad. Hold down the Sleep/Wake button and the Home button at the same time for at least ten seconds, until the Apple logo appears. You can reset the word dictionary, network settings, home screen layout, and location warnings. You can also erase all of your content and settings. Reset iPad settings Reset iPad settings. Go to Settings > General > Reset, then choose an option: Reset All Settings: All your preferences and settings are reset. Erase All Content and Settings: Your information and settings are removed. iPad cannot be used until itâs set up again. Reset Network Settings: When you reset network settings, previously used networks and VPN UGVVKPIUVJCVYGTGP¨VKPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGCTGTGOQXGF 6QTGOQXG820UGVVKPIU KPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGIQVQ5GVVKPIU )GPGTCN 2TQ°NGUGNGEVVJGRTQ°NGVJGP VCR4GOQXG6JKUCNUQTGOQXGUQVJGTUGVVKPIUQTCEEQWPVURTQXKFGFD[VJGRTQ°NG 9K(KKU VWTPGFQĂCPFVJGPDCEMQPFKUEQPPGEVKPI[QWHTQOCP[PGVYQTM[QW¨TGQP6JG9K(KCPF âAsk to Join Networksâ settings remain turned on. Reset Keyboard Dictionary: ;QWCFFYQTFUVQVJGMG[DQCTFFKEVKQPCT[D[TGLGEVKPIYQTFUK2CF suggests as you type. Resetting the keyboard dictionary erases all words youâve added. Reset Home Screen Layout: Returns the built-in apps to their original layout on the Home screen. Reset Location & Privacy: Resets the location services and privacy settings to their defaults. #PCRRFQGUP¨V°NNVJGUETGGP Most apps for iPhone and iPod touch can be used with iPad, but they might not take advantage of the large screen. In this case, tap to zoom in on the app. Tap to return to the original size. Check the App Store to see if thereâs a version of the app thatâs optimized for iPad, or a universal version thatâs optimized for iPhone, iPod touch, and iPad. Onscreen keyboard doesnât appear If iPad is paired with a Bluetooth keyboard, the onscreen keyboard doesnât appear. To make the QPUETGGPMG[DQCTFCRRGCTRTGUUVJG'LGEVMG[QPC$NWGVQQVJMG[DQCTF;QWECPCNUQOCMGVJG QPUETGGPMG[DQCTFCRRGCTD[OQXKPIVJG$NWGVQQVJMG[DQCTFQWVQHTCPIGQTVWTPKPIKVQĂ Get information about your iPad See information about iPad. Go to Settings > General > About. The items you can view include: Name Appendix D Safety, Handling, & Support Apple Confidential 153 DRAFT Network Number of songs, videos, photos, and apps Capacity and available storage space iOS version (Cellular models) Carrier Model number Serial number (Cellular models) Cellular Data Number Wi-Fi and Bluetooth addresses (Cellular models) IMEI (International Mobile Equipment Identity) %GNNWNCTOQFGNU +%%+& +PVGITCVGF%KTEWKV%CTF+FGPVK°GTQT5OCTV%CTF HQT)5/PGVYQTMU %GNNWNCTOQFGNU /'+& /QDKNG'SWKROGPV+FGPVK°GT HQT%&/#PGVYQTMU /QFGO°TOYCTG Legal (including legal notices, and license, warranty, regulatory marks, and RF exposure information) 6QEQR[VJGUGTKCNPWODGTCPFQVJGTKFGPVK°GTUVQWEJCPFJQNFVJGKFGPVK°GTWPVKN%QR[CRRGCTU To help Apple improve products and services, iPad sends diagnostic and usage data. This data doesnât personally identify you, but may include location information. 8KGYQTVWTPQĂFKCIPQUVKEKPHQTOCVKQPGo to Settings > Privacy > Diagnostics & Usage. Usage information View cellular usage. Go to Settings > Cellular Data. See Cellular settings on page 156. View usage information. Go to Settings > General > Usage to: See Battery Usage, including the elapsed time since iPad has been charged and usage by app Display battery level as a percentage View overall storage availability and storage used per app View and manage iCloud storage Disabled iPad If iPad is disabled because you forgot your passcode or entered an incorrect passcode too many times, you can restore iPad from an iTunes or iCloud backup and reset the passcode. For more information, see Restore iPad on page 156. If you get a message in iTunes that your iPad is locked and you must enter a passcode, see support.apple.com/kb/HT1212. VPN settings A VPN (virtual private network) provides secure access over the Internet to private networks, such as the network at your organization. You may need to install a VPN app from the App Store that EQP°IWTGUK2CFVQCEEGUUCPGVYQTM%QPVCEV[QWTU[UVGOCFOKPKUVTCVQTHQTKPHQTOCVKQPCDQWVVJG app and settings you need. Appendix D Safety, Handling, & Support Apple Confidential 154 DRAFT 2TQ°NGUUGVVKPIU %QP°IWTCVKQPRTQ°NGUFG°PGUGVVKPIUHQTWUKPIK2CFYKVJEQTRQTCVGQTUEJQQNPGVYQTMUQT CEEQWPVU;QWOKIJVDGCUMGFVQKPUVCNNCEQP°IWTCVKQPRTQ°NGVJCVYCUUGPVVQ[QWKPCPGOCKN QTQPGVJCVKUFQYPNQCFGFHTQOCYGDRCIGK2CFCUMUHQT[QWTRGTOKUUKQPVQKPUVCNNVJGRTQ°NG CPFFKURNC[UKPHQTOCVKQPCDQWVYJCVKVEQPVCKPUYJGP[QWQRGPVJG°NG;QWECPUGGVJGRTQ°NGU [QWJCXGKPUVCNNGFKP5GVVKPIU )GPGTCN 2TQ°NGU+H[QWFGNGVGCRTQ°NGCNNQHVJGUGVVKPIUCRRU CPFFCVCCUUQEKCVGFYKVJVJGRTQ°NGCTGCNUQFGNGVGF Back up iPad You can use iCloud or iTunes to automatically back up iPad. If you choose to back up using iCloud, you canât also use iTunes to automatically back up to your computer, but you can use iTunes to manually back up to your computer. iCloud backs up iPad daily over Wi-Fi, when itâs connected to a power source and is locked. The date and time of the last backup is listed at the bottom of the Backup screen. iCloud backs up your: Purchased music, movies, TV shows, apps, and books Photos and videos taken with iPad (if you use iCloud Photo Library (Beta), your photos and videos are already stored in iCloud, so they wonât also be part of an iCloud backup) iPad settings App data Home screen, folders, and app layout Messages Ringtones Note: Purchased content is not backed up in all areas. Turn on iCloud backups. Go to Settings > iCloud, then log in with your Apple ID and password if required. Go to Backup, then turn on iCloud Backup. To turn on backups in iTunes on your computer, go to File > Devices > Back Up. Back up immediately. Go to Settings > iCloud > Backup, then tap Back Up Now. Encrypt your backup. iCloud backups are encrypted automatically so that your data is protected from unauthorized access both while itâs transmitted to your devices and when itâs stored in iCloud. If youâre using iTunes for your backup, select âEncrypt iPad backupâ in the iTunes Summary pane. Manage your backups. Go to Settings > iCloud. You can manage which apps are backed up VQK%NQWFD[VCRRKPIVJGOQPQTQĂ)QVQ5GVVKPIU K%NQWF 5VQTCIG /CPCIG5VQTCIGVQ remove existing backups and manage iCloud Drive or Documents & Data. In iTunes, remove backups in iTunes Preferences. View the devices being backed up. Go to Settings > iCloud > Storage > Manage Storage. Stop iCloud backups. )QVQ5GVVKPIU K%NQWF $CEMWRVJGPVWTPQĂK%NQWF$CEMWR Music not purchased in iTunes isnât backed up in iCloud. Use iTunes to back up and restore that content. See Sync with iTunes on page 17. Important: Backups for music, movies, or TV show purchases are not available in all countries. Previous purchases may not be restored if they are no longer in the iTunes Store, App Store, or iBooks Store. Appendix D Safety, Handling, & Support Apple Confidential 155 DRAFT Purchased content, iCloud Photo Sharing, and My Photo Stream content donât count against your 5 GB of free iCloud storage. For more information about backing up iPad, see support.apple.com/kb/HT5262. Update and restore iPad software You can update iPad software in Settings, or by using iTunes. You can also erase iPad, and then use iCloud or iTunes to restore a backup. Deleted data is no longer accessible through the iPad user interface, but it isnât erased from iPad. For information about erasing all content and settings, see Restart or reset iPad on page 152. Update iPad You can update iPad software in Settings or by using iTunes. Update wirelessly on iPad. Go to Settings > General > Software Update. iPad checks for available software updates. Update software in iTunes. iTunes checks for available software updates each time you sync iPad using iTunes. See Sync with iTunes on page 17. For more information about updating iPad software, see support.apple.com/kb/HT4623. Restore iPad You can use iCloud or iTunes to restore iPad from a backup. Restore from an iCloud backup. Reset iPad to erase all content and settings, then choose âRestore from a Backupâ and sign in to iCloud in the Setup Assistant. See Restart or reset iPad on page 152. Restore from an iTunes backup. Connect iPad to the computer you normally sync with, select iPad in the iTunes window, and click Restore in the Summary pane. When the iPad software is restored, you can either set it up as a new iPad, or restore your music, videos, app data, and other content from a backup. For more information about restoring iPad software, see support.apple.com/kb/HT1414. Cellular settings Use Cellular Data settings on iPad (Wi-Fi + Cellular models) to activate cellular data service, turn EGNNWNCTWUGQPQTQĂQTCFFC2GTUQPCN+FGPVK°ECVKQP0WODGT 2+0 VQNQEMVJG5+/ECTF9KVJ some carriers, you can also change your data plan. (QTVJGHQNNQYKPIQRVKQPUIQVQ5GVVKPIU %GNNWNCT&CVCCPFVWTPVJGQRVKQPUQPQTQĂQTHQNNQY the onscreen instructions. 6WTP%GNNWNCT&CVCQPQTQĂ+H%GNNWNCT&CVCKUQĂCNNFCVCUGTXKEGUYKNNWUGQPN[9K(K¤KPENWFKPI GOCKNYGDDTQYUKPIRWUJPQVK°ECVKQPUCPFQVJGTUGTXKEGU+H%GNNWNCT&CVCKUQPECTTKGTEJCTIGU may be incurred. For example, using certain features and services that transfer data, such as Messages, could result in charges to your data plan. Monitor and manage your cellular data network usage. You can see which apps use cellular FCVCCPFVWTPQĂVJGQRVKQPKH[QWYCPV 6WTP.6'QPQTQĂTurning on LTE loads data faster. Appendix D Safety, Handling, & Support Apple Confidential 156 DRAFT 6WTP&CVC4QCOKPIQPQTQĂ6WTPKPIQĂ&CVC4QCOKPICXQKFUECTTKGTEJCTIGUYJGPWUKPIC PGVYQTMRTQXKFGFD[CFKĂGTGPVECTTKGT Set up Personal Hotspot. Personal Hotspot shares iPadâs Internet connection with your computer and other iOS devices. See Personal Hotspot on page 38. Set whether cellular data is used for apps and services. 6WTPEGNNWNCTFCVCQPQTQĂHQTCP[CRR VJCVECPWUGEGNNWNCTFCVC+HCUGVVKPIKUQĂK2CFWUGUQPN[9K(KHQTVJCVUGTXKEG6JGK6WPGUUGVVKPI includes both iTunes Match and automatic downloads from the iTunes Store and the App Store. Activate, view, or change your cellular data account. Tap View Account, then follow the onscreen instructions. Lock the SIM card. Locking the SIM card with a PIN means you need to enter the PIN to use a cellular connection on iPad. Sound, music, and video If iPad doesnât have sound or if video doesnât play, try these steps. No sound Make sure the iPad speaker isnât covered. Make sure the Side Switch isnât set to silent. See Volume buttons and the Side Switch on page 11. If youâre using a headset, unplug it, then plug it in again. Make sure you push the plug all the way in. Make sure the volume isnât turned all the way down. Music on iPad might be paused. If youâre using a headset with a play button, try pressing the play button to resume playback. Or from the Home screen, tap Music, then tap . Check to see if a volume limit is set. In Settings, go to Music > Volume Limit. If youâre using the line out port on the optional iPad Dock, make sure that you turn on the external speakers or stereo, and that theyâre plugged in correctly and working properly. Use the volume controls on the the external speakers or stereo, not on iPad. If youâre using an app that works with AirPlay, check to see if the AirPlay device youâre sending the sound to is turned on and the volume is turned up. If you want to hear sound through iPadâs speaker, tap and select it from the list. A song, video, or other item wonât play The song, video, audiobook, or podcast may be encoded in a format that iPad doesnât UWRRQTV(QTKPHQTOCVKQPCDQWVVJGCWFKQCPFXKFGQ°NGHQTOCVUK2CFUWRRQTVUIQVQ www.apple.com/ipad, choose your iPad, click Tech Specs, then scroll to Audio Playback, TV and Video. If a song or video in your iTunes library isnât supported by iPad, you may be able to convert it to a format iPad supports. For example, you can use iTunes for Windows to convert nonprotected 9/#°NGUVQCHQTOCVK2CFUWRRQTVU(QTOQTGKPHQTOCVKQPQRGPK6WPGUVJGPEJQQUG*GNR iTunes Help. Appendix D Safety, Handling, & Support Apple Confidential 157 DRAFT No video or sound when using AirPlay To send video or audio to an AirPlay device such as an Apple TV, iPad and the AirPlay device button, iPad isnât must be connected to the same wireless network. If you donât see the connected to the same Wi-Fi network as an AirPlay device, or the app youâre using doesnât support AirPlay. When sound or video is being sent to an AirPlay device, iPad doesnât display video or play audio. To direct the content to iPad and disconnect iPad from the AirPlay device, tap and select iPad in the list. Some apps play only audio over AirPlay. If video isnât working, make sure that the app youâre using supports both audio and video. If the Apple TV has been set up to require a passcode, you must enter it on iPad when asked, in order to use AirPlay. Make sure the speakers on the AirPlay device are turned on and turned up. If youâre using an Apple TV, make sure the TVâs input source is set to Apple TV. Make sure the volume control on iPad is turned up. When iPad is streaming with AirPlay, it must remain connected to the Wi-Fi network. If you take iPad out of range, playback stops. Depending on the speed of your network, it may take 30 seconds or more for playback to begin when using AirPlay. For more information about AirPlay, see support.apple.com/kb/HT4437. No image on TV or projector connected to iPad 9JGP[QWEQPPGEVK2CFVQC68QTRTQLGEVQTWUKPIC75$ECDNGVJGCVVCEJGFFKURNC[ automatically mirrors the iPad screen. Some apps may support using the attached display as a second monitor. Check the appâs settings and documentation. To view HD videos in high resolution, use the Apple Digital AV Adapter or a component video cable. /CMGUWTGVJGXKFGQECDNGKU°TON[EQPPGEVGFCVDQVJGPFUCPFVJCVKV¨UCUWRRQTVGFECDNG If iPad is connected to an A/V switchbox or receiver, try connecting it directly to the TV or RTQLGEVQTKPUVGCF Make sure that your TV has the proper video input selected, such as HDMI or component video. If no video appears, press the Home button, disconnect and reconnect the cable, and try again. Sell or give away iPad Before you sell or give away your iPad, be sure to erase all content and your personal information. If youâve enabled Find My iPad (see Find My iPad on page 43), Activation Lock is on. You need to VWTPQĂ#EVKXCVKQP.QEMDGHQTGVJGPGYQYPGTECPCEVKXCVGK2CFWPFGTJKUQTJGTQYPCEEQWPV Erase iPad and remove Activation Lock. Go to Settings > General > Reset > Erase All Content and Settings. See support.apple.com/kb/HT5661. Appendix D Safety, Handling, & Support Apple Confidential 158 DRAFT Learning more, service, and support Refer to the following resources to get more iPad-related safety, software, service, and support information. To learn about Do this Using iPad safely See Important safety information on page 149. iPad service and support, tips, forums, and Apple software downloads Go to www.apple.com/support/ipad. The latest information about iPad Go to www.apple.com/ipad. Managing your Apple ID account Go to appleid.apple.com. Using iCloud Go to help.apple.com/icloud. Using iTunes Open iTunes and choose Help > iTunes Help. For an online iTunes tutorial (not available in all areas), go to www.apple.com/support/itunes. Using other Apple iOS apps Go to www.apple.com/support/ios. Obtaining warranty service First follow the advice in this guide. Then go to www.apple.com/support/ipad. Viewing iPad regulatory information On iPad, go to Settings > General > About > Legal > Regulatory. Battery replacement service Go to apple.com/batteries/replacement-and-recycling/. Using iPad in an enterprise environment Go to www.apple.com/ipad/business. FCC compliance statement 6JKUFGXKEGEQORNKGUYKVJRCTVQHVJG(%%TWNGU1RGTCVKQPKUUWDLGEVVQVJGHQNNQYKPIVYQ conditions: (1) This device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation. Note: This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses, and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning VJGGSWKROGPVQĂCPFQPVJGWUGTKUGPEQWTCIGFVQVT[VQEQTTGEVVJGKPVGTHGTGPEGD[QPGQT more of the following measures: Reorient or relocate the receiving antenna. Increase the separation between the equipment and receiver. %QPPGEVVJGGSWKROGPVVQCPQWVNGVQPCEKTEWKVFKĂGTGPVHTQOVJCVVQYJKEJVJGTGEGKXGT is connected. Consult the dealer or an experienced radio/TV technician for help. Appendix D Safety, Handling, & Support Apple Confidential 159 DRAFT Important: %JCPIGUQTOQFK°ECVKQPUVQVJKURTQFWEVPQVCWVJQTK\GFD[#RRNGEQWNFXQKF the electromagnetic compatibility (EMC) and wireless compliance and negate your authority to operate the product. This product has demonstrated EMC compliance under conditions that included the use of compliant peripheral devices and shielded cables between system components. It is important that you use compliant peripheral devices and shielded cables between system components to reduce the possibility of causing interference to radios, televisions, and other electronic devices. Canadian regulatory statement 6JKUFGXKEGEQORNKGUYKVJ+PFWUVT[%CPCFCNKEGPEGGZGORV455UVCPFCTF U 1RGTCVKQPKUUWDLGEV to the following two conditions: (1) this device may not cause interference, and (2) this device must accept any interference, including interference that may cause undesired operation of the device. Operation in the band 5150-5250 MHz is only for indoor use to reduce the potential for harmful interference to co-channel mobile satellite systems. Users are advised that high-power radars are allocated as primary users (i.e., priority users) of the bands 5250-5350 MHz and 5650-5850 MHz and that these radars could cause interference and/or damage to LE-LAN devices. Le prĂŠsent appareil est conforme aux CNR dâIndustrie Canada applicables aux appareils radio exempts de licence. Lâexploitation est autorisĂŠe aux deux conditions suivantes : (1) lâappareil ne doit pas produire de brouillage, et (2) lâutilisateur de lâappareil doit accepter tout brouillage radioĂŠlectrique subi, mĂŞme si le brouillage est susceptible dâen compromettre le fonctionnement. .CDCPFG/*\GUVToUGTXoUWPKSWGOGPVRQWTWPGWVKNKUCVKQPiN¨KPVoTKGWTC°PFG ToFWKTGNGUTKUSWGUFGDTQWKNNCIGRToLWFKEKCDNGCWZU[UVpOGUFGUCVGNNKVGUOQDKNGUWVKNKUCPVNGU mĂŞmes canaux. Les utilisateurs ĂŞtes avisĂŠs que les utilisateurs de radars de haute puissance sont dĂŠsignĂŠs utilisateurs principaux (c.-Ă -d., quâils ont la prioritĂŠ) pour les bandes 5 250-5 350 MHz et 5 650-5 850 MHz et que ces radars pourraient causer du brouillage et/ou des dommages aux dispositifs LAN-EL. CAN ICES-3 (B)/NMB-3(B) Disposal and recycling information Your iPad and/or battery should not be disposed of with household waste. Dispose of your iPad and/or battery in accordance with local environmental laws and guidelines. For information about Appleâs recycling program and recycling collection points visit www.apple.com/recycling. For information about Appleâs restricted substances and other environmental initiatives, visit www.apple.com/environment. Battery replacement: The lithium-ion battery in iPod touch should be replaced only by Apple or an Apple Authorized Service Provider. For more information about battery replacement services, go to www.apple.com/batteries/replacement-and-recycling/. Appendix D Safety, Handling, & Support Apple Confidential 160 DRAFT %CNKHQTPKC$CVVGT[%JCTIGT'PGTI['ĂEKGPE[ TĂźrkiye TĂźrkiye Cumhuriyeti: EEE YĂśnetmeliÄine Uygundur. Taiwan Battery Statement China Battery Statement European UnionâDisposal Information The symbol above means that according to local laws and regulations your product and/or its battery shall be disposed of separately from household waste. When this product reaches its end of life, take it to a collection point designated by local authorities. The separate collection and recycling of your product and/or its battery at the time of disposal will help conserve natural resources and ensure that it is recycled in a manner that protects human health and the environment. BrasilâInformaçþes sobre descarte e reciclagem O sĂmbolo indica que este produto e/ou sua bateria nĂŁo devem ser descartadas no lixo domĂŠstico. Quando decidir descartar este produto e/ou sua bateria, faça-o de acordo com as leis e diretrizes ambientais locais. Para informaçþes sobre o programa de reciclagem da Apple, pontos de coleta e telefone de informaçþes, visite www.apple.com/br/environment. InformaciĂłn sobre eliminaciĂłn de residuos y reciclaje El sĂmbolo indica que este producto y/o su baterĂa no debe desecharse con los residuos domĂŠsticos. Cuando decida desechar este producto y/o su baterĂa, hĂĄgalo de conformidad con las leyes y directrices ambientales locales. Para obtener informaciĂłn sobre el programa de TGEKENCLGFG#RRNGRWPVQUFGTGEQNGEEKxPRCTCTGEKENCLGUWUVCPEKCUTGUVTKPIKFCU[QVTCUKPKEKCVKXCU ambientales, visite www.apple.com/la/environment. Appendix D Safety, Handling, & Support Apple Confidential 161 DRAFT ENERGY STARÂŽ compliance statement To save energy, iPad is set to lock after two minutes of user inactivity. To change this setting, go to Settings > General > Auto-Lock. To unlock iPad, press the Sleep/Wake button or the Home button. K2CFOGGVUVJG'0'4);56#4IWKFGNKPGUHQTGPGTI[GĂEKGPE[4GFWEKPIGPGTI[EQPUWORVKQP saves money and helps conserve valuable resources. For more information about ENERGY STAR, go to www.energystar.gov. Apple and the environment At Apple, we recognize our responsibility to minimize the environmental impacts of our operations and products. For more information, go to www.apple.com/environment. Appendix D Safety, Handling, & Support Apple Confidential 162 DRAFT ENERGY STARÂŽ is a U.S. registered trademark. Apple Inc. Š 2014 Apple Inc. All rights reserved. Apple, the Apple logo, AirDrop, AirPlay, AirPort, Apple TV, FaceTime, Finder, GarageBand, Guided Access, iBooks, iMessage, iPad, iPhone, iPod, iPod touch, iSight, iTunes, Keychain, Keynote, Mac, Numbers, OS X, Pages, Photo Booth, Safari, Siri, Smart Cover, and Spotlight, are trademarks of Apple Inc., registered in the U.S. and other countries. AirPrint, EarPods, Flyover, iPad Air, iPad mini, Lightning, MultiTouch, and Touch ID are trademarks of Apple Inc. Apple Store, Genius, iAd, iCloud, iTunes Extras, iTunes Match, iTunes Plus, iTunes Store, iTunes U, and the Podcast logo are service marks of Apple Inc., registered in the U.S. and other countries. App Store, iBooks Store, and iTunes Radio are service marks of Apple Inc. IOS is a trademark or registered trademark of Cisco in the U.S. and other countries and is used under license. The BluetoothÂŽ word mark and logos are registered trademarks owned by Bluetooth SIG, Inc. and any use of such marks by Apple Inc. is under license. Adobe and Photoshop are trademarks or registered trademarks of Adobe Systems Incorporated in the U.S. and/or other countries. Other company and product names mentioned herein may be trademarks of their respective companies. Some apps are not available in all areas. App availability is UWDLGEVVQEJCPIG %QPVGPVCXCKNCDNGQPK6WPGU6KVNGCXCKNCDKNKV[KUUWDLGEV to change. Mention of third-party products is for informational purposes only and constitutes neither an endorsement nor a recommendation. Apple assumes no responsibility with regard to the performance or use of these products. All understandings, agreements, or warranties, if any, take place directly between the vendors and the prospective users. Every GĂQTVJCUDGGPOCFGVQGPUWTGVJCVVJGKPHQTOCVKQPKPVJKU manual is accurate. Apple is not responsible for printing or clerical errors. 019-xxxxx/2014-10 Apple Confidential
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.6 Linearized : No Encryption : Standard V4.4 (128-bit) User Access : Extract Apple Keywords : Author : Kim Ross Create Date : 2014:09:11 20:43:25Z Modify Date : 2014:09:12 13:12:27-07:00 Subject : Has XFA : No XMP Toolkit : Adobe XMP Core 5.4-c005 78.147326, 2012/08/23-13:03:03 Format : application/pdf Creator : Kim Ross Description : Title : ipad-sign-off-taos-9-10-14 Creator Tool : Preview Metadata Date : 2014:09:12 13:12:27-07:00 Keywords : Producer : Mac OS X 10.9.4 Quartz PDFContext Document ID : uuid:5e245056-fc7a-7241-90ba-769571e31fa8 Instance ID : uuid:2caec8a6-abe2-f342-b543-c47baa049c11 Page Count : 163EXIF Metadata provided by EXIF.tools