Apple E2380B Smart Cellular Telephone User Manual iPhone User Guide
Apple Inc. Smart Cellular Telephone iPhone User Guide
  
    Apple   >  
Contents
- 1. 08 user guide final
 - 2. CRN 39557 Final version of user manual
 - 3. HAC mode implementation
 
CRN 39557 Final version of user manual

iPhone
User Guide
For iOS 4.2 and 4.3 Software

Contents
9  Chapter 1:   iPhone at a Glance
9  About This Guide
9  iPhone Overview
11  Buttons
14 iPhone Apps
17 Status Icons
19 Chapter 2:   Getting Started
19 Viewing the User Guide on iPhone
19 What You Need
20  Installing the SIM Card
21 Activating iPhone
21 Setting Up iPhone
22 Disconnecting iPhone from Your Computer
22 Connecting to the Internet
25  Adding Mail, Contacts, and Calendar Accounts
29  Chapter 3:   Basics
29  Using Apps
33 Customizing the Home Screen
37 Typing
41 Printing
43  Searching
44 Voice Control
46  Apple Earphones with Remote and Mic
47  Bluetooth Devices
48  Battery
50  Security Features
51 Cleaning iPhone
51 Restarting or Resetting iPhone
52 Chapter 4:   Syncing and File Sharing
52 About Syncing
52 Syncing Accounts
2

53 Syncing with iTunes
54  iPhone Settings Panes in iTunes
57 Automatic iTunes Syncing
58 Manually Managing Content
58 Transferring Purchased Content to Another Computer
59 File Sharing
60  Chapter 5:   Phone
60  Phone Calls
68  Visual Voicemail
70  Contacts
70  Favorites
70  Call Forwarding, Call Waiting, and Caller ID
72 Ringtones and the Ring/Silent Switch 
73 International Calls
75 Chapter 6:   Mail
75 Setting Up Email Accounts
76 Checking and Reading Email
78 Using Links and Detected Data
79 Viewing Attachments
80  Printing Messages and Attachments
81 Sending Email
82  Organizing Email
84  Searching Email
85 Chapter 7:   Safari
85 Viewing Webpages
88  Searching
89  Printing Webpages, PDFs, and Other Documents
89  Viewing Web Videos on a TV
89  Bookmarks
90  Web Clips
91 Chapter 8:   iPod
91 Getting Music, Videos, and More
91 Music and Other Audio
100  Videos
104  Home Sharing
104  Setting a Sleep Timer
105  Changing the Browse Buttons
3
Contents

106  Chapter 9:   Messages
106  Sending and Receiving Messages
108  Searching Messages
108  Sharing Photos and Videos
109  Sending Voice Memos
109  Editing Conversations
110  Using Contact Information and Links
110  Managing Previews and Alerts
111  Chapter 10:   Calendar
111  About Calendar
111  Syncing Calendars
112  Viewing Your Calendars
113  Searching Calendars
113  Adding and Updating Events on iPhone
114  Responding to Meeting Invitations
116  Subscribing to Calendars
116  Importing Calendar Files from Mail
116  Alerts
117  Chapter 11:   Photos
117  About Photos
117  Syncing Photos and Videos with Your Computer
118  Viewing Photos and Videos
120  Deleting Photos and Videos
120  Slideshows
121  Viewing Photos, Slideshows, and Videos on a TV
121  Sharing Photos and Videos
124  Printing Photos
124  Assigning a Photo to a Contact
124  Wallpaper
125  Chapter 12:   Camera
125  About Camera
126  Taking Photos and Recording Videos
127  Viewing and Sharing Photos and Videos
128  Trimming Videos
128  Uploading Photos and Videos to Your Computer
129  Chapter 13:  YouTube
129  Finding and Viewing Videos
130  Controlling Video Playback
131  Watching YouTube Videos on a TV
4Contents

131  Managing Videos
132 Getting More Information
133 Using YouTube Account Features
134  Changing the Browse Buttons
134  Sending Videos to YouTube
135  Chapter 14:   Stocks
135  Viewing Stock Quotes
136  Getting More Information
137 Chapter 15:   Maps
138  Finding and Viewing Locations
142  Getting Directions
144 5JQYKPI6TCÓE%QPFKVKQPs
144 Finding and Contacting Businesses
145  Sharing Location Information
145  Bookmarking Locations
146  Chapter 16:  Weather
146  Viewing Weather Summaries
147  Getting More Weather Information
148  Chapter 17:   Notes
148  About Notes
148  Syncing Notes
149  Writing and Reading Notes
150  Searching Notes
150  Emailing Notes
151 Chapter 18:  Clock
151 World Clocks
152 Alarms
153 Stopwatch
153 Timer
154  Chapter 19:  Calculator
154  Using the Calculator
154  Standard Memory Functions
155 5EKGPVK°E%CNEWNCVQT-G[s
157 Chapter 20:  Compass
157 Getting Compass Readings
158 Compass and Maps
5
Contents

160  Chapter 21:  Voice Memos
160  Recording Voice Memos
161 Listening to Voice Memos
162 Managing Voice Memos
163 Trimming Voice Memos
163 Sharing Voice Memos
164  Syncing Voice Memos
165 Chapter 22:   iTunes Store
165 About the iTunes Store
166  Finding Music, Videos, and More
167 Following Artists and Friends
169 Purchasing Ringtones
170  Purchasing Music or Audiobooks
170  Purchasing or Renting Videos
172 Streaming or Downloading Podcasts
172 Checking Download Status
173 Syncing Purchased Content
173 Changing the Browse Buttons
174 Viewing Account Information
174 Verifying Downloads
175  Chapter 23:  App Store
175  About the App Store
176 Browsing and Searching
177 Info Screen
178 Downloading Apps
179 Deleting Apps
179 Writing Reviews
180  Updating Apps
180  Syncing Purchased Apps
181 Chapter 24:   Game Center
181 About Game Center
181 Setting Up Game Center
182  Games
185 Friends
186  Your Status and Account Information
187 Chapter 25:   Settings
187 Airplane Mode
189  Wi-Fi
189  VPN
6Contents

190  Personal Hotspot
190  0QVK°ECVKQPs
190  Carrier
191 Sounds and the Ring/Silent Switch
191 Brightness
192 Wallpaper
192 General
202  Mail, Contacts, Calendars
206  Phone
208  Safari
209  Messages
210 iPod
211 Photos
211 Notes
212 Store
212 Nike + iPod
213 Chapter 26:   Contacts
213 About Contacts
213 Adding Contacts
214 Searching Contacts
215 Managing Contacts on iPhone
216 Using Contact Information
217 7PK°GF%QPVCEVs
219 Chapter 27:   Nike + iPod
219 Activating Nike + iPod
220  Linking a Sensor
220  Working Out with Nike + iPod
221 Sending Workouts to Nikeplus.com
222 Calibrating Nike + iPod
222 Nike + iPod Settings
223 Chapter 28:   iBooks
223 About iBooks
224  Syncing Books and PDFs
224  Using the iBookstore
225  Reading Books
226 Reading PDFs
226 Changing a Book’s Appearance
227 Searching Books and PDFs
227 .QQMKPIWRVJG&G°PKVKQPQHC9QTd
227 Having a Book Read to You
7
Contents

227 Printing or Emailing a PDF
228  Organizing the Bookshelf
228  Bookmark and Note Syncing
229  Chapter 29:   Accessibility
229  Universal Access Features
230  VoiceOver
243  Zoom
243  Large Text
244  White on Black
244  Mono Audio
244  Speak Auto-text
245  Triple-Click Home
245  Closed Captioning and Other Helpful Features
247  Hearing Aid Compatibility
248  Appendix A:  International Keyboards
248  #FFKPI-G[DQCTFs
249  5YKVEJKPI-G[DQCTFs
249  Chinese
251  Japanese
252  -QTGCn
252  Vietnamese
253  Creating Dictionaries
254  Appendix B:  Support and Other Information
254  Apple iPhone Support Site
254  Restarting and Resetting iPhone
255  Backing Up iPhone
256  Updating and Restoring iPhone Software
258  Safety, Software, and Service Information
259  Using iPhone in an Enterprise Environment
259  Using iPhone with Other Carriers
260  Disposal and Recycling Information
261 Apple and the Environment
261 iPhone Operating Temperature
262 Index
8Contents

iPhone at a Glance 1
About This Guide
This guide describes the features of:
iOS 4.2. x on an iPhone 4 CDMA model
iOS 4.3 on an iPhone 3GS model or iPhone 4 GSM model 
iPhone Overview
iPhone 4
/LHKZL[°QHJR
9LJLP]LY
9PUN:PSLU[
Z^P[JO
;VW
TPJYVWOVUL
=VS\TL
I\[[VUZ
(WWSL9L[PUH
KPZWSH`
:WLHRLY
/VTL°I\[[VU
-YVU[JHTLYH
4HPUJHTLYH
3,+MSHZO
:04°JHYK°[YH`
.:4TVKLS
+VJR
JVUULJ[VY
6U6MM
:SLLW>HRL
)V[[VT
TPJYVWOVUL
(WWPJVUZ
:[H[\Z°IHY
L3KRQH
9

iPhone 3GS
L3KRQH
/LHKZL[QHJR
9LJLP]LY
9PUN:PSLU[
Z^P[JO *HTLYH
:04JHYK[YH`
=VS\TL
I\[[VUZ
;V\JOZJYLLU
:WLHRLY
+VJR
JVUULJ[VY
/VTLI\[[VU
6U6MM
:SLLW>HRL
4PJYVWOVUL
(WWPJVUZ
:[H[\ZIHY
;QWT*QOGUETGGPOC[NQQMFKÒGTGPVFGRGPFKPIQPVJGOQFGNQHK2JQPG[QWJCXG
and whether you’ve rearranged its icons.
Accessories
The following accessories are included with iPhone:
+VJR*VUULJ[VY[V<:)*HISL
(WWSL,HYWOVULZ
^P[O9LTV[LHUK4PJ
:04LQLJ[[VVS
<:)WV^LYHKHW[LY
Note:  The SIM eject tool is not included in all countries or regions.
10 Chapter 1    iPhone at a Glance

Item What you can do with it
Apple Earphones with Remote and Mic Listen to music, videos, and phone calls. Use 
the built-in microphone to talk. Press the center 
button to answer or end a call. When listening to 
iPod, press the button to play or pause a song, or 
press twice quickly to skip to the next track. Use 
the + and – buttons to adjust the volume. Press 
and hold the center button to use Voice Control.
Dock Connector to USB Cable Use this cable to connect iPhone to your 
computer to sync and charge. The cable can be 
used with the optional dock or plugged directly 
into iPhone.
USB power adapter Connect the power adapter to iPhone using 
the included cable, then plug it into a standard 
power outlet to charge iPhone.
SIM eject tool (not included in all countries or 
regions)
Eject the SIM card tray.
Buttons
#HGYUKORNGDWVVQPUOCMGKVGCU[VQVWTPK2JQPGQPQTQÒCFLWUVVJGXQNWOGCPF
switch between ring and silent modes.
1P1Ò5NGGR9CMG$WVVQP
9JGP[QW¨TGPQVCEVKXGN[WUKPIK2JQPG[QWECPNQEMKVVQVWTPQÒVJGFKURNC[CPFUCXG
the battery. 
When iPhone is locked, nothing happens if you touch the screen. iPhone can still 
receive calls, text messages, and other updates. You can also:
listen to music 
adjust the volume using the buttons on the side of iPhone (or on the iPhone  
earphones) while you’re on a phone call or listening to music
use the center button on iPhone earphones to answer or end a call, or to control  
audio playback (see “Controlling Audio Playback” on page 92)
By default, iPhone locks if you don’t touch the screen for a minute.
6U6MM:SLLW
>HRLI\[[VU
11
Chapter 1    iPhone at a Glance

Lock iPhone 2TGUUVJG1P1Ò5NGGR9CMGDWVVQP
Unlock iPhone Press the Home  DWVVQPQTVJG1P1Ò 
Sleep/Wake button, then drag the slider.
6WTPK2JQPGEQORNGVGN[QÒ 2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPHQT
a few seconds until the red slider appears, then 
FTCIVJGUNKFGT9JGPK2JQPGKUQÒKPEQOKPIECNNU
go straight to voicemail.
Turn iPhone on 2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQP
until the Apple logo appears.
For information about changing how long before iPhone locks, see “Auto-Lock” on 
page 195. For information about setting iPhone to require a passcode to unlock it, see 
“Passcode Lock” on page 195.
Home Button
Press the Home   button at any time to go to the Home screen, which contains your 
iPhone apps. Tap any app icon to get started. To see apps you’ve recently used, double-
click the Home button. See “Opening and Switching Apps” on page 29.
Volume Buttons
When you’re on the phone or listening to songs, movies, or other media, the buttons 
on the side of iPhone adjust the audio volume. Otherwise, the buttons control the 
XQNWOGHQTVJGTKPIGTCNGTVUCPFQVJGTUQWPFGÒGEVU
WARNING:  For important information about avoiding hearing loss, see the Important 
Product Information Guide at www.apple.com/support/manuals/iphone. 
To adjust the volume, use the buttons on the side of iPhone.
=VS\TL
\W
=VS\TL
KV^U
To set a volume limit for music and videos on iPhone, see “Music” on page 210.
12 Chapter 1    iPhone at a Glance

Ring/Silent Switch
Flip the Ring/Silent switch to put iPhone in ring   mode or silent   mode.
9PUN
:PSLU[
In ring mode, iPhone plays all sounds. In silent mode, iPhone doesn’t ring or play alerts 
CPFQVJGTUQWPFGÒGEVU
Important:  Clock alarms, audio apps such as iPod, and many games still play sounds 
through the built-in speaker when iPhone is in silent mode.
By default, when you get a call, iPhone vibrates whether it’s in ring mode or silent 
OQFG+HK2JQPGKUKPTKPIOQFG[QWECPUKNGPEGCECNND[RTGUUKPIVJG1P1Ò 
Sleep/Wake button or one of the volume buttons. Press a second time to send the  
call to voicemail.
For information about changing sound and vibrate settings, see “Sounds and the 
Ring/Silent Switch” on page 191.
13
Chapter 1    iPhone at a Glance

iPhone Apps
The apps in the following table are included with iPhone.
Note:  App functionality and availability may vary, depending on the country or region 
where you purchase and use iPhone.
Phone
Make calls, with quick access to recent callers, favorites, and all your contacts. Dial 
manually using the numeric keypad. Or just use voice dialing. Visual voicemail presents 
a list of your voicemail messages—just tap to listen to any message, in any order. Make 
FaceTime video calls (iPhone 4). See Chapter 5, “Phone,” on page 60.
Mail
iPhone works with MobileMe, Microsoft Exchange, and many of the most popular email 
systems—including Yahoo!, Google, and AOL—as well as most industry-standard POP3 
and IMAP email systems. View and print PDFs and other attachments. Save attached 
photos and graphics to your Camera Roll album. See Chapter 6, “Mail,” on page 75.
Safari
Browse websites over a cellular data network or over Wi-Fi. Rotate iPhone sideways 
HQTYKFGUETGGPXKGYKPI&QWDNGVCRVQ\QQOKPQTQWV¤5CHCTKCWVQOCVKECNN[°VUVJG
webpage column to the iPhone screen for easy reading. Open multiple pages. Sync 
bookmarks with Safari or Microsoft Internet Explorer on your computer. Add Safari web 
clips to the Home screen for fast access to favorite websites. Save images from websites 
to your Photo Library. Print webpages, PDFs, and other documents that open in Quick 
Look. See Chapter 7, “Safari,” on page 85.
iPod
Listen to your songs, audiobooks, and podcasts. Create playlists, or use Genius to create 
playlists for you. Listen to Genius Mixes of songs from your library. Watch movies and 
video podcasts in widescreen. Use AirPlay to stream your music or videos wirelessly to 
an Apple TV or compatible audio system. See Chapter 8, “iPod,” on page 91.
Messages
Send and receive SMS text messages. View a list of your previous conversations, and 
tap a conversation to see the messages you sent and received. Send photos, video clips, 
contact information, and voice memos to MMS devices. See Chapter 9, “Messages,” on 
page 106.
Calendar
View and search your MobileMe, iCal, Microsoft Entourage, Microsoft Outlook, or 
Microsoft Exchange calendars. Enter events on iPhone and they sync back to the 
calendar on your computer. Subscribe to calendars. See the birthdays you’ve entered 
in Contacts. Set alerts to remind you of events, appointments, and deadlines. See 
Chapter 10, “Calendar,” on page 111.
Photos
View photos and videos you take with iPhone, save them from incoming messages, 
or sync them from your computer. View videos in portrait or landscape orientation. 
Zoom in on photos for a closer look. Print them, or watch a slideshow. Email photos 
and videos, send them in MMS messages, or publish them to a MobileMe gallery. 
Assign photos to contacts, or use them as wallpaper. View photos by place, and if you 
sync with iPhoto 8.0 (part of iLife ‘09) or later, view photos by events and faces. See 
Chapter 11 , “Photos,” on page 117.
14 Chapter 1    iPhone at a Glance

Camera
Take photos and record videos. View them on iPhone, email them, text them, or upload 
them to your computer. Tap to focus on an object or area. Trim and save video clips. 
Upload videos straight to YouTube. Take a friend’s picture and set iPhone to display it 
when that person calls you. See Chapter 12, “Camera,” on page 12 5.
YouTube
Play videos from YouTube’s online collection. Search for any video, or browse featured, 
most viewed, most recently updated, and top-rated videos. Set up and log in to your 
YouTube account—then rate videos, sync your favorites, view subscriptions, and more. 
Use AirPlay to stream YouTube videos to an Apple TV. Upload your own videos taken 
with iPhone. See Chapter 13, “YouTube,” on page 129.
Stocks
Watch your favorite stocks, updated automatically from the Internet. View company 
news and current trading information, such as opening or average price, trading 
volume, or market capitalization. Rotate iPhone to see detailed charts in landscape 
QTKGPVCVKQP&TCI[QWT°PIGTCNQPIVJGEJCTVUVQVTCEMRTKEGRQKPVUQTWUGVYQ°PIGTU
to see a range between points. See Chapter 14, “Stocks,” on page 135.
Maps
See street maps, satellite views, and hybrid views of locations around the world. 
Zoom in for a closer look, or check out Google Street View. Find and track your 
current (approximate) location. See which way you’re facing using the built-in 
compass. Get detailed driving, public transit, or walking directions, and see current 
JKIJYC[VTCÓEEQPFKVKQPU(KPFCPGCTD[DWUKPGUUCPFECNNKVYKVJCUKPINGVCR5GG
Chapter 15, “Maps,” on page 137.
Weather
Get current weather conditions and a six-day forecast. Add your favorite cities for a 
quick weather report anytime. See Chapter 16, “Weather,” on page 14 6.
Notes
Jot notes on the go—reminders, grocery lists, brilliant ideas. Send them in email. Sync 
notes to Mail on your Mac, or to Microsoft Outlook or Outlook Express on your PC. 
Sync notes over the air with your MobileMe, Google, Yahoo!, or IMAP accounts. See 
Chapter 17, “Notes,” on page 148.
Clock
In the Utilities folder. View the time in cities around the world—create clocks for your 
favorites. Set one or more alarms. Use the stopwatch, or set a countdown timer. See 
Chapter 18, “Clock,” on page 151.
Calculator
In the Utilities folder. Add, subtract, multiply, and divide. Rotate iPhone sideways to use 
GZRCPFGFUEKGPVK°EHWPEVKQPU5GG%JCRVGT19, “Calculator,” on page 154.
Compass
In the Utilities folder. Use the built-in digital compass to determine your heading. 
Get your current coordinates. Choose between true north and magnetic north. See 
Chapter 20, “Compass,” on page 157.
15
Chapter 1    iPhone at a Glance

Voice 
Memos
In the Utilities folder. Record voice memos with iPhone. Play them back on iPhone, or 
sync them with iTunes to listen on your computer. Attach voice memos to email or 
MMS messages. See Chapter 21, “Voice Memos,” on page 160.
iTunes
Search the iTunes Store for music, movies, TV shows, audiobooks, and more. Browse, 
preview, and download new releases, get Genius recommendations, or see what’s on 
the top charts. Rent movies and TV shows to watch on iPhone. Stream and download 
RQFECUVU(QNNQY[QWTHCXQTKVGCTVKUVUCPFHTKGPFUVQ°PFQWVYJCVOWUKEVJG[¨TG
listening to and talking about. See Chapter 22, “iTunes Store,” on page 165.
App Store
Search the App Store for iPhone apps you can purchase or download using your Wi-Fi 
or cellular data network connection. Read reviews or write your own reviews for your 
favorite apps. Download and install the app on your Home screen. See Chapter 23, “App 
Store,” on page 175.
Game 
Center
Discover new games and share your game experiences with friends around the world. 
Invite a friend, or request a match with other worthy opponents. Check player rankings 
on the leaderboards. Earn achievements for extras points. See Chapter 24, “Game 
Center,” on page 181.
Settings
Set up accounts and adjust all iPhone settings in one convenient place. Set your own 
volume limit for listening comfort. Set your ringtone, wallpaper, screen brightness, and 
settings for network, phone, mail, web, music, video, photos, and more. Use Location 
Services settings to set location privacy options for Maps, Camera, Compass, and 
applicable third-party apps. Set auto-lock and a passcode for security. Restrict access 
to explicit iTunes content and certain apps. Reset iPhone. See Chapter 25, “Settings,” on 
page 187.
Contacts
Get contact information synced from MobileMe, Mac OS X Address Book, Yahoo! 
Address Book, Google Contacts, Windows Address Book (Outlook Express), Microsoft 
Outlook, or Microsoft Exchange. Search, add, change, or delete contacts, which get 
synced back to your computer. See Chapter 26, “Contacts,” on page 213.
Nike + iPod
Nike + iPod (which appears when you activate it in Settings) turns iPhone into a 
workout companion. Track your pace, time, and distance from one workout to the next, 
and choose a song to power through your routine. Requires select Nike shoes and a 
Nike + iPod Sensor, sold separately.) See Chapter 27, “Nike + iPod,” on page 219.
iBooks
Download the free iBooks app from the App Store for a great way to buy and read 
books. Get everything from classics to best sellers from the built-in iBookstore. 
Add ePub books and PDFs to your bookshelf using iTunes. Print PDFs. See 
Chapter 28, “iBooks,” on page 223.
16 Chapter 1    iPhone at a Glance

Status Icons
The icons in the status bar at the top of the screen give information about iPhone:
Status icon What it means
Cell signal* Shows whether you’re in range of the cellular network and 
can make and receive calls. The more bars, the stronger 
the signal. If there’s no signal, the bars are replaced with 
“No service.”
Airplane mode Shows that airplane mode is on—you cannot use the 
phone, access the Internet, or use Bluetooth® devices. 
Non-wireless features are available. See “Airplane Mode” on 
page 187.
UMTS/EV-DO Shows that your carrier’s 3G UMTS (GSM) or EV-DO 
(CDMA) network is available, and iPhone can connect to 
the Internet over that network. See “How iPhone Connects 
to the Internet” on page 22.
EDGE Shows that your carrier’s EDGE network is available (GSM 
models), and iPhone can connect to the Internet over that 
network. See “How iPhone Connects to the Internet” on 
page 22.
GPRS/1xRTT Shows that your carrier’s GPRS (GSM) or 1xRTT (CDMA) 
network is available, and iPhone can connect to the 
Internet over that network. See “How iPhone Connects to 
the Internet” on page 22.
Wi-Fi* Shows that iPhone is connected to the Internet over a 
Wi-Fi network. The more bars, the stronger the connection. 
See “Joining a Wi-Fi Network” on page 23.
Personal Hotspot Shows that iPhone is connected to another iPhone 
providing a Personal Hotspot (GSM models). See “Personal 
Hotspot” on page 24.
Network activity Shows over-the-air syncing or other network activity. 
Some third-party apps may also use the icon to show an 
active process.
Call Forwarding Shows that Call Forwarding is set up on iPhone (GSM 
models). See “Call Forwarding” on page 206.
VPN Shows that you’re connected to a network using VPN. See 
“Network” on page 193.
Lock Shows that iPhone is locked. See “1P1Ò5NGGR9CMG
Button” on page 11.
17
Chapter 1    iPhone at a Glance

Status icon What it means
TTY Shows that iPhone is set to work with a TTY machine. 
See “Using iPhone with a Teletype (TTY) Machine” on 
page 206.
Play Shows that a song, audiobook, or podcast is playing. See 
“Playing Songs and Other Audio” on page 92.
Portrait orientation lock Shows that the iPhone screen is locked in portrait 
orientation. See “Viewing in Portrait or Landscape 
Orientation” on page 32.
Alarm Shows that an alarm is set. See “Alarms” on page 152 .
Location services Shows that an app is using location services. See “Location 
Services” on page 194.
Bluetooth* Blue or white icon:  Bluetooth is on and a device, such as a 
headset or car kit, is connected. Gray icon:  Bluetooth is on, 
but no device is connected. No icon:  Bluetooth is turned 
QÒ5GG¥Bluetooth Devices” on page 47.
Battery Shows battery level or charging status. See “Battery” on 
page 48.
6JGWUGQHEGTVCKPCEEGUUQTKGUYKVJK2JQPGOC[CÒGEVYKTGNGUURGTHQTOCPEG
18 Chapter 1    iPhone at a Glance

Getting Started 2
WARNING:  To avoid injury, read all operating instructions in this guide  
and safety information in the iPhone Important Product Information Guide at  
www.apple.com/support/manuals/iphone before using iPhone.
Viewing the User Guide on iPhone
The iPhone User Guide can be viewed on iPhone by tapping the iPhone User Guide 
bookmark in Safari, or by installing the free iBooks app and downloading the user 
guide from the iBookstore.
View the user guide in Safari:  Tap  , then tap the iPhone User Guide bookmark.
To add an icon for the user guide to the Home screen, tap  , then tap “Add to Home 
5ETGGP¦6QXKGYVJGWUGTIWKFGKPCFKÒGTGPVNCPIWCIGVCR¥%JCPIG.CPIWCIG¦CVVJG
bottom of the screen on the main contents page.
View the user guide in iBooks:
  1  If you haven’t installed iBooks, open App Store, search for “iBooks” and tap it in the 
results list. Tap Free, then tap Install.
  2  Open iBooks and tap Store.
  3  Search for “iPhone User” and tap the user guide in the results list.
  4  Tap Free, then tap Get Book.
For more information about iBooks, see Chapter 28, “iBooks,” on page 223.
What You Need
To use iPhone, you need:
A wireless service plan with a carrier that provides iPhone service in your area 
A Mac or a PC with a USB 2.0 port and one of the following operating systems: 
Mac OS X v10.5.8 or later 
Windows 7, Windows Vista, or Windows XP Home or Professional (SP3) 
19

Screen resolution on your computer set to 1024 x 768 or higher 
iTunes 10.1.2 or later, available at  www.itunes.com/download
QuickTime 7.6.2 or later (for playing videos recorded with iPhone, on your computer) 
An Apple ID (such as an iTunes Store account or MobileMe account) for purchases  
from the iTunes Store or App Store
An Internet connection for your computer (broadband is recommended) 
Installing the SIM Card
If your SIM card (GSM models) wasn’t preinstalled, you must install it before you can 
use iPhone.
Installing the SIM Card in iPhone 4
4PJYV:04
JHYK
4PJYV:04
JHYK[YH`
7HWLYJSPW
VY:04
LQLJ[[VVS
Installing the SIM Card in iPhone 3GS
:04
JHYK
:04JHYK[YH`
7HWLYJSPWVY
:04LQLJ[[VVS
Install the SIM card:
  1  Insert the end of a paper clip or SIM eject tool into the hole on the SIM card tray.
2WUJ°TON[UVTCKIJVKPWPVKNVJGVTC[RQRUQWV
  2  Pull out the SIM card tray and place the SIM card in the tray as shown.
  3  With the tray aligned and the SIM card on top as shown, carefully replace the tray.
20 Chapter 2    Getting Started

Activating iPhone
You must activate iPhone by signing up for a service plan with an iPhone service 
carrier in your area and registering iPhone with the network.
Your iPhone may have been activated at the time of purchase. If it isn’t activated, 
contact your iPhone retailer or cellular service provider.
For more information about iPhone, go to www.apple.com/iphone.
Setting Up iPhone
Before you can use iPhone, you must set it up in iTunes. During setup, you can create a 
new Apple ID or specify an existing Apple ID for making purchases with iPhone. (The 
iTunes Store may not be available in all countries or regions.) iTunes also records the 
serial number of your iPhone in case you need it.
Set up iPhone:
  1  Download and install the latest version of iTunes from www.itunes.com/download.
  2  Connect iPhone to a USB 2.0 port on your Mac or PC using the cable that came  
with iPhone.
  3  Follow the onscreen instructions.
In the Set Up Your iPhone screen, select “Automatically sync contacts, calendars and 
DQQMOCTMU¦VQEQP°IWTGVJQUGKVGOUVQU[PECWVQOCVKECNN[YJGP[QWEQPPGEVK2JQPG
to your computer. You can also customize your sync settings in iTunes. See “Syncing 
with iTunes” on page 53.
Note:  If you have a visual impairment, VoiceOver can help you set up iPhone without 
a sighted assistant. VoiceOver describes aloud what appears on the screen, so you 
can use iPhone without seeing it. When you connect iPhone to your computer, iTunes 
detects whether you’re using a compatible screen reader on your computer, such as 
VoiceOver (Mac) or GW Micro Window-Eyes (PC), and automatically enables VoiceOver 
on iPhone. A sighted user can also enable VoiceOver on iPhone using Accessibility 
settings. (VoiceOver may not be available in all languages.) See “VoiceOver” on 
page 230. 
21
Chapter 2    Getting Started

Disconnecting iPhone from Your Computer
You can disconnect iPhone from your computer at any time. However, if you 
disconnect it while a sync is in progress, some data may not get synced until the next 
time you connect iPhone to your computer.
When iPhone is syncing with your computer, iPhone shows “Sync in Progress.” If you 
FKUEQPPGEVK2JQPGDGHQTGKV°PKUJGUU[PEKPIUQOGFCVCOC[PQVIGVVTCPUHGTTGF9JGP
the sync is complete, iTunes shows “iPhone sync is complete.”
Cancel a sync:  Drag the slider on iPhone. 
If you get a call during a sync, the sync is canceled and you can disconnect iPhone to 
CPUYGTVJGECNN%QPPGEVK2JQPGCHVGTVJGECNNVQ°PKUJU[PEKPI
Connecting to the Internet
iPhone connects to the Internet whenever you use Mail, Safari, YouTube, Stocks, Maps, 
Weather, the App Store, or the iTunes Store. 
How iPhone Connects to the Internet
iPhone connects to the Internet using either a Wi-Fi network or a cellular data network. 
iPhone does the following, in order, until connected:
Connects over the last Wi-Fi   network you used that’s available.
If no previously used Wi-Fi networks are available, iPhone shows a list of Wi-Fi  
networks in range. Tap a network and, if necessary, enter the password to join. 
Networks that require a password show the lock   icon next to them. You can 
prevent iPhone from automatically showing available networks. See “Wi-Fi” on 
page 189.
If no Wi-Fi networks are available or you choose not to join any, iPhone connects to  
the Internet over a cellular data network ( ,  , or  ). You can prevent iPhone from 
using cellular data in Settings. See “Network” on page 193.
If a Wi-Fi network or a cellular data network isn’t available, iPhone can’t connect to  
the Internet.
Note:  The 3G (UMTS) cellular network supports simultaneous voice and data 
communications on GSM models. For all other network connections (EDGE or GPRS 
on GSM models, or EV-DO or 1xRTT on a CDMA model), you can’t use Internet services 
while you’re on the phone unless iPhone also has a Wi-Fi connection to the Internet.
Many Wi-Fi networks can be used free of charge including, in some countries or 
regions, Wi-Fi hotspots provided by your iPhone carrier. Some Wi-Fi networks require 
a fee. To join a Wi-Fi network at a hotspot where charges apply, you can usually open 
Safari to see a webpage that allows you to sign up for service.
22 Chapter 2    Getting Started

Joining a Wi-Fi Network
The Wi-Fi settings let you turn on Wi-Fi and join Wi-Fi networks.
Turn on Wi-Fi:  Choose Settings > Wi-Fi and turn Wi-Fi on.
Join a Wi-Fi network:  Choose Settings > Wi-Fi, wait a moment as iPhone detects 
networks in range, then select a network (fees may apply to join some Wi-Fi networks). 
If necessary, enter a password and tap Join (networks that require a password appear 
with a lock   icon).
Once you join a Wi-Fi network manually, iPhone automatically connects to it whenever 
the network is in range. If more than one previously used network is in range, iPhone 
joins the one last used.
When iPhone is connected to a Wi-Fi network, the Wi-Fi   icon in the status bar at the 
top of the screen shows the connection strength. The more bars you see, the stronger 
the connection.
(QTKPHQTOCVKQPCDQWVEQP°IWTKPI9K(KUGVVKPIUUGG¥Wi-Fi” on page 189.
Cellular Data Network Access
iPhone can access the Internet through your iPhone carrier’s cellular network. Check 
the carrier’s network coverage in your area for availability.
If iPhone is connected to the Internet via the cellular data network, the UMTS/EV-DO ( ),  
EDGE ( ), or GPRS/1xRTT ( ) icon appears in the status bar.
Depending on your model of iPhone and the network connection, you may not be 
able to receive calls while iPhone transfers data over the cellular network—when 
downloading a webpage, for example.
GSM:  On an EDGE or GPRS connection, incoming calls may go directly to voicemail 
during data transfers. For incoming calls that you answer, data transfers are paused.
CDMA:  On EV-DO connections, data transfers are paused when you answer incoming 
calls. On 1xRTT connections, incoming calls may go directly to voicemail during data 
transfers. For incoming calls that you answer, data transfers are paused.
Data transfer resumes when you end the call.
Turn 3G on (GSM models):  In Settings, choose General > Network and tap Enable 3G.
When you’re outside your carrier’s network, you may be able to access the Internet 
through another carrier. To enable email, web browsing, and other data services 
whenever possible, turn Data Roaming on.
Turn Data Roaming on:  In Settings, choose General > Network and turn Data 
Roaming on.
23
Chapter 2    Getting Started

Important:  Roaming charges may apply. To avoid data roaming charges, make sure 
FCVCTQCOKPIKUVWTPGFQÒ
Internet Access on an Airplane
#KTRNCPGOQFGVWTPUQÒVJGK2JQPGEGNNWNCT9K(K$NWGVQQVJCPF)25VTCPUOKVVGTUCPF
receivers to avoid interfering with aircraft operation. Airplane mode disables many 
of the iPhone features. In some countries or regions, where allowed by the aircraft 
operator and applicable laws and regulations, you can turn on Wi-Fi while airplane 
mode is on, to:
Send and receive email 
Browse the Internet 
Sync your contacts, calendars, browser bookmarks, and notes over the air 
Stream YouTube videos 
Get stock quotes 
Get map locations 
Get weather reports 
Purchase music and apps 
You may also be allowed to turn on Bluetooth to use Bluetooth devices with iPhone.
For more information, see “Airplane Mode” on page 187.
VPN Access
VPN (virtual private network) provides secure access over the Internet to private 
networks, such as the network at your company or school. Use Network settings to 
EQP°IWTGCPFVWTPQP8205GG¥Network” on page 193.
Personal Hotspot
You can use Personal Hotspot (iPhone 4) to share an Internet connection with a 
computer or another Wi-Fi device—such as an iPod, iPad, or other iPhone—connected 
to your iPhone via Wi-Fi. You can also use Personal Hotspot to share an Internet 
connection with a computer that’s connected to your iPhone via Bluetooth or USB.
Note:  This feature may not be available in all countries or regions. Additional fees may 
apply. Contact your carrier for more information, including the number of devices that 
can share an Internet connection at the same time.
If the Set Up Personal Hotspot button appears in your General > Network settings, 
[QW°TUVPGGFVQUGVWRVJGUGTXKEGYKVJ[QWTECTTKGT;QWECPEQPVCEV[QWTECTTKGTD[
tapping that button.
Personal Hotspot works only if iPhone is connected to the Internet over the cellular 
data network.
24 Chapter 2    Getting Started

Share an Internet connection:
  1  In Settings, choose Personal Hotspot (or choose General > Network > Personal 
Hotspot, if Personal Hotspot settings aren’t available at the top level of Settings).
  2  Turn on Personal Hotspot.
  3  Connect a computer or other device to iPhone:
 Wi-Fi:  On the device, choose iPhone from the list of available Wi-Fi networks. Enter 
the Wi-Fi password for iPhone when prompted.
 USB:  Connect your computer to iPhone using the Dock Connector to USB Cable.  
In your computer’s Network preferences, choose iPhone.
1PC/CECRQRWRYKPFQYCRRGCTUVJG°TUVVKOG[QWEQPPGEVUC[KPI¥#PGY
PGVYQTMKPVGTHCEGJCUDGGPFGVGEVGF¦%NKEM0GVYQTM2TGHGTGPEGUEQP°IWTGVJG
network settings for iPhone, then click Apply. On a PC, use the Network Control 
2CPGNVQEQP°IWTGVJGK2JQPGEQPPGEVKQP
 Bluetooth:  On iPhone, choose Settings > General > Bluetooth and turn on 
Bluetooth. Then refer to the documentation that came with your computer to pair 
and connect iPhone with your device.
When a device is connected, a blue band appears at the top of the iPhone screen. 
Personal Hotspot remains on when you connect with USB, even when you aren’t 
actively using the Internet connection.
Note:  The Personal Hotspot   icon appears in the status bar of an iPhone (GSM 
models) using the Personal Hotspot of another iPhone.
Change the Wi-Fi password for iPhone:  In Settings, choose Personal Hotspot >  
Wi-Fi Password, then enter a password of at least 8 characters.
Changing the password disconnects any devices that are sharing the Internet 
connection.
Monitor your cellular data network usage:  In Settings, choose General > Usage.
Adding Mail, Contacts, and Calendar Accounts
About Accounts
iPhone works with MobileMe, Microsoft Exchange, and many of the most popular 
Internet-based email, contacts, and calendar service providers. If you don’t already 
have an email account, you can get a free account online at www.yahoo.com,  
www.google.com, or www.aol.com. You can also try MobileMe, free for 60 days, at 
www.me.com.
You can add contacts using an LDAP or CardDAV account if your company or 
organization supports it. See “Adding Contacts” on page 213.
25
Chapter 2    Getting Started

You can add a CalDAV calendar account. See “Syncing Calendars” on page 111.
You can subscribe to iCal (.ics) calendars or import them from Mail. See “Subscribing to 
Calendars” and “Importing Calendar Files from Mail” on page 116 .
Setting Up MobileMe Accounts
To use MobileMe on iPhone, you need to set up a MobileMe Free Account or a 
MobileMe Paid Subscription.
A MobileMe Free Account lets you use Find My iPhone (not available in all countries or 
regions), a feature that helps you locate and protect the information on your iPhone if 
it’s lost or stolen. See “Security Features” on page 50>.
A MobileMe Paid Subscription lets you use Find My iPhone, plus the following features:
Mail account at me.com 
Over-the-air syncing for contacts, calendars, bookmarks, and notes 
MobileMe Gallery for sharing photos and videos 
/QDKNG/GK&KUMHQTUVQTKPICPFUJCTKPI°NGU 
You can try out these features with a 60-day free trial at www.apple.com/mobileme. 
A MobileMe Free Account is available to any customer with an iPhone 4 running  
iOS 4.2 or later. If you’ve already created an account for the App Store or Game Center,  
you can use that Apple ID for your MobileMe Free Account. You can create a new 
#RRNG+&KH[QWFQP¨VCNTGCF[JCXGQPGQTKH[QWYCPVCFKÒGTGPV#RRNG+&HQT[QWT
MobileMe account.
Set up a MobileMe Free Account:
  1  In Settings, tap “Mail, Contacts, Calendars.”
  2  Tap Add Account, then tap MobileMe.
  3  Enter your Apple ID and password, or tap Create Free Apple ID.
  4  Follow the onscreen instructions.
Verify your email address, if required.
  5  Make sure Find My iPhone is turned on.
Only one MobileMe account at a time can be used for Find My iPhone and for syncing 
contacts, calendars, bookmarks, and notes.
To use Gallery, iDisk, and Find My iPhone on iPhone, download the free MobileMe 
Gallery, MobileMe iDisk, and Find My iPhone apps from the App Store.
26 Chapter 2    Getting Started

Setting Up Microsoft Exchange Accounts
To use Microsoft Exchange on iPhone, you need to add an account with your  
Microsoft Exchange account settings. See your service provider or system 
administrator for those settings. 
iPhone uses the Exchange ActiveSync protocol to sync email, calendars, and contacts 
over the air with the following versions of Microsoft Exchange: 
Exchange Server 2003 Service Pack 2 
Exchange Server 2007 Service Pack 1 
Exchange Server 2010 
When setting up the account, you can choose which Exchange services you want to 
use with iPhone:
Mail 
Contacts 
Calendars 
Services you turn on are synced automatically over the air without having to connect 
iPhone to your computer. See “Syncing Accounts” on page 52. 
You can set up multiple Exchange accounts.
Set up an Exchange account:
  1  In Settings, tap “Mail, Contacts, Calendars.”
  2  Tap Add Account, then tap Microsoft Exchange.
  3  Enter your complete email address, domain (optional), user name, password, and a 
description. The description can be whatever you like.
iPhone supports Microsoft’s Autodiscovery service, which uses your user name and 
password to determine the address of the Exchange server. If the server’s address 
can’t be determined, you’re asked to enter it. (Enter the complete address in the Server 
°GNF1PEG[QWEQPPGEVVQVJG'ZEJCPIGUGTXGT[QWOC[DGRTQORVGFVQEJCPIG[QWT
passcode to match the policies set on the server.
  4  Tap the items you want to use on iPhone (mail, contacts, and calendars) and set how 
many days of email you want to sync to iPhone.
27
Chapter 2    Getting Started

Setting Up Google, Yahoo!, and AOL Accounts
For many popular accounts (Google, Yahoo!, AOL), iPhone enters most of the settings 
for you. When setting up the account, you can choose which account services you 
want to use with iPhone. Services you turn on are synced automatically over the 
air without having to connect iPhone to your computer. See “Syncing Accounts” on 
page 52.
Set up an account:
  1  In Settings, tap “Mail, Contacts, Calendars.”
  2  Tap Add Account, then tap Google, Yahoo!, or AOL.
  3  Enter your name, complete email address, password, and a description. The description 
can be whatever you like.
  4  Tap the items you want to use on iPhone. Available items depend upon the service 
provider.
Setting Up Other Accounts
Choose Other Accounts to set up other accounts for mail (such as POP), contacts (such 
as LDAP or CardDAV), or calendars (such as CalDAV). Contact your service provider or 
system administrator to get the account settings you need.
Set up an account:
  1  In Settings, tap “Mail, Contacts, Calendars.”
  2  Tap Add Account, then tap Other.
  3  Choose the account type you want to add (Mail, Contacts, or Calendars).
  4  Enter your account information and tap Save.
28 Chapter 2    Getting Started

Basics 3
Using Apps
6JGJKIJTGUQNWVKQP/WNVK6QWEJUETGGPCPFUKORNG°PIGTIGUVWTGUOCMGKVGCU[VQWUG
iPhone apps.
Opening and Switching Apps
You open an app on iPhone by tapping its icon on the Home screen. 
Return to the Home screen:  Press the Home   button below the display.
Switch to another Home screen:  Flick left or right, or tap to the left or right of the row 
of dots.
)QVQVJG°TUV*QOGUETGGPPress the Home   button again.
View your recently used apps:  Double-click the Home   button.
29

Your most recently used apps appear at the bottom of the screen, in order starting 
from the left. Flick to see more apps.
Switch to another app:  Tap an app in the recents list.
Remove an app from the recents list:  Touch and hold the app icon until it begins to 
jiggle, then tap  . Removing an app from the recents list also forces it to quit.
The app is added to recent apps again the next time you open it.
Scrolling
Drag up or down to scroll. On some screens such as webpages, you can also scroll side 
to side.
&TCIIKPI[QWT°PIGTVQUETQNNYQP¨VEJQQUGQTCEVKXCVGCP[VJKPIQPVJGUETGGP
30 Chapter 3    Basics

Flick to scroll quickly.
You can wait for the scrolling to come to a stop, or touch anywhere on the screen  
to stop it immediately. Touching the screen to stop scrolling won’t choose or  
activate anything.
To quickly scroll to the top of a list, webpage, or email, just tap the status bar.
Find items in an indexed list:  Tap a letter to jump to items starting with that letter. 
&TCI[QWT°PIGTCNQPIVJGKPFGZVQUETQNNSWKEMN[VJTQWIJVJGNKUV
0UKL_
Choose an item:  Tap an item in the list.
&GRGPFKPIQPVJGNKUVVCRRKPICPKVGOECPFQFKÒGTGPVVJKPIU¤HQTGZCORNGKVOC[
open a new list, play a song, open an email, or show someone’s contact information so 
you can call that person.
31
Chapter 3    Basics

Zooming In or Out
When viewing photos, webpages, email, or maps, you can zoom in and out. Pinch your 
°PIGTUVQIGVJGTQTCRCTV(QTRJQVQUCPFYGDRCIGU[QWECPFQWDNGVCRVCRVYKEG
quickly) to zoom in, then double-tap again to zoom out. For maps, double-tap to zoom 
KPCPFVCRQPEGYKVJVYQ°PIGTUVQ\QQOQWV
Zoom is also an accessibility feature that lets you magnify the screen with any app 
you’re using, to help you see what’s on the display. See “Zoom” on page 243.
Viewing in Portrait or Landscape Orientation
Many iPhone apps let you view the screen in either portrait or landscape orientation. 
4QVCVGK2JQPGCPFVJGFKURNC[TQVCVGUVQQCFLWUVKPICWVQOCVKECNN[VQ°VVJGPGY
screen orientation.
You may prefer landscape orientation for viewing webpages in Safari, or when 
entering text, for example. In landscape orientation:
Webpages scale to the wider screen, making the text and images larger. 
The onscreen keyboard is larger, which may help increase your typing speed   
and accuracy.
32 Chapter 3    Basics

The following apps support both portrait and landscape orientation:
Mail 
Safari 
Messages 
Notes 
Contacts 
Stocks 
iPod 
Photos 
Camera  
Calculator 
Movies viewed in iPod and YouTube appear only in landscape orientation. Street views 
in Maps also appear only in landscape orientation.
Lock the screen in portrait orientation:  Double-click the Home  DWVVQP±KEMVJG
bottom of the screen from left to right, then tap  .
The portrait orientation lock ( ) icon appears in the status bar when the screen 
orientation is locked.
Customizing the Home Screen
You can customize the layout of icons on the Home screen—including the Dock 
icons along the bottom of the screen. If you want, arrange them over multiple Home 
screens. You can also organize apps by grouping them in folders.
Rearranging Icons
You can arrange the icons on your Home screen in any order you want.
Rearrange icons:
  1  Touch and hold any icon on the Home screen until it begins to jiggle.
  2  Arrange the icons by dragging them.
  3  Press the Home   button to save your arrangement.
You can also add links to your favorite webpages on the Home screen. See “Web 
Clips” on page 90.
When iPhone is connected to your computer, you can rearrange icons on the Home 
screen and the order of the screens. In iTunes, select iPhone in the Devices list, then 
click Apps at the top of the screen.
33
Chapter 3    Basics

Move an icon to another screen:  While arranging icons, drag an icon to the side of 
the screen.
Create additional Home screens:  9JKNGCTTCPIKPIKEQPU±KEMVQVJGTKIJVOQUV*QOG
screen, then drag an icon to the right edge of the screen until a new screen appears.
You can create up to 11 screens. The number of dots above the Dock shows the 
number of screens you have, and which screen you’re viewing.
Reset your Home screen to the default layout:  Choose Settings > General > Reset 
and tap Reset Home Screen Layout.
Resetting the Home screen removes any folders you’ve created and applies the default 
wallpaper to your Home screen.
Organizing with Folders
Folders let you organize icons on the Home screen. You can put up to 12 icons in a 
folder. iPhone automatically names a folder when you create it, based on the icons you 
use to create the folder, but you can change the name anytime you want. Like icons, 
folders can be rearranged by dragging them around the Home screen. You can move 
folders to a new Home screen or to the Dock.
Create a folder:  Touch and hold an icon until the Home screen icons begin to jiggle, 
then drag the icon onto another icon.
34 Chapter 3    Basics

iPhone creates a new folder that includes the two icons, and shows the folder’s name. 
;QWECPVCRVJGPCOG°GNFCPFGPVGTCFKÒGTGPVPCOG
You can also create folders within iTunes.
Create a folder using iTunes:  With iPhone connected to your computer, select iPhone 
in the Devices list in iTunes. Click Apps at the top of the screen, and on the Home 
screen near the top of the window, drag an app on top of another.
Add an icon to a folder While arranging icons, drag the icon onto the folder.
Remove an icon from a folder While arranging icons, tap to open the folder, then drag  
the icon out of the folder.
Open a folder Tap the folder. You can then tap an app icon to open  
that app.
Close a folder Tap outside the folder, or press the Home button.
Delete a folder Move all icons out of the folder. The folder is deleted 
automatically when empty.
Rename a folder While arranging icons, tap to open the folder, then tap the 
name at the top and use the keyboard to enter a new name. 
Press the Home   button to save your changes.
9JGP[QW°PKUJQTICPK\KPI[QWT*QOGUETGGPRTGUUVJG*QOG  button to save  
your changes.
Many apps, such as Phone, Messages, Mail, and the App Store, display an alert badge on 
their Home screen icon with a number (to indicate incoming items) or an exclamation 
mark (to indicate a problem). If these apps are contained in a folder, the badge appears 
on the folder. A badge with a number shows the total number of items you haven’t 
attended to, such as incoming phone calls, email messages, text messages, and updated 
apps to download. A badge with an exclamation mark indicates a problem with an app. 
35
Chapter 3    Basics

Adding Wallpaper
You can set an image or photo as wallpaper for the Lock screen. You can also set 
wallpaper for your Home screen. You can choose an image that came with iPhone, a 
photo from your Camera Roll, or a photo synced to iPhone from your computer.
The Lock screen wallpaper also appears when you’re on a call with someone you don’t 
have a contact photo for.
Set wallpaper:
  1  In Settings, choose Wallpaper, tap the image of the Lock and Home screens, then tap 
Wallpaper or an album.
  2  Tap to choose an image or photo. If you choose a photo, drag to position it and pinch 
to zoom in or out, until it looks the way you want.
  3  Tap Set, then choose whether you want to use the photo as wallpaper for your Lock 
Screen, Home screen, or both.
36 Chapter 3    Basics

Typing
The onscreen keyboard appears anytime you need to type.
Entering Text
Use the keyboard to enter text, such as contact information, email, text messages, and 
web addresses. The keyboard corrects misspellings, predicts what you're typing, and 
learns as you use it.
Depending on the app you’re using, the intelligent keyboard may suggest corrections 
as you type, to help prevent mistyped words.
Enter text:
  1 6CRCVGZV°GNFUWEJCUKPCPQVGQTPGYEQPVCEVVQDTKPIWRVJGMG[DQCTF
  2  Tap keys on the keyboard.
5VCTVD[V[RKPIYKVJLWUV[QWTKPFGZ°PIGT#U[QWIGVOQTGRTQ°EKGPV[QWECPV[RG
more quickly using two thumbs.
#U[QWV[RGGCEJNGVVGTCRRGCTUCDQXG[QWTVJWODQT°PIGT+H[QWVQWEJVJGYTQPI
MG[[QWECPUNKFG[QWT°PIGTVQVJGEQTTGEVMG[6JGNGVVGTKUP¨VGPVGTGFWPVKN[QW
TGNGCUG[QWT°PIGTHTQOVJGMG[
Delete the previous character Tap  .
Type uppercase Tap the Shift   key before tapping a letter. Or touch and 
hold the Shift key, then slide to a letter.
Quickly type a period and space &QWDNGVCRVJGURCEGDCT;QWECPVWTPVJKUHGCVWTGQPQTQÒ
KP5GVVKPIU )GPGTCN -G[DQCTF
37
Chapter 3    Basics

Turn caps lock on Double-tap the Shift   key. The Shift key turns blue, and 
all letters you type are uppercase. Tap the Shift key again 
VQVWTPECRUNQEMQÒ;QWECPVWTPVJKUHGCVWTGQPQTQÒKP
5GVVKPIU )GPGTCN -G[DQCTF
Show numbers, punctuation, or 
symbols
Tap the Number   key. Tap the Symbol   key to see 
additional punctuation and symbols.
Type letters or symbols that aren’t on  
the keyboard
Touch and hold the related letter or symbol, then slide to 
choose a variation.
Dictionary
For many languages, iPhone has dictionaries to help you type. The appropriate 
dictionary is activated when you select a supported keyboard. 
For a list of supported languages, see www.apple.com/iphone/specs.html.
iPhone uses the active dictionary to suggest corrections or complete the word you’re 
typing. You don’t need to interrupt your typing to accept the suggested word.
:\NNLZ[LK
^VYK
Accept or reject dictionary suggestions:
 BTo reject the suggested word, °PKUJV[RKPIVJGYQTFCU[QWYCPVKVVJGPVCRVJG¥Z¦VQ
dismiss the suggestion before typing anything else. Each time you reject a suggestion 
for the same word, iPhone becomes more likely to accept your word.
Note:  If you’re entering Chinese or Japanese, tap one of the suggested alternatives.
 BTo use the suggested word, type a space, punctuation mark, or return character.
iPhone also underlines words you’ve already typed that might be misspelled.
38 Chapter 3    Basics

Use spell checking to replace a misspelled word:  Tap the underlined word, then tap 
one of the suggested corrections.
If none of the suggestions is correct, you can correct the spelling of the selected word 
by retyping it. To leave the word unchanged, tap somewhere else in the message area.
6WTPCWVQEQTTGEVKQPQPQTQÒ%JQQUG)GPGTCN -G[DQCTFVJGPVWTP#WVQ%QTTGEVKQP
QPQTQÒ#WVQ%QTTGEVKQPKUQPD[FGHCWNV
6WTPURGNNEJGEMKPIQPQTQÒ%JQQUG)GPGTCN -G[DQCTFVJGPVWTP%JGEM5RGNNKPI
QPQTQÒ5RGNNEJGEMKPIKUQPD[FGHCWNV
Editing—Cut, Copy, and Paste
The touchscreen makes it easy to make changes to text you’ve entered. An onscreen 
magnifying glass helps you position the insertion point precisely where you need it. 
Grab points on selected text let you quickly select more or less text. You can also cut, 
copy, and paste text and photos within apps, or across multiple apps.
Position the insertion point:  Touch and hold to bring up the magnifying glass, then 
drag to position the insertion point.
Select text:  Tap the insertion point to display the selection buttons. Tap Select to 
select the adjacent word or tap Select All to select all text. You can also double-tap to 
select a word. In read-only documents, such as webpages, or email or text messages 
you’ve received, touch and hold to select a word.
39
Chapter 3    Basics

Drag the grab points to select more or less text.
Cut or copy text:  Select text, then tap Cut or Copy.
Paste text:  Tap the insertion point and tap Paste. The last text that you cut or copied is 
inserted. Or select text and tap Paste to replace the text.
Undo the last edit:  Shake iPhone and tap Undo.
Keyboard Layouts
You can use Settings to set the keyboard layouts for software and hardware keyboards. 
The available layouts depend on the keyboard language.
Select a keyboard layout:  +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN
-G[DQCTFUVJGPUGNGEVCMG[DQCTF(QTGCEJNCPIWCIG[QWECPOCMGUGRCTCVG
selections for both the onscreen software and any external hardware keyboards.
The software keyboard layout determines the layout of the keyboard on the iPhone 
screen. The hardware keyboard layout determines the layout of an Apple Wireless 
-G[DQCTFEQPPGEVGFVQK2JQPG.
Using an Apple Wireless Keyboard
(QTGCUGQHV[RKPI[QWECPWUGCP#RRNG9KTGNGUU-G[DQCTFCXCKNCDNGUGRCTCVGN[
6JG#RRNG9KTGNGUU-G[DQCTFEQPPGEVUXKC$NWGVQQVJUQ[QWOWUVRCKTVJGMG[DQCTF
with iPhone. See “Pairing a Bluetooth Device with iPhone” on page 47.
Once the keyboard is paired with iPhone, it connects whenever the keyboard is within 
range (up to 30 feet). You can tell that the keyboard is connected if the onscreen 
MG[DQCTFFQGUP¨VCRRGCTYJGP[QWVCRKPCVGZV°GNF
Switch the language when using a hardware keyboard:  Press and hold the 
Command key, then tap the space bar to display a list of available languages. Tap the 
URCEGDCTCICKPVQEJQQUGCFKÒGTGPVNCPIWCIG
Disconnect a wireless keyboard from iPhone:  Press and hold the power button on 
VJGMG[DQCTFWPVKNVJGITGGPNKIJVIQGUQÒ
40 Chapter 3    Basics

iPhone disconnects the keyboard when it’s out of range.
Unpair a wireless keyboard from iPhone:  In Settings, choose General > Bluetooth,  
tap   next to the device name, then tap “Forget this Device.”
;QWECPCRRN[FKÒGTGPVNC[QWVUVQCYKTGNGUUMG[DQCTF5GG#RRGPFKZA, “International 
-G[DQCTFU,” on page 248 and “-G[DQCTF.C[QWVU” on page 40.
Printing
About AirPrint
AirPrint lets you print wirelessly to AirPrint-enabled printers. You can print from  
these iOS apps:
Mail—email messages and attachments that can be viewed in Quick Look 
Photos—photos 
Safari—webpages, PDFs, and other attachments that can be viewed in Quick Look 
iBooks—PDFs 
Other apps available from the App Store may also support AirPrint.
An AirPrint-enabled printer doesn’t need setup—just connect it to the same Wi-Fi 
network as iPhone. (If you’re not sure whether your printer is AirPrint-enabled, refer to 
its documentation.)
For more information, go to support.apple.com/kb/HT4356.
Printing a Document
AirPrint uses your Wi-Fi network to send print jobs wirelessly to your printer. iPhone 
must be connected to the same wireless network as the AirPrint printer.
Print a document:
  1  Tap   or   (depending on the app you’re using), then tap Print.
  2  Tap Select Printer to select a printer.
  3  Set printer options such as number of copies and double-sided output (if the printer 
supports it). Some apps also let you set a range of pages to print.
41
Chapter 3    Basics

  4  Tap Print.
See the status of a print job:  Double-click the Home   button, then tap Print Center.
The Print Center app appears as the most recent app when a document is printing.  
A badge on the app icon shows how many documents are queued for printing.
If you’re printing more than one document, select a print job to see its status summary.
Cancel a print job:  Double-click the Home   button, tap Print Center, select the print 
job (if you’re printing more than one document), then tap Cancel Printing.
42 Chapter 3    Basics

Searching
You can search many apps on iPhone, including Mail, Calendar, iPod, Notes, Messages, 
and Contacts. You can search an individual app, or search all apps at once using Search.
Go to Search:  1PVJGOCKP*QOGUETGGP±KEMNGHVVQTKIJVQTRTGUUVJG*QOG  button.
From the Search screen, press the Home   button to return to the main Home  
screen page.
Search iPhone:  1PVJG5GCTEJUETGGPGPVGTVGZVKPVJG5GCTEJ°GNF5GCTEJTGUWNVU
appear as you type. Tap an item in the list to open it. Tap Search to dismiss the 
keyboard and see more results.
Icons next to the search results show which app the results are from. 
iPhone may display a top hit for you at the top of the list, based on your previous 
searches. The Safari search results include options to search the web or to search 
Wikipedia.
App What’s searched
Contacts First, last, and company names
Mail 6Q(TQOCPF5WDLGEV°GNFUQHCNNCEEQWPVUVJGVGZVQH
messages isn’t searched)
Calendar Event titles, invitees, locations, and notes
iPod Music (names of songs, artists, and albums) and the titles of 
podcasts, videos, and audiobooks
Messages Names and text of messages
Notes Text of notes
Search also searches the names of the native and installed apps on iPhone, so if you 
have a lot of apps, you may want to use Search to locate and open apps.
43
Chapter 3    Basics

Open apps from Search:  Enter the app name, then tap to open the app directly from 
the search results.
Use the Spotlight Search setting to specify which contents are searched and the order 
the results are presented in. See “Spotlight Search” on page 195.
Voice Control
Voice Control lets you make phone calls and control iPod music playback using  
voice commands. 
Note:  Voice Control may not be available in all languages.
Use Voice Control:  Press and hold the Home   button until the Voice Control screen 
appears and you hear a beep. You can also press and hold the center button on the 
iPhone earphones.
Use the following commands to make calls or play songs.
Call someone in contacts Say “call” or “dial,” then say the name of the person. If the 
person has more than one phone number, you can add 
“home” or “mobile,” for example.
Make a FaceTime call to someone in 
contacts (iPhone 4)
Say “FaceTime,” then say the name of the person. If the 
person has more than one phone number, you can add 
“home” or “mobile,” for example.
Dial a number Say “call” or “dial,” then say the number.
Control music playback Say “play” or “play music.” To pause, say “pause” or “pause 
music.” You can also say “next song” or “previous song.”
Play an album, artist, or playlist Say “play,” then say “album,” “artist,” or “playlist” and the name.
5JWÔGVJGEWTTGPVRNC[NKUV 5C[¥UJWÔG¦
Find out more about the currently  
playing song
Say “what’s playing,” “what song is this,” “who sings this 
song,” or “who is this song by.”
Use Genius to play similar songs Say “Genius,” “play more like this,” or “play more songs like this.”
Find out the current time Say “what time is it?” or “what is the time?”
Cancel Voice Control Say “cancel” or “stop.”
44 Chapter 3    Basics

For best results:
Speak into the iPhone microphone as if you were making a phone call. You can also  
use the microphone on your Bluetooth headset or compatible Bluetooth car kit.
Speak clearly and naturally. 
Say only iPhone commands and names, and numbers. Pause slightly between  
commands.
Use full names. 
For more about using Voice Control, including information about using Voice Control 
KPFKÒGTGPVNCPIWCIGUIQVQsupport.apple.com/kb/HT3597.
Voice Control normally expects you to speak voice commands in the language that’s 
set for iPhone (the setting in General > International > Language). Voice Control 
settings let you change the language for speaking voice commands. Some languages 
CTGCXCKNCDNGKPFKÒGTGPVFKCNGEVUQTCEEGPVU
Change the language or country:  In Settings, choose General > International >  
Voice Control and tap the language or country.
Voice Control for the iPod app is always on, but for better security you can prevent 
voice dialing when iPhone is locked.
Prevent voice dialing when iPhone is locked:  In Settings, choose General > Passcode 
.QEMCPFVWTP8QKEG&KCNQÒ7PNQEMK2JQPGVQWUGXQKEGFKCNKPI
See “Voice Dialing” on page 61 and “Using Voice Control with iPod” on page 95.
45
Chapter 3    Basics

Apple Earphones with Remote and Mic
The Apple Earphones with Remote and Mic included with iPhone feature a microphone, 
volume buttons, and an integrated button that allows you to answer and end calls 
easily, and control audio and video playback.
*LU[LYI\[[VU
Plug in the earphones to listen to music or make a phone call. Press the center button 
to control music playback and answer or end calls, even when iPhone is locked.
Pause a song or video Press the center button. Press again to resume playback.
Skip to the next song Press the center button twice quickly.
Return to previous song Press the center button three times quickly.
Fast-forward Press the center button twice quickly and hold.
Rewind Press the center button three times quickly and hold.
Adjust the volume Press the + or – button.
Answer an incoming call Press the center button.
End the current call Press the center button.
Decline an incoming call Press and hold the center button for about two seconds, 
VJGPNGVIQ6YQNQYDGGRUEQP°TO[QWFGENKPGFVJGECNN
Switch to an incoming or on-hold call 
and put the current call on hold
Press the center button. Press again to switch back to the 
°TUVECNN
Switch to an incoming or on-hold call 
and end the current call
Press and hold the center button for about two seconds, 
VJGPNGVIQ6YQNQYDGGRUEQP°TO[QWGPFGFVJG°TUVECNN
Use Voice Control Press and hold the center button. See “Voice Control” on 
page 44.
If you get a call while the earphones are plugged in, you can hear the ringtone 
through both the iPhone speaker and the earphones.
46 Chapter 3    Basics

Bluetooth Devices
;QWECPWUGK2JQPGYKVJVJG#RRNG9KTGNGUU-G[DQCTFCPFQVJGT$NWGVQQVJFGXKEGU
such as Bluetooth headsets, car kits, and stereo headphones. Third-party Bluetooth 
headphones may support volume and playback controls. See the documentation  
VJCVECOGYKVJ[QWT$NWGVQQVJFGXKEG(QTUWRRQTVGF$NWGVQQVJRTQ°NGUIQVQ 
support.apple.com/kb/HT3647.
Pairing a Bluetooth Device with iPhone
WARNING:  For important information about avoiding hearing loss and about  
driving safely, see the Important Product Information Guide at  
www.apple.com/support/manuals/iphone.
$GHQTG[QWECPWUGC$NWGVQQVJFGXKEGYKVJK2JQPG[QWOWUV°TUVRCKTVJGO
Pair a Bluetooth headset, car kit, or other device with iPhone:  
  1  Follow the instructions that came with the device to make it discoverable or to set it to 
search for other Bluetooth devices.
  2  In Settings, choose General > Bluetooth and turn Bluetooth on.
  3  Choose the device on iPhone, and enter its passkey or PIN number. See the 
instructions about the passkey or PIN that came with the device.
After you pair a Bluetooth device to work with iPhone, you must make a connection  
to have iPhone use the device for your calls. See the documentation that came with 
the device.
When iPhone is connected to a Bluetooth headset or car kit, outgoing calls are routed 
through the device. Incoming calls are routed through the device if you answer using 
the device, and through iPhone if you answer using iPhone.
Pair an Apple Wireless Keyboard with iPhone:  
  1  In Settings, choose General > Bluetooth and turn Bluetooth on.
  2 2TGUUVJGRQYGTDWVVQPQPVJG#RRNG9KTGNGUU-G[DQCTFVQVWTPKVQP
  3  On iPhone, select the keyboard listed under Devices.
  4  Type the passkey on the keyboard as instructed, then press Return.
Note:  ;QWECPRCKTQPN[QPG#RRNG9KTGNGUU-G[DQCTFYKVJK2JQPGCVCVKOG6QRCKTC
FKÒGTGPVMG[DQCTF[QWOWUV°TUVWPRCKTVJGEWTTGPVQPG
For more information, see “7UKPICP#RRNG9KTGNGUU-G[DQCTF” on page 40.
47
Chapter 3    Basics

Bluetooth Status
The Bluetooth icon appears in the iPhone status bar at the top of the screen:
  or  : Bluetooth is on and a device is connected to iPhone. (The color depends on 
the current color of the status bar.)
 : Bluetooth is on but no device is connected. If you’ve paired a device with iPhone, 
KVOC[DGQWVQHTCPIGQTVWTPGFQÒ
 No Bluetooth icon: $NWGVQQVJKUVWTPGFQÒ
Unpairing a Bluetooth Device from iPhone
You can unpair a Bluetooth device if you don’t want to use it with iPhone any more.
Unpair a Bluetooth device:  
  1  In Settings, choose General > Bluetooth and turn Bluetooth on.
  2  Tap   next to the device name, then tap “Forget this Device.”
Battery
iPhone has an internal rechargeable battery.
Charging the Battery
WARNING:  For important safety information about charging iPhone, see the 
Important Product Information Guide at www.apple.com/support/manuals/iphone. 
The battery icon in the upper-right corner shows the battery level or charging status. 
You can also display the percentage of the battery charge. See “Usage” on page 192.
*OHYNPUN *OHYNLK
Charge the battery:  Connect iPhone to a power outlet using the included Dock 
Connector to USB Cable and USB power adapter.
48 Chapter 3    Basics

Charge the battery and sync iPhone:  Connect iPhone to your computer using the 
included Dock Connector to USB Cable. Or connect iPhone to your computer using the 
included cable and the Dock, available separately.
Unless your keyboard has a high-powered USB 2.0 port, you must connect iPhone to a 
USB 2.0 port on your computer.
Important:  The iPhone battery may drain instead of charge if iPhone is connected to a 
EQORWVGTVJCV¨UVWTPGFQÒQTKUKPUNGGRQTUVCPFD[OQFG
If you charge the battery while syncing or using iPhone, it may take longer to charge. 
Important:  If iPhone is very low on power, it may display one of the following images, 
indicating that iPhone needs to charge for up to ten minutes before you can use it. 
If iPhone is extremely low on power, the display may be blank for up to two minutes 
before one of the low-battery images appears.
VY
Maximizing Battery Life
iPhone uses lithium-ion batteries. To learn more about how to maximize the battery 
life of iPhone, go to www.apple.com/batteries.
Replacing the Battery
Rechargeable batteries have a limited number of charge cycles and may eventually 
need to be replaced. The iPhone battery isn’t user replaceable; it can be replaced 
only by an authorized service provider. For more information, go to www.apple.com/
support/iphone/service/battery.
49
Chapter 3    Basics

Security Features
Security features help protect the information on iPhone from being accessed by others.
Passcodes and Data Protection
You can set a passcode that you must enter each time you turn on or wake up iPhone.
Set a passcode:  Choose Settings > General > Passcode Lock and enter a 4-digit 
passcode, then enter the passcode again to verify it. iPhone then requires you to enter 
the passcode to unlock it or to display the passcode lock settings.
Setting a passcode turns on data protection. Data protection uses your passcode as 
the key for encrypting mail messages and their attachments stored on iPhone. (Data 
protection may also be used by some apps available in the App Store.) A notice at  
the bottom of the Passcode Lock screen in Settings shows whether data protection  
is enabled.
6QKPETGCUGK2JQPGUGEWTKV[VWTPQÒ5KORNG2CUUEQFGCPFWUGCNQPIGTRCUUEQFGYKVJ
a combination of numbers, letters, punctuation, and special characters. See “Passcode 
Lock” on page 195.
Important:  On an iPhone 3GS that didn’t ship with iOS 4 or later, you must also restore 
iOS software to enable data protection. See “Restoring iPhone” on page 257.
Prevent voice dialing when iPhone is locked:  In Settings, choose General > Passcode 
.QEMCPFVWTP8QKEG&KCNQÒ7PNQEMK2JQPGVQWUGXQKEGFKCNKPI
Find My iPhone
Find My iPhone helps you locate and secure your iPhone using the free Find My 
iPhone app on another iPhone, iPad, or iPod touch, or using a Mac or PC with a web 
browser. Find My iPhone includes:
 Locate on a map:  View the approximate location of your iPhone on a full-screen map
 Display a Message or Play a Sound:  Lets you compose a message that will appear 
on your iPhone screen, or play a sound at full volume for two minutes, even if the 
Ring/Silent switch is set to silent
 Remote Passcode Lock:  Lets you remotely lock your iPhone and create a 4-digit 
passcode, if you haven’t set one previously
 Remote Wipe:  Lets you protect your privacy by erasing all media and data on 
iPhone, restoring it to factory settings
Use Find My iPhone:  You need to turn on Find My iPhone on iPhone before you can 
use these features. See “Setting Up MobileMe Accounts” on page 26.
To locate your missing iPhone and use the other Find My iPhone features, download 
the free Find My iPhone app from the App Store on another iOS device, or sign in to 
me.com in a web browser on a Mac or PC.
50 Chapter 3    Basics

Note:  Find My iPhone requires a MobileMe account. MobileMe is Apple’s online 
service, which provides Find My iPhone for free to iPhone 4 customers, and additional 
features with a paid subscription. MobileMe may not be available in all countries or 
regions. For more information, see “Setting Up MobileMe Accounts” on page 26, or go 
to www.apple.com/mobileme.
Cleaning iPhone
Clean iPhone immediately if it comes in contact with any contaminants that may cause 
stains, such as ink, dyes, makeup, dirt, food, oils, or lotions. To clean iPhone, disconnect 
CNNECDNGUCPFVWTPQÒK2JQPGRTGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPVJGP
slide the onscreen slider). Then use a soft, slightly damp, lint-free cloth. Avoid getting 
moisture in openings. Don’t use window cleaners, household cleaners, compressed air, 
aerosol sprays, solvents, alcohol, ammonia, or abrasives to clean iPhone. The front cover 
of iPhone 3GS and the front and back covers of iPhone 4 are made of glass and have 
an oleophobic coating. To clean these surfaces, simply wipe with a soft, lint-free cloth. 
The ability of this coating to repel oil will diminish over time with normal usage, and 
TWDDKPIVJGUETGGPYKVJCPCDTCUKXGOCVGTKCNYKNNHWTVJGTFKOKPKUJKVUGÒGEVCPFOC[
scratch the glass.
For more information about handling iPhone, see the iPhone Important Product 
Information Guide at www.apple.com/support/manuals/iphone.
Restarting or Resetting iPhone
If something isn’t working right, try restarting iPhone, force quitting an app, or 
resetting iPhone.
Restart iPhone:  2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPWPVKNVJGTGFUNKFGT
CRRGCTU5NKFG[QWT°PIGTCETQUUVJGUNKFGTVQVWTPQÒK2JQPG6QVWTPK2JQPGDCEMQP
RTGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPWPVKNVJG#RRNGNQIQCRRGCTU
+H[QWECP¨VVWTPQÒK2JQPGQTKHVJGRTQDNGOEQPVKPWGU[QWOC[PGGFVQTGUGVK2JQPG
#TGUGVUJQWNFDGFQPGQPN[KHVWTPKPIK2JQPGQÒCPFQPFQGUP¨VTGUQNXGVJGRTQDNGO
Force quit an app:  2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPHQTCHGYUGEQPFU
until a red slider appears, then press and hold the Home   button until the app quits.
You can also force an app to quit by removing it from the recents list. See “Opening 
and Switching Apps” on page 29.
Reset iPhone:  2TGUUCPFJQNFDQVJVJG1P1Ò5NGGR9CMGDWVVQPCPFVJG*QOG  
button for at least ten seconds, until the Apple logo appears.
For more troubleshooting suggestions, see Appendix B, “Support and Other 
Information,” on page 254.
51
Chapter 3    Basics

Syncing and File Sharing 4
About Syncing
Syncing copies information from your computer or online account to iPhone, then 
keeps the information in sync by copying changes made in one location to the other.
You use iTunes on your computer to sync contacts, calendars, and other information; 
iOS apps; photos and videos; and music and other iTunes content. By default, syncing 
occurs whenever you connect iPhone to your computer.
;QWECPCNUQEQP°IWTGK2JQPGVQCEEGUUCEEQWPVUYKVJQPNKPGUGTXKEGRTQXKFGTUUWEJCU
MobileMe, Microsoft Exchange, Google, Yahoo!, and others. Your information on those 
services is synced over the air.
Syncing Accounts
MobileMe, Microsoft Exchange, Google, Yahoo!, and other online service providers  
sync information—which might include contacts, calendars, browser bookmarks,  
and notes—wirelessly over the air, so you don’t have to connect iPhone to your 
computer. The wireless Internet connection can be via your cellular network or your 
local Wi-Fi network.
Some service providers—including MobileMe and Microsoft Exchange—push 
information updates. This means that syncing happens whenever any information is 
changed. The Push setting in Fetch New Data must be turned on (it’s on by default). 
Other providers sync by periodically “fetching” changes that have occurred. Use the 
Fetch setting to determine how frequently this happens. See “Fetch New Data” on 
page 203.
For information about setting up accounts on iPhone, see “Adding Mail, Contacts, and 
Calendar Accounts” on page 25.
52

Syncing with iTunes
You can set iTunes to sync any or all of the following:
Contacts—names, phone numbers, addresses, email addresses, and more 
Calendars—appointments and events 
Email account settings 
Webpage bookmarks 
Notes 
Ringtones 
Music 
Photos and videos (in your computer’s photo application or folder) 
iTunes U collections 
Podcasts 
Books and audiobooks 
Movies, TV shows, and music videos 
Apps downloaded from the App Store 
You can adjust sync settings whenever iPhone is connected to your computer.
Ringtones, music, audiobooks, podcasts, books, iTunes U collections, videos, and  
apps are synced from your iTunes library. If you don’t already have content in iTunes, 
the iTunes Store (not available in all countries or regions) makes it easy to preview 
content and download it to iTunes. You can also add music to your iTunes library  
from your CDs. To learn about iTunes and the iTunes Store, open iTunes and choose 
Help > iTunes Help.
Contacts, calendars, notes, and webpage bookmarks are synced with applications on 
your computer, as described in the following section. New entries or changes you 
make on iPhone are synced to your computer, and vice versa.
iTunes also lets you sync photos and videos from an application or from a folder.
Email account settings are synced only from your computer’s email application to 
K2JQPG6JKUCNNQYU[QWVQEWUVQOK\G[QWTGOCKNCEEQWPVUQPK2JQPGYKVJQWVCÒGEVKPI
email account settings on your computer.
Note:  You can also set up email accounts directly on iPhone. See “Adding Mail, 
Contacts, and Calendar Accounts” on page 25.
Purchases you make on iPhone in the iTunes Store or the App Store are synced back 
to your iTunes library. You can also purchase or download content and apps from the 
iTunes Store on your computer, and then sync them to iPhone.
53
Chapter 4    Syncing and File Sharing

You can set iPhone to sync with only a portion of what’s on your computer. For 
example, you might want to sync only a group of contacts from your address book,  
or only unwatched video podcasts. 
Important:  You should be logged in to your own user account on your computer 
before connecting iPhone.
Set up iTunes syncing:
  1  Connect iPhone to your computer, and open iTunes.
  2  In iTunes, select iPhone in the Devices list.
  3 %QP°IWTGVJGU[PEUGVVKPIUKPGCEJQHVJGUGVVKPIURCPGU
See the following section for descriptions of the panes.
  4  Click Apply in the lower-right corner of the screen.
By default, “Open iTunes when this iPhone is connected” is selected. 
iPhone Settings Panes in iTunes
The following sections provide an overview of each of the iPhone settings panes.  
For more information, open iTunes and choose Help > iTunes Help.
Note:  Buttons for additional panes may appear in iTunes, depending on the types of 
content in your iTunes library.
Summary Pane
Select “Open iTunes when this iPhone is connected” to have iTunes open and sync 
iPhone automatically whenever you connect it to your computer. Deselect this option 
if you want to sync only by clicking the Sync button in iTunes. For more information, 
see “Automatic iTunes Syncing” on page 57.
Select “Sync only checked songs and videos” if you want iTunes to skip unchecked 
items in your iTunes library when syncing.
54 Chapter 4    Syncing and File Sharing

5GNGEV¥2TGHGTUVCPFCTFFG°PKVKQPXKFGQU¦KH[QWYCPVK6WPGUVQU[PEUVCPFCTFFG°PKVKQP
KPUVGCFQHJKIJFG°PKVKQPXKFGQUK2JQPG
Select “Convert higher bit rate songs to 128 kbps AAC” if you want iTunes to convert 
NCTIGTCWFKQ°NGUVQVJGUVCPFCTFK6WPGUCWFKQHQTOCVFWTKPIU[PEKPI
5GNGEV¥/CPWCNN[OCPCIGOWUKECPFXKFGQU¦VQVWTPQÒCWVQOCVKEU[PEKPIKPVJG/WUKE
and Video settings panes. See “Manually Managing Content” on page 58.
Select “Encrypt iPhone backup” if you want to encrypt the information stored on your 
computer when iTunes makes a backup. Encrypted backups are indicated by a lock   
icon, and a password is required to restore the information to iPhone. See “Backing Up 
iPhone” on page 255.
6QVWTPQP#EEGUUKDKNKV[HGCVWTGUENKEM%QP°IWTG7PKXGTUCN#EEGUU5GG%JCRVGT29, 
“Accessibility,” on page 229.
Info Pane
6JG+PHQRCPGNGVU[QWEQP°IWTGVJGU[PEUGVVKPIUHQT[QWTEQPVCEVUECNGPFCTUGOCKN
accounts, and web browser.
Contacts 
Sync contacts with applications such as Mac OS X Address Book, Yahoo! Address 
Book, and Google Contacts on a Mac, or with Yahoo! Address Book, Google Contacts, 
Windows Address Book (Outlook Express), Windows Contacts (Vista and Windows 7), 
or Microsoft Outlook 2003, 2007, or 2010 on a PC. (On a Mac, you can sync contacts 
with multiple applications. On a PC, you can sync contacts with one application at  
a time.)
+H[QWU[PEYKVJ;CJQQ#FFTGUU$QQM[QWQPN[PGGFVQENKEM%QP°IWTGVQGPVGT[QWT
new login information when you change your Yahoo! ID or password after you’ve 
set up syncing.
Calendars 
Sync calendars from applications such as iCal on a Mac, or from Microsoft Outlook 
2003, 2007, or 2010 on a PC. (On a Mac, you can sync calendars with multiple 
applications. On a PC, you can sync calendars with only one application at a time.)
Mail Accounts 
Sync email account settings from Mail on a Mac, and from Microsoft Outlook 2003, 
2007, or 2010 or Outlook Express on a PC. Account settings are transferred only from 
your computer to iPhone. Changes you make to an email account on iPhone don’t 
CÒGEVVJGCEEQWPVQP[QWTEQORWVGT
Note:  The password for your Yahoo! email account isn’t saved on your computer, 
so it can’t be synced and must be entered on iPhone. In Settings, choose “Mail, 
Contacts, Calendars,” tap your Yahoo! account, and enter the password.
55
Chapter 4    Syncing and File Sharing

Web Browser 
You can sync bookmarks on iPhone with Safari on a Mac, or with Safari or Microsoft 
Internet Explorer on a PC.
Notes 
Sync notes in the Notes app on iPhone with notes in Mail on a Mac or with 
Microsoft Outlook 2003, 2007, or 2010 on a PC.
Advanced 
These options let you replace the information on iPhone with the information on 
your computer during the next sync.
Apps Pane
Use the Apps Pane to sync App Store apps, arrange apps on the iPhone Home screen, 
or copy documents between iPhone and your computer.
Select “Automatically sync new apps” to sync new apps to iPhone that you 
downloaded or synced from another device. If you delete an app on iPhone, you can 
reinstall it from the Apps pane as long as it was previously synced.
;QWECPETGCVGFQEWOGPVUQPK2JQPGYKVJCRRUVJCVUWRRQTV°NGUJCTKPICPFVJGP
copy those documents to your computer. You can also copy documents from your 
EQORWVGTVQK2JQPGCPFWUGVJGOYKVJCRRUVJCVUWRRQTV°NGUJCTKPI5GG¥File 
Sharing” on page 59.
Ringtones Pane
Use the Ringtones pane to select the ringtones you want to sync to iPhone.
Music, Movies, TV Shows, Podcasts, iTunes U, and Books Panes
Use these panes to specify the media you want to sync. You can sync all music, movies, 
TV shows, podcasts, iTunes U collections, books and audiobooks, or select the content 
you want.
If you create a playlist folder (collection of playlists) in iTunes, the folder and its playlists 
will be synced to iPhone. You can’t create playlist folders directly on iPhone. 
If you listen to part of a podcast or audiobook, your place in the story is included if you 
sync the content with iTunes. If you started listening to the story on iPhone, you can 
RKEMWRYJGTG[QWNGHVQÒWUKPIK6WPGUQP[QWTEQORWVGT¤QTXKEGXGTUC
If you want to watch a rented movie from your computer on iPhone, sync it to  
iPhone using the Movies pane in iTunes.
Only songs and videos encoded in formats that iPhone supports are synced to  
iPhone. For information about which formats iPhone supports, go to  
www.apple.com/iphone/specs.html.
56 Chapter 4    Syncing and File Sharing

Important:  If you delete an item from iTunes, it will also be deleted from iPhone the 
next time you sync.
Photos Pane
On a Mac, you can sync photos with Aperture or iPhoto 4.0.3 or later, and videos with 
iPhoto 6.0.6 or later. On a PC, you can sync photos with Adobe Photoshop Elements 
8.0 or later. You can also sync photos and videos from any Mac or PC folder that 
contains images.
Automatic iTunes Syncing
By default, iPhone syncs whenever you connect it to iTunes. You can prevent iPhone 
from syncing when you connect iPhone to a computer other than the one you usually 
sync with.
6WTPQÒCWVQOCVKEU[PEKPIHQTK2JQPG
  1  Connect iPhone to your computer.
  2  In iTunes, select iPhone in the Devices list, then click Summary at the top of the screen.
  3  Deselect “Open iTunes when this iPhone is connected.”
9JGPCWVQOCVKEU[PEKPIKUVWTPGFQÒ[QWECPUVKNNU[PED[ENKEMKPIVJG5[PEDWVVQP
Prevent automatic syncing for all iPods, iPhones, and iPads:  
  1  In iTunes, choose iTunes > Preferences (on a Mac) or Edit > Preferences (on a PC).
  2  Click Devices, then select “Prevent iPods, iPhones, and iPads from syncing 
automatically.”
If this checkbox is selected, iPhone won’t sync, even if “Open iTunes when this iPhone 
is connected” is selected in the Summary pane.
Prevent automatic syncing one time, without changing settings:  Open iTunes, 
connect iPhone to your computer, then press and hold Command-Option (on a Mac) 
or Shift-Control (on a PC) until you see iPhone appear in the sidebar.
Sync manually:  In iTunes, select iPhone in the sidebar, then click Sync in the bottom-
right corner of the window. Or, if you’ve changed any sync settings, click Apply.
57
Chapter 4    Syncing and File Sharing

Manually Managing Content
The manually managing feature lets you choose just the music, videos, and podcasts 
you want to have on iPhone.
Set up iPhone for manually managing content:  
  1  Connect iPhone to your computer.
  2  In iTunes, select iPhone in the sidebar.
  3 Click Summary at the top of the screen and select “Manually manage music and videos.”
  4  Click Apply.
Add items to iPhone:  Drag a song, video, podcast, or playlist in your iTunes library to 
iPhone (in the sidebar). Shift-click or Command-click (Mac) or Control-click (Windows) 
to select multiple items to add at the same time.
iTunes syncs the content immediately. If you deselect “Manually manage music and 
videos,” the content you added manually is removed from iPhone the next time iTunes 
syncs content.
Remove items from iPhone:  With iPhone connected to your computer, select iPhone 
in the iTunes sidebar, and click its disclosure triangle to show contents. Select a 
content area, such as Music or Movies, then select the items you want to delete and 
press the Delete key on the keyboard.
Removing an item from iPhone doesn’t delete it from your iTunes library.
Note:  Genius doesn’t work if you manually manage content. See “Using Genius on 
iPhone” on page 98.
Transferring Purchased Content to Another Computer
You can transfer content on iPhone that was purchased using iTunes on one  
computer to an iTunes library on another authorized computer. The computer must  
be authorized to play content purchased using your Apple ID.
Authorize a computer:  Open iTunes on the computer and choose Store >  
Authorize Computer.
Transfer purchased content:  Connect iPhone to the other computer. In iTunes,  
choose File > Transfer Purchases from iPhone.
58 Chapter 4    Syncing and File Sharing

File Sharing
(KNG5JCTKPINGVU[QWVTCPUHGT°NGUDGVYGGPK2JQPGCPF[QWTEQORWVGT;QWECPUJCTG
°NGUETGCVGFYKVJCEQORCVKDNGCRRCPFUCXGFKPCUWRRQTVGFHQTOCV
#RRUVJCVUWRRQTV°NGUJCTKPICRRGCTKPVJG(KNG5JCTKPI#RRUNKUVKPK6WPGU(QT
each app, the Files list shows the documents that are on iPhone. See the app’s 
FQEWOGPVCVKQPHQTJQYKVUJCTGU°NGUPQVCNNCRRUUWRRQTVVJKUHGCVWTG
6TCPUHGTC°NGHTQOK2JQPGVQ[QWTEQORWVGT
  1  Connect iPhone to your computer.
  2  In iTunes, select iPhone in the Devices list, then click Apps at the top of the screen.
  3  In the File Sharing section, select an app from the list on the left.
  4 1PVJGTKIJVUGNGEVVJG°NG[QWYCPVVQVTCPUHGTVJGPENKEM¥5CXGVQ¦CPFEJQQUGC
destination on your computer.
6TCPUHGTC°NGHTQO[QWTEQORWVGTVQK2JQPG
  1  Connect iPhone to your computer.
  2  In iTunes, select iPhone in the Devices list, then click Apps at the top of the screen.
  3  In the File Sharing section, click Add.
  4 5GNGEVC°NGVJGPENKEM%JQQUG/CEQT1-2%
6JG°NGKUVTCPUHGTTGFVQ[QWTFGXKEGCPFECPDGQRGPGFWUKPICPCRRVJCVUWRRQTVU
VJCV°NGV[RG6QVTCPUHGTOQTGVJCPQPG°NGUGNGEVGCEJCFFKVKQPCN°NG
&GNGVGC°NGHTQOK2JQPG5GNGEVVJG°NGKPVJG(KNGUNKUVVJGPVCR&GNGVG
59
Chapter 4    Syncing and File Sharing

Phone 5
Phone Calls
Making a call on iPhone is as simple as tapping a name and number in your contacts, 
tapping one of your favorites, or tapping a recent call to return it.
Making Calls
Buttons at the bottom of the Phone screen give you quick access to your favorites, 
recent calls, your contacts, and a numeric keypad for dialing manually.
WARNING:  For important information about driving safely, see the Important Product 
Information Guide at www.apple.com/support/manuals/iphone.
5\TILYVMTPZZLKJHSSZ
5\TILYVM\UOLHYK
]VPJLTHPSTLZZHNLZ
Use Contacts to call someone Tap Contacts, choose a contact, then tap a phone number.
Call a favorite Tap Favorites, then choose a contact.
Return a recent call Tap Recents, then tap a name or number in the list. If the 
call was a FaceTime video call (indicated by  ), 
tap the item to make a new video call.
60

Dialing Manually
You can use the keypad to manually dial a phone number.
Dial a number:  6CR-G[RCFGPVGTVJGPWODGTVJGPVCR%CNN
If you copy a phone number to the clipboard, you can paste it to the numeric keypad.
Paste a number to the keypad:  Tap the screen above the keyboard, then tap Paste. 
If the phone number you copied included letters, iPhone converts them to the 
appropriate digits.
You can include a soft pause, which pauses dialing for about two seconds, or a hard 
pause, which pauses dialing until you tap the Dial Button. Pauses can be useful when 
dialing in to a conference call, for example.
Enter a soft pause:  Press and hold the “*” key until a comma appears in the number.
Enter a hard pause:  Press and hold the “#” key until a semicolon appears in the number.
Redial the last number you dialed:  6CR-G[RCFVJGPVCR%CNN6CR%CNNCICKPVQFKCN
the number.
Voice Dialing
;QWECPWUG8QKEG%QPVTQNVQECNNUQOGQPGKP[QWTEQPVCEVUQTVQFKCNCURGEK°EPWODGT
Note:  Voice Control may not be available in all languages.
Use Voice Control to make a phone call:  Press and hold the Home   button until the 
Voice Control screen appears and you hear a beep. Then use the commands described 
below to make a call. 
You can also press and hold the center button on the iPhone earphones to use  
Voice Control.
Call someone in contacts Say “call” or “dial” then say the name of the person. If the 
person has more than one number, specify which one you 
want to call.
Examples:
 Call John Appleseed
 Call John Appleseed at home
 Call John Appleseed, mobile
Dial a number Say “call” or “dial,” then say the number.
For best results, speak the full name of the person you’re calling. If you speak only the 
°TUVPCOGCPF[QWJCXGOQTGVJCPQPGEQPVCEVYKVJVJCVPCOGK2JQPGCUMUYJKEJQH
those contacts you want to call. If there’s more than one number for the person you’re 
calling, say which number to use. Otherwise, iPhone asks you.
61
Chapter 5    Phone

When voice dialing a number, speak each digit separately—for example, say “four one 
°XG°XG°XG°XGQPGVYQQPGVYQ¦
Note:  For the “800” area code in the U.S., you can say “eight hundred.”
Prevent voice dialing when iPhone is locked:  In Settings, choose General > Passcode 
.QEMCPFVWTP8QKEG&KCNQÒ7PNQEMK2JQPGVQWUGXQKEGFKCNKPI
Receiving Calls
When you receive a call, tap Answer. If iPhone is locked, drag the slider. You can also 
press the center button on your iPhone earphones to answer a call.
*LU[LYI\[[VU
Silence a call:  2TGUUVJG1P1Ò5NGGR9CMGDWVVQPQTGKVJGTXQNWOGDWVVQP;QWECP
still answer the call after silencing it, until it goes to voicemail.
Decline a call:  Do one of the following to send a call directly to voicemail.
2TGUUVJG1P1Ò5NGGR9CMGDWVVQPVYKEGSWKEMN[ 
6U6MM:SLLW
>HRLI\[[VU
Press and hold the center button on the iPhone earphones for about two seconds.  
6YQNQYDGGRUEQP°TOVJCVVJGECNNYCUFGENKPGF
Tap Decline (if iPhone is awake when a call comes in). 
Block calls and maintain Wi-Fi access to the Internet:  In Settings, turn on Airplane 
Mode, then tap Wi-Fi to turn it on.
62 Chapter 5    Phone

While On a Call
When you’re on a call, the screen shows call options.
The call options may vary, depending on which iPhone you’re using.
Mute your line Tap Mute. You can still hear the caller, but the caller can’t 
hear you.
Use the numeric keypad to  
enter information
6CR-G[RCF
Use the speakerphone or a  
Bluetooth device
Tap Speaker. The Button is labeled Audio Source when 
a Bluetooth device is available, which lets you select the 
Bluetooth device, iPhone, or Speaker Phone.
See contact information Tap Contacts.
Put a call on hold iPhone 4:  Touch and hold Mute.
iPhone 3GS:  Tap Hold.
Neither party can hear the other. When a call is on hold, tap 
Hold again to return to the call.
Make another call Tap Add Call.
You can use other apps during a call—to check your schedule in Calendar, for example.
Use another app during a call:  Press the Home   button, then tap an app icon. To 
return to the call, tap the green bar at the top of the screen.
Note:  The 3G (UMTS) cellular network supports simultaneous voice and data 
communications on GSM models. For all other network connections (EDGE or GPRS 
on GSM models, or EV-DO or 1xRTT on a CDMA model), you can’t use Internet services 
while you’re on the phone unless iPhone also has a Wi-Fi connection to the Internet.
End a call:  Tap End Call. Or press the center button on your iPhone earphones.
63
Chapter 5    Phone

Second Calls
During a call, you can make or receive another call. If you receive a second call, iPhone 
beeps and shows the caller’s information and a list of options.
Note:  Making and receiving a second call may be an optional service in some 
countries or regions. Contact your carrier for more information.
Respond to a second incoming call:  
 To ignore the call and send it to voicemail:  Tap Ignore.
 6QJQNFVJG°TUVECNNCPFCPUYGTVJGPGYQPGTap Hold Call + Answer.
 6QGPFVJG°TUVECNNCPFCPUYGTVJGPGYQPGOn GSM models, tap End Call + Answer. 
On a CDMA model, tap End Call and when the second call rings back, tap Answer,  
or drag the slider if the phone is locked.
If you’re on a FaceTime video call, you can either end the video call and answer the 
incoming call, or decline the incoming call.
Make a second call:  6CR#FF%CNN6JG°TUVECNNKURWVQPJQNF
Switch between calls:   Tap Swap. The active call is put on hold.
On a CDMA model, you can’t switch between calls if the second call was outgoing,  
but you can merge the calls. If you end the second call or the merged call, both calls 
are terminated.
Merge calls:  Tap Merge Calls.
On a CDMA model, you can’t merge calls if the second call was incoming.
Conference Calls
1P)5/OQFGNU[QWECPUGVWRCEQPHGTGPEGECNNVQVCNMYKVJWRVQ°XGRGQRNGCVC
time, depending on your carrier.
Note:  Conference calling may be an optional service in some countries or regions. 
Contact your carrier for information.
Create a conference call:  
  1  Make a call.
  2 6CR#FF%CNNCPFOCMGCPQVJGTECNN6JG°TUVECNNKURWVQPJQNF
  3  Tap Merge Calls. The calls are merged on one line and everyone can hear each other.
  4  Repeat steps two and three to add additional calls.
Drop one call Tap Conference and tap   next to a call. Then tap End Call.
Talk privately with a call Tap Conference, then tap Private next to a call. Tap Merge 
Calls to resume the conference call.
Add an incoming call Tap Hold Call + Answer, then tap Merge Calls.
64 Chapter 5    Phone

If your service includes conference calling, iPhone always has a second line available in 
addition to the conference call.
Note:  You can’t make a FaceTime video call when you’re on a conference call.
FaceTime
FaceTime video calls (iPhone 4) let you see as well as hear the person you’re talking to. 
You can make a video call to someone with a device that supports FaceTime. No setup 
is needed, but you must have a Wi-Fi connection to the Internet. FaceTime uses the 
front camera so the person you call can see your face, but you can switch to the main 
camera to share what you see around you.
Note:  FaceTime may not be available in all countries or regions.
Make a FaceTime call:  In Contacts, choose a name, then tap FaceTime and tap the 
email address or phone number the person uses for FaceTime.
To call someone who has an iPhone 4, you can start by making a voice call, then  
tap FaceTime.
If you previously had a FaceTime call with someone,   appears on the FaceTime 
button and on the email address or phone number you used.
4HRLH
-HJL;PTL
]PKLVJHSS
Make a FaceTime call using Voice Control:  Press and hold the Home button until the 
Voice Control screen appears and you hear a beep. Then say “FaceTime,” followed by 
the name of the person to call.
If you had a previous FaceTime video call with someone, you can make another video 
call to that person by tapping the entry for that call in Recents. Previous FaceTime 
video calls are indicated by  . 
65
Chapter 5    Phone

When the voice call is established, you see the image from the other person’s iPhone. 
A picture-in-picture window shows the image from your iPhone that the other person 
sees. You can drag the window to any corner. You can use FaceTime in portrait or 
landscape orientation.
Video calls use the top microphone on iPhone.
If you move away from your Wi-Fi network, or it otherwise becomes unavailable, you’ll 
get an option to redial the number for a voice call.
Note:  When you make a FaceTime video call, your phone number is displayed even if 
ECNNGT+&KUDNQEMGFQTVWTPGFQÒ
Receive a FaceTime video call:  Click Accept.
Mute a FaceTime video call Tap   at the bottom of the screen. You can still hear and 
see the caller. The caller can see, but not hear you.
Switch between the front and  
main cameras
Tap   at the bottom of the screen.
Use another app during a FaceTime 
video call
Press the Home   button, then tap an app icon. You can 
still talk, but won’t see each other. To return to the video 
call, tap the green bar at the top of the screen.
End a FaceTime video call Tap   at the bottom of the screen.
6QDNQEM(CEG6KOGXKFGQECNNU[QWECPVWTPQÒ(CEG6KOGKP5GVVKPIU
6WTP(CEG6KOGQPQTQÒIn Settings, choose Phone and tap the FaceTime switch. 
FaceTime is on by default.
You can also disable FaceTime in Restrictions. See “Restrictions” on page 196 .
66 Chapter 5    Phone

Using a Bluetooth Device for Calls
You can make and receive calls using a Bluetooth device paired with iPhone. See 
“Pairing a Bluetooth Device with iPhone” on page 47. 
For information about using a Bluetooth device to make and receive calls, see the 
documentation that came with the device.
Listen to calls through iPhone when a Bluetooth device is connected:  Do one of  
the following:
Answer a call by tapping the iPhone screen. 
During a call, tap Audio on iPhone. Choose iPhone to hear calls through iPhone or  
Speaker Phone to use the speakerphone.
6WTPQÒ$NWGVQQVJ+P5GVVKPIUEJQQUG)GPGTCN $NWGVQQVJCPFFTCIVJGUYKVEJVQ1Ò 
6WTPQÒVJG$NWGVQQVJFGXKEGQTOQXGQWVQHTCPIG;QWOWUVDGYKVJKPCDQWV  
30 feet of a Bluetooth device for it to be connected to iPhone.
Emergency Calls
If iPhone is locked with a passcode, you may still be able to make an emergency call.
Make an emergency call when iPhone is locked:  On the Enter Passcode screen, tap 
Emergency Call, then dial the number using the numeric keypad.
In the U.S., location information (if available) is provided to emergency service 
providers when you dial 911.
On a CDMA model, when an emergency call ends, iPhone enters Emergency call mode 
to allow a call back from emergency services. While in this mode, data transmission 
and text messages are blocked.
Exit emergency call mode (CDMA model):  Do one of the following:
Tap the back button. 
Press the Sleep/Wake or Home   button.
Use the keypad to dial a non-emergency number. 
Emergency call mode ends automatically after a few minutes, as determined by  
your carrier.
Important:  You should not rely on wireless devices for essential communications, 
such as medical emergencies. Use of any cellular phone to call emergency services 
may not work in all locations. Emergency numbers and services vary by country or 
region. Only emergency numbers valid in the country or region where you’re making 
the call will work, and sometimes an emergency call cannot be placed due to network 
unavailability or environmental interference. Some cellular networks may not accept 
an emergency call from iPhone if it doesn’t have a SIM card or if the SIM card is locked 
(GSM models), or if you haven’t activated your iPhone. If you’re on a FaceTime video 
call, you must end that call before you can call an emergency number.
67
Chapter 5    Phone

Visual Voicemail
On iPhone, visual voicemail lets you see a list of your messages and choose which ones 
to listen to or delete, without having to listen to instructions or prior messages.
Note:  Visual voicemail may not be available in all countries or regions, or may be an 
optional service. Contact your carrier for more information. If visual voicemail isn’t 
available, tap Voicemail and follow the voice prompts to retrieve your messages.
5\TILYVMTPZZLKJHSSZHUK\UOLHYK
]VPJLTHPSTLZZHNLZHWWLHYZVU[OL
/VTLZJYLLU7OVULPJVU
Setting Up Voicemail
6JG°TUVVKOG[QWVCR8QKEGOCKNK2JQPGRTQORVU[QWVQETGCVGCXQKEGOCKNRCUUYQTF
and record your voicemail greeting.
Change your greeting:  
  1  Tap Voicemail, tap Greeting, then tap Custom.
  2  Tap Record when you’re ready to start.
  3 9JGP[QW°PKUJVCR5VQR6QTGXKGYVCR2NC[
To rerecord, repeat steps 2 and 3.
  4  Tap Save.
Use your carrier’s default greeting Tap Voicemail, tap Greeting, then tap Default.
Set an alert sound for new voicemail In Settings, choose Sounds and turn New Voicemail on. The 
alert sounds once for each new voicemail. If the Ring/Silent 
UYKVEJKUQÒK2JQPGYQP¨VUQWPFCNGTVU
Change the voicemail password In Settings, choose Phone > Change Voicemail Password.
Checking Voicemail
When you tap Phone, iPhone shows the number of missed calls and unheard 
voicemail messages.
5\TILYVMTPZZLKJHSSZ
5\TILYVM\UOLHYK
]VPJLTHPSTLZZHNLZ
68 Chapter 5    Phone

Tap Voicemail to see a list of your messages.
:RPW[VHU`WVPU[PU
HTLZZHNL!+YHN[OL
WSH`OLHK
<UOLHYK
TLZZHNLZ 7SH`7H\ZL
*VU[HJ[PUMV
:JY\IILYIHY
:WLHRLYWOVUL(\KPV
^OLUH)S\L[VV[OKL]PJL
PZJVUULJ[LK;HW[V
JOVVZLH\KPVV\[W\[
9L[\YU[OLJHSS
Listen to a message:  Tap the message. (If you’ve already heard the message, tap the 
message again to replay it.) Use   and   to pause and resume playback.
Once you listen to a message, it’s saved until your carrier erases it.
Check voicemail from another phone:  Dial your own number or your carrier’s remote 
access number.
Deleting Messages
Select a message, then tap Delete.
Listen to a deleted message Tap Deleted Messages (at the end of the list), then tap  
the message.
Undelete a message Tap Deleted Messages (at the end of the list), then tap  
the message and tap Undelete.
Delete messages permanently Tap Deleted Messages (at the end of the list), then tap  
Clear All.
Note:  In some countries or regions, deleted visual voicemail messages may be 
permanently erased by your carrier.
Getting Contact Information
Visual voicemail saves the date and time of the call, the length of the message, and 
any available contact information.
See a caller’s contact information:  Tap   next to a message.
You can use the information to email or text the caller, or update contact info.
69
Chapter 5    Phone

Contacts
From a contact’s Info screen, a quick tap lets you make a phone call, create a new email 
OGUUCIG°PFVJGNQECVKQPQHVJGKTCFFTGUUCPFOQTG5GG¥Searching Contacts” on 
page 214.
Favorites
Favorites gives you quick access to your most-used phone numbers.
Add a contact’s phone number to your favorites list:  Tap Contacts and choose a 
contact. Then tap “Add to Favorites” and choose the phone number or email address 
you want to add. On iPhone 4, choose whether to save the favorite as a voice call or as 
a FaceTime call. If you save the contact as a FaceTime call,   appears with the name in 
the favorites list.
If someone already in your contacts calls you, you can add their name to favorites from 
the recents list.
Add a contact to favorites from the recents list:  Tap Recents and tap   next to the 
contact’s name, then tap “Add to Favorites.”
Call a contact from your favorites Tap Favorites and choose a contact. If   appears next to a 
name, you can tap the name to make a FaceTime call.
Delete a contact from your favorites Tap Favorites and tap Edit. Then tap   next to a contact or 
number and tap Remove.
Reorder your favorites list Tap Favorites and tap Edit. Then drag   next to a contact 
to a new place in the list.
Call Forwarding, Call Waiting, and Caller ID
iPhone supports call forwarding, call waiting, and caller ID.
Call Forwarding
;QWECPUGVK2JQPGVQHQTYCTFKPEQOKPIECNNUVQCFKÒGTGPVPWODGT(QTGZCORNGKH
you’re going to an area with no cellular coverage, you may want to forward calls to a 
number where you can be reached.
Note:  FaceTime calls are not forwarded.
On GSM models, use the Call Forwarding setting to forward incoming calls to  
another number.
Forward incoming calls (GSM models):
  1  In Settings, choose Phone > Call Forwarding, then turn on Call Forwarding.
  2  On the “Forward to” screen, enter the phone number you want calls forwarded to.
70 Chapter 5    Phone

When Call Forwarding is on, the call forwarding ( ) icon appears in the status bar 
(GSM models). You must be in range of the cellular network when you set iPhone to 
forward calls, or calls won’t be forwarded.
1PC%&/#OQFGN[QWVWTPECNNHQTYCTFKPIQPQTQÒD[FKCNKPIURGEKCNEQFGU
Turn on call forwarding (CDMA model):  Enter *72 on the Phone keypad, followed by 
the number you’re forwarding calls to, then tap Call.
6WTPQÒECNNHQTYCTFKPI%&/#OQFGNEnter *73 on the Phone keypad, then tap Call.
Call Waiting
Call waiting lets you know if you receive another call when you’re on the phone. You 
can ignore the incoming call, put the current call on hold and answer the incoming 
ECNNQTGPFVJGEWTTGPVECNNCPFCPUYGTVJGKPEQOKPIECNN+HECNNYCKVKPIKUQÒYJGP
you’re on the phone, incoming calls go directly to voicemail.
1P)5/OQFGNUWUGVJG%CNN9CKVKPIUGVVKPIVQVWTPECNNYCKVKPIQPQTQÒ
6WTPECNNYCKVKPIQPQTQÒ)5/OQFGNUIn Settings, choose Phone > Call Waiting, 
VJGPVWTP%CNN9CKVKPIQPQTQÒ
On a CDMA model, call waiting is on by default. You can disable call waiting for a call 
by entering a special code before dialing the number.
Disable call waiting during a call (CDMA model):  Enter *70, then dial the number.
To disable call waiting for a subsequent call, you must again enter *70 before dialing 
the number.
Caller ID
Caller ID displays your name or phone number to the person you call, if the recipient’s 
equipment has that capability and you haven’t blocked caller ID on your phone service.
Note:  When you make a FaceTime call, your phone number is displayed even if caller ID 
KUVWTPGFQÒQTDNQEMGF
1P)5/OQFGNUWUGVJG5JQY/[%CNNGT+&VQVWTPECNNGT+&QPQTQÒ
6WTPECNN+&QPQTQÒ)5/OQFGNUIn Settings, choose Phone > Show My Caller ID, 
VJGPVWTP5JQY/[%CNNGT+&QPQTQÒ
On a CDMA model, caller ID is on by default. You can block your ID for a call you’re 
making by entering a special code before dialing the number.
Disable caller ID for a call (CDMA model):  Enter *67, then dial the number.
71
Chapter 5    Phone

Ringtones and the Ring/Silent Switch 
iPhone comes with ringtones you can use for incoming calls, Clock alarms, and the 
Clock timer. You can also purchase ringtones from songs in iTunes.
Ring/Silent Switch and Vibrate Modes
#UYKVEJQPVJGUKFGQHK2JQPGOCMGUKVGCU[VQVWTPVJGTKPIGTQPQTQÒ
6WTPVJGTKPIGTQPQTQÒFlip the switch on the side of iPhone.
9PUN
:PSLU[
Important:  Clock alarms still sound even if you set the Ring/Silent switch to silent.
Set iPhone to vibrate:  In Settings, choose Sounds. Separate controls let you set vibrate 
for both ring mode and silent mode.
For more information, see “Sounds and the Ring/Silent Switch” on page 191.
Setting Ringtones
You can set the default ringtone for calls, and for Clock alarms and timers. You can also 
assign individual ringtones to contacts so you know who’s calling.
Set the default ringtone:  In Settings, choose Sounds > Ringtone, then choose a 
ringtone.
Assign a ringtone to a contact:  From Phone, tap Contacts and choose a contact. Tap 
Edit, then tap Ringtone and choose a ringtone.
Purchasing Ringtones
You can purchase ringtones from the iTunes Store on iPhone. See “Purchasing 
Ringtones” on page 169.
72 Chapter 5    Phone

International Calls
Making International Calls from Your Home Area
For information about making international calls from your home area, including rates 
and other charges that may apply, contact your carrier or go to your carrier’s website.
Using iPhone Abroad
You may be able to use iPhone to make calls in other countries around the world, 
depending on available networks.
Enable international roaming:  Contact your carrier for information about availability 
and fees.
Important:  Voice and data roaming charges may apply. To avoid data roaming charges, 
VWTP&CVC4QCOKPIQÒ
6WTP&CVC4QCOKPIQÒIn Settings, choose General > Network, then tap to turn Data 
4QCOKPIQÒ&CVC4QCOKPIKUVWTPGFQÒD[FGHCWNV
6WTPKPI&CVC4QCOKPIQÒJGNRUVQCXQKFFCVCTQCOKPIEJCTIGUYJGPVTCXGNKPIQWVUKFG
your carrier’s network by disabling data transmission over the cellular network. You 
can still access the Internet if you have a Wi-Fi connection. If Wi-Fi network access isn’t 
available, however, you cannot:
Make or receive FaceTime video calls 
Send or receive email 
Browse the Internet 
Sync your contacts, calendars, or bookmarks with MobileMe or Exchange 
Stream YouTube videos 
Get stock quotes 
Get map locations 
Get weather reports 
Purchase music or apps 
Other third-party apps that use data roaming may also be disabled.
+H&CVC4QCOKPIKUVWTPGFQÒ[QWECPUVKNNOCMGCPFTGEGKXGRJQPGECNNUCPFUGPFCPF
receive text messages. Voice roaming charges may apply. Visual voicemail is delivered 
if there’s no charge; if your carrier charges for delivery of visual voicemail when 
TQCOKPIVWTPKPI&CVC4QCOKPIQÒRTGXGPVUVJGFGNKXGT[QHXKUWCNXQKEGOCKN
Important:  If Data Roaming is turned on, you may incur charges when roaming 
outside your carrier’s network for the use of any of the features listed above, as well  
as for delivery of visual voicemail. Check with your carrier for information about 
roaming charges.
73
Chapter 5    Phone

;QWECPCNUQVWTPQÒEGNNWNCTFCVCVQRTGXGPVCP[EGNNWNCTFCVCWUCIG
6WTPQÒ%GNNWNCT&CVCIn Settings, choose General > Network, then tap the Cellular 
&CVCUYKVEJVQVWTPKVQÒ
5GVK2JQPGVQCFFVJGEQTTGEVRTG°ZYJGPFKCNKPIHTQOCPQVJGTEQWPVT[In Settings, 
tap Phone, then turn International Assist on. This lets you make calls to your home 
country using the numbers in your contacts and favorites, without having to add a 
RTG°ZQT[QWTEQWPVT[EQFG+PVGTPCVKQPCN#UUKUVYQTMUHQT75VGNGRJQPGPWODGTUQPN[
When you make a call using International Assist, “International Assist” appears on the 
iPhone screen, alternating with the “calling …” message, until your call is connected.
Note:  International Assist may not be available in all areas.
Set the carrier to use:  In Settings, tap Carrier, then select the carrier you prefer. This 
option is available only when you’re traveling outside your carrier’s network. You can 
make calls only on carriers that have roaming agreements with your iPhone service 
provider. For more information, see “Carrier” on page 190.
Get voicemail when visual voicemail isn’t available:  Dial your own number (on a 
CDMA model, dial your number followed by #), or touch and hold “1” on the numeric 
keypad.
;QWECPWUG#KTRNCPG/QFGVQVWTPQÒEGNNWNCTUGTXKEGUCPFVJGPVWTP9K(KQPVQIGV
access to the Internet, while preventing voice roaming charges. 
7UGCKTRNCPGOQFGVQVWTPQÒEGNNWNCTUGTXKEGUIn Settings, tap Airplane Mode to turn 
it on, then tap Wi-Fi and turn Wi-Fi on. See “Airplane Mode” on page 187.
Incoming phone calls are sent to voicemail. To make and receive calls again and get 
[QWTXQKEGOCKNOGUUCIGUVWTPCKTRNCPGOQFGQÒ
74 Chapter 5    Phone

Mail 6
Mail works with MobileMe, Microsoft Exchange, and many of the most popular email 
systems—including Yahoo!, Google, and AOL—as well as other industry-standard 
POP3 and IMAP email systems. You can send and receive photos, videos, and graphics, 
and view PDFs and other attachments. You can also print messages, and attachments 
that open in Quick Look.
Setting Up Email Accounts
You can set up email accounts on iPhone in either of the following ways:
Set up an account directly on iPhone. See “ Adding Mail, Contacts, and Calendar 
Accounts” on page 25.
In iTunes, use the iPhone settings panes to sync email accounts settings from your  
computer. See “iPhone Settings Panes in iTunes” on page 54.
75

Checking and Reading Email
The Mail icon on the Home screen shows the number of unread messages in your 
inboxes. You may have other unread messages in other mailboxes.
5\TILYVM\UYLHK
LTHPSZPU`V\YPUIV_LZ
In Mail, the Mailboxes screen gives you quick access to all your inboxes and other 
mailboxes. Tap an inbox to see the incoming messages for that account. To see 
incoming messages for all your accounts, tap All Inboxes. If only one mail account is 
set up, only that inbox appears on the Mailboxes screen.
5\TILYVM\UYLHK
TLZZHNLZ
0UJVTPUN
TLZZHNLZMVYHSS
HJJV\U[Z
When you open a mailbox, Mail retrieves and displays the most recent messages, and 
shows the number of unread messages at the top of the screen. Unread messages 
have a blue dot   next to them. The number of messages retrieved is determined by 
your Mail settings. See “Mail” on page 204.
If you organize messages by thread, related messages appear as a single entry in the 
mailbox. Message threads have a number next to the right arrow, showing the number 
of messages in the thread. A blue dot indicates that one or more messages in the 
thread are unread. The message displayed is the oldest unread message, or the most 
recent message if all the messages are read.
<UYLHKTLZZHNLZ
5\TILYVM
TLZZHNLZPU
[OYLHK
See messages in a thread:  Tap the thread in the mailbox. 
Read a message:  Tap a message. Within a message, tap   or   to see the next or 
previous message.
76 Chapter 6    Mail

6WTP¥1TICPK\G$[6JTGCF¦QPQTQÒIn Settings, choose “Mail, Contacts, Calendars,” 
CPFVCRVJGUYKVEJVQVWTP1TICPK\G$[6JTGCFQPQTQÒ5GG¥Mail” on page 204.
If you set up more than one account, the Accounts section of the Mailboxes screen lets 
you access your accounts. Tap an account to see its folders and mailboxes, including its 
inbox. If only one account is set up, the folders and mailboxes for that account appear 
on the Mailboxes screen. 
5\TILYVM\UYLHK
TLZZHNLZ
;HW[VZLLHSS`V\Y
LTHPSHJJV\U[Z
Check for new messages:  Choose a mailbox, or tap   at any time.
Load additional messages:  Scroll to the bottom of the list of messages and tap Load 
More Messages.
Zoom in on part of a message Double-tap an area of the message. Double-tap again to 
zoom out. Or pinch apart or together to zoom in or out.
4GUK\GCP[EQNWOPQHVGZVVQ°V 
the screen
Double-tap the text.
See all the recipients of a message Tap Details.
Tap a name or email address to see the recipient’s contact 
information. Then tap a phone number, email address,  
or text message to contact the person. Tap Hide to hide  
the recipients.
Add an email recipient to your 
contacts list
Tap the message and, if necessary, tap Details to see the 
recipients. Then tap a name or email address and tap Create 
New Contact or “Add to Existing Contact.”
Mark a message as unread Open the message and tap “Mark as Unread.”
A blue dot   appears next to the message in the mailbox 
list until you open it again.
Open a meeting invitation:  Tap the invitation.
77
Chapter 6    Mail

You can get contact information for the organizer and other invitees, set an alert, add 
notes to the event, and add comments that are included in your response emailed 
to the organizer. You can accept, tentatively accept, or decline the invitation. See 
“Responding to Meeting Invitations” on page 114 .
6WTP2WUJQPQTQÒIn Settings, choose “Mail, Contacts, Calendars” > Fetch New Data, 
VJGPVWTP2WUJQPQTQÒ5GG¥Fetch New Data” on page 203.
Using Links and Detected Data
iPhone detects web links, phone numbers, email addresses, and other types of 
information that you can use to open a webpage, make a phone call, create a 
preaddressed email message, create or add information to a contact, or perform some 
other useful action. Detected data appears as blue underlined text. Tap the data to use 
its default action, or touch and hold it to see other actions.
Link or image Tap to open the webpage in Safari.
Touch and hold to:
 Open the webpage in Safari
 Copy the link
Phone number Tap the number, then tap Call to dial the number.
Touch and hold to:
 Dial the number
 Send a text message
 Create a new contact with the number
 Add the number to an existing contact
Address Tap to display the location in Maps.
Touch and hold to:
 Display the location in Maps
 Create a new contact with the address
 Add the address to an existing contact
 Copy the address
Email address Tap to create a new preaddressed email message.
Touch and hold to:
 Create a new email message
 Create a new contact with the address
 Add the address to an existing contact
 Copy the address
Day, date, or time Tap the item, then tap Create Event to create an event  
in Calendar.
Tracking number (may not be 
available in all countries or regions)
Tap to open the shipper’s webpage for the status of  
a package.
78 Chapter 6    Mail

Viewing Attachments
iPhone displays image attachments in many commonly used formats (JPEG, GIF, and 
TIFF) inline with the text in email messages. iPhone can play many types of audio 
CVVCEJOGPVUUWEJCU/2##%9#8CPF#+((;QWECPFQYPNQCFCPFXKGY°NGU
UWEJCU2&(YGDRCIGVGZV2CIGU-G[PQVG0WODGTUCPF/KETQUQHV9QTF'ZEGNCPF
PowerPoint documents) that are attached to messages you receive.
8KGYCPCVVCEJGF°NGTap the attachment to open it in Quick Look.
;QWOC[PGGFVQFQYPNQCFVJGCVVCEJOGPV°TUVD[VCRRKPI  (if it appears at the end 
of the message in a dotted box with the document name).
;HWH[[HJOTLU[
[VKV^USVHK
You can view attachments in portrait or landscape orientation.
+HVJGHQTOCVQHCPCVVCEJGF°NGKUP¨VUWRRQTVGFD[K2JQPG[QWECPUGGVJGPCOGQHVJG
°NGDWV[QWECP¨VQRGPKVK2JQPGUWRRQTVUVJGHQNNQYKPIFQEWOGPVV[RGU
.doc Microsoft Word
.docx Microsoft Word (XML)
.htm webpage
.html webpage
.key -G[PQVG
.numbers Numbers
.pages Pages
.pdf Preview, Adobe Acrobat
.ppt Microsoft PowerPoint
.pptx Microsoft PowerPoint (XML)
.rtf Rich Text Format
.txt text
.vcf contact information
.xls Microsoft Excel
.xlsx Microsoft Excel (XML)
79
Chapter 6    Mail

1RGPCPCVVCEJGF°NGYKVJCPQVJGTCRRTouch and hold the attachment, then 
choose an app. If no apps are available, you can open the attachment in Quick Look.
Save an attached photo to your Camera Roll album:  Tap the photo, then tap Save 
+OCIG+HVJGRJQVQJCUP¨VDGGPFQYPNQCFGF[GVVCRVJGFQYPNQCFPQVKEG°TUV
Save an attached video to your Camera Roll album:  Touch and hold the attachment, 
then tap Save Video. If the video hasn’t been downloaded yet, tap the download 
PQVKEG°TUV
Printing Messages and Attachments
You can print email messages, and attachments that can be viewed in Quick Look. 
Print an email message:  Tap  , then tap Print. Tap Select Printer to select a printer, 
then set printer options such as number of copies and double-sided output (if the 
printer supports it). Then tap Print.
To print an inline image without the rest of the email message, save the image (tap the 
image and tap Save Image), then open Photos or Camera and print the image from 
your Camera Roll album.
Print an attachment:  Tap the attachment to view it in Quick Look, then tap   and  
tap Print. Tap Select Printer to select a printer, then set printer options such as the 
range of pages, number of copies, and double-sided output (if the printer supports it). 
Then tap Print.
For more information, see “Printing” on page 41.
80 Chapter 6    Mail

Sending Email
You can send an email message to anyone who has an email address.
Compose and send a message:
  1  Tap  .
  26[RGCPCOGQTGOCKNCFFTGUUKPVJG6Q°GNFQTVCR  to add a name from your contacts.
As you type an email address, matching email addresses from your contacts list appear 
below. Tap an address to add it. To add more names, tap Return or  . 
Note:  If you’re composing a message from your Microsoft Exchange account and 
have access to your enterprise Global Address List (GAL), matching addresses from the 
EQPVCEVUQPK2JQPGCRRGCT°TUVHQNNQYGFD[OCVEJKPI)#.CFFTGUUGU
  3  Tap Cc/Bcc/From if you want to copy or blind copy the message to others, or change 
the account you send the message from. If you have more than one email account, 
QTKH[QWJCXGGOCKNCNKCUGUHQT[QWT/QDKNG/GCEEQWPV[QWECPVCRVJG(TQO°GNFVQ
change the account or alias you’re sending from.
  4  Enter a subject, then your message.
;QWECPVCR4GVWTPVQOQXGHTQOQPG°GNFVQCPQVJGT
  5  Tap Send.
Send a photo or video in an  
email message
In Photos, choose a photo or video, tap  , then tap Email 
Photo or Email Video. You can also copy and paste photos 
and videos.
To send multiple photos or videos, tap   while viewing 
thumbnails in an album. Tap to select the photos and 
videos, tap Share, then tap Email.
Paste and send a photo or video in  
an email message
In Photos, touch and hold a photo or video until the Copy 
command appears. Tap Copy. Go to Mail and create a new 
message. Tap to place the insertion point where you want 
the video, then tap the insertion point to display the edit 
commands and tap Paste.
To copy multiple videos, in Photos, open an album, tap  , 
tap to select photos and videos, then tap Copy.
Save a draft of a message to  
complete later
Tap Cancel, then tap Save. The message is saved in the 
Drafts mailbox.
Open the most recently saved draft Touch and hold   to open the most recently saved draft 
from the last account you were working in.
Reply to a message Tap  . Tap Reply to reply only to the sender or tap Reply 
All to reply to the sender and all recipients. Type your return 
message, then tap Send.
Files or images attached to the initial message aren’t  
sent back.
81
Chapter 6    Mail

Forward a message Open a message and tap  , then tap Forward. Add one or 
more email addresses, type your message, then tap Send.
9JGP[QWHQTYCTFCOGUUCIG[QWECPKPENWFGVJG°NGUQT
images attached to the original message.
Share contact information In Contacts, choose a contact, tap Share Contact at the 
bottom of the Info screen, then tap Email.
Organizing Email
You can organize messages in any mailbox, folder, or search results window. You 
can delete messages one at a time, or select a group to delete all at once. You can 
also move messages from one mailbox or folder to another in the same account or 
DGVYGGPFKÒGTGPVCEEQWPVU
Delete a message:  Open the message and tap  .
You can also delete a message directly from the mailbox message list by swiping left 
or right over the message title, then tapping Delete.
;VZOV^[OL
+LSL[LI\[[VU
Z^PWLSLM[VY
YPNO[V]LY
[OLTLZZHNL
Note:  For Google accounts, tap Archive. Messages aren’t deleted, but are moved to 
your account archive.
82 Chapter 6    Mail

Delete multiple messages:  When viewing a list of messages, tap Edit, select the 
messages you want to delete, then tap Delete.
Move a message to another mailbox or folder:  When viewing a message, tap  , then 
choose a mailbox or folder.
Tap Accounts to choose a mailbox or folder for another account.
Move multiple messages:  When viewing a list of messages, tap Edit, select the 
messages you want to move, then tap Move and choose a mailbox or folder.
83
Chapter 6    Mail

Searching Email
;QWECPUGCTEJVJG6Q(TQOCPF5WDLGEV°GNFUQHGOCKNOGUUCIGU/CKNUGCTEJGUVJG
downloaded messages in the currently open mailbox. For MobileMe, Exchange, and 
some IMAP mail accounts, you can also search messages on the server.
Search email messages:  Open a mailbox, scroll to the top, and enter text in the Search 
°GNF6CR(TQO6Q5WDLGEVQT#NNVQEJQQUGYJKEJ°GNFU[QWYCPVVQUGCTEJ6QUETQNN
SWKEMN[VQVJGUGCTEJ°GNFCVVJGVQRQHVJGNKUVVCRVJGUVCVWUDCT
Search results for the messages already downloaded to iPhone appear automatically 
as you type. Tap Search to dismiss the keyboard and see more of the results.
Search messages on the server:  Tap “Continue Search on Server” at the end of the 
search results.
Note:  Search results of messages on servers may vary depending on the type of 
account. Some servers may search only whole words.
Mail messages are included in searches from the Home screen. See “Searching” on 
page 43.
84 Chapter 6    Mail

Safari 7
Safari lets you surf the web and view webpages on iPhone as if you were on your 
computer. Create bookmarks on iPhone and sync them with your computer. Add 
web clips to quickly access your favorite sites directly from the Home screen. Print 
webpages, PDFs, and other documents that open in Quick Look.
Viewing Webpages
You can view webpages in either portrait or landscape orientation. Rotate iPhone and 
VJGYGDRCIGTQVCVGUVQQCWVQOCVKECNN[CFLWUVKPIVQ°VVJGRCIG
85

Opening Webpages
Open a webpage:  6CRVJGCFFTGUU°GNFQPVJGNGHVUKFGQHVJGVKVNGDCTVJGPV[RGVJG
YGDCFFTGUUCPFVCR)Q+HVJGCFFTGUU°GNFKUP¨VXKUKDNGVCRVJGUVCVWUDCTCVVJGVQRQH
VJGUETGGPVQSWKEMN[UETQNNVQVJGCFFTGUU°GNFCVVJGVQRQHVJGYGDRCIG
As you type, web addresses that start with those letters appear. These are bookmarked 
RCIGUQTTGEGPVRCIGU[QW¨XGQRGPGF6CRCPCFFTGUUVQIQVQVJCVRCIG-GGRV[RKPI
if you want to enter a web address that’s not in the list.
'TCUGVJGVGZVKPVJGCFFTGUU°GNF6CRVJGCFFTGUU°GNFVJGPVCR .
Zooming and Scrolling
Zoom in or out:  Double-tap a column on a webpage to expand the column.  
Double-tap again to zoom out.
You can also pinch to zoom in or out manually.
Scroll around a webpage Drag up, down, or sideways. When scrolling, you can touch 
and drag anywhere on the page without activating any links.
Scroll within a frame on a webpage 7UGVYQ°PIGTUVQUETQNNYKVJKPCHTCOGQPCYGDRCIG7UG
QPG°PIGTVQUETQNNVJGGPVKTGYGDRCIG
Scroll quickly to the top of a webpage Tap the status bar at the top of the iPhone screen.
Navigating Webpages
Links on webpages typically take you to another place on the web.
Follow a link on a webpage:  Tap the link.
You can also use web links to make a phone call, display a location in Maps, play 
streaming audio, or create a preaddressed Mail message. To return to Safari after a link 
opens another app, press the Home   button and tap Safari.
See a link’s destination address Touch and hold the link. The address pops up next to your 
°PIGT;QWECPVQWEJCPFJQNFCPKOCIGVQUGGKHKVJCUC
link.
Stop a webpage from loading Tap  .
Reload a webpage Tap  .
86 Chapter 7    Safari

Return to the previous or next page Tap   or   at the bottom of the screen.
Return to a recently viewed page Tap   and tap History. To clear the history list, tap Clear.
Create a preaddressed Mail message Touch and hold an email web link, then tap New Message.
Create a new or add to an existing 
contact
Touch and hold a web link containing contact information, 
then tap Create New Contact or Add to Existing Contact.
Send a webpage URL via email Tap   and tap “Mail Link to this Page.”
Save an image or photo to your 
Camera Roll album
Touch and hold the image, then tap Save Image.
View a webpage video on an  
Apple TV 
Start playing the video, then tap   and choose Apple TV. 
If   doesn’t appear or if you don’t see the Apple TV you’re 
looking for, make sure iPhone is on the same wireless 
network.
9JGP[QW°PKUJ6CR  and choose iPhone from the list.
Opening Multiple Pages
You can have up to eight pages open at a time. Some links automatically open a new 
page instead of replacing the current one.
The number inside the   at the bottom of the screen shows how many pages are 
open. If there’s no number inside, just one page is open. For example:
 = one page is open
 = three pages are open
Open a new page:  Tap   and tap New Page.
Go to another page:  Tap  CPF±KEMNGHVQTTKIJV6CRVJGRCIG[QWYCPVVQXKGY
Close a page:  Tap   and tap  .
87
Chapter 7    Safari

Entering Text and Filling Out Forms
5QOGYGDRCIGUJCXGVGZV°GNFUCPFHQTOUVQ°NNQWV;QWECPUGV5CHCTKVQTGOGODGT
PCOGUCPFRCUUYQTFUQHYGDUKVGU[QWXKUKVCPF°NNQWVVGZV°GNFUCWVQOCVKECNN[YKVJ
information from Contacts. See “Safari” on page 208.
Bring up the keyboard 6CRKPUKFGCVGZV°GNF
/QXGVQCPQVJGTVGZV°GNF 6CRCPQVJGTVGZV°GNFQTVCRVJG0GZVQT2TGXKQWUDWVVQP
Submit a form 1PEG[QW°PKUJ°NNKPIQWVCHQTOVCR)QQT5GCTEJ/QUV
pages also have a link you can tap to submit the form.
Close the keyboard without 
submitting the form
Tap Done.
'PCDNG#WVQ(KNNVQJGNR[QW°NNQWVYGDHQTOUIn Settings, choose Safari > AutoFill, 
then do one of the following:
 To use information from contacts, turn Use Contact Info on, then choose My Info and 
select the contact you want to use.
5CHCTKWUGUKPHQTOCVKQPHTQO%QPVCEVUVQ°NNKPEQPVCEV°GNFUQPYGDHQTOU
 To use information from names and passwords, turn Names & Passwords on.
When this feature is on, Safari remembers names and passwords of websites you 
XKUKVCPFCWVQOCVKECNN[°NNUKPVJGKPHQTOCVKQPYJGP[QWTGXKUKVVJGYGDUKVG
 To remove all AutoFill information, tap Clear All.
Searching
7UGVJGUGCTEJ°GNFVQGPVGTYQTFUCPFRJTCUGUHQTUGCTEJKPIDQVJVJGYGDCPFVJG
current webpage. As you type, suggested and recent searches appear.
Search the web:
  1 6CRVJGUGCTEJ°GNFQPVJGTKIJVUKFGQHVJGVKVNGDCT
  2  Type a word or phrase that describes what you’re looking for, then tap a suggestion 
from the list or tap Search.
  3  Tap a link in the list of search results to open a webpage.
Find the search word or phrase on the current webpage:  Scroll to the bottom of the 
TGUWNVUNKUVVJGPVCRVJGGPVT[DGNQY1P6JKU2CIGVQ°PFVJG°TUVQEEWTTGPEGQHVJG
UGCTEJYQTFQTRJTCUG6Q°PFUWDUGSWGPVQEEWTTGPEGUVCR0GZV
By default, Safari searches using Google. You can use other search engines.
5GV5CHCTKVQUGCTEJWUKPICFKÒGTGPVUGCTEJGPIKPGIn Settings, choose Safari > 
5GCTEJ'PIKPGVJGPEJQQUGCFKÒGTGPVUGCTEJGPIKPG
88 Chapter 7    Safari

Printing Webpages, PDFs, and Other Documents
You can print webpages, PDFs, and other documents that open in Quick Look  
from Safari.
Print a webpage, PDF, or Quick Look document:  Tap  , then tap Print. Tap Select 
Printer to select a printer, then set printer options such as number of copies and 
double-sided output (if the printer supports it). If you’re printing a PDF or other Quick 
Look document, you may be able to set the range of pages you want to print. Then  
tap Print.
For more information, see “Printing” on page 41.
Viewing Web Videos on a TV
You can view QuickTime and other supported web videos on a TV by connecting 
iPhone to your TV or AV receiver using an Apple Component AV Cable, Apple 
Composite AV Cable, Apple VGA Adapter, or Apple Digital AV Adapter (iPhone 4), or 
wirelessly using AirPlay and Apple TV. See “Watching Videos on a TV” on page 102.
Bookmarks
You can bookmark webpages you want to return to later.
Bookmark a webpage:  Open the page and tap  . Then tap Add Bookmark.
When you save a bookmark you can edit its title. By default, bookmarks are saved at 
the top level of Bookmarks. Tap Bookmarks to choose another folder.
If you use Safari on a Mac, or Safari or Microsoft Internet Explorer on a PC, you can sync 
bookmarks with the web browser on your computer.
Sync bookmarks with your computer:
  1  Connect iPhone to your computer.
  2  In iTunes, select iPhone in the Devices list.
  3  Click Info at the top of the screen, select “Sync … bookmarks” under Other, then  
click Apply.
See “iPhone Settings Panes in iTunes” on page 54.
Sync bookmarks with MobileMe:  In Settings on iPhone, select Bookmarks in your 
MobileMe account. See “Setting Up MobileMe Accounts” on page 26.
Open a bookmarked webpage:  Tap  , then choose a bookmark or tap a folder to 
see the bookmarks inside.
89
Chapter 7    Safari

Edit a bookmark or bookmark folder:  Tap  , choose the folder that has the 
bookmark or folder you want to edit, then tap Edit. Then do one of the following:
 To make a new folder, tap New Folder.
 To delete a bookmark or folder, tap  , then tap Delete.
 To reposition a bookmark or folder, drag  .
 6QGFKVVJGPCOGQTCFFTGUUQTVQRWVKVKPCFKÒGTGPVHQNFGTtap the bookmark or folder.
9JGP[QW°PKUJVCR&QPG
Web Clips
Add web clips to the Home screen for fast access to your favorite webpages. Web clips 
appear as icons on the Home screen, and you can arrange your web clips along with 
the other icons. See “Customizing the Home Screen” on page 33.
Add a web clip:  Open the webpage and tap  . Then tap “Add to Home Screen.”
When you open a web clip, Safari automatically zooms and scrolls to the area of the 
webpage that was displayed when you saved the web clip. The displayed area is also 
used to create the icon for the web clip on your Home screen, unless the webpage 
comes with its own custom icon.
When you add a web clip, you can edit its name. If the name is too long (more than 
about 10 characters), it may appear abbreviated on the Home screen.
Web clips aren’t bookmarks, and aren’t synced by MobileMe or iTunes.
Delete a web clip:
  1  Touch and hold any icon on the Home screen until the icons start to jiggle.
  2  Tap   in the corner of the web clip you want to delete.
  3  Tap Delete, then press the Home   button to save your arrangement.
90 Chapter 7    Safari

iPod 8
Use the iPod app to enjoy your favorite music, widescreen videos, and more. Browse 
your content on iPhone by playlists, artists, songs, videos, or other categories, or 
browse your album artwork using Cover Flow. Play your music on AirPlay speakers or 
sound systems, or watch your videos on a TV using AirPlay and Apple TV.
Getting Music, Videos, and More
There are two ways to get music, videos, and other content onto iPhone:
Transfer music, videos, and more onto iPhone by syncing content from iTunes on  
[QWTEQORWVGT;QWECPU[PECNNQH[QWTOGFKCQT[QWECPUGNGEVURGEK°EUQPIU
videos, podcasts, and iTunes U collections. See “Syncing with iTunes” on page 53.
Use the iTunes Store on iPhone to purchase and download songs, albums, TV shows,  
movies, music videos, ringtones, and audiobooks directly to iPhone. You can also 
stream and download audio and video podcasts, as well as iTunes U content. After 
listening to a podcast or watching a TV show, you can tap a built-in link to get more 
episodes from the iTunes Store. See Chapter 22, “iTunes Store,” on page 165.
Music and Other Audio
The high-resolution Multi-Touch display makes listening to songs on iPhone as much 
a visual experience as a musical one. You can scroll through your playlists, or use Cover 
Flow to browse your album artwork.
WARNING:  For important information about avoiding hearing loss, see the Important 
Product Information Guide at www.apple.com/support/manuals/iphone.
91

Playing Songs and Other Audio
You can browse content on iPhone by playlists, artists, songs, videos, and other 
categories, or browse your album artwork using Cover Flow. Playlist folders, which you 
can sync from iTunes, let you organize playlists into groups.
Browse your collection:  Tap Playlists, Artists, or Songs. Tap More to browse Albums, 
Audiobooks, Compilations, Composers, Genres, iTunes U, Podcasts, or Videos.
You can replace the browse buttons at the bottom of the screen with buttons you use 
more frequently. See “Changing the Browse Buttons” on page 105.
Get more podcast episodes:  6CR2QFECUVUVCR/QTG°TUVKH2QFECUVUKUP¨VXKUKDNGVJGP
tap a podcast to see a list of episodes. Tap “Get More Episodes…” to see a list of more 
episodes in the iTunes Store.
Browse Genius Mixes:  6CR)GPKWUVCR/QTG°TUVKH)GPKWUKUP¨VXKUKDNG+H)GPKWU
doesn’t appear, you need to turn on Genius in iTunes, and then sync iPhone with 
iTunes. See “Using Genius on iPhone” on page 98.
Play a song:  Tap the song.
5JCMGVQUJWÔG5JCMGK2JQPGVQVWTPUJWÔGQPCPFEJCPIGUQPIU5JCMGCP[VKOGVQ
change to another song.
;QWECPVWTP5JCMGVQ5JWÔGQPQTQÒKP5GVVKPIU K2QFKV¨UQPD[FGHCWNV5GG
“Music” on page 210.
Controlling Audio Playback
When you play a song, the Now Playing screen appears.
5L_[-HZ[MVY^HYK
7SH`7H\ZL
;YHJR3PZ[
)HJR
=VS\TL7YL]PV\Z
9L^PUK
(PY7SH`
92 Chapter 8    iPod

Pause a song Tap  , or press the center button on the iPhone earphones.
Resume playback Tap  , or press the center button on the iPhone earphones.
Raise or lower the volume Drag the volume slider or use the buttons on the side of 
iPhone. You can also use the volume buttons on the iPhone 
earphones.
Play music on AirPlay speakers or 
Apple TV
Tap  , then choose the speakers or Apple TV. If   doesn’t 
appear or if you don’t see the AirPlay system you’re looking 
for, make sure iPhone is on the same wireless network.
Switch from AirPlay back to iPhone Tap   and choose iPhone from the list.
Restart a song or a chapter in an 
audiobook or podcast
Tap  .
Skip to the next song or chapter in an 
audiobook or podcast
Tap  , or press the center button on the iPhone earphones 
twice quickly.
Go to the previous song or chapter in 
an audiobook or podcast
Tap   twice, or press the center button on the iPhone 
earphones three times quickly.
Rewind or fast-forward Touch and hold   or  . The longer you hold the control, 
the faster the song rewinds or fast-forwards. On the iPhone 
earphones, press the center button twice quickly and hold to 
fast forward, or three times quickly and hold to rewind.
Return to the iPod browse lists Tap  , or swipe to the right over the album artwork.
Return to the Now Playing screen Tap Now Playing.
Display a song’s lyrics Tap the album artwork when playing a song. (Lyrics appear 
if you’ve added them to the song using the song’s Info 
window in iTunes.)
Display audio playback controls from another app or from the Lock screen:  Double-
click the Home  DWVVQPVJGP±KEMHTQONGHVVQTKIJVCNQPIVJGDQVVQOQHVJGUETGGP
The controls operate the currently playing app, or the most recent app that played, if 
the audio is paused. The icon for the active app appears on the right. You can tap the 
icon to open the app.
If iPhone is locked and music is playing, double-click the Home button.
93
Chapter 8    iPod

Additional Audio Controls
To display additional controls, tap the album artwork on the Now Playing screen.
6JGTGRGCV)GPKWUCPFUJWÔGEQPVTQNUCRRGCTCNQPIYKVJVJGUETWDDGTDCT;QWECP
see elapsed time, remaining time, and the song number. The song’s lyrics also appear, if 
you’ve added them to the song in iTunes.
Use the scrubber bar to skip to any point along the timeline. You can adjust the scrub 
TCVGHTQOJKIJURGGFVQ°PGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCF
along the scrubber bar.
9LWLH[ 7PUNSPRL
:JY\IILYIHY
:O\MMSL
.LUP\Z
7PUNWVZ[
7SH`OLHK
Set iPhone to repeat songs Tap  . Tap   again to set iPhone to repeat only the 
current song.
 = iPhone is set to repeat all songs in the current album 
or list.
 = iPhone is set to repeat the current song over and over.
 = iPhone isn’t set to repeat songs.
Skip to any point in a song &TCIVJGRNC[JGCFCNQPIVJGUETWDDGTDCT5NKFG[QWT°PIGT
down to adjust the scrub rate. The scrub rate becomes 
UNQYGTVJGHCTVJGTFQYP[QWUNKFG[QWT°PIGT
Tell your Ping followers you like a 
song
Tap  .
 = You’ve already said that you like this song.
Make a Genius playlist Tap  . The Genius playlist appears, with buttons that let 
you create a new Genius playlist, refresh the current one, or 
save the playlist. See “Using Genius on iPhone” on page 98.
Post a Ping comment about a song Tap  .
5GVK2JQPGVQUJWÔGUQPIU Tap  . Tap   again to set iPhone to play songs in order.
K2JQPGKUUGVVQUJWÔGUQPIU
 = iPhone is set to play songs in order.
5JWÔGVJGVTCEMUKPCP[RNC[NKUV
album,  
or other list of songs
6CR5JWÔGCVVJGVQRQHVJGNKUV(QTGZCORNGVQUJWÔGCNN
VJGUQPIUQPK2JQPGEJQQUG5QPIU 5JWÔG
9JGVJGTQTPQVK2JQPGKUUGVVQUJWÔGKH[QWVCR5JWÔGCV
the top of a list of songs, iPhone plays the songs from that 
list in random order.
Hide lyrics +P5GVVKPIUEJQQUGK2QFVJGPVWTP.[TKEU2QFECUV+PHQQÒ
94 Chapter 8    iPod

Podcast and Audiobook Controls
Additional controls and information appear on the Now Playing screen when you 
begin playback.
The email, 30-second repeat, and playback speed controls appear along with  
the scrubber bar. You can see elapsed time, remaining time, and the episode or 
chapter number.
Use the scrubber bar to skip to any point along the timeline. You can adjust the scrub 
TCVGHTQOJKIJURGGFVQ°PGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCF
along the scrubber bar.
:JY\IILYIHY 7SH`OLHK
7SH`IHJR
ZWLLK
ZLJVUKYLWLH[,THPS
Send an email link to this podcast Tap  .
Skip to any point &TCIVJGRNC[JGCFCNQPIVJGUETWDDGTDCT5NKFG[QWT°PIGT
down to adjust the scrub rate. The scrub rate becomes 
UNQYGTVJGHCTVJGTFQYP[QWUNKFG[QWT°PIGT
Play back the last 30 seconds Tap  . 
Set the playback speed Tap  . Tap again to change the speed.
 = Play at double speed.
 = Play at half speed.
 = Play at normal speed.
Show or hide the controls Tap in the center of the screen.
Hide podcast information +P5GVVKPIUEJQQUGK2QFVJGPVWTP.[TKEU2QFECUV+PHQQÒ
Using Voice Control with iPod
You can use Voice Control to control music playback on iPhone. 
Note:  Voice Control may not be available in all languages.
Use Voice Control:  Press and hold the Home   button until the Voice Control screen 
appears and you hear a beep. Then use the commands described below to play songs. 
You can also press and hold the center button on the iPhone earphones to bring up 
Voice Control.
95
Chapter 8    iPod

Control music playback Say “play” or “play music.” To pause, say “pause” or “pause 
music.” You can also say “next song” or “previous song.”
Play an album, artist, or playlist Say “play,” then say “album,” “artist,” or “playlist” and the 
name.
5JWÔGVJGEWTTGPVRNC[NKUV 5C[¥UJWÔG¦
Find out more about the currently 
playing song
Say “what’s playing,” “what song is this,” “who sings this 
song,” or “who is this song by.”
Use Genius to play similar songs Say “Genius,” “play more like this,” or “play more songs like 
this.”
Cancel Voice Control Say “cancel” or “stop.”
Browsing Album Artwork in Cover Flow
When you’re browsing music, you can rotate iPhone sideways to see your iTunes 
content in Cover Flow and browse your music by album artwork.
Browse album artwork Drag left or right.
See the tracks on an album Tap the album artwork or  .
96 Chapter 8    iPod

Play any track Tap the track. Drag up or down to scroll through the tracks.
Return to the artwork Tap the title bar. Or tap   again.
Play or pause the current song Tap   or  . You can also press the center button on the 
iPhone earphones.
Viewing All Tracks on an Album
See all the tracks on the album that contains the current song:  On the Now Playing 
screen, tap  . Tap a track to play it. Tap the album artwork thumbnail to return to the 
Now Playing screen.
9H[PUNIHY
)HJR[V5V^
7SH`PUN
ZJYLLU
(SI\T[YHJRZ
In track list view, you can assign ratings to songs. You can use ratings to create  
smart playlists in iTunes that dynamically update to include, for example, your highest 
rated songs.
Rate a song:  &TCI[QWT°PIGTCETQUUVJGTCVKPIDCTVQIKXGVJGUQPI\GTQVQ°XGUVCTU
Searching Audio Content
You can search the titles, artists, albums, and composers of songs, podcasts, and other 
content you’ve synced to iPhone.
Search music:  'PVGTVGZVKPVJGUGCTEJ°GNFCVVJGVQRQHCUQPINKUVRNC[NKUVCTVKUVNKUV
or other view of your iPod content. (Tap the status bar to scroll quickly to the top of a 
NKUVCPFTGXGCNVJGUGCTEJ°GNF
Search results appear as you type. Tap Search to dismiss the keyboard and see more of 
the results.
Audio content is included in searches from the Home screen. See “Searching” on 
page 43.
97
Chapter 8    iPod

Using Genius on iPhone
)GPKWU°PFUUQPIUKP[QWTK6WPGUNKDTCT[VJCVIQITGCVVQIGVJGT#)GPKWURNC[NKUVKUC
collection of songs that are picked for you to go with a song you choose from your 
library. A Genius Mix is a selection of songs of the same kind of music. Genius Mixes 
are recreated each time you listen to them, so they’re always new and fresh.
You can create Genius playlists in iTunes and sync them to iPhone. You can also create 
and save Genius playlists directly on iPhone.
)GPKWU/KZGUCTGETGCVGFCWVQOCVKECNN[HQT[QWD[K6WPGUK6WPGUETGCVGUFKÒGTGPV
mixes depending on the variety of music you have in your iTunes library. For example, 
you may have Genius Mixes that highlight R&B songs, or Alternative Rock songs.
6QWUG)GPKWUQPK2JQPG°TUVVWTPQP)GPKWUKPK6WPGUVJGPU[PEK2JQPGYKVJK6WPGU
Genius Mixes are synced automatically, unless you manually manage your music and 
choose which mixes you want to sync in iTunes. Genius is a free service, but it requires 
an Apple ID.
When you sync a Genius Mix, iTunes may select and sync songs from your library that 
[QWJCXGP¨VURGEK°ECNN[EJQUGPVQU[PE
Browse Genius Mixes:  6CR)GPKWUVCR/QTG°TUVKH)GPKWUKUP¨VXKUKDNG6JGPWODGT 
of dots at the bottom of the screen shows the number of mixes you’ve synced  
from iTunes, and indicates which mix you’re viewing. Flick left or right to access your 
other mixes.
Play a Genius Mix:  Tap the mix or tap  .
Make a Genius playlist on iPhone:  
  1 6CR2NC[NKUVUVCR/QTG°TUVKH2NC[NKUVUKUP¨VXKUKDNGVJGPVCR)GPKWU2NC[NKUV
  2  Tap a song in the list. Genius creates a playlist with additional songs that go great with 
that song.
98 Chapter 8    iPod

You can also make a Genius playlist of songs that go great with the song you’re 
playing. Tap the album artwork on the Now Playing screen to display additional 
controls, then tap  .
Save a Genius playlist:  In the playlist, tap Save. The playlist is saved in Playlists with 
the title of the song you picked.
You can make and save as many Genius playlists as you want. If you save a Genius 
playlist created on iPhone, it syncs back to iTunes the next time you connect.
Refresh a Genius playlist:  In the playlist, tap Refresh.
4GHTGUJKPICRNC[NKUVETGCVGUCRNC[NKUVQHFKÒGTGPVUQPIUVJCVIQITGCVYKVJVJGUQPI
you picked. You can refresh any Genius playlist, whether it was created in iTunes and 
synced to iPhone, or created directly on iPhone.
/CMGC)GPKWURNC[NKUVWUKPICFKÒGTGPVUQPITap Genius Playlist, then tap New and 
pick a song.
Delete a saved Genius playlist:  Tap the Genius playlist, then tap Delete.
Once a Genius playlist is synced back to iTunes, you won’t be able to delete it  
directly from iPhone. You can use iTunes to edit the playlist name, stop syncing, or 
delete the playlist.
Creating Playlists
You can create and edit your own playlists on iPhone. You can also edit playlists synced 
from iTunes on your computer.
Create a playlist:
  1 6CR2NC[NKUVUVCR/QTG°TUVKH2NC[NKUVUKUP¨VXKUKDNGVJGPVCR¥#FF2NC[NKUV¦
  2  Type a name for your playlist, then tap Save.
  3  Browse for songs using the buttons at the bottom of the screen. Tap any song or video 
to add it to the playlist. Tap Add All Songs at the top of any list of songs to add all the 
songs in the list.
  4 9JGP[QW°PKUJVCR&QPG
When you make a playlist and then sync iPhone to your computer, the playlist is 
synced to your iTunes library.
Edit a playlist:
  1 6CR2NC[NKUVUVCR/QTG°TUVKH2NC[NKUVUKUP¨VXKUKDNGVJGPVCRVJGRNC[NKUV[QWYCPVVQGFKV
  2  Tap Edit, then do one of the following:
 To move a song higher or lower in the list, drag   next to the song.
 To delete a song from the playlist, tap   next to a song, then tap Delete. Deleting a 
song from a playlist doesn’t delete it from iPhone.
 To add more songs, tap  .
  3 9JGP[QW°PKUJVCR&QPG
99
Chapter 8    iPod

When you edit a playlist and then sync iPhone to your computer, the playlist is synced 
to your iTunes library.
Delete a playlist:  In Playlists, tap the playlist you want to delete, then tap Delete (scroll 
VQVJGVQRQHVJGNKUVVQTGXGCNVJG&GNGVGDWVVQP%QP°TOD[VCRRKPI&GNGVG2NC[NKUV
Clear a playlist:  In Playlists, tap the playlist you want to clear, then tap Clear (scroll to 
VJGVQRQHVJGNKUVVQTGXGCNVJG%NGCTDWVVQP%QP°TOD[VCRRKPI%NGCT2NC[NKUV
Videos
With iPhone, you can view video content such as movies, music videos, and video 
podcasts. If a video contains chapters, you can skip to the next or previous chapter, 
or bring up a list and start playing at any chapter that you choose. If a video provides 
alternate language features, you can choose an audio language or display subtitles.
Playing Videos
Play a video:  6CR8KFGQUVCR/QTG°TUVKH8KFGQUKUP¨VXKUKDNGVJGPVCRVJGXKFGQ
Display playback controls:  Tap the screen to show the controls. Tap again to hide them.
Get more podcast or TV show episodes:  6CR8KFGQUVCR/QTG°TUVKH8KFGQUKUP¨V
visible), then tap a podcast or TV show to see a list of episodes. Tap “Get More 
Episodes…” to see a list of more episodes in the iTunes Store.
Controlling Video Playback
Videos play in landscape orientation to take full advantage of the widescreen display.
The scrubber bar lets you skip to any point along the timeline. You can adjust the scrub 
TCVGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCFCNQPIVJGUETWDDGTDCT
7SH`OLHK
:JY\IILYIHY
7SH`7H\ZL
5L_[-HZ[
MVY^HYK
:JHSL
9LZ[HY[9L^PUK =VS\TL
(PY7SH`
100 Chapter 8    iPod

Pause a video Tap  , or press the center button on the iPhone earphones.
Resume playback Tap  , or press the center button on the iPhone earphones.
Raise or lower the volume Drag the volume slider. You can also use the volume 
buttons on the iPhone earphones.
Switch from AirPlay back to iPhone Tap   and choose iPhone from the list.
Skip to the next chapter (if available) Tap  , or press the center button on the iPhone earphones 
twice quickly.
Go to the previous chapter  
(if available)
Tap  , or press the center button on the iPhone earphones 
three times quickly.
5VCTVRNC[KPICVCURGEK°EEJCRVGT 
(if available)
Tap  , then choose a chapter from the list.
Rewind or fast-forward Touch and hold   or  .
Skip to any point in a video &TCIVJGRNC[JGCFCNQPIVJGUETWDDGTDCT5NKFG[QWT°PIGT
down to adjust the scrub rate. The scrub rate becomes 
UNQYGTVJGHCTVJGTFQYP[QWUNKFG[QWT°PIGT
Stop watching a video before it 
°PKUJGURNC[KPI
Tap Done. Or press the Home   button.
5ECNGCXKFGQVQ°NNVJGUETGGPQT°VVQ
the screen
Tap  VQOCMGVJGXKFGQ°NNVJGUETGGP6CR  to make 
KV°VVJGUETGGP;QWECPCNUQFQWDNGVCRVJGXKFGQVQUYKVEJ
DGVYGGP°VVKPICPF°NNKPIVJGUETGGP
9JGP[QWUECNGCXKFGQVQ°NNVJGUETGGPVJGUKFGUQTVQR
OC[DGETQRRGFHTQOXKGY9JGP[QWUECNGKVVQ°VVJG
screen, you may see black bars on the sides or above and 
below the video.
Select an alternate audio language  
(if available)
Tap  , then choose a language from the Audio list.
Show or hide subtitles (if available) Tap  VJGPEJQQUGCNCPIWCIGQT1ÒHTQOVJG 
Subtitles list.
Searching for Videos
You can search the titles of movies, TV shows, and video podcasts you’ve synced  
to iPhone.
Search for a video:  'PVGTVGZVKPVJGUGCTEJ°GNFCVVJGVQRQHVJGNKUVQHXKFGQU
Search results appear as you type. Tap Search to dismiss the keyboard and see more  
of the results.
Video content is included in searches from the Home screen. See “Searching” on page 43.
101
Chapter 8    iPod

Watching Rented Movies and TV Shows
You can rent movies from the iTunes Store and watch them on iPhone. You can 
download rented movies and TV shows directly to iPhone, or transfer movies from 
iTunes on your computer to iPhone. (Rented movies and TV shows may not be 
available in all countries or regions.)
See “Purchasing or Renting Videos” on page 170.
A movie or TV show must be completely downloaded before you can start watching it. 
You can pause a download and resume it later. 
Rented movies and TV shows expire after a certain time, and once you start a movie or 
68UJQY[QWJCXGCNKOKVGFCOQWPVQHVKOGVQ°PKUJYCVEJKPIKV6JGVKOGTGOCKPKPI
appears near the title. Rented items are automatically deleted when they expire. Before 
renting a movie or TV show, check the iTunes Store for the rental period.
View a rented movie or TV show:  1PK2JQPGEJQQUGK2QF 8KFGQUVCR/QTG°TUVKH
Videos isn’t visible), then select the movie or TV show.
On iPhone 3GS, you can transfer rented movies between iPhone and your computer. 
On iPhone 4, you can transfer rented movies between iPhone and your computer only 
if they were rented in iTunes on your computer. Movies rented on iPhone 4 can’t be 
transferred to your computer.
Transfer a rented movie between iPhone and your computer:  
  1  Connect iPhone to your computer.
  2  In iTunes, select iPhone in the Devices list, then click Movies.
  3  Click Move next to the item you want to transfer, then click Apply.
Your computer must be connected to the Internet.
Watching Videos on a TV
You can watch iPod videos on your TV, using any of the following:
Apple Component AV Cable 
Apple Composite AV Cable 
Apple Digital AV Adapter and an HDMI cable (iPhone 4) 
Apple VGA Adapter and a VGA cable 
6JG&KIKVCN#8#FCRVGTUWRRQTVUJKIJFG°PKVKQPXKFGQWRVQRYKVJCWFKQ
You can also stream iPod videos wirelessly to your TV using AirPlay and Apple TV.
Note:  Apple cables, adapters, and docks are available for purchase separately. Go to 
www.apple.com/ipodstore (may not be available in all countries or regions) or check 
with your local Apple retailer.
102 Chapter 8    iPod

Connect using an AV cable:  Use the Apple Component AV Cable, Apple Composite 
AV Cable, or other authorized iPhone-compatible cable. You can also use these cables 
with the Apple Universal Dock to connect iPhone to your TV. The Apple Universal Dock 
includes a remote that lets you control playback from a distance. 
Connect using an Apple Digital AV Adapter (iPhone 4):  Attach the Apple Digital AV 
Adapter to the iPhone Dock connector. Use an HDMI cable to connect the HDMI port 
of the adapter to your TV or receiver. To keep iPhone charged while watching videos, 
use an Apple Dock Connector to USB Cable to connect the 30-pin port of the adapter 
to your computer, or to a USB Power Adapter plugged into a power outlet.
Connect using a VGA Adapter:  Attach the VGA Adapter to the iPhone Dock connector. 
Connect the VGA Adapter with a VGA cable to a compatible TV, projector, or VGA display.
Stream videos using AirPlay:  Start video playback, then tap   and choose Apple TV 
from the list. If   doesn’t appear or if you don’t see Apple TV in the list of AirPlay 
devices, make sure it’s on the same wireless network as iPhone. To return playback to 
iPhone, tap   again and choose iPhone from the list.
Converting Videos for iPhone
You can add videos other than those purchased from the iTunes Store to iPhone, such 
as videos you create in iMovie on a Mac, or videos you download from the Internet 
and then add to iTunes.
If you try to add a video from iTunes to iPhone and a message says the video can’t play 
on iPhone, you can convert the video.
Convert a video to work with iPhone:  Select the video in your iTunes library and choose 
Advanced > “Create iPod or iPhone Version.” Then add the converted video to iPhone.
Deleting Videos from iPhone
You can delete videos from iPhone to save space.
Delete a video:  In the videos list, swipe left or right over the video, then tap Delete.
Deleting a video from iPhone (other than a rented movie or TV show) doesn’t delete 
the video from your iTunes library. It may reappear on iPhone if the video in iTunes is 
still set to sync.
Important:  If you delete a rented movie or TV show from iPhone, it’s deleted 
permanently and cannot be transferred back to your computer.
103
Chapter 8    iPod

Home Sharing
Home Sharing (iOS 4.3) lets you play music, movies, and TV shows on iPhone from the 
iTunes library on your Mac or PC. 
Note:  Home Sharing requires iTunes 10.2 or later, available at www.itunes.com/download. 
Bonus content, such as digital booklets and iTunes Extras, can’t be shared.
iPhone and your computer must be on the same Wi-Fi network. On your computer, 
iTunes must be open, with Home Sharing turned on and logged in to the same Apple 
account as Home Sharing on iPhone. 
Play music or video on iPhone from your iTunes library:
  1  In iTunes on your Mac or PC, choose Advanced > Turn On Home Sharing. Enter your 
Apple ID and password, then click Create Home Share.
  2  In Settings, choose iPod then, under Home Sharing, enter the same Apple ID and 
password you used when turning on Home Sharing in iTunes.
  3  In iPod, tap More, then tap Shared and choose your iTunes library.
The Playlists, Artists, Songs, and other tabs in iPod now show the content of your 
iTunes library, instead of your iPhone content. 
Return to content on your iPhone:  In iPod, tap More, then tap Shared and choose 
iPhone at the top of the list.
Setting a Sleep Timer
You can set iPhone to stop playing music or videos after a period of time.
Set a sleep timer:  (TQOVJG*QOGUETGGPEJQQUG%NQEM 6KOGTVJGP±KEMVQUGVVJG
number of hours and minutes. Tap When Timer Ends and choose Sleep iPod, tap Set, 
then tap Start to start the timer.
When the timer ends, iPhone stops playing music or video, closes any other open app, 
and then locks itself.
104 Chapter 8    iPod

Changing the Browse Buttons
You can replace the browse buttons at the bottom of the screen with buttons you 
use more frequently. For example, if you often listen to podcasts, you can replace the 
Songs button with Podcasts.
Change the browse buttons:  Tap More and tap Edit, then drag a button to the 
bottom of the screen, over the button you want to replace.
You can drag the buttons at the bottom of the screen left or right to rearrange them. 
6CR&QPGYJGP[QW°PKUJ6CR/QTGCVCP[VKOGVQCEEGUUVJGDWVVQPU[QWTGRNCEGF
105
Chapter 8    iPod

Messages 9
Sending and Receiving Messages
WARNING:  For important information about driving safely, see the Important Product 
Information Guide at www.apple.com/support/manuals/iphone.
Messages lets you exchange text messages with anyone using an SMS-capable phone 
or other device. Messages also supports MMS, so you can send photos, video clips, 
contact information, and voice memos to other MMS-capable devices. You can enter 
multiple addressees to send one message to several people.
Note:  SMS or MMS support may not be available in all countries or regions. Additional 
fees may apply for use of Messages. Contact your carrier for more information.
The Messages icon on the Home screen shows the number of unread messages  
you have.
5\TILYVM
\UYLHKTLZZHNLZ
You can use Messages whenever you’re in range of the cellular network. If you can 
make a call, you can send a message. Depending on your phone plan, you may be 
charged for the messages you send or receive. 
Send a message:  Tap  , then enter a phone number or name, or tap   and choose a 
EQPVCEVHTQO[QWTEQPVCEVUNKUV6CRVJGVGZV°GNFCDQXGVJGMG[DQCTFV[RGCOGUUCIG
and tap Send.
106

If the message can’t be sent (if you’re out of cellular network range, for example), an 
alert badge appears on the Messages icon on the Home screen. If Messages is in a 
folder, the alert badge appears on the folder.
(SLY[IHKNL
Your conversations are saved in the Messages list. Conversations that contain unread 
messages have a blue dot   next to them. Tap a conversation in the list to see the 
conversation or add to it.
;L_[TLZZHNLZ
`V\ZLU[
;L_[TLZZHNLZ
MYVT[OLV[OLY
WLYZVU
iPhone displays the 50 most recent messages in the conversation. To see earlier 
messages, scroll to the top and tap Load Earlier Messages.
Group messaging (not available in all countries and regions) lets you send a message 
to multiple recipients. 
Send a message to a group of people:  Tap  , then add recipients. If you enter a 
phone number manually (instead of selecting it from Contacts), tap Return before 
entering another entry.
Note:  Check to make sure Group Messaging in Settings > Messages is turned on.
Replies from any of the recipients are sent only to you, not to the other people  
you texted.
Reply or send a message to a person or group you’ve texted:  Tap an entry in the 
Messages list, then type a new message in the conversation and tap Send.
107
Chapter 9    Messages

Send a message to a favorite or to a recent call:  
  1  Tap Phone on the Home screen, then tap Favorites or Recents.
  2  Tap   next to a name or number, then tap Text Message.
  3  If multiple phone numbers appear, tap the one you want to text.
When MMS is available, Messages allows you to include a subject in your text messages. 
;QWECPVWTPVJKUHGCVWTGQPQTQÒKP/GUUCIGUUGVVKPIU+VKUVWTPGFQPD[FGHCWNV
+PENWFGQTTGOQXGVJGUWDLGEV°GNFIn Settings, tap Messages, then tap Show  
Subject Field.
Note:  6JGUWDLGEV°GNFCPFVJG5JQY5WDLGEV(KGNFUGVVKPIFQP¨VCRRGCTKH//5KUP¨V
supported by your carrier.
6WTPEJCTCEVGTEQWPVKPIQPQTQÒIn Settings, tap Messages, then tap the Character 
Count switch. The character count includes all characters—including spaces, 
punctuation, and returns—and appears as you type when your message exceeds two 
lines. You may want to count characters, for example, when carrier fees apply.
Note:  6JGEJCTCEVGTEQWPVFQGUP¨VCRRGCTKH[QWGPVGTVGZVKPVJGUWDLGEV°GNFQTCVVCEJ
a photo or video.
6WTP//5OGUUCIKPIQPQTQÒIn Settings, tap Messages, then tap MMS Messaging. 
;QWOC[YCPVVQVWTP//5/GUUCIKPIQÒHQTGZCORNGVQRTGXGPVUGPFKPIQTTGEGKXKPI
attachments when fees apply.
Note:  The MMS Messaging setting doesn’t appear if MMS isn’t supported by your carrier.
Searching Messages
You can search the content of messages in the Messages list.
Search the Messages list:  6CRVJGVQRQHVJGUETGGPVQFKURNC[VJGUGCTEJ°GNFVJGP
VCRVJGUGCTEJ°GNFCPFGPVGTVJGVGZV[QW¨TGNQQMKPIHQT
Messages are included in searches from the Home screen. See “Searching” on page 43.
Sharing Photos and Videos
You can take a photo or video from within Messages and include it in your 
conversation with another MMS-capable device. You can save photos or videos you 
receive in Messages to your Camera Roll album.
If MMS isn’t supported by your carrier,   doesn’t appear and you can’t send photos  
or videos. 
Send a photo or video:  Tap  . Then tap “Take Photo or Video”, or tap “Choose Existing” 
and then select an item from a photo album and tap Choose.
108 Chapter 9    Messages

The size limit of attachments is determined by your carrier. If necessary, iPhone 
may compress the photo or video. To learn about taking photos and videos, see 
Chapter 12, “Camera,” on page 12 5.
Save a photo or video attachment to your Camera Roll album:  Tap the photo or 
video in the conversation, tap  , then tap Save Image or Save Video.
Copy a photo or video:  Touch and hold the attachment, then tap Copy. You can paste 
the photo or video to an Mail message or another MMS message.
Sending Voice Memos
You can send voice memos in a message to another MMS-capable device.
Send a voice memo:  In Voice Memos, tap  , tap the voice memo you want to send, 
then tap Share and tap MMS. Address the message and tap Send.
Editing Conversations
If you want to keep just part of a conversation, you can delete the parts you don’t 
want. You can also delete entire conversations from the Messages list.
Edit a conversation:  Tap Edit. Tap the circles along the left side to select the parts of 
VJGEQPXGTUCVKQP[QWYCPVVQFGNGVGVJGPVCR&GNGVG9JGP[QW¨TG°PKUJGFVCR&QPG
%NGCTCNNVGZVCPF°NGUYKVJQWVFGNGVKPIVJGEQPXGTUCVKQPTap Edit, then tap Clear All. 
6CR%NGCT%QPXGTUCVKQPVQEQP°TO
Forward a conversation:  Select a conversation, then tap Edit. Tap the circles on the 
left side of the screen to select the parts of the conversation you want to include, then 
tap Forward, enter one or more recipients, and tap Send.
Delete a conversation:  Tap Edit, then tap   next to the conversation and tap Delete. 
You can also swipe left or right over the conversation and tap Delete.
;VZOV^[OL
+LSL[LI\[[VU
Z^PWLSLM[VYYPNO[
V]LY[OLTLZZHNL
109
Chapter 9    Messages

Using Contact Information and Links
Call, FaceTime, or email someone you’ve texted:  Tap a message in the Text Messages 
list and scroll to the top of the conversation. (Tap the status bar to scroll quickly to the 
top of the screen.)
 To call the person, tap Call.
 To call the person using FaceTime, tap FaceTime.
 To email the person, tap Contact Info, then tap an email address.
Follow a link in a message:  Tap the link.
A link may open a webpage in Safari, make a phone call in Phone, open a 
preaddressed message in Mail, or display a location in Maps. To return to your text 
messages, press the Home button and tap Messages.
Add someone you’ve texted to your contacts list:  Tap a phone number in the 
Messages list, then tap “Add to Contacts.”
Send contact information:  In Contacts, tap the person whose information you want 
to share. Tap Share Contact at the bottom of the screen, then tap MMS. Address the 
message and tap Send.
Save contact information received:  Tap the contact bubble in the conversation and 
tap Create New Contact or “Add to Existing Contact.”
Managing Previews and Alerts
By default, iPhone displays a preview of new messages when iPhone is locked or when 
[QWCTGWUKPICPQVJGTCRR;QWECPVWTPVJKURTGXKGYQPQTQÒKP5GVVKPIU;QWECPCNUQ
enable alerts for text messages.
6WTPRTGXKGYUQPQTQÒIn Settings, choose Messages and tap Show Preview.
Show multiple message alerts (iOS 4.3):  In Settings, choose Messages, then tap Play 
Alert Tone and set the number of times an alert should appear if you don’t respond.
Set whether an alert sounds when you get a text message or preview:  In Settings, 
choose Sounds, then tap New Text Message. Tap the alert sound you want, or None if 
you don’t want an audible alert.
Important:  +HVJG4KPI5KNGPVUYKVEJKUQÒVGZVCNGTVUYQP¨VUQWPF
110 Chapter 9    Messages

Calendar 10
About Calendar
Calendar gives you ready access to your calendars and events. You can view individual 
calendars, or several calendars at once. You can view your events by day, by month, 
or in a list. You can search the titles, invitees, locations, and notes of events. If you’ve 
entered birthdays for your contacts, you can view those birthdays in Calendar.
You can sync iPhone with the calendars on your computer, and with services such as 
MobileMe, Microsoft Exchange, Yahoo!, and Google. You can also make, edit, or cancel 
appointments on iPhone and have them sync back to your computer or calendar 
account. If you have a MobileMe, Microsoft Exchange, Google, Yahoo!, or CalDAV 
account, your calendars can sync over the air without connecting iPhone to your 
computer. MobileMe Shared Calendars that you’ve joined from your computer also 
sync with iPhone.
;QWECPUWDUETKDGVQTGCFQPN[K%CNGPFCTKEUECNGPFCTUQTKORQTVKEU°NGUHTQOGOCKN
If you have a Microsoft Exchange account with Calendars enabled, or a supported 
CalDAV account, you can receive and respond to meeting invitations from others, and 
invite people to events you schedule.
Syncing Calendars
You can sync Calendar in either of the following ways:
In iTunes, use the iPhone Info pane to sync with iCal or Microsoft Entourage on a  
Mac, or Microsoft Outlook 2003, 2007, or 2010 on a PC, when you connect iPhone to 
your computer. See “iPhone Settings Panes in iTunes” on page 54.
In Settings on iPhone, turn on Calendars in your MobileMe, Microsoft Exchange,  
Google, or Yahoo! accounts to sync your calendar information over the air, or set 
up a CalDAV account if your company or organization supports it. See “Adding Mail, 
Contacts, and Calendar Accounts” on page 25.
111

Viewing Your Calendars
You can view a single calendar, selected calendars, or all calendars at once.
Select calendars to view:  Tap Calendars, then tap to select the calendars you want 
to view. To quickly select or deselect all calendars, tap Show All Calendars or Hide All 
Calendars. To view your contacts’ birthdays, tap Birthdays at the bottom of the screen. 
Tap Done to view the selected calendars.
The events for all selected calendars appear in a single calendar on iPhone. You can 
view your calendar events in a list, by day, or by month. 
Switch views:  Tap List, Day, or Month.
 List view:  All your appointments and events appear in a scrollable list.
 Day view:  Scroll up or down to see the events in a day. Tap   or   to see the 
previous or next day’s events.
 Month view:  Tap a day to see its events. Tap   or   to see the previous or next month.
(KKHUL]LU[
+H`Z^P[OKV[Z
OH]LZJOLK\SLK
L]LU[Z
.V[V[VKH` :^P[JO]PL^Z
9LZWVUK[V
JHSLUKHYPU]P[H[PVU
,]LU[ZMVY
ZLSLJ[LKKH`
See the details of an event:  Tap the event.
Set iPhone to adjust event times for a selected time zone:  
  1  In Settings, choose “Mail, Contacts, Calendars.”
  2  Under Calendars, tap Time Zone Support, then turn Time Zone Support on.
  3  Tap Time Zone, then search for a major city in the time zone you want.
When Time Zone Support is on, Calendar displays event dates and times in the time 
\QPGQHVJGEKV[[QWUGNGEVGF9JGP6KOG<QPG5WRRQTVKUQÒ%CNGPFCTFKURNC[UGXGPVU
in the time zone of your current location as determined by the network time.
112 Chapter 10    Calendar

Searching Calendars
;QWECPUGCTEJVJGVKVNGUKPXKVGGUNQECVKQPUCPFPQVGU°GNFUQHVJGGXGPVUKP[QWT
calendars. Calendar searches only the events for the calendars you’re currently viewing.
Search for events:  +PNKUVXKGYGPVGTVGZVKPVJGUGCTEJ°GNF
Search results appear as you type. Tap Search to dismiss the keyboard and see  
more results.
Calendar events are included in searches from the Home screen. See “Searching” on 
page 43.
Adding and Updating Events on iPhone
You can create and update calendar events directly on iPhone.
If you have a Microsoft Exchange account with Calendars enabled, or a supported 
CalDAV account, you can invite other people to your event or meeting.
Add an event:  Tap   and enter event information, then tap Done.
You can enter any of the following:
Title 
Location 
Starting and ending times (or turn on All-day if it’s an all-day event) 
Repeat times—none, or every day, week, two weeks, month, or year 
Invitees (if supported by your calendar server) 
#NGTVVKOG¤HTQO°XGOKPWVGUVQVYQFC[UDGHQTGVJGGXGPV 
When you set an alert, the option to set a second alert appears. When an alert 
IQGUQÒK2JQPGFKURNC[UCOGUUCIG;QWECPCNUQUGVK2JQPGVQRNC[CUQWPFUGG
“Alerts” on page 116 ).
113
Chapter 10    Calendar

Important:  Some carriers don’t support network time in all locations. If you’re 
traveling, iPhone may not alert you at the correct local time. To manually set the 
correct time, see “Date and Time” on page 198.
Calendar 
You can change the default calendar using the Default Calendar setting. See 
“Calendars” on page 205.
Notes 
You can’t assign an event to a read-only calendar.
Events can also be created by tapping a day, date, or time in a Mail message. See 
“Using Links and Detected Data” on page 78.
Update an event:  Tap Edit and change event information. Tap Done when you’re 
°PKUJGF
Delete an event:  Tap the event, tap Edit, then scroll down and tap Delete Event.
Responding to Meeting Invitations
If you have a Microsoft Exchange or MobileMe account with Calendars enabled, or a 
supported CalDAV account, you can receive and respond to meeting invitations from 
people in your organization. When you receive an invitation, the meeting appears in 
your calendar with a dotted line around it.   appears in the lower-right corner of the 
screen with an alert badge that shows the total number of new invitations you have. 
The number of new invitations also appears on the Calendar icon on the Home screen.
5\TILYVM
TLL[PUNPU]P[H[PVUZ
114 Chapter 10    Calendar

Respond to an invitation in Calendar:
  1  Tap a meeting invitation in the calendar, or tap   to display the Event screen and tap 
an invitation.
Tap “Invitation from” to get contact information for the meeting organizer. Tap the  
email address to send a message to the organizer. If the organizer is in your contacts 
list, you can also tap to call or send a text message.
Tap Invitees to see the other people invited to the meeting. Tap a name to see an  
attendee’s contact information. Tap the email address to send a message to the 
attendee. If the attendee is in your contacts list, you can also tap to call or send a 
text message.
Tap Alert to set iPhone to sound an alert before the meeting. 
Tap Add Comments to add comments in the email response to the meeting  
organizer. You comments will also appear in your Info screen for the meeting.
Notes are made by the meeting organizer.
  2  Tap Accept, Maybe, or Decline.
When you accept, tentatively accept, or decline the invitation, a response email that 
includes any comments you added is sent to the organizer.
If you accept or tentatively accept the meeting, you can change your response later. 
Tap Add Comments if you want to change your comments.
Meeting invitations are also sent in an email message, which lets you open the 
meeting’s Info screen from Mail.
Open a meeting invitation in an email message:  Tap the invitation.
115
Chapter 10    Calendar

Subscribing to Calendars
You can subscribe to calendars that use the iCalendar (.ics) format. Many calendar-based 
services support calendar subscriptions, including Yahoo!, Google, and the Mac OS X  
iCal application.
Subscribed calendars are read-only. You can read events from subscribed calendars on 
iPhone, but you can’t edit them or create new events.
Subscribe to a calendar:  
  1  In Settings, choose “Mail, Contacts, Calendars,” then tap Add Account.
  2  Choose Other, then choose Add Subscribed Calendar.
  3  Enter the server information, then tap Next to verify the subscription.
  4  Tap Save.
You can also subscribe to an iCal (or other .ics) calendar published on the web by 
tapping a link to the calendar you receive in an email or text message on iPhone.
Importing Calendar Files from Mail
;QWECPCFFGXGPVUVQCECNGPFCTD[KORQTVKPICECNGPFCT°NGHTQOCPGOCKNOGUUCIG
;QWECPKORQTVCP[UVCPFCTFKEUECNGPFCT°NG
+ORQTVGXGPVUHTQOCECNGPFCT°NGIn Mail, open the message and tap the calendar 
°NG9JGPVJGNKUVQHGXGPVUCRRGCTUVCR#FF#NNEJQQUGVJGECNGPFCT[QWYCPVVQCFF
the events to, and tap Done.
Alerts
Set calendar alerts:  In Settings, choose Sounds, then turn Calendar Alerts on. If 
%CNGPFCT#NGTVUKUQÒYJGPCPGXGPVKUCDQWVVQQEEWTK2JQPGFKURNC[UCOGUUCIGDWV
makes no sound.
Important:  +HVJG4KPI5KNGPVUYKVEJKUQÒECNGPFCTCNGTVUYQP¨VUQWPF
Sound alerts for invitations:  In Settings, choose “Mail, Contacts, Calendar.” Under 
Calendars, tap New Invitation Alert to turn it on.
116 Chapter 10    Calendar

Photos 11
About Photos
Carry photos and videos with you on iPhone, so you can share them with your family, 
friends, and associates. View photos and videos on iPhone, or use AirPlay and Apple 
TV to view photos and videos (iOS 4.3) on a TV. You can sync photos and videos from 
your computer, view photos and videos taken with iPhone, use photos as wallpaper, 
and assign photos to identify contacts when they call. You can also send photos and 
videos in email messages, send photos and videos in MMS messages, upload photos 
and videos to MobileMe galleries, and print photos.
Note:   MMS is available only if supported by your carrier. Additional fees may apply.
Syncing Photos and Videos with Your Computer
iTunes can sync your photos and videos with the following applications:
 Mac:  iPhoto 4.0.3 or later (syncing videos requires iPhoto 6.0.6 or later), or Aperture 
(photos only)
 PC:  Adobe Photoshop Elements 8.0 or later (photos only)
You can also sync photos and videos from any folder on your computer that contains 
images. See “Syncing with iTunes” on page 53.
iPhone supports H.264 and MPEG-4 video formats, with AAC audio. If you are having 
trouble syncing a video to iPhone, you might be able to use iTunes to create an iPhone 
version of the video. 
117

Create an iPhone version of a video:
  1  Copy the video to your iTunes library.
  2  In iTunes, select Movies in the Library list and select the video you want to sync.
  3  Choose Advanced > Create iPod or iPhone Version.
For more information, go to support.apple.com/kb/HT1211.
Viewing Photos and Videos
Photos and videos you take with iPhone, sync from your computer, or save from an 
email or MMS message can be viewed in Photos. If you sync photos with iPhoto 8.0 
(part of iLife ’09) or later, you can view your photos and videos by the events and faces 
[QW¨XGKFGPVK°GF;QWECPCNUQUGGVJGRNCEGUYJGTG[QWTRJQVQUCPFXKFGQUYGTG
taken if they’re tagged with location data.
View photos and videos:  
  1  In Photos, tap a photo album. Tap the buttons at the bottom of the screen to view 
your photos and videos by albums, events, faces, or places if available.
Photos are sorted by creation date. If you tap Places, a map shows each location that 
you’ve tagged photos from. Tap a pin, then tap   to see your photos and videos from 
that location.
  2  Tap a thumbnail to see the photo or video in full screen.
Show or hide the controls:  Tap the full-screen photo or video to show the controls. 
Tap again to hide the controls.
Play a video:  Tap   in the center of the screen.
To replay a video, tap   at the bottom of the screen. If you don’t see  , tap the screen 
to show the controls.
118 Chapter 11    Photos

View a photo or video in landscape orientation:  Rotate iPhone sideways. The photo 
QTXKFGQTQVCVGUCWVQOCVKECNN[CPFKHKV¨UKPYKFGUETGGPHQTOCVGZRCPFUVQ°VVJGUETGGP
Zoom in on part of a photo:  Double-tap where you want to zoom in. Double-tap 
again to zoom out. You can also pinch to zoom in or out.
8KGYXKFGQKPHWNNUETGGPQT°VXKFGQVQUETGGPDouble tap the screen to scale the 
XKFGQVQ°NNVJGUETGGP&QWDNGVCRCICKPVQ°VVJGXKFGQVQVJGUETGGP
Pan around a photo:  Drag the photo.
See the next or previous photo or video:  Flick left or right. Or tap the screen to show 
the controls, then tap   or  .
119
Chapter 11    Photos

Deleting Photos and Videos
You can delete photos and videos from Camera Roll on iPhone.
Delete photos and videos:
  1  Tap   in the upper-right corner of the screen.
  2  Tap to select the photos and videos you want to delete.
The Delete button shows the number of items you select.
  3  Tap Delete.
Slideshows
You can view a photo album as a slideshow, complete with background music and 
transitions (iOS 4.3).
View a slideshow (iOS 4.3):
  1  Tap an album to open it, then tap a photo and tap  .
  2  Select slideshow options.
 To change the type of transition, tap Transitions and choose a transition.
Available transitions are determined by how you view the slideshow. If you’re 
connected to an Apple TV, choose from the available transitions. If iPhone is 
connected to a TV or projector using an AV cable, choose the Dissolve transition. For 
more information, see “Viewing Photos, Slideshows, and Videos on a TV,” below.
 To play music during the slideshow, turn on Play Music, then tap Music and select  
a song.
  3  Tap Start Slideshow.
View a slideshow (iOS 4.2):  Tap an album, then tap a photo and tap  .
Videos play automatically when they appear during the slideshow.
Stop a slideshow:  Tap the screen.
Set slideshow settings:  In Settings, choose Photos and set the following options:
 To set the length of time each slide is shown, tap Play Each Slide For and choose a time.
 6QUGVVTCPUKVKQPGÒGEVUYJGPOQXKPIHTQORJQVQVQRJQVQK15tap Transition and 
choose a transition type.
 To set whether slideshows repeat, VWTP4GRGCVQPQTQÒ
 To set whether photos and videos are shown in random order, VWTP5JWÔGQPQTQÒ
Play music during a slideshow (iOS 4.2):  In iPod, play a song, then choose Photos on 
the Home screen and start a slideshow.
120 Chapter 11    Photos

Viewing Photos, Slideshows, and Videos on a TV
You can use the Photos app to view photos, slideshows, and videos (iOS 4.3) on your 
TV, using any of the following:
Apple Component AV Cable 
Apple Composite AV Cable 
Apple Digital AV Adapter and an HDMI cable (iPhone 4) 
Apple VGA Adapter and a VGA cable 
6JG&KIKVCN#8#FCRVGTUWRRQTVUJKIJFG°PKVKQPXKFGQWRVQRYKVJCWFKQ
You can also stream photos, slideshows, and videos (iOS 4.3) wirelessly to your TV 
using AirPlay and Apple TV.
Note:  Apple cables, adapters, and docks are available for purchase separately. Go to 
www.apple.com/ipodstore (may not be available in all countries or regions) or check 
with your local Apple retailer.
Connect using an AV cable:  Use the Apple Component AV Cable, Apple Composite 
AV Cable, or other authorized iPhone-compatible cable. You can also use these cables 
with the Apple Universal Dock to connect iPhone to your TV or AV receiver. The Apple 
Universal Dock includes a remote that lets you control playback from a distance. 
Connect using a VGA Adapter:  Attach the VGA Adapter to the iPhone Dock connector. 
Connect the VGA Adapter with a VGA cable to a compatible TV, projector, or VGA display.
Connect using an Apple Digital AV Adapter (iPhone 4):  Attach the Digital AV Adapter 
to the iPhone Dock connector. Use an HDMI cable to connect the HDMI port of the 
adapter to your TV or receiver. To keep iPhone charged while watching videos, use 
a Dock Connector to USB Cable to connect the 30-pin port of the adapter to your 
computer, or to a USB Power Adapter plugged into a power outlet.
Stream content using AirPlay and Apple TV:  View a photo, slideshows, or video  
(iOS 4.3), then tap   and choose Apple TV from the list. If   doesn’t appear or if you 
don’t see Apple TV in the list of AirPlay devices, make sure it’s on the same wireless 
network as iPhone. To return playback to iPhone, tap   again and choose iPhone 
from the list.
Sharing Photos and Videos
You can send photos and videos in email and MMS messages, add photos and videos 
to MobileMe galleries, and publish videos to YouTube. You can also copy and paste 
photos and videos, save photos and videos from email messages to Photos, and save 
images from webpages to Photos.
121
Chapter 11    Photos

Sending a Photo or Video in an Email or MMS Message
Send a photo or video in an email message:
  1  Choose a photo or video and tap  . If you don’t see  , tap the screen to show  
the controls.
  2  Tap Email Photo/Video.
The photo or video appears in a new mail message window.
  3  Compose your message, then tap Send.
  4  If sending a photo, you may be asked if you want to reduce the message size by 
scaling the image. Tap the size you want to use.
Send multiple photos or videos at the same time:  When viewing thumbnails in an 
album, tap  , then tap to select the photos or videos you want to send, tap Share, 
and tap Email.
Send a photo or video via MMS:  Choose a photo or video and tap  , then tap MMS.
The size limit of attachments is determined by your carrier. If necessary, iPhone 
may compress the photo or video. To learn about taking photos and videos, see 
Chapter 12, “Camera,” on page 12 5.
Copying and Pasting Photos and Videos
You can copy a photo or video from Photos and paste it in an email or MMS message. 
Some third-party apps may also support copying and pasting photos or videos.
Copy a photo or video:  *QNF[QWT°PIGTQPVJGUETGGPWPVKNVJG%QR[DWVVQPCRRGCTU
then tap Copy.
Copy multiple photos or videos:
  1  Tap   in the upper-right corner of the screen.
  2  Tap to select the photos and videos you want to copy.
The Copy button shows the number of items you select.
  3  Tap Copy.
Paste a photo or video:  Tap to place the insertion point where you want to place the 
photo or video, then tap the insertion point and tap Paste.
Adding a Photo or Video to a MobileMe Gallery
If you have a MobileMe account, you can add photos and videos directly from iPhone 
to your MobileMe gallery. You can also add photos and videos to someone else’s 
MobileMe gallery if that person enables email contributions.
Before you can add photos or videos to a gallery in your MobileMe account, you must:
Set up your MobileMe account on iPhone 
Publish a MobileMe gallery, and allow adding photos via email or iPhone 
122 Chapter 11    Photos

For more information about creating a gallery and adding photos and videos to it, see 
MobileMe Help.
Add a photo or video to your gallery:  Choose a photo or video and tap  , then tap 
“Send to MobileMe.” Enter a title and description, if you like, then select the album to 
add the photo or video to and tap Publish.
If you don’t see  , tap the screen to show the controls.
iPhone tells you when the photo or video has been published, and gives you options 
to view it on MobileMe or email a link to a friend.
Add a photo or video to someone else’s gallery:  Choose a photo or video and tap  , 
then tap “Email Photo/Video.” Enter the album’s email address, then click Send.
Publishing Videos to YouTube
If you have a YouTube account, you can publish videos directly from iPhone to 
YouTube. Some videos may not be transferable, depending on the length of the  
movie or other factors.
Publish a video to YouTube:  
  1  While viewing a video, tap  , then tap “Send to YouTube.”
  2  Sign in to your YouTube account.
  3  Enter publishing information such as Title, Description, and Tags. 
  4  Tap Category to choose a category. 
  5  Tap Publish.
Saving Photos and Videos from Email Messages, MMS Messages, and 
Webpages
Save a photo from an email message to your Camera Roll album:  Tap the photo, 
then tap Save Image. If the photo hasn’t been downloaded yet, tap the download 
PQVKEG°TUV
Save a video from an email message to your Camera Roll album:  Touch and hold 
the attachment, then tap Save Video. If the video hasn’t been downloaded yet, tap the 
FQYPNQCFPQVKEG°TUV
Save a photo from a webpage to your Camera Roll album:  Touch and hold the 
photo, then tap Save Image.
Save a photo or video from an MMS message to your Camera Roll album:  Tap the 
image in the conversation, tap  , and tap Save Image or Save Video.
If you don’t see  , tap the screen to show the controls.
You can download the photos and videos in your Camera Roll album to your 
computer’s photo application by connecting iPhone to your computer.
123
Chapter 11    Photos

Printing Photos
You can use AirPrint to print photos from iPhone.
Print a photo:  Tap  , then tap Print. Tap Select Printer to select a printer, set the 
number of copies, then tap Print.
Print multiple photos:  While viewing a photo album, tap  . Select the photos you 
want to print, then tap Print. Tap Select Printer to select a printer, set the number of 
copies, then tap Print.
For more information, see “Printing” on page 41.
Assigning a Photo to a Contact
You can assign a photo to a contact. When that person calls, iPhone displays the photo.
Assign a photo to a contact:  
  1  Choose Camera on the Home screen, then take someone’s picture. Or choose any 
photo already on iPhone, and tap  .
  2  Tap “Assign to Contact” and choose a contact.
  3  Position and size the photo until it looks the way you want.
Drag the photo to pan, and pinch to zoom in or out.
  4  Tap Set Photo.
You can also assign a photo to a contact in Contacts by tapping Edit and then tapping 
“Add Photo.”
Wallpaper
You can set a photo as wallpaper for the Lock screen or for the Home screen.
Set a photo as wallpaper:  
  1  Choose any photo and tap  , then tap Use As Wallpaper.
  2  Drag the photo to position it and pinch to zoom in or out, until it looks the way  
you want.
  3  Tap Set, then choose whether you want to use the photo as wallpaper for your Lock 
Screen, Home screen, or both.
You can also choose from several wallpaper pictures included with iPhone by choosing 
Settings > Wallpaper from the Home screen. See “Adding Wallpaper” on page 36.
124 Chapter 11    Photos

Camera 12
About Camera
With iPhone, you have a great still camera and video camera wherever you go.  
K2JQPGJCUCOCKPECOGTCVJCVVCMGURJQVQUCPFJKIJFG°PKVKQPXKFGQCP.'&±CUJ
for photos and videos taken with the main camera, and a front camera that lets you 
make FaceTime video calls and take photos and videos of yourself.
The main camera is on the back of iPhone. You use the screen to control the camera 
and to see the photo or video you’re taking. Tap-to-focus lets you tap anywhere on the 
UETGGPVQHQEWUQPCURGEK°EQDLGEVQTCTGCQH[QWTUJQVCPFCWVQOCVKECNN[CFLWUVVJG
exposure. The macro autofocus feature (about 10 cm) and a 5x digital zoom let you 
take great close-ups.
If location services is turned on, photos and videos are tagged with location data—
including your current geographical coordinates provided by GPS, Wi-Fi, or cell-tower 
information. You can use location data with some apps and photo-sharing websites 
to track and post where you took the photos. For example, the Photos app organizes 
photos by places.
Note:  +HNQECVKQPUGTXKEGUKUVWTPGFQÒYJGP[QWQRGP%COGTC[QWOC[DGCUMGFVQ
turn it on. If you don’t want to include location data with your photos and videos, 
you can use Camera without turning on location services. See “Location Services” on 
page 194.
125

Taking Photos and Recording Videos
Taking photos and recording videos with iPhone is as easy as point and tap.
*HTLYH=PKLV
Z^P[JO
-VJ\ZHYLH
:^P[JOJHTLYHZ
AVVT
;O\TIUHPSVM
SHZ[ZOV[
;HW[V
[HRLWOV[V
:L[3,+
MSHZOTVKL
;\YU/+9
VUVYVMM
Take a photo:  Aim iPhone and tap  .
Make sure the Camera/Video switch is set to  .
When you take a photo or start a video recording, iPhone makes a shutter sound. You 
can use the volume buttons on the side of the iPhone to control the volume of the 
shutter sound. You don’t hear a sound if you set the Ring/Silent switch to silent. See 
“Sounds and the Ring/Silent Switch” on page 191.
Note:  +PUQOGTGIKQPUVJGUQWPFGÒGEVUHQT%COGTCCTGRNC[GFGXGPKHVJG4KPI5KNGPV
switch is set to silent.
On iPhone 4, you can turn on HDR to take HDR (high dynamic range) photos. HDR 
blends the best parts of three separate exposures into a single photo. For best results, 
iPhone and the subject should be stationary.
6WTP*&4QPQTQÒTap the HDR button at the top of the screen. The button shows 
YJGVJGT*&4KUQPQTQÒ*&4KUQÒD[FGHCWNV
Note:  9JGP*&4KUQPVJG±CUJKUVWTPGFQÒ
With HDR, you can save both the normal-exposure version and the HDR version of a 
photo in the Camera Roll, or save just the HDR version. By default, both are saved.
Choose whether to save both the normal-exposure version and the HDR version 
of photos:  +P5GVVKPIUEJQQUG2JQVQUVJGPVWTP-GGR0QTOCN2JQVQQPQTQÒ+HVJG
UGVVKPIKUVWTPGFQÒQPN[VJG*&4XGTUKQPQHCRJQVQKUUCXGF
126 Chapter 12    Camera

If you save both versions,   appears in the upper-left corner of the HDR photo 
when you view the photos in Camera Roll (if the controls are visible).
Record a video:  Slide the Camera/Video switch to  , then tap   to start recording. 
The record button blinks while Camera is recording. Tap   again to stop recording. You 
can also press the center button on the iPhone earphones to start or stop recording.
A rectangle on the screen shows the area where the camera is focused and setting  
the exposure.
Tap the screen to bring up the camera controls.
Change the focus area and set the exposure:  Tap anywhere to focus the camera and 
adjust the exposure for the selected area.
Zoom in or out:  Tap the screen, then drag the slider at the bottom of the screen to 
zoom in or out (main camera, in camera mode only).
5GV.'&±CUJOQFG6CRVJG±CUJDWVVQPKPVJGWRRGTNGHVEQTPGTQHVJGUETGGPVJGP
VCR1Ò#WVQQT1P
Switch between the main and front cameras:  Tap   in the upper-right corner of 
the screen.
Review a photo or video you’ve just taken:  Tap the thumbnail of your last shot, in the 
lower-left corner of the screen. 
Use the left and right arrows at the bottom of the screen to review other photos and 
XKFGQUKPVJG%COGTC4QNNQTLWUV±KEMNGHVQTTKIJV6CR&QPGVQTGVWTPVQECOGTCQT
video mode. If you don’t see the controls, tap the screen to display them.
Delete a photo or video:  Tap  . If you don’t see  , tap the screen to display the controls.
Take a screenshot:  3WKEMN[RTGUUCPFTGNGCUGVJG1P1Ò5NGGR9CMGCPF*QOG
DWVVQPUCVVJGUCOGVKOG#±CUJQHVJGUETGGPNGVU[QWMPQYVJGUETGGPUJQVYCU
taken. The screenshot is added to the Camera Roll album.
Viewing and Sharing Photos and Videos
The photos and videos you take with Camera are saved in the Camera Roll album on 
iPhone. You can view the Camera Roll album from either Camera or Photos. 
View photos and videos in the Camera Roll album:  In Camera, tap the thumbnail 
image in the lower-left corner of the screen. In Photos, tap the Camera Roll album. Tap 
VJGNGHVQTTKIJVDWVVQPQT±KEMNGHVQTTKIJVVQ±KRVJTQWIJVJGRJQVQUCPFXKFGQU
When viewing a photo or video in the Camera Roll album, tap the screen to display the 
controls. If you save both the normal and the HDR versions of a photo,   appears 
in the upper-left corner of the HDR photo (when the controls are visible).
For more information about viewing and sharing photos and videos, see:
“ Viewing Photos and Videos” on page 118
“ Sharing Photos and Videos” on page 121
127
Chapter 12    Camera

Trimming Videos
You can trim the frames from the beginning and end of a video that you just recorded, 
or any other video in the Camera Roll album. You can replace the original video or save 
the trimmed version as a new video clip.
Trim a video:  
  1  While viewing a video, tap the screen to display the controls.
  2  Drag either end of the frame viewer at the top of the video, then tap Trim.
  3  Tap Trim Original or “Save as New Clip.”
Important:  If you choose Trim Original, the trimmed frames are permanently deleted 
from the original video. If you choose “Save as New Clip,” a new trimmed video clip is 
UCXGFKPVJG%COGTC4QNNCNDWOCPFVJGQTKIKPCNXKFGQKUWPCÒGEVGF
Uploading Photos and Videos to Your Computer
You can upload the photos and videos you take with Camera to photo applications on 
your computer, such as iPhoto on a Mac.
Upload photos and videos to your computer:  Connect iPhone to your computer.
 Mac:  Select the photos and videos you want and click the Import or Download 
button in iPhoto or other supported photo application on your computer.
 PC:  Follow the instructions that came with your photo application.
If you delete the photos and videos from iPhone when you upload them to your 
computer, they’re removed from the Camera Roll album. You can use the Photos 
settings pane in iTunes to sync photos and videos to the Photos app on iPhone 
(videos can be synced with Macs only). See “iPhone Settings Panes in iTunes” on 
page 54.
128 Chapter 12    Camera

YouTube 13
Finding and Viewing Videos
YouTube features short videos submitted by people from around the world. To use 
some features on iPhone, you need to sign in to a YouTube account. For information 
about requirements and how to get a YouTube account, go to www.youtube.com.
Note:  YouTube may not be available in all languages and locations.
Browse videos:  Tap Featured, Most Viewed, or Favorites. Or tap More to browse by 
Most Recent, Top Rated, History, Subscriptions, or Playlists.
 Featured:  8KFGQUTGXKGYGFCPFHGCVWTGFD[;QW6WDGUVCÒ
 Most Viewed:  Videos most seen by YouTube viewers. Tap All for all-time most viewed 
videos, or Today or This Week for most-viewed videos of the day or week.
 Favorites:  Videos you’ve added to Favorites. When you sign in to a YouTube account, 
account favorites appear and any existing favorites can be synced to your account.
 Most Recent:  Videos most recently submitted to YouTube.
 Top Rated:  Videos most highly rated by YouTube viewers. To rate videos, go to  
www.youtube.com.
 History:  Videos you’ve viewed most recently.
 Subscriptions:  Videos from YouTube accounts to which you’ve subscribed. You must 
be signed in to a YouTube account to use this feature.
 Playlists:  Videos you’ve added to playlists. You must be signed in to a YouTube 
account to use this feature.
You can replace the browse buttons at the bottom of the screen with buttons you use 
more frequently. See “Changing the Browse Buttons” on page 134.
129

Search for a video:  
  1 6CR5GCTEJVCR/QTG°TUVKH5GCTEJKUP¨VXKUKDNGVJGPVCRVJG;QW6WDGUGCTEJ°GNF
  2  Type a word or phrase that describes what you’re looking for, then tap Search.
YouTube shows results based on video titles, descriptions, tags, and user names.  
Listed videos show title, rating, number of views, length, and the account name that 
posted the video.
Play a video:  Tap the video.
The video begins to download to iPhone and a progress bar appears. When enough of 
the video has downloaded, it begins to play. You can also tap   to start the video.
Controlling Video Playback
When a video starts playing, the controls disappear so they don’t obscure the video.
Show or hide the video controls:  Tap the screen.
5L_[
-HZ[MVY^HYK
7SH`7H\ZL
,THPS
:JHSL
+V^USVHKWYVNYLZZ
=VS\TL
7SH`OLHK :JY\IILYIHY
)VVRTHYR 7YL]PV\ZYL^PUK
(PY7SH`
Play or pause a video Tap   or  . You can also press the center button 
on the iPhone earphones.
Adjust the volume Drag the volume slider, or use the volume 
buttons on the side of iPhone. You can also use 
the volume buttons on the iPhone earphones.
Skip to the next or previous video in a list Tap   twice to skip to the previous video. Tap 
 to skip to the next video.
Rewind or fast-forward Touch and hold   or  .
Skip to any point in a video Drag the playhead along the scrubber bar.
5VQRYCVEJKPICXKFGQDGHQTGKV°PKUJGURNC[KPI Tap Done, or press the Home   button.
5YKVEJDGVYGGPUECNKPICXKFGQVQ°NNVJGUETGGP
QT°VVQVJGUETGGP
Double-tap the video. You can also tap   to 
OCMGVJGXKFGQ°NNVJGUETGGPQTVCR  to make 
KV°VVJGUETGGP
Add a video to Favorites using video controls Start playing a video and tap  .
Email a link to the video using video controls Start playing a video and tap  .
130 Chapter 13    YouTube

Watching YouTube Videos on a TV
You can wach YouTube videos, including videos in HD format (iPhone 4), on a TV by 
connecting iPhone to your TV or AV receiver using an Apple Component AV Cable, 
Apple Composite AV Cable, Apple VGA Adapter, or Apple Digital AV Adapter (iPhone 4),  
or wirelessly by using AirPlay and Apple TV. See “Watching Videos on a TV” on page 102.
Managing Videos
Tap   next to a video to see related videos and more controls for managing videos.
Add the video to Favorites Tap “Add to Favorites.”
Add the video to a playlist Tap “Add to Playlist,” then select an existing 
playlist or tap   to create a new playlist.
Email a link to the video Tap Share Video.
Browse and view related videos Tap a video in the list of related videos to view, or 
tap   next to a video for more information.
131
Chapter 13    YouTube

Getting More Information
Tap   next to the video to show the video’s comments, description, date added, and 
other information.
Rate the video or add a comment On the More Info screen, tap “Rate, Comment,  
or Flag,” then choose “Rate or Comment.” You 
must be signed in to a YouTube account to use 
this feature.
See more videos from this account On the More Info screen, tap More Videos.
Subscribe to this YouTube account On the More Info screen, tap More Videos, then 
tap “Subscribe to <account>” at the bottom of 
the video list. You must be signed in to a YouTube 
account to use this feature.
132 Chapter 13    YouTube

Using YouTube Account Features
If you have a YouTube account, you can access account features such as subscriptions, 
comments and ratings, and playlists. To create a YouTube account, go to  
www.youtube.com.
Show favorites you’ve added to your account:  In Favorites, tap Sign In, then enter 
your username and password to see your account favorites. Any existing favorites 
you’ve added to iPhone can be merged with your account favorites when you sign in.
Delete a favorite:  In Favorites, tap Edit, tap   next to a video, then tap Delete.
Show subscriptions you’ve added to your account:  In Subscriptions, tap Sign In, then 
enter your username and password to see your account subscriptions. Tap an account 
in the list to see all videos for that account.
Unsubscribe from a YouTube account:  In Subscriptions, tap an account in the list, 
then tap Unsubscribe.
View playlists:  In Playlists, tap a playlist to see the list of videos you’ve added. Tap any 
video in the playlist to begin playing videos from that point in the playlist.
Edit a playlist:  In Playlists, tap Edit, then do one of the following:
 To delete the entire playlist, tap   next to a playlist, then tap Delete.
 To create a new playlist, tap  , then enter a name for the playlist.
Add a video to a playlist:  Tap   next to a video, then tap “Add to Playlist” and choose 
a playlist.
Delete a video from a playlist:  
  1  In Playlists, tap a playlist, then tap Edit.
  2  Tap   next to a playlist, then tap Delete.
133
Chapter 13    YouTube

Changing the Browse Buttons
You can replace the Featured, Most Viewed, Bookmarks, and Search buttons at the 
bottom of the screen with ones you use more frequently. For example, if you watch 
top-rated videos often but don’t watch many featured videos, you could replace the 
Featured button with Top Rated.
Change the browse buttons:  Tap More and tap Edit, then drag a button to the 
bottom of the screen, over the button you want to replace.
You can drag the buttons at the bottom of the screen left or right to rearrange them. 
9JGP[QW°PKUJVCR&QPG
When you’re browsing for videos, tap More to access the browse buttons that  
aren’t visible.
Sending Videos to YouTube
If you have a YouTube account, you can send videos directly to YouTube. See 
“Publishing Videos to YouTube” on page 123.
134 Chapter 13    YouTube

Stocks 14
Viewing Stock Quotes
Stocks lets you see the latest available quotes for your selected stocks, funds,  
and indexes. 
Quotes are updated every time you open Stocks when connected to the Internet. Quotes 
may be delayed by up to 20 minutes or more, depending upon the reporting service.
Add a stock, fund, or index to the stock reader:  
  1  Tap  , then tap  .
  2  Enter a symbol, company name, fund name, or index, then tap Search.
  3  Select an item from the search results and tap Done.
View charts in landscape orientation:  Rotate iPhone sideways. Flick left or right to 
view the other charts in your stock reader.
Show the progress of a stock, fund, or index over time:  Tap the stock, fund, or index 
in your list, then tap 1d, 1w, 1m, 3m, 6m, 1y, or 2y. The chart adjusts to show progress 
over one day, one week, one month, three months, six months, one year, or two years.
When you view a chart in landscape orientation, you can touch the chart to display the 
XCNWGHQTCURGEK°ERQKPVKPVKOG
135

7UGVYQ°PIGTUVQUGGVJGEJCPIGKPXCNWGQXGTCURGEK°ERGTKQFQHVKOG
Delete a stock:  Tap   and tap   next to a stock, then tap Delete.
Change the order of the list:  Tap  . Then drag   next to a stock or index to a new 
place in the list.
Switch the view to percentage change, price change, or market capitalization:  Tap 
any of the values along the right side of the screen. Tap again to switch to another 
view. Or tap   and tap %, Price, or Mkt Cap, then tap Done.
Getting More Information
See the summary, chart, or news page about a stock, fund, or index:  Select the stock, 
HWPFQTKPFGZKP[QWTNKUVVJGP±KEMVJGRCIGUWPFGTPGCVJVJGUVQEMTGCFGTVQXKGYVJG
summary, chart, or recent news page.
On the news page, you can scroll up and down to read headlines, or tap a headline to 
view the article in Safari.
See more information at Yahoo.com:  Select the stock, fund, or index in your list, then 
tap  .
136 Chapter 14    Stocks

Maps 15
WARNING:  For important information about driving and navigating safely, see the 
Important Product Information Guide at www.apple.com/support/manuals/iphone.
Maps provides street maps, satellite photos, a hybrid view, and street views of 
NQECVKQPUKPOCP[QHVJGYQTNF¨UEQWPVTKGUCPFTGIKQPU;QWECPIGVVTCÓEKPHQTOCVKQP
and detailed driving, public transit, or walking directions. Find and track your current 
(approximate) location, and use your current location to get driving directions to or 
from another place. The built-in digital compass lets you see which way you’re facing.
Important:  Maps, directions, and location-based apps depend on data services. These 
data services are subject to change and may not be available in all geographic areas, 
resulting in maps, directions, or location-based information that may be unavailable, 
inaccurate, or incomplete. Compare the information provided on iPhone to your 
surroundings, and defer to posted signs to resolve any discrepancies. 
+HNQECVKQPUGTXKEGUKUVWTPGFQÒYJGP[QWQRGP/CRU[QWOC[DGCUMGFVQVWTPKV
on. You can use Maps without turning on location services. See “Location Services” on 
page 194.
137

Finding and Viewing Locations
You can search for locations, get your current location, mark a location with the drop 
pin, and get satellite and Google Street Views.
Searching for Locations
You can search for locations in many ways—by address, intersection, area, landmark, 
bookmark, contact, or zip code, for example. 
Find a location and see a map:
  1 6CRVJGUGCTEJ°GNFVQDTKPIWRVJGMG[DQCTF
  2  Type an address or other search information.
  3  Tap Search.
A pin marks the location. Tap the pin to see the name or description of the location.
;HW[VNL[
PUMVYTH[PVUHIV\[
[OLSVJH[PVUNL[
KPYLJ[PVUZHKK[OL
SVJH[PVU[V`V\Y
IVVRTHYRZVY
JVU[HJ[ZSPZ[VY
LTHPSHSPUR[V
.VVNSL4HWZ
Locations can include places of interest added by Google My Maps users (“User-
created content”), and sponsored links that appear as special icons (for example,  ).
Zoom in to a part of a map 2KPEJVJGOCRYKVJVYQ°PIGTU1TFQWDNGVCR
the part you want to zoom in on. Double-tap 
again to zoom in even closer.
Zoom out 2KPEJVJGOCR1TVCRVJGOCRYKVJVYQ°PIGTU
6CRYKVJVYQ°PIGTUCICKPVQ\QQOQWVHWTVJGT
Pan or scroll to another part of the map Drag up, down, left, or right.
See the location of a contact’s address:  Tap  KPVJGUGCTEJ°GNFVJGPVCR%QPVCEVU
and choose a contact.
To locate an address in this way, the contact must include at least one address. If the 
contact has more than one address, choose the one you want to locate. You can also 
°PFVJGNQECVKQPQHCPCFFTGUUD[VCRRKPIVJGCFFTGUUFKTGEVN[KP%QPVCEVU
138 Chapter 15    Maps

Finding Your Current Location
#SWKEMVCR°PFU[QWTEWTTGPVCRRTQZKOCVGNQECVKQP
Find your current location and turn on tracking mode:  Tap  .
Your current location is shown by a blue marker. If your location can’t be determined 
precisely, a blue circle also appears around the marker. The size of the circle depends 
on how precisely your location can be determined—the smaller the circle, the greater 
the precision.
As you move around, iPhone updates your location, adjusting the map so that the 
location indicator remains in the center of the screen. If you tap   again until it is no 
longer highlighted, or if you drag the map, iPhone continues to update your location 
DWVUVQRUEGPVGTKPIKVUQVJGNQECVKQPKPHQTOCVKQPOC[OQXGQÒVJGUETGGP
iPhone uses location services to determine your location. Location services uses 
available information from cellular network data, local Wi-Fi networks (if Wi-Fi is turned 
on), and GPS (may not be available in all locations). When an app is using location 
services,   appears in the status bar. Location services may not be available in all 
countries or regions.
+HNQECVKQPUGTXKEGUKUVWTPGFQÒ[QW¨NNDGRTQORVGFVQVWTPKVQP;QWECP¨V°PFCPF
VTCEM[QWTEWTTGPVNQECVKQPKHNQECVKQPUGTXKEGUKUVWTPGFQÒ5GG¥Location Services” on 
page 194.
6QEQPUGTXGDCVVGT[NKHGVWTPNQECVKQPUGTXKEGUQÒYJGP[QW¨TGPQVWUKPIKV+P5GVVKPIU
choose General > Location Services.
139
Chapter 15    Maps

Get information about your current location:  Tap the blue marker, then tap  . 
iPhone displays the address of your current location, if available. You can use this 
information to:
Get directions 
Add the location to contacts 
Send the address via email or MMS 
Bookmark the location 
Show which way you’re facing:  Tap   again. (The icon changes to  .) Maps uses the 
built-in compass to determine which way you’re facing. The angle shows the accuracy 
of the compass reading—the smaller the angle, the greater the accuracy.
Maps uses true north to determine your heading, even if magnetic north is set in 
Compass. If the compass needs calibrating, iPhone asks you to wave the phone in 
C°IWTGGKIJV+HVJGTG¨UKPVGTHGTGPEG[QWOC[DGCUMGFVQOQXGHTQOVJGUQWTEGQH
interference. See Chapter 20, “Compass,” on page 157.
Marking a Location with the Drop Pin
The drop pin lets you mark a location by hand.
Mark a location:  Touch and hold the location on the map.
The drop pin appears where you’re touching the map.
Move the drop pin:  Touch and hold, then drag the pin to a new location, or touch and 
hold a new location until a new pin drops, replacing the previous one.
140 Chapter 15    Maps

Satellite View and Street View
You can see a satellite view of a map, or a combined satellite and street map view. You 
can also see a Google Street View of a location.
See a satellite view or hybrid view:  Tap  , then tap Satellite or Hybrid to see just a 
satellite view or a combined street map and satellite view.
To return to map view, tap Map.
141
Chapter 15    Maps

See the Google Street View of a location:  Tap  . Flick left or right to pan through the 
360° panoramic view. (The inset shows your current view.) Tap an arrow to move down 
the street. To return to map view, tap the map inset in the lower-right corner.
;HW[VYL[\YU[VTHW]PL^
Street View may not be available in all areas.
Getting Directions
You can get step-by-step directions for driving, taking public transit, or walking to a 
destination.
Get directions:
  1  Tap Directions.
  2 'PVGTUVCTVKPICPFGPFKPINQECVKQPUKPVJG5VCTVCPF'PF°GNFU$[FGHCWNVK2JQPGUVCTVU
with your current approximate location (if available). Tap  KPGKVJGT°GNFVQEJQQUG
a location in Bookmarks (including your current location and the dropped pin, if 
available), Recents, or Contacts. If  KUP¨VUJQYKPIFGNGVGVJGEQPVGPVUQHVJG°GNF
For example, if a friend’s address is in your contacts list, you can tap Contacts and tap 
your friend’s name instead of having to type the address.
To reverse the directions, tap  .
  3  Tap Route (if you entered locations manually), then select directions by car ( ), 
directions by public transit ( ), or directions by walking ( ).
The travel options available depend on the route. 
  4  Do one of the following:
142 Chapter 15    Maps

 To view all the directions in a list, tap  , then tap List. Tap any item in the list to  
see a map showing that leg of the trip. Tap Route Overview to return to the 
overview screen.
 To view directions one step at a time, tap Start, then tap   to see the next leg of the 
trip. Tap   to go back.
If you’re driving or walking, the approximate distance and travel time appear at the top 
QHVJGUETGGP+HVTCÓEFCVCKUCXCKNCDNGVJGFTKXKPIVKOGKUCFLWUVGFCEEQTFKPIN[
If you’re taking public transit, the overview screen shows each leg of the trip and the 
mode of transportation, including where you need to walk. The top of the screen 
UJQYUVJGVKOGQHVJGDWUQTVTCKPCVVJG°TUVUVQRVJGGUVKOCVGFCTTKXCNVKOGCPFVJG
total fare. Tap   to set your departure or arrival time, and to choose a schedule for 
the trip. Tap the icon at a stop to see the departure time for that bus or train, and to 
get a link to the transit provider’s website or contact info. When you tap Start and step 
through the route, detailed information about each leg of the trip appears at the top 
of the screen.
;QWECPCNUQIGVFKTGEVKQPUD[°PFKPICNQECVKQPQPVJGOCRVCRRKPIVJGRKPVJCV
points to it, tapping  , then tapping Directions To Here or Directions From Here.
Switch start and end points, for reverse directions:  Tap  .
If you don’t see  , tap Edit.
See recently viewed directions:  Tap  KPVJGUGCTEJ°GNFVJGPVCR4GEGPVU
143
Chapter 15    Maps

5JQYKPI6TCÓE%QPFKVKQPU
9JGPCXCKNCDNG[QWECPUJQYVTCÓEEQPFKVKQPUHQTOCLQTUVTGGVUCPFJKIJYC[UQP 
the map. 
5JQYQTJKFGVTCÓEEQPFKVKQPUTap  VJGPVCR5JQY6TCÓEQT*KFG6TCÓE
5VTGGVUCPFJKIJYC[UCTGEQNQTEQFGFVQKPFKECVGVJG±QYQHVTCÓE
.YLLU$WVZ[LK
ZWLLKSPTP[
@LSSV^$ZSV^LY
[OHU[OLWVZ[LK
ZWLLKSPTP[
.YH`$UVKH[H
J\YYLU[S`H]HPSHISL
9LK$Z[VWHUKNV
+H[QWFQP¨VUGGVTCÓE[QWOC[PGGFVQ\QQOQWVVQCNGXGNYJGTG[QWECPUGGOCLQT
TQCFU6TCÓEEQPFKVKQPUCTGPQVCXCKNCDNGKPCNNCTGCU
Finding and Contacting Businesses
Find businesses in an area:  
  1  Find a location—for example, a city and state or country, or a street address—or scroll 
to a location on a map.
  2 6[RGVJGMKPFQHDWUKPGUUKPVJGVGZV°GNFCPFVCR5GCTEJ
Pins appear for matching locations in the area. For example, if you locate your city and 
then type “movies” and tap Search, pins mark movie theaters in your city.
Tap the pin that marks a business to see its name or description.
(KPFDWUKPGUUGUYKVJQWV°PFKPIVJGNQECVKQP°TUVType things like:
restaurants san francisco ca 
apple inc new york 
Contact a business or get directions:  Tap the pin that marks a business, then tap   
next to the name.
From there, you can do the following:
Tap a phone number to call, an email address to send email to, or a web address   
to visit.
144 Chapter 15    Maps

For directions, tap Directions To Here or Directions From Here. 
To add the business to your contacts list, tap “Add to Contacts” at the bottom of the  
screen, then tap “Create New Contact” or “Add to Existing Contact.”
Share the location of the business by email or text message. 
See a list of the businesses found in the search:  From the Map screen, tap List.
Tap a business to see its location. Or tap   next to a business to see its information.
.L[
KPYLJ[PVUZ
=PZP[
^LIZP[L
;HW[VZOV^
JVU[HJ[PUMV
*HSS
Sharing Location Information
You can add a location you’ve found to your contacts list. You can also send links to a 
Google Maps location using email or MMS.
Add a location to your contacts list:  Find a location, tap the pin that points to it, tap 
 next to the name or description, then tap “Add to Contacts” at the bottom of the 
screen and tap “Create New Contact” or “Add to Existing Contact.” 
Email a link to a Google Maps location:  Find a location, tap the pin that points to it, 
tap   next to the name or description, then tap Share Location at the bottom of the 
screen and tap Email. 
Send a link via MMS to a Google Maps location:  Find a location, tap the pin that 
points to it, tap   next to the name or description, then tap Share Location at the 
bottom of the screen and tap MMS. 
Bookmarking Locations
;QWECPDQQMOCTMNQECVKQPUVJCV[QWYCPVVQ°PFCICKPNCVGT
Bookmark a location:  Find a location, tap the pin that points to it, tap   next to the 
name or description, then tap “Add to Bookmarks” at the bottom of the Info screen.
See a bookmarked location or recently viewed location:  Tap  KPVJGUGCTEJ°GNF
then tap Bookmarks or Recents.
145
Chapter 15    Maps

Weather 16
Viewing Weather Summaries
Tap Weather on the Home screen to get the current temperature and six-day forecast 
for one or more cities around the world.
:P_KH`MVYLJHZ[
*\YYLU[[LTWLYH[\YL
*\YYLU[JVUKP[PVUZ
(KKHUKKLSL[LJP[PLZ
5\TILYVMJP[PLZZ[VYLK
;VKH`»ZOPNOHUKSV^
If the weather board is light blue, it’s daytime in that city—between 6:00 a.m. and 6:00 
p.m. If the board is dark purple, it’s nighttime—between 6:00 p.m. and 6:00 a.m.
Add a city:  
  1  Tap  , then tap  .
  2  Enter a city name or zip code, then tap Search.
  3  Choose a city in the search list.
146

Switch to another city:  Flick left or right, or tap to the left or right of the row of dots. 
The number of dots below the weather board shows how many cities are stored.
Reorder cities:  Tap  , then drag   next to a city to a new place in the list.
Delete a city:  Tap   and tap   next to a city, then tap Delete.
Display the temperature in Fahrenheit or Celsius:  Tap  , then tap °F or °C.
Getting More Weather Information
You can see a more detailed weather report, news and websites related to the city,  
and more.
See information about a city at Yahoo.com:  Tap  .
147
Chapter 16    Weather

Notes 17
About Notes
You can create notes on iPhone and sync notes with supported applications on your 
computer and online accounts. You can search for text in a list of notes.
Syncing Notes
You can sync Notes in either of the following ways:
In iTunes, use the iPhone settings panes to sync with Mail on a Mac or with  
Microsoft Outlook 2003, 2007, or 2010 on a PC when you connect iPhone to your 
computer. See “iPhone Settings Panes in iTunes” on page 54.
In Settings, turn on Notes in your MobileMe, Google, Yahoo!, AOL, or other IMAP  
account to sync your notes over the air with those accounts. See “Adding Mail, 
Contacts, and Calendar Accounts” on page 25.
148

Writing and Reading Notes
When you sync Notes with an application on your computer or with online accounts, 
the Accounts screen shows each those accounts, plus a button to display all notes in a 
single list.
See all notes:  Tap All Notes.
5GGPQVGUHQTCURGEK°ECEEQWPVTap the account name.
Change the font used to display notes:  In Settings, choose Notes, then select the font 
you want to use.
0QVGUCTGNKUVGFD[NCUVOQFK°GFFCVGYKVJVJGOQUVTGEGPVN[OQFK°GFPQVGCVVJGVQR
;QWECPUGGVJG°TUVHGYYQTFUQHGCEJPQVGKPVJGNKUV4QVCVGK2JQPGVQXKGYPQVGUKP
landscape orientation and type using a larger keyboard.
Add a note:  Tap  , then type your note and tap Done.
0GYPQVGUCTGCFFGFVQVJGFGHCWNVCEEQWPVURGEK°GFKP0QVGUUGVVKPIU5GG¥Notes” on 
page 211.
Read a note:  Tap the note. Tap   or   to see the next or previous note.
Edit a note:  Tap anywhere on the note to bring up the keyboard.
Delete a note:  Tap the note, then tap  .
149
Chapter 17    Notes

Searching Notes
You can search the text of notes.
Search for notes:  
  1 6CRVJGUVCVWUDCTVQUETQNNVQVJGUGCTEJ°GNFCVVJGVQRQHVJGPQVGNKUV
  2 'PVGTVGZVKPVJGUGCTEJ°GNF
Search results appear as you type. Tap Search to dismiss the keyboard and see more  
of the results. 
Notes are included in searches from the Home screen. See “Searching” on page 43.
Emailing Notes
Email a note:  Tap the note, then tap  .
To email a note, iPhone must be set up for email. See “Setting Up Email Accounts” on 
page 75.
150 Chapter 17    Notes

Clock 18
World Clocks
You can add clocks to show the time in other major cities and time zones around  
the world.
View clocks:  Tap World Clock.
If the clock face is white, it’s daytime in that city. If the clock face is black, it’s nighttime. 
+H[QWJCXGOQTGVJCPHQWTENQEMU±KEMVQUETQNNVJTQWIJVJGO
Add a clock:  
  1  Tap World Clock.
  2  Tap  , then type the name of a city.
Cities matching what you’ve typed appear below.
  3  Tap a city to add a clock for that city.
If you don’t see the city you’re looking for, try a major city in the same time zone.
Delete a clock:  Tap World Clock and tap Edit. Then tap   next to a clock and tap Delete.
Rearrange clocks:  Tap World Clock and tap Edit. Then drag   next to a clock to a  
new place in the list.
151

Alarms
You can set multiple alarms. Set each alarm to repeat on days you specify, or to sound 
only once.
Set an alarm:  
  1  Tap Alarm and tap  .
  2  Adjust any of the following settings:
 To set the alarm to repeat on certain days, tap Repeat and choose the days.
 6QEJQQUGVJGTKPIVQPGVJCVUQWPFUYJGPVJGCNCTOIQGUQÒtap Sound.
 To set whether the alarm gives you the option to hit snooze, VWTP5PQQ\GQPQTQÒ 
If Snooze is on and you tap Snooze when the alarm sounds, the alarm stops and 
then sounds again in ten minutes.
 To give the alarm a description, tap Label. iPhone displays the label when the  
alarm sounds.
If at least one alarm is set and turned on,   appears in the iPhone status bar at the top 
of the screen.
Important:  Some carriers don’t support network time in all locations. If you’re 
traveling, iPhone alerts may not sound at the correct local time. See “Date and Time” on 
page 198.
6WTPCPCNCTOQPQTQÒ6CR#NCTOCPFVWTPCP[CNCTOQPQTQÒ+HCPCNCTOKUVWTPGF
QÒKVYQP¨VUQWPFCICKPWPNGUU[QWVWTPKVDCEMQP
+HCPCNCTOKUUGVVQUQWPFQPN[QPEGKVVWTPUQÒCWVQOCVKECNN[CHVGTKVUQWPFU;QWECP
turn it on again to reenable it.
Change settings for an alarm:  Tap Alarm and tap Edit, then tap   next to the alarm 
you want to change.
Delete an alarm:  Tap Alarm and tap Edit, then tap   next to the alarm and tap Delete.
152 Chapter 18    Clock

Stopwatch
Use the stopwatch to time an event:  
  1  Tap Stopwatch.
  2  Tap Start to start the stopwatch.
 To record lap times, tap Lap after each lap.
 To pause the stopwatch, tap Stop. Tap Start to resume.
 To reset the stopwatch, tap Reset when the stopwatch is paused.
If you start the stopwatch and switch to another app, the stopwatch keeps running.
Timer
Set the timer:  6CR6KOGTVJGP±KEMVQUGVVJGPWODGTQHJQWTUCPFOKPWVGU6CR5VCTV
to start the timer.
Choose the sound:  Tap When Timer Ends.
Set a sleep timer:  Set the timer, then tap When Timer Ends and choose Sleep iPod.
When you set a sleep timer, iPhone stops playing music or video when the timer ends.
If you start the timer and then switch to another iPhone app, the timer keeps running.
153
Chapter 18    Clock

Calculator 19
Using the Calculator
Tap numbers and functions in Calculator just as you would with a standard calculator. 
When you tap the add, subtract, multiply, or divide button, a white ring appears 
around the button to let you know the operation to be carried out. Rotate iPhone to 
IGVCPGZRCPFGFUEKGPVK°EECNEWNCVQT
Standard Memory Functions
 C:  Tap to clear the displayed number.
 MC:  Tap to clear the memory.
 M+:  Tap to add the displayed number to the number in memory. If no number is in 
memory, tap to store the displayed number in memory.
 M–:  Tap to subtract the displayed number from the number in memory.
 MR:  Tap to replace the displayed number with the number in memory. If the button 
has a white ring around it, there is a number stored in memory.
The stored number remains in memory when you switch between the standard and 
UEKGPVK°EECNEWNCVQTU
154

5EKGPVK°E%CNEWNCVQT-G[U
4QVCVGK2JQPGVQNCPFUECRGQTKGPVCVKQPVQFKURNC[VJGUEKGPVK°EECNEWNCVQT
2nd Changes the trigonometric buttons (sin, cos, tan, sinh, cosh, and tanh) to their inverse 
functions (sin-1, cos-1, tan-1, sinh-1, cosh-1, and tanh-1). It also changes ln to log2, and ex to 
2x. Tap 2nd again to return the buttons to their original functions.
(Opens a parenthetical expression. Expressions can be nested.
)Closes a parenthetical expression.
%Calculates percentages, adds markups, and subtracts discounts. To calculate a 
percentage, use it with the multiplication (x) key. For example, to calculate 8% of 500, 
enter 
500 x 8 % = 
which returns 40.
To add a markup or subtract a discount, use it with the plus (+) or minus (–) key. For 
example, to compute the total cost of a $500 item with an 8% sales tax, enter 
500 + 8 % = 
which returns 540.
1/x Returns the reciprocal of a value in decimal format.
x2Squares a value.
x3Cubes a value.
yx6CRDGVYGGPXCNWGUVQTCKUGVJG°TUVXCNWGVQVJGRQYGTQHVJGUGEQPFXCNWG(QT
example, to compute 34, enter 
3 yx 4 = 
which returns 81.
x! Calculates the factorial of a value.
3Calculates the square root of a value.
x3yUse between values to calculate the x root of y. For example to compute 4381, enter 
81 x3y 4 = 
which returns 3.
155
Chapter 19    Calculator

log Returns the log base 10 of a value.
sin Calculates the sine of a value.
sin-1 Calculates the arc sine of a value. (Available when the 2nd button is tapped.)
cos Calculates the cosine of a value.
cos-1 Calculates the arc cosine of a value. (Available when the 2nd button is tapped.)
tan Calculates the tangent of a value.
tan-1 Calculates the arc tangent of a value. (Available when the 2nd button is tapped.)
ln Calculates the natural log of a value.
log2 Calculates the log base 2. (Available when the 2nd button is tapped.)
sinh Calculates the hyperbolic sine of a value.
sinh-1 Calculates the inverse hyperbolic sine of a value. (Available when the 2nd button  
is tapped.)
cosh Calculates the hyperbolic cosine of a value.
cosh-1 Calculates the inverse hyperbolic cosine of a value. (Available when the 2nd button  
is tapped.)
tanh Calculates the hyperbolic tangent of a value.
tanh-1 Calculates the inverse hyperbolic tangent of a value. (Available when the 2nd button  
is tapped.)
exTap after entering a value to raise the constant “e” (2.718281828459045…) to the power 
of that value.
2xCalculates 2 to the power of the displayed value. For example, 10 2x = 1024. (Available 
when the 2nd button is tapped.)
Rad Changes the mode to express trigonometric functions in radians.
Deg Changes the mode to express trigonometric functions in degrees.
Enters the value of  (3.141592653589793…).
EE An operator that multiplies the currently displayed value by 10 to the power of the next 
value you enter.
Rand Returns a random number between 0 and 1.
156 Chapter 19    Calculator

Compass 20
Getting Compass Readings
The built-in compass shows which direction you’re facing, along with the geographical 
coordinates of your current location. You can choose magnetic north, or have Compass 
adjust the declination to show true north.
Important:  6JGCEEWTCE[QHVJGFKIKVCNEQORCUUOC[DGPGICVKXGN[CÒGEVGFD[
magnetic or other environmental interference, including interference caused by the 
close proximity of the magnets contained in the iPhone earbuds. The digital compass 
should be used only for basic navigation assistance and should not be solely relied on 
to determine precise locations, proximity, distance, or direction.
;QWPGGFVQECNKDTCVGVJGEQORCUUVJG°TUVVKOG[QWWUGKVCPF[QWOC[PGGFVQ
recalibrate it occasionally after that. iPhone alerts you if calibration is needed.
Note:  +HNQECVKQPUGTXKEGUKUVWTPGFQÒYJGP[QWQRGP%QORCUU[QWOC[DGCUMGFVQ
turn it on. You can use Compass without turning on location services. See “Location 
Services” on page 19 4.
157

Calibrate iPhone:  9CXGK2JQPGKPC°IWTGGKIJV;QWOC[DGCUMGFVQOQXGCYC[
from a source of interference.
See the direction you’re facing:  Hold iPhone level to the ground. The compass needle 
rotates to point north. Your current direction appears at the top of the screen. The 
coordinates of your current location are displayed at the bottom of the screen.
Switch between true north and magnetic north:  Tap   and tap the setting you want.
Compass and Maps
6JG%QORCUUCRRNGVU[QW°PF[QWTEWTTGPVNQECVKQPKP/CRU/CRUCNUQWUGUVJGDWKNV
in compass to show the direction you’re facing.
See your current location in Maps:  Tap   at the bottom of the Compass screen. Maps 
opens and shows your current location with a blue marker.
158 Chapter 20    Compass

Voice Memos 21
Recording Voice Memos
Voice Memos lets you use iPhone as a portable recording device using the built-in 
microphone, iPhone or Bluetooth headset mic, or supported external microphone.
Note:  External microphones must be designed to work with the iPhone headset jack 
or Dock Connector. These include Apple-branded earbuds and authorized third-party 
accessories marked with the Apple “Made for iPhone” or “Works with iPhone” logo.
You can adjust the recording level by moving the microphone closer to or further 
away from what you’re recording. For better recording quality, the loudest level on the 
level meter should be between –3dB and 0 dB.
9LJVYKI\[[VU
(\KPVSL]LSTL[LY
.V[V]VPJLTLTVZ
160

Record a voice memo:  
  1  Tap   to start recording. You can also press the center button on the iPhone 
earphones.
  2  Tap   to pause or   to stop recording. You can also press the center button on the 
iPhone earphones.
Recordings using the built-in microphone are mono, but you can record stereo using 
an external stereo microphone.
When you start a voice recording, iPhone makes a short ringing sound. The sound isn’t 
played if you’ve set the Ring/Silent switch to silent. See “Sounds and the Ring/Silent 
Switch” on page 191.
Note:  +PUQOGEQWPVTKGUQTTGIKQPUVJGUQWPFGÒGEVUHQT8QKEG/GOQUCTGRNC[GFGXGP
if the Ring/Silent switch is set to silent.
To use other apps while recording your voice memo, you can lock iPhone or press the 
Home   button.
Play a voice memo you just recorded:  Tap  .
Listening to Voice Memos
:JY\IILYIHY
7SH`OLHK
Play a voice memo you previously recorded:  
  1  Tap  .
/GOQUCTGNKUVGFKPEJTQPQNQIKECNQTFGTYKVJVJGOQUVTGEGPVOGOQ°TUV
  2  Tap a memo, then tap  . 
Tap   to pause, then tap   again to resume playback.
Skip to any point in a voice memo:  Drag the playhead along the scrubber bar.
Listen through the built-in speaker:  Tap Speaker.
161
Chapter 21    Voice Memos

Managing Voice Memos
Delete a voice memo:  Tap a memo in the list, then tap Delete.
See more information:  Tap   next to the memo. The Info screen displays information 
about the length, recording time and date, and provides additional editing and 
sharing functions.
Add a label to a voice memo:  On the Info screen tap  , then select a label in the list 
on the Label screen. To create a custom label, choose Custom at the bottom of the list, 
then type a name for the label.
162 Chapter 21    Voice Memos

Trimming Voice Memos
You can trim the beginning or ending of a voice memo to eliminate unwanted pauses 
or noise.
Trim a voice memo:  
  1  On the Voice Memos screen, tap   next to the memo you want to trim.
  2  Tap Trim Memo.
  3  Using the time markers as a guide, drag the edges of the audio region to adjust the 
beginning and end of the voice memo. To preview your edit, tap  .
  4  Tap Trim Voice Memo.
Important:  Edits you make to voice memos can’t be undone.
Sharing Voice Memos
You can share your voice memos as attachments in email or MMS messages.
Share a voice memo:  
  1  Select a voice memo on the Voice Memos screen, then tap Share.
You can also tap Share on the Info screen of a voice memo.
  2  Choose Email to open a new message in Mail with the memo attached, or choose 
MMS to open a new message in Messages. 
#OGUUCIGCRRGCTUKHVJG°NG[QW¨TGVT[KPIVQUGPFKUVQQNCTIG
163
Chapter 21    Voice Memos

Syncing Voice Memos
iTunes syncs voice memos to your iTunes library when you connect iPhone to your 
computer. This lets you listen to voice memos on your computer and provides a 
backup if you delete them from iPhone.
Voice memos are synced to the Voice Memos playlist. iTunes creates the playlist if it 
doesn’t exist. When you sync voice memos to iTunes, they remain in the Voice Memos 
app until you delete them. If you delete a voice memo on iPhone, it isn’t deleted from 
the Voice Memos playlist in iTunes. However, if you delete a voice memo from iTunes, it 
is deleted from iPhone the next time you sync with iTunes.
You can sync the iTunes Voice Memos playlist to the iPod app on iPhone using the 
Music pane in iTunes.
Sync the Voice Memos playlist to iPhone:
  1  Connect iPhone to your computer. 
  2  In iTunes, select iPhone in the Devices list.
  3  Select Music at the top of the screen.
  4  Select the “Include voice memos” checkbox and click Apply.
164 Chapter 21    Voice Memos

iTunes Store 22
About the iTunes Store
You can search for, browse, preview, purchase, and download music, ringtones, 
audiobooks, TV shows, movies, and music videos from the iTunes Store directly to 
iPhone. You can listen to audio or watch video podcasts from the iTunes Store, either 
by streaming them from the Internet or by downloading them directly to iPhone. And, 
[QWECPHQNNQY[QWTHCXQTKVGCTVKUVUCPFHTKGPFUVQ°PFQWVYJCVOWUKEVJG[¨TGNKUVGPKPI
VQCPFVCNMKPICDQWV°PFQWVYJGP[QWTHCXQTKVGCTVKUVUCTGQPVQWTPGCT[QWCPF
who’s planning to go, and more.
Note:  The iTunes Store may not be available in all countries or regions, and iTunes 
Store content may vary by country or region. Features are subject to change.
To access the iTunes Store, iPhone must be connected to the Internet. See “Connecting 
to the Internet” on page 22.
To purchase items or write reviews, you need an Apple ID. By default, iPhone gets your 
Apple ID information from iTunes. If you don’t have an Apple ID, or if you want to make 
purchases using another Apple ID, go to Settings > Store. See “Store” on page 212.
You don’t need an Apple ID to play or download podcasts.
165

Finding Music, Videos, and More
Browse content:  Tap one of the content categories at the bottom of the screen, such 
as Music or Videos. Or tap More to browse other content. Choose a sort method at the 
top of the screen—for example New Releases or Genres (the categories may vary).
Search for content:  6CR5GCTEJVCR/QTG°TUVKH5GCTEJKUP¨VXKUKDNGVCRVJGUGCTEJ
°GNFCPFGPVGTQPGQTOQTGYQTFUVJGPVCR5GCTEJ5GCTEJTGUWNVUCTGITQWRGFD[
category, such as Movies, Albums, or Podcasts.
Tap an item in a list to see more details on its Info screen. You can read reviews, write 
your own review, or email a link about the item to a friend. Depending on the item, 
you can also buy, download, or rent it.
Note:  If you join a Starbucks Wi-Fi network in a select Starbucks location in the U.S., 
the Starbucks icon appears at the bottom of the screen. You can preview and purchase 
the currently playing and other songs from featured Starbucks Collections.
166 Chapter 22    iTunes Store

Explore artist and friend recommendations:  6CR2KPIVCR/QTG°TUVKH2KPIKUP¨VXKUKDNG
VQ°PFQWVYJCV¨UPGYHTQO[QWTHCXQTKVGCTVKUVUQTUGGYJCVOWUKE[QWTHTKGPFUCTG
excited about. For information, see the following section, “Following Artists and Friends.”
Get Genius recommendations:  Tap More, then tap Genius.
Following Artists and Friends
Use iTunes Ping to connect with the world’s most passionate music fans. Follow 
favorite artists to learn about new releases and upcoming concerts and tours, get an 
insider’s perspective through their photos and videos, and learn about their musical 
KP±WGPEGU4GCFHTKGPFU¨EQOOGPVUCDQWVVJGOWUKEVJG[¨TGNKUVGPKPIVQCPFUGGYJCV
they’re buying and which concerts they plan to attend. Finally, express your musical 
likes and post comments for your own followers.
6QETGCVGCPFGZRNQTGOWUKECNEQPPGEVKQPU[QWPGGFVQETGCVGCRTQ°NG
%TGCVG[QWTK6WPGU2KPIRTQ°NGOpen the iTunes application on your Mac or PC, click 
Ping, and follow the onscreen instructions.
Explore iTunes Ping on iPhone:  1RGPVJGK6WPGUCRRVCR2KPIVCR/QTG°TUVKH2KPI
isn’t visible), then:
Tap Activity to see the latest from and about the people you follow. Updates include  
purchases, reviews, likes, comments, and posts.
Tap People to see who you’re following and who’s following you, or to search for  
artists or friends.
6CR/[2TQ°NGVQTGXKGY[QWTRTQ°NGKPHQTOCVKQP 
Follow an artist:  6CR(QNNQYQPVJGKTRTQ°NGRCIG
 By searching:  6CR2GQRNGGPVGTVJGCTVKUV¨UPCOGKPVJGUGCTEJ°GNFCVVJGVQRQHVJG
page, then tap Search. Tap the artist in the list of results, then tap Follow.
 While browsing:  6CR2TQ°NGCVVJGDQVVQOQHCP[CNDWORCIGVJGPVCR(QNNQY
167
Chapter 22    iTunes Store

Follow a friend:  %JQQUGCUVCTVKPIITQWRQHHTKGPFUYJGP[QWUGVWR[QWTRTQ°NG 
using iTunes on your Mac or PC. After that, you can choose to follow others using  
Ping on iPhone.
 By searching:  6CR2GQRNGGPVGT[QWTHTKGPF¨UPCOGKPVJGUGCTEJ°GNFVJGPVCR
Search. Tap your friend’s name in the list of matches, then tap Follow.
 While exploring Ping:  Tap a person’s name, then tap Follow.
9JGP[QWHQNNQYUQOGQPGVJG[FQP¨VCWVQOCVKECNN[HQNNQY[QW+P[QWTRTQ°NG[QWECP
choose to approve or decline requests to be followed as they arrive, or simply accept 
all new followers without review (the default).
Share your thoughts:  As you browse albums and songs, tap Post to comment on a 
piece of music, or tap Like just to say you like it. Your friends will see your thoughts in 
their iTunes Ping Activity feed. You can also say you like a song, or comment on it while 
you listen to it on iPhone. See “Additional Audio Controls” on page 94.
Share concert plans:  6CR%QPEGTVUQP[QWTRTQ°NGRCIGVQUGGWREQOKPIEQPEGTVUD[
the artists you follow, and see which of your friends are going to a concert. Tap Tickets 
to buy your own ticket, or tap I’m Going to let others know you’ll be there too. (Not 
available in all countries or regions.)
Ping can send a text alert, play a sound, or add an alert badge to the iTunes app icon 
on your iPhone when someone:
Starts following you 
Needs your approval to follow you 
Comments on one of your activities 
Approves your request to follow them 
5RGEKH[VJGV[RGQHPQVK°ECVKQP2KPIUGPFU+P5GVVKPIUEJQQUG0QVK°ECVKQPU 2KPI
168 Chapter 22    iTunes Store

Purchasing Ringtones
You can preview and purchase ringtones from the iTunes Store and download them  
to iPhone.
Note:  Ringtones may not be available in all countries or regions.
Browse for ringtones:  6CR4KPIVQPGUVCR/QTG°TUVKH4KPIVQPGUKUP¨VXKUKDNGQTWUG
5GCTEJVQ°PFCURGEK°EUQPIKPVJGK6WPGU5VQTG
Preview a ringtone:  Tap the item to preview. Double-tap the item for more information.
Purchase and download a ringtone:
  1  Tap the price, then tap Buy Now.
  2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1-
When you purchase a ringtone, you can set it as your default ringtone, or assign it to  
a contact.
If you don’t have an Apple ID, tap Create New Apple ID to set one up.
Your purchase is charged to your Apple ID. For additional purchases made within the 
PGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP
You can change your default ringtone or assign individual ringtones to contacts in 
Settings > Sounds. See “Sounds and the Ring/Silent Switch” on page 191.
Ringtones you purchase on iPhone are synced to your iTunes library when you 
connect iPhone to your computer. You can sync purchased ringtones to more than 
one iPhone, if they’re all synced using the Apple ID that you used to purchase the 
ringtones. You can’t edit ringtones you purchase from the iTunes Store.
You can create custom ringtones in Garage Band. For information, see Garage Band Help.
169
Chapter 22    iTunes Store

Purchasing Music or Audiobooks
9JGP[QW°PFCUQPICNDWOQTCWFKQDQQM[QWNKMGKPVJGK6WPGU5VQTG[QWECP
purchase and download it to iPhone. You can preview an item before you purchase it 
to make sure it’s what you want.
Preview a song or audiobook:  Tap the item.
Purchase and download a song, album, or audiobook:
  1  Tap the price, then tap Buy.
  2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1-
If you don’t have an Apple ID, tap Create New Apple ID to set one up.
Your purchase is charged to your Apple ID. For additional purchases made within the 
PGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP
If you already purchased songs from the album, the price is discounted based on that 
number of songs.
Some albums include bonus content. Bonus songs and music videos are downloaded 
to iPhone when you purchase the album. Other bonus content—iTunes Extras,  
iTunes LP, and digital booklets—can be downloaded and viewed only on your 
computer. To download these items to your iTunes library, choose Store > Check for 
Available Downloads.
Once you purchase an item, it begins downloading and appears on the Downloads 
screen. See “Checking Download Status” on page 172 .
Purchased songs are added to a Purchased playlist on iPhone. If you delete the Purchased 
playlist, iTunes creates a new one when you buy an item from the iTunes Store.
;QWECPTGFGGOK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ
make purchases. When you’re signed in, your remaining store credit appears with your 
Apple ID information at the bottom of most iTunes Store screens.
Enter a redemption code:  6CR/WUKEVCR/QTG°TUVKH/WUKEKUP¨VXKUKDNGVJGPVCR
Redeem at the bottom of the screen and follow the onscreen instructions.
Complete an album:  While viewing any album, tap the discounted price for the 
TGOCKPKPIUQPIUDGNQY%QORNGVG/[#NDWO6QUGGQÒGTUVQEQORNGVGQVJGTCNDWOU
VCR/WUKEVJGPVCR%QORNGVG/[#NDWO1ÒGTUPGCTVJGDQVVQO
Purchasing or Renting Videos
The iTunes Store lets you purchase and download movies, TV shows, and music videos 
(may not be available in all countries or regions). Some movies and TV shows can also 
DGTGPVGFHQTCNKOKVGFVKOG8KFGQEQPVGPVOC[DGCXCKNCDNGKPUVCPFCTFFG°PKVKQP 
5&QTRHQTOCVJKIJFG°PKVKQP*&QTRHQTOCVQTDQVJ
Preview a video:  Tap Preview.
170 Chapter 22    iTunes Store

View the preview on a TV using AirPlay and AppleTV (iOS 4.3):  When the preview 
starts, tap   and choose Apple TV. If   doesn’t appear or if you don’t see Apple TV, 
make sure iPhone is on the same wireless network.
Purchase or rent a video:
  1  Tap Buy or Rent.
  2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1-
If you don’t have an Apple ID, tap Create New Apple ID to set one up. Your purchase 
KUEJCTIGFVQ[QWT#RRNG+&(QTCFFKVKQPCNRWTEJCUGUOCFGYKVJKPVJGPGZV°HVGGP
minutes, you don’t have to enter your password again.
Once you purchase an item, it begins downloading and appears on the Downloads 
screen. See “Checking Download Status” on page 172 .
Rented movies and TV shows don’t begin playing until the download completes. See 
“Watching Rented Movies and TV Shows” on page 102.
When the download is complete, purchased videos are added to the Purchased playlist 
on iPhone. Purchased content is synced to the Purchased playlist for your iPhone in 
iTunes the next time you connect iPhone to your computer. See “Syncing Purchased 
Content” on page 173.
Note:  If you purchase HD video on iPhone 3GS, the video is downloaded in SD format.
To view or sync videos in the Purchased playlist in iTunes on your computer, you must 
be signed in using your Apple ID.
Sync purchased videos in iTunes:  Connect iPhone to your computer. In iTunes, select 
iPhone in the Devices list, click the appropriate button (Movies, TV Shows, or Music for 
music videos), select the items you want to sync, then click Sync.
If you purchase a video in HD format, you can choose to sync it in either SD or HD 
format. You may want to sync an HD video in SD format for a quicker download, or to 
save room on iPhone.
Select SD or HD format:  In iTunes, Control-click or right-click a video marked “HD-SD” 
CPFEJQQUG5VCPFCTF&G°PKVKQPQT*KIJ&G°PKVKQPHTQOVJG8GTUKQPOGPW
;QWECPTGFGGOK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ
make purchases. When you’re signed in, your remaining store credit appears with your 
Apple ID information at the bottom of most iTunes Store screens.
Enter a redemption code:  6CR/WUKEVCR/QTG°TUVKH/WUKEKUP¨VXKUKDNGVJGPVCR
Redeem at the bottom of the screen and follow the onscreen instructions.
171
Chapter 22    iTunes Store

Streaming or Downloading Podcasts
You can listen to audio podcasts or watch video podcasts streamed over the Internet 
from the iTunes Store. You can also download audio and video podcasts to iPhone. 
Podcasts you download to iPhone are synced to your iTunes library when you connect 
iPhone to your computer.
6CR2QFECUVUVCR/QTG°TUVKH2QFECUVUKUP¨VXKUKDNGVQDTQYUGRQFECUVUKPVJG 
iTunes Store. To see a list of episodes, tap a podcast. Video podcasts are marked with  
a video   icon.
Stream a podcast:  Tap the podcast title.
Download a podcast:  Tap the Free button, then tap Download. Downloaded podcasts 
appear in the Podcasts list in iPod.
Listen to or watch a podcast you’ve downloaded:  In iPod, tap Podcasts (tap More 
°TUVKH2QFECUVUKUP¨VXKUKDNGVJGPVCRVJGRQFECUV8KFGQRQFECUVUCNUQCRRGCTKP[QWT
list of videos.
Get more episodes of the podcast you’ve downloaded:  In the Podcasts list in iPod, 
tap the podcast, then tap Get More Episodes.
Delete a podcast:  In the Podcasts list in iPod, swipe left or right over the podcast, then 
tap Delete.
Checking Download Status
You can check the Downloads screen to see the status of in-progress and scheduled 
downloads, including purchases you’ve pre-ordered.
See the status of items being downloaded:  6CR&QYPNQCFUVCR/QTG°TUVKH
Downloads isn’t visible).
To pause a download, tap  .
If a download is interrupted, iPhone starts the download again the next time it has an 
Internet connection. Or, if you open iTunes on your computer, iTunes completes the 
download to your iTunes library (if your computer is connected to the Internet and 
signed in using the same Apple ID).
See the status of pre-ordered items:  6CR&QYPNQCFUVCR/QTG°TUVKH&QYPNQCFU 
isn’t visible).
Pre-ordered items appear in a list until the item is released. Tap the item for release 
date information. Once the item is available for download,   appears next to the 
download.
Download a pre-ordered item:  Tap the item, then tap  .
Pre-ordered items don’t download automatically when they’re released. Return to the 
Downloads screen to begin the download.
172 Chapter 22    iTunes Store

Syncing Purchased Content
iTunes automatically syncs everything you’ve downloaded or purchased on iPhone to 
your iTunes library when you connect iPhone to your computer. This lets you access 
the downloads on your computer and provides a backup if you delete purchased 
content from iPhone.
Purchased content is synced to the “Purchased on <name of your iPhone>” playlist. 
iTunes creates the playlist if it doesn’t exist. iTunes also copies your purchases to the 
Purchased playlist that iTunes uses for purchases you make on your computer, if that 
playlist exists and is set to sync with iPhone.
Downloaded podcasts are synced to the Podcast list in your iTunes library.
Changing the Browse Buttons
You can replace the Music, Podcasts, Videos, and Search buttons at the bottom of the 
screen with ones you use more frequently. For example, if you download audiobooks 
often but don’t watch many videos, you could replace the Videos button with 
Audiobooks.
Change the browse buttons:  Tap More, tap Edit, then drag a button to the bottom of 
the screen, over the button you want to replace.
You can drag the buttons at the bottom of the screen left or right to rearrange them. 
9JGP[QW°PKUJVCR&QPG
While you browse, tap More to access the browse buttons that aren’t visible.
173
Chapter 22    iTunes Store

Viewing Account Information
To view iTunes Store information for your Apple ID on iPhone, tap your Apple ID (at the 
bottom of most iTunes Store screens). Or go to Settings > Store and tap View Apple ID. 
You must be signed in to view your account information. See “Store” on page 212.
Verifying Downloads
You can use iTunes on your computer to verify that all the music, videos, apps, and 
other items you bought from the iTunes Store or App Store are in your iTunes library. 
You might want to do this if a download was interrupted.
Verify your purchases:
  1  Make sure your computer is connected to the Internet.
  2  In iTunes, choose Store > Check for Available Downloads.
  3  Enter your Apple ID and password, then click Check.
Purchases not yet on your computer are downloaded.
The Purchased playlist displays your purchases. However, because you can add or 
remove items in this list, it might not be accurate. To see all of your purchases, sign in 
using your Apple ID, choose Store > View My Account, and click Purchase History.
174 Chapter 22    iTunes Store

App Store 23
About the App Store
You can search for, browse, review, purchase, and download apps from the App 
Store directly to iPhone. Apps that you download and install from the App Store 
on iPhone are backed up to your iTunes library the next time you sync iPhone with 
your computer. When you sync iPhone, you can also install apps you’ve purchased or 
downloaded from the iTunes Store on your computer.
Note:  The App Store may not be available in all countries or regions, and App Store 
content may vary by country or region. Features are subject to change.
To browse the App Store, iPhone must be connected to the Internet. See “Connecting 
to the Internet” on page 22. To download apps, you also need an Apple ID (may not 
be available in all countries or regions). By default, iPhone gets your Apple ID settings 
from iTunes. If you don’t have an Apple ID, or if you want to make purchases using 
another Apple ID, go to Settings > Store. See “Store” on page 212.
175

Browsing and Searching
Browse the featured selections to see new, notable, or recommended apps, or browse 
6QRVQUGGVJGOQUVRQRWNCTCRRU+H[QW¨TGNQQMKPIHQTCURGEK°ECRRWUG5GCTEJ
Browse apps:  Tap Featured, Categories, or Top 25. Choose a category, or choose a sort 
method at the top of the screen to browse by lists such as New, What’s Hot, Genius, 
Top Paid, or Top Free.
Browse using Genius:  Tap Genius to see a list of recommended apps based on what’s 
already in your app collection. To turn Genius on, follow the onscreen instructions. 
Genius is a free service, but it requires an Apple ID. 
Search for apps:  6CR5GCTEJVCRVJGUGCTEJ°GNFCPFGPVGTQPGQTOQTGYQTFUVJGP
tap Search.
176 Chapter 23    App Store

Info Screen
Tap any app in a list to see more information, such as the app’s price, screenshots,  
and ratings.
If you already installed the app, “Installed” appears instead of the price on the Info screen.
View screenshots:  Scroll to near the bottom of the Info page. Flick left or right to view 
additional screenshot pages. Double-tap to zoom in.
Get ratings and read reviews:  Tap Ratings near the bottom of the Info screen.
Email a link to the app’s Info page in iTunes:  Tap “Tell a Friend” near the bottom of 
the Info screen.
Report a problem:  Tap “Report a Problem” near the bottom of the Info screen. Select a 
problem from the list or type optional comments, then tap Report.
Send the app to someone as a gift:  Tap “Gift This App” near the bottom of the Info 
screen, then follow the onscreen instructions.
177
Chapter 23    App Store

Downloading Apps
9JGP[QW°PFCPCRR[QWYCPVKPVJG#RR5VQTG[QWECPRWTEJCUGCPFFQYPNQCFKV
to iPhone. If the app is free, you can download it without charge.
Once you download an app, it’s immediately installed on iPhone.
Purchase and download an app:
  1  Tap the price (or tap Free), then tap Buy Now.
  2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1-
If you don’t have an Apple ID, tap Create New Apple ID to set one up.
Downloads for purchase are charged to your Apple ID. For additional downloads made 
YKVJKPVJGPGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP
Some apps allow you to make purchases within the app. You can restrict in-app 
purchases in Settings. See “Restrictions” on page 196.
5QOGCRRUWUGRWUJPQVK°ECVKQPUVQCNGTV[QWQHPGYKPHQTOCVKQPGXGPYJGPVJGCRR
KUP¨VTWPPKPI0QVK°ECVKQPUXCT[FGRGPFKPIQPVJGCRRDWVOC[KPENWFGVGZVQTUQWPF
alerts, and an alert badge on the app icon on the Home screen. See “0QVK°ECVKQPU” on 
page 190.
;QWECPTGFGGOK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ
make purchases. When you’re signed in, your remaining store credit appears with your 
Apple ID information at the bottom of most App Store screens.
Enter a redemption code:  Tap Redeem near the bottom of the Featured screen, then 
follow the onscreen instructions.
See the status of downloading apps:  After you begin downloading an app, its icon 
appears on the Home screen and shows a progress indicator.
If a download is interrupted, iPhone starts the download again the next time it has an 
Internet connection. Or, if you open iTunes on your computer, iTunes completes the 
download to your iTunes library (if your computer is connected to the Internet and 
signed in using the same Apple ID).
178 Chapter 23    App Store

Deleting Apps
You can delete apps you install from the App Store. If you delete an app, data 
associated with the app is no longer available to iPhone, unless you reinstall the app 
and restore its data from a backup.
You can reinstall an app and restore its data as long as you backed up iPhone with 
iTunes on your computer. (If you try to delete an app that hasn’t been backed up to 
your computer, an alert appears.) To retrieve the app data, you must restore iPhone 
from a backup containing the data. See “Restoring from a Backup” on page 257.
Delete an App Store app:
  1  Touch and hold any app icon on the Home screen, until the icons start to jiggle.
  2  Tap   in the corner of the app you want to delete.
  3  Tap Delete, then press the Home   button.
If you don’t see   on the app icon, either the app wasn’t purchased from the  
App Store or deleting apps has been restricted. See “Restrictions” on page 196.
When you delete an app, its data is no longer accessible through the iPhone user 
interface, but it isn’t erased from iPhone. For information about erasing all content and 
settings, see “Erase All Content and Settings” on page 201.
You can redownload any app that you’ve purchased from the App Store, free of charge.
Replace a deleted app:  
 1PK2JQPGPurchase the app again (you won’t be charged).
 In iTunes:  Connect iPhone to your computer, select iPhone in the Devices list, click 
Apps and select the checkbox next to the app, then click Apply.
Writing Reviews
You can write and submit your own app reviews directly on iPhone.
Write a review:
  1  Tap Ratings near the bottom of the Info screen.
  2  On the Reviews screen, tap “Write a Review.”
  3  Select the number of stars (1–5) for your rating of the app, and enter your nickname, 
a title for the review, and optional review comments. If you’ve written reviews before, 
VJGPKEMPCOG°GNFKUCNTGCF[°NNGFKP1VJGTYKUG[QW¨TGCUMGFVQETGCVGCTGXKGYGT
nickname.
  4  Tap Send.
You must be signed in to your Apple account and have downloaded the item in order 
to submit reviews.
179
Chapter 23    App Store

Updating Apps
Whenever you access the App Store, it checks for updates to apps you’ve installed. The 
App Store also automatically checks for updates every week. The App Store icon shows 
the total number of app updates available.
If an update is available and you access the App Store, the Updates screen appears 
immediately. App updates are downloaded and automatically installed when you 
choose to update them.
App upgrades are new releases that can be purchased or downloaded through the 
App Store on iPhone or the iTunes Store on your computer.
Update an app:
  1  At the bottom of the screen, tap Updates.
  2  Tap an app to see more information about the update. 
  3  Tap Update.
Update all apps:  At the bottom of the screen, tap Updates, then tap Update All.
+H[QWVT[VQWRFCVGCPCRRRWTEJCUGFHTQOCFKÒGTGPV#RRNGCEEQWPV[QW¨TGCUMGFHQT
that account ID and password in order to download the update.
Syncing Purchased Apps
When you connect iPhone to your computer, iTunes syncs apps you download or 
purchase on iPhone to your iTunes library. This lets you access the downloads on your 
computer and provides a backup if you delete apps from iPhone.
Downloaded apps are backed up the next time you sync with iTunes. Afterwards, only 
app data is backed up when you sync with iTunes.
Apps are synced to the Apps list in your iTunes library. iTunes creates the list if it 
doesn’t exist. 
180 Chapter 23    App Store

Game Center 24
About Game Center
You can discover new games and share your game experiences with friends around 
VJGYQTNFKP)COG%GPVGT+PXKVG[QWTHTKGPFUVQRNC[QTWUGCWVQOCVEJVQ°PFQVJGT
worthy opponents. Check leaderboards to see who the best players are. Earn bonus 
RQKPVUD[CEJKGXKPIURGEK°ECEEQORNKUJOGPVUKPCICOG
Note:  Game Center may not be available in all countries or regions, and the available 
games may vary by country or region.
To use Game Center, you need an Internet connection and an Apple ID. If you already 
have an iTunes Store, MobileMe, or other Apple account, you can use that Apple ID 
with Game Center. If you don’t already have an Apple account, you can create a new 
one in Game Center, as described below.
Setting Up Game Center
9JGP[QW°TUVQRGP)COG%GPVGT[QW¨TGCUMGFKH[QWYCPVVQCNNQYRWUJPQVK°ECVKQPU
;QWOC[°TUVDGCUMGFKH[QWYCPVVQVWTPQP0QVK°ECVKQPU0QVK°ECVKQPUOC[KPENWFG
alerts, sounds, and badges that let you know about Game Center events even when 
you’re not using Game Center. For example, you might receive an alert that a friend 
has invited you to play a game. 
#NNQYPQVK°ECVKQPU6CR1-
+H[QWVCR&QP¨V#NNQY[QWYQP¨VTGEGKXGPQVK°ECVKQPUHQT)COG%GPVGT;QWECP
VWTPPQVK°ECVKQPUQPCVCNCVGTVKOGKH[QWYCPVCPF[QWECPURGEKH[YJCVMKPFUQH
PQVK°ECVKQPU[QWYCPVVQIGV
6WTPPQVK°ECVKQPUQPQTQÒ+P5GVVKPIUEJQQUG0QVK°ECVKQPU6WTPKPIQÒ0QVK°ECVKQPU
FKUCDNGUCNNPQVK°ECVKQPUHQTCNNCRRU
181

5RGEKH[YJKEJPQVK°ECVKQPU[QWYCPVHQT)COG%GPVGTIn Settings, choose 
0QVK°ECVKQPU )COG%GPVGTVJGPEQP°IWTGVJG5QWPFU#NGTVUCPF$CFIGUUGVVKPIU 
+H)COG%GPVGTFQGUP¨VCRRGCTVWTPQP0QVK°ECVKQPU
Set up Game Center information for your Apple ID:
  1  Enter your Apple ID and password, then tap Sign In.
You may be asked to provide additional information. If you don’t have an Apple ID,  
you can create one by tapping Create New Account.
  2  Tap Agree to accept the Game Center Terms & Conditions.
  3  Enter a nickname—the name others will see and know you by.
  4 %QP°IWTG[QWT)COG%GPVGTUGVVKPIU
To allow other users to invite you to play a game, leave Allow Game Invites turned  
QP1VJGTYKUGVCRVQVWTPKVQÒ
6QCNNQYQVJGTWUGTUVQ°PF[QWD[[QWTGOCKNCFFTGUUNGCXG(KPF/G$['OCKN 
VWTPGFQP1VJGTYKUGVCRVQVWTPKVQÒ
8GTKH[[QWTCEEQWPVGOCKN;QWECPGPVGTCFKÒGTGPVCFFTGUUKH[QWFQP¨VYCPVVQ 
WUGVJGQPGHTQOVJG#RRNGCEEQWPV[QWWUGFVQUKIPKP6QEQP°TOVJKUCFFTGUUCU
yours, you’ll need to respond to the email that is sent to that address.
To add more email addresses that people can use to contact you in Game Center,  
tap Add Another Email.
  5 6CR0GZVYJGP[QWTCEEQWPVKUEQP°IWTGF
Change Game Center settings for your Apple ID:
  1  Tap Me at the bottom of the screen, then tap your account banner.
  2  Tap View Account.
  3  Make your changes, then tap Done.
5KIPKPWUKPICFKÒGTGPV#RRNG+&
  1  Tap Me, then tap the account banner at the bottom of the screen.
  2  Tap Sign Out.
  3  Enter the new Apple ID and password, then tap Sign In.
Games
Games for Game Center are available from the App Store.
Purchasing and Downloading Games
The Game Center section of App Store shows the games that work with Game Center.
Purchase and download games:  Tap Games, then tap Find Game Center Games. 
182 Chapter 24    Game Center

You can browse this section, and purchase and download games from it. If you haven’t 
entered credit card information for your Apple ID, you’re prompted to enter it before 
you purchase and download games. See Chapter 23, “App Store,” on page 175.
If you want to purchase a game that a friend has, tap the game on your friend’s info 
screen to go directly to that game in the App Store. 
Playing Games
The Games screen displays the games you download from the App Store. For each 
game, your number of achievements and your ranking among all the game’s players 
are displayed.
Get information about a game:  Tap Games, then tap a game. If available, you can 
FKURNC[VJGICOG¨UNGCFGTDQCTFUUGG[QWTCEJKGXGOGPVUHQTVJGICOGCPF°PFQWV
who’s recently played the game.
Play a game:  Tap Games, choose a game, then tap Play.
Depending on the game, the home screen may provide instructions or other 
information, and let you view leaderboards and achievements, set game options, and 
start a single or multiplayer game. To play against others, you can either invite a friend 
QTWUGCWVQOCVEJVQJCXG)COG%GPVGT°PFQVJGTRNC[GTUHQT[QW(QTKPHQTOCVKQP
about making friends in Game Center, see “Friends” on page 185.
For multiplayer games, you can also send a game invitation from the Friends screen.
Invite a friend to a multiplayer game from the Friends screen:
  1  Tap Friends at the bottom of the screen.
  2  Choose a friend.
  3  Choose a game and tap Play.
If the game allows or requires additional players, you can choose players to invite,  
then tap Next.
183
Chapter 24    Game Center

  4  Enter and send your invitation, then wait for the others to accept.
  5  Start the game.
If a friend isn’t available or doesn’t respond to your invitation, you can tap Auto-Match 
VQJCXG)COG%GPVGT°PFCPQVJGTRNC[GTHQT[QWQTVCR+PXKVG(TKGPFVQVT[KPXKVKPI
some other friend.
Other players may invite you to play the game.
Respond to an invitation to play a game:  Tap Accept or Decline in the alert that appears.
You can disable multiplayer games in Restrictions. See “Restrictions” on page 196. 
;QWECPRTGXGPVQVJGTRNC[GTUHTQOKPXKVKPI[QWVQRNC[ICOGUD[VWTPKPIQÒ#NNQY
Game Invites in Game Center settings. See “Your Status and Account Information” on 
page 186.
Return to Game Center:  Press the Home button, then tap Game Center on the  
Home screen.
You can also press the Home button twice quickly, then tap Game Center in the list of 
recent apps.
Leaderboards
Some games provide one or more leaderboards to show the ranking of the game’s 
players, with their scores, times, or other measures of the players’ success.
See a game’s leaderboard:  Tap Games, then choose the game and tap Leaderboard.
You may also be able to view leaderboards from within a game.
If a game has variations (such as Easy, Normal, and Hard), the Categories screen lets 
you choose the leaderboard for the game in general, or for one of the variations.
The leaderboard shows the ranking of your friends, and of all players. You may be able 
VQXKGYNGCFGTDQCTFUVCVUHQTCURGEK°EVKOGRGTKQFUWEJCUVQFC[VJKUYGGMQTCNNVKOG
Rotate iPhone to see a leaderboard in landscape orientation.
Start playing a game from the leaderboard:  Tap Play in the upper-right corner.
Achievements
5QOGICOGUTGYCTF[QWYKVJDQPWURQKPVUHQTURGEK°ECEJKGXGOGPVU
See the possible achievements for a game:  Tap Games, choose a game, then tap 
Achievements.
For each achievement, Game Center shows how many bonus points are awarded, 
and whether you’ve completed the achievement. The total points awarded for your 
CEJKGXGOGPVUCRRGCTCVVJGVQR;QWECPIGVDQPWURQKPVUHQTCURGEK°ECEJKGXGOGPV
only once.
You may also be able to view achievements from within a game.
184 Chapter 24    Game Center

Recently Played
Some games let you see which of your friends have recently played the game.
See who’s recently played a game:  Tap Games, tap a game, then tap Recently Played.
Get information about a player:  Tap a player’s name in the list.
Friends
Game Center puts you in contact with players around the world. You add friends to 
Game Center by making a request, or by accepting a request from another player.
Add a friend to Game Center:
  1  Tap Friends or Requests.
  2  Tap +, then enter a friend’s email address or Game Center nickname.
Matching addresses and names from your contacts appear as you type. Tap a contact 
to include that person in your request. Tap   to browse your contacts.
To add several friends at once, enter additional contacts.
  3  Enter a message for your request, then tap Send.
In order to become a friend, a person must accept your request.
Other players might send you a request. If you receive an alert, you can accept the 
request from there, or close it and respond to the request later from the Request 
screen. An alert badge on the Requests button shows the number of outstanding 
friend requests.
Respond to a friend request:  Tap Requests, tap the name of the person making the 
request, then tap Accept, Ignore, or Report a Problem.
When a player accepts another player’s request, they each become the other’s friend. 
Friends’ names appear on the Friends screen.
Get information about a friend:  Tap the friend’s name.
Search for a friend:  Tap the status bar to scroll to the top of the screen, then tap the 
UGCTEJ°GNFCPFUVCTVV[RKPI(TKGPFUYJQOCVEJ[QWTUGCTEJCRRGCTCU[QWV[RG
A friend’s info page shows how many friends (including you) the person has, the 
PWODGTQHFKÒGTGPVICOGU[QWTHTKGPFJCURNC[GFCPFJQYOCP[CEJKGXGOGPVU[QWT
friend has completed. The info screen may also show:
The games you’ve played together 
The games you have in common 
Other games your friend has 
You can tap a game in any of the lists to see your position and your friend’s position 
on the overall leaderboard, and your respective accomplishments for the game.
185
Chapter 24    Game Center

Invite a friend to play a game:  Tap Friends, tap the friend’s name, tap a game, then 
tap Play. See “Playing Games” on page 183.
Remove a friend:  Tap Friends, tap a name, then tap Unfriend and tap Remove.
+HCRNC[GTKUQÒGPUKXGQTGZJKDKVUKPCRRTQRTKCVGDGJCXKQT[QWECPTGRQTVVJGRTQDNGO
Report a problem with a friend:  Tap Friends, tap the friend’s name, then tap “Report a 
Problem.” Describe the problem, then tap Report to send the report. 
+H[QWVWTPQÒ/WNVKRNC[GT)COGUKP5GVVKPIU[QWECP¨VUGPFQTTGEGKXGKPXKVCVKQPUVQ
play games. See “Restrictions” on page 196.
Your Status and Account Information
The Me screen summarizes information about your friends, your games, and your 
achievements.
6JGVGZV°GNFKPVJGEGPVGTQHVJGUETGGPNGVU[QWGPVGT[QWTEWTTGPVUVCVWUOGUUCIG
Your status appears along with your nickname in other players’ Friends screens.
Change your status:  6CRVJGUVCVWU°GNFCPFWUGVJGMG[DQCTFVQGPVGTQTWRFCVG 
your status.
View your account information:  Tap the account banner, then tap View Account.
You can change or update the following settings:
Nickname 
Allow game invites 
Find Me By Email 
Your mail address for Game Center 
Additional email addresses 
9JGP[QW°PKUJVCR&QPG
;QWECPCNUQUKIPQWVCPFUKIPKPVQCFKÒGTGPVCEEQWPVQTETGCVGCPGYCEEQWPV
Sign out:  Tap the account banner, then tap Sign Out.
To sign in to another account, enter your username and password, then tap Sign In. To 
create a new account, tap Create New Account and follow the onscreen instructions.
186 Chapter 24    Game Center

Settings 25
5GVVKPIUCNNQYU[QWVQEWUVQOK\GK2JQPGCRRUUGVVJGFCVGCPFVKOGEQP°IWTG[QWT
network connection, and enter other preferences for iPhone.
Airplane Mode
Airplane mode disables the wireless features of iPhone to reduce potential 
interference with aircraft operation and other electrical equipment.
Turn on airplane mode:  Tap Settings and turn airplane mode on.
When airplane mode is on,   appears in the status bar at the top of the screen. No 
phone, radio, Wi-Fi, or Bluetooth signals are emitted from iPhone and GPS reception is 
VWTPGFQÒFKUCDNKPIOCP[QHK2JQPG¨UHGCVWTGU;QWYQP¨VDGCDNGVQ
Make or receive phone calls 
Make or receive FaceTime video calls 
Get visual voicemail 
Send or receive email 
Browse the Internet 
Sync your contacts, calendars, or bookmarks (MobileMe only) with MobileMe or  
Microsoft Exchange
Send or receive text or MMS messages 
Stream YouTube videos 
Get stock quotes 
Get map locations 
Get weather reports 
Use the iTunes Store or the App Store 
Use Game Center 
187

If allowed by the aircraft operator and applicable laws and regulations, you can 
continue to use iPhone to:
Listen to music and watch videos 
Listen to visual voicemail previously received 
Check your calendar 
Take or view photos or video (iPhone 4 or later) 
Hear alarms 
Use the stopwatch or timer 
Use the calculator 
Take notes 
Record voice memos 
Use Compass 
Read text messages and email messages stored on iPhone 
If Wi-Fi is available and allowed by the aircraft operator and applicable laws and 
regulations, you can turn Wi-Fi back on and:
Make or receive FaceTime video calls 
Send and receive email 
Browse the Internet 
Sync your contacts, calendars, and bookmarks (MobileMe only) with MobileMe   
and Microsoft Exchange
Stream YouTube videos 
Get stock quotes 
Get map locations 
Get weather reports 
Use the iTunes Store or the App Store 
Use Game Center 
You may also be allowed to turn on Bluetooth and use Bluetooth devices with iPhone.
188 Chapter 25    Settings

Wi-Fi
Wi-Fi settings determine whether iPhone uses local Wi-Fi networks to connect to the 
+PVGTPGV+HPQ9K(KPGVYQTMUCTGCXCKNCDNGQT[QW¨XGVWTPGF9K(KQÒVJGPK2JQPG
connects to the Internet via your cellular data network, when available.
6WTP9K(KQPQTQÒ%JQQUG9K(KCPFVWTP9K(KQPQTQÒ
Join a Wi-Fi network:  Choose Wi-Fi, wait a moment as iPhone detects networks in 
range, then select a network. If necessary, enter a password and tap Join (networks 
that require a password appear with a lock   icon).
Once you join a Wi-Fi network manually, iPhone automatically joins it whenever the 
network is in range. If more than one previously used network is in range, iPhone joins 
the one last used.
When iPhone is joined to a Wi-Fi network, the Wi-Fi   icon in the status bar at the top 
of the screen shows signal strength. The more bars you see, the stronger the signal.
Set iPhone to ask if you want to join a new network:  Choose Wi-Fi and turn “Ask to 
,QKP0GVYQTMU¦QPQTQÒ
When you’re trying to access the Internet, by using Safari or Mail for example, and you 
aren’t in range of a Wi-Fi network you‘ve previously used, this option tells iPhone to 
look for another network. iPhone displays a list of all available Wi-Fi networks that you 
can choose from. (Networks that require a password appear with a lock   icon.) If “Ask 
VQ,QKP0GVYQTMU¦KUVWTPGFQÒ[QWOWUVOCPWCNN[LQKPCPGVYQTMVQEQPPGEVVQVJG
Internet when a previously used network or a cellular data network isn’t available.
Forget a network, so iPhone doesn’t join it:  Choose Wi-Fi and tap   next to a 
network you’ve joined before. Then tap “Forget this Network.”
Join a closed Wi-Fi network:  To join a Wi-Fi network that isn’t shown in the list of 
scanned networks, choose Wi-Fi > Other, then enter the network name. If the network 
requires a password, tap Security, tap the type of security the network uses, and enter 
the password.
You must already know the network name, password, and security type to connect to 
a closed network.
Some Wi-Fi networks may require you to enter or adjust additional settings, such as a 
client ID or static IP address. Ask the network administrator which settings to use.
Adjust settings for connecting to a Wi-Fi network:  Choose Wi-Fi, then tap   next to 
a network.
VPN
6JKUUGVVKPICRRGCTUYJGP[QWJCXG820EQP°IWTGFQPK2JQPGCNNQYKPI[QWVQVWTP
820QPQTQÒ5GG¥Network” on page 193.
189
Chapter 25    Settings

Personal Hotspot
Personal Hotspot settings appear at the top level of Settings, as well as at General > 
Network settings. See “Network” on page 193.
Note:  Depending on your carrier, the Personal Hotpost service may need to be 
activated before the settings appear in this location.
0QVK°ECVKQPU
This setting appears when you open an app (such as Game Center) that uses the 
#RRNG2WUJ0QVK°ECVKQPUGTXKEG
2WUJPQVK°ECVKQPUCNGTV[QWVQPGYKPHQTOCVKQPGXGPYJGPVJGCRRKUP¨VTWPPKPI
0QVK°ECVKQPUXCT[D[CRRDWVOC[KPENWFGVGZVQTUQWPFCNGTVUCPFCPWODGTGFDCFIG
on the app icon on the Home screen.
;QWECPVWTPPQVK°ECVKQPUQÒKH[QWFQP¨VYCPVVQDGPQVK°GFQTKH[QWYCPVVQ
conserve battery life.
6WTPCNNPQVK°ECVKQPUQPQTQÒ6CR0QVK°ECVKQPUVJGPVWTPPQVK°ECVKQPUQPQTQÒ
6WTPUQWPFUCNGTVUQTDCFIGUQPQTQÒHQTCPCRR6CR0QVK°ECVKQPUEJQQUGCPCRR
HTQOVJGNKUVVJGPEJQQUGVJGV[RGUQHPQVK°ECVKQP[QWYCPVVQVWTPQPQTQÒ
Carrier
This setting appears on GSM models when you’re outside your carrier’s network 
and other local carrier data networks are available to use for your phone calls, visual 
voicemail, and cellular network Internet connections. You can make calls only on 
carriers that have a roaming agreement with your carrier. Additional fees may apply. 
Roaming charges may be billed to you by the other carrier, through your carrier.
For information about out-of-network coverage and how to enable roaming, contact 
your carrier or go to your carrier’s website.
Select a carrier:  Choose Carrier and select the network you want to use.
Once you select a network, iPhone uses only that network. If the network is 
unavailable, “No service” appears on the iPhone screen and you can’t make or receive 
calls or visual voicemail, or connect to the Internet via cellular data network. Set 
Network Settings to Automatic to have iPhone select a network for you.
190 Chapter 25    Settings

Sounds and the Ring/Silent Switch
Switch between ring and silent mode:  Flip the Ring/Silent switch on the side of iPhone.
9JGPUGVVQUKNGPVK2JQPGFQGUP¨VRNC[CP[TKPICNGTVQTGÒGEVUUQWPFU+VFQGU
however, play alarms set using Clock.
Note:  +PUQOGEQWPVTKGUQTTGIKQPUVJGUQWPFGÒGEVUHQT%COGTCCPF8QKEG/GOQUCTG
played even if the Ring/Silent switch is set to silent.
Set whether iPhone vibrates when you get a call:  Choose Sounds. To set whether 
iPhone vibrates in silent mode, turn Vibrate under Silent  QPQTQÒ6QUGVYJGVJGT
iPhone vibrates in ring mode, turn Vibrate under Ring  QPQTQÒ
Adjust the ringer and alerts volume:  Choose Sounds and drag the slider. Or, if 
“Change with Buttons” is turned on, use the volume buttons on the side of iPhone. The 
volume buttons don’t change the ringer and alerts volume if a song or video is playing 
or if you’re on a call.
Allow the volume buttons to change the ringer or alerts volume:  Choose Sounds 
and turn on “Change with Buttons.” 
Set the ringtone:  Choose Sounds > Ringtone.
5GVVJGCNGTVCPFGÒGEVUUQWPFU%JQQUG5QWPFUCPFVWTPKVGOUQPQTQÒWPFGT 
Ring  . When the Ring/Silent switch is set to ring, iPhone plays sounds for alerts and 
GÒGEVUVJCVCTGVWTPGFQP
You can set iPhone to play a sound whenever you:
Get a call 
Get a text message 
Get a voicemail message 
Get an email message 
Send an email message 
Have an appointment that you’ve set to alert you 
Lock iPhone 
Type using the keyboard 
Brightness
5ETGGPDTKIJVPGUUCÒGEVUDCVVGT[NKHG&KOVJGUETGGPVQGZVGPFVJGVKOGDGHQTG[QW
need to recharge iPhone, or use Auto-Brightness.
Adjust the screen brightness:  Choose Brightness and drag the slider.
Set whether iPhone adjusts screen brightness automatically:  Choose Brightness 
CPFVWTP#WVQ$TKIJVPGUUQPQTQÒ+H#WVQ$TKIJVPGUUKUQPK2JQPGCFLWUVUVJGUETGGP
brightness for current light conditions using the built-in ambient light sensor.
191
Chapter 25    Settings

Wallpaper
Wallpaper settings let you set an image or photo as wallpaper for the Lock screen or 
Home screen. See “Adding Wallpaper” on page 36.
General
General settings include network, sharing, security, and other iOS settings. You can also 
°PFKPHQTOCVKQPCDQWV[QWTK2JQPGCPFTGUGVXCTKQWUK2JQPGUGVVKPIU
About
Choose General > About to get information about iPhone, including:
Name of your phone network 
Number of songs, videos, photos, and apps 
Total storage capacity 
Space available 
Software version 
Carrier 
Model and serial numbers 
Wi-Fi and Bluetooth addresses 
 GSM Models:  IMEI (International Mobile Equipment Identity) and ICCID (Integrated 
%KTEWKV%CTF+FGPVK°GTQT5OCTV%CTF
 CDMA Model:/'+&/QDKNG'SWKROGPV+FGPVK°GT
/QFGO°TOYCTGXGTUKQPQHVJGEGNNWNCTVTCPUOKVVGT 
Legal information 
Regulatory information 
Usage
Show battery percentage:  Choose General > Usage and turn Battery Percentage on.
See your usage statistics:  Choose General > Usage. There, you can see:
Usage—Amount of time iPhone has been awake and in use since the last full  
charge. iPhone is awake whenever you’re using it—including making or receiving 
phone calls, using email, sending or receiving text messages, listening to music, 
browsing the web, or using any other iPhone features. iPhone is also awake while 
performing background tasks, such as fetching email messages.
Standby—Amount of time iPhone has been powered on since its last full charge,  
including the time iPhone has been asleep.
Current period call time and lifetime call time. 
Amount of data sent and received over the cellular data network. 
192 Chapter 25    Settings

Reset your usage statistics:  Choose General > Usage, then tap Reset Statistics to clear 
the data and cumulative time statistics. The statistics for the amount of time iPhone 
has been unlocked and in standby mode aren’t reset.
Network
7UG0GVYQTMUGVVKPIUVQEQP°IWTGC820XKTVWCNRTKXCVGPGVYQTMEQPPGEVKQPCEEGUU
9K(KUGVVKPIUQTVWTP&CVC4QCOKPIQPQTQÒ
6WTP)QPQTQÒ)5/OQFGNUChoose General > Network, then tap to turn 3G on 
QTQÒ
Using 3G loads Internet data faster in some cases, but may decrease battery 
RGTHQTOCPEG+H[QW¨TGOCMKPICNQVQHRJQPGECNNU[QWOC[YCPVVQVWTP)QÒVQ
extend battery performance.
6WTP%GNNWNCT&CVCQPQTQÒChoose General > Network, then turn Cellular Data on  
QTQÒ
+H%GNNWNCT&CVCKUVWTPGFQÒ[QWYQP¨VDGCDNGVQCEEGUUVJG+PVGTPGVWPNGUU[QWLQKPC
Wi-Fi network. By default, Cellular Data is turned on.
6WTP&CVC4QCOKPIQPQTQÒChoose General > Network, then turn Data Roaming  
QPQTQÒ
Data Roaming turns on Internet and visual voicemail access over a cellular data 
network when you’re in an area not covered by your carrier’s network. For example, 
YJGP[QW¨TGVTCXGNKPI[QWECPVWTPQÒ&CVC4QCOKPIVQCXQKFRQVGPVKCNTQCOKPI
EJCTIGU$[FGHCWNV&CVC4QCOKPIKUVWTPGFQÒ
6WTP2GTUQPCN*QVURQVQPQTQÒChoose General > Network > Personal Hotspot,  
VJGPVWTP2GTUQPCN*QVURQVQPQTQÒ
See “Personal Hotspot” on page 24.
#FFCPGY820EQP°IWTCVKQPChoose General > Network > VPN > Add VPN 
%QP°IWTCVKQP
VPNs used within organizations allow you to communicate private information 
UGEWTGN[QXGTCPQPRTKXCVGPGVYQTM;QWOC[PGGFVQEQP°IWTG820HQTGZCORNG 
to access your work email on iPhone.
iPhone can connect to VPNs that use the L2TP, PPTP, or Cisco IPSec protocols. VPN 
works over both Wi-Fi and cellular data network connections.
Ask your network administrator which settings to use. In most cases, if you’ve set up 
VPN on your computer, you can use the same VPN settings for iPhone.
Once you enter VPN settings, a VPN switch appears in the Settings menu that you can 
WUGVQVWTP820QPQTQÒ
820OC[CNUQDGCWVQOCVKECNN[UGVWRD[CEQP°IWTCVKQPRTQ°NG5GG¥Connecting to 
the Internet” on page 22.
193
Chapter 25    Settings

%JCPIGC820EQP°IWTCVKQPChoose General > Network > VPN and tap the 
EQP°IWTCVKQP[QWYCPVVQWRFCVG
6WTP820QPQTQÒ%JQQUG820VJGPVCRVQVWTP820QPQTQÒ
&GNGVGC820EQP°IWTCVKQPChoose General > Network > VPN, tap the blue 
CTTQYPGZVVQVJGEQP°IWTCVKQPPCOGVJGPVCR&GNGVG820CVVJGDQVVQOQHVJG
EQP°IWTCVKQPUETGGP
Bluetooth
iPhone can connect wirelessly to Bluetooth devices such as headsets, headphones,  
and car kits for music listening and hands-free talking. See “Using a Bluetooth Device 
for Calls” on page 67.
;QWECPCNUQEQPPGEVVJG#RRNG9KTGNGUU-G[DQCTFXKC$NWGVQQVJ5GG¥Using an Apple 
9KTGNGUU-G[DQCTF” on page 40.
6WTP$NWGVQQVJQPQTQÒ%JQQUG)GPGTCN $NWGVQQVJCPFVWTP$NWGVQQVJQPQTQÒ
Location Services
Location services lets apps such as Maps, Camera, Compass, and third-party location-
based apps gather and use data indicating your location. The location data collected 
D[#RRNGKUPQVEQNNGEVGFKPCHQTOVJCVRGTUQPCNN[KFGPVK°GU[QW;QWTCRRTQZKOCVG
location is determined using available information from cellular network data, local  
Wi-Fi networks (if you have Wi-Fi turned on), and GPS (may not be available in all 
locations).
When an app is using location services,   appears in the status bar.
Every app that uses location services appears in the Location Services settings screen, 
UJQYKPIYJGVJGTNQECVKQPUGTXKEGUKUVWTPGFQPQTQÒHQTVJCVCRR  appears for each 
app that has requested your location within the last 24 hours. You can turn location 
UGTXKEGUQÒHQTUQOGQTHQTCNNCRRUKH[QWFQP¨VYCPVVQWUGVJKUHGCVWTG+H[QWVWTP
NQECVKQPUGTXKEGUQÒ[QW¨TGRTQORVGFVQVWTPKVQPCICKPVJGPGZVVKOGCPCRRVTKGUVQ
use this feature.
6WTPNQECVKQPUGTXKEGUQPQTQÒHQTCNNCRRUChoose General > Location Services and 
VWTPNQECVKQPUGTXKEGUQPQTQÒ
6WTPNQECVKQPUGTXKEGUQPQTQÒHQTUQOGCRRU6WTPNQECVKQPUGTXKEGUQPQTQÒHQTVJG
individual apps.
If you have third-party apps on iPhone that use location services, review the third 
party’s terms and privacy policy to understand how that app uses your location data.
6QEQPUGTXGDCVVGT[NKHGVWTPNQECVKQPUGTXKEGUQÒYJGP[QW¨TGPQVWUKPIKV
194 Chapter 25    Settings

Spotlight Search
The Spotlight Search setting lets you specify the content areas searched by Search, 
and rearrange the order of the results.
Set which content areas are searched by Search:
  1  Choose General > Spotlight Search.
  2  Tap an item to select or deselect it.
All search categories are selected by default.
Set the order of search result categories: 
  1  Choose General > Spotlight Search.
  2  Touch   next to an item, then drag up or down.
Auto-Lock
.QEMKPIK2JQPGVWTPUQÒVJGFKURNC[VQUCXG[QWTDCVVGT[CPFVQRTGXGPVWPKPVGPFGF
operation of iPhone. You can still receive calls and text messages, and you can adjust 
the volume and use the mic button on the iPhone earphones when listening to music 
or on a call.
Set the amount of time before iPhone locks:  Choose General > Auto-Lock, then 
choose a time.
Passcode Lock
By default, iPhone doesn’t require you to enter a passcode to unlock it.
Setting a passcode enables data protection. See “Security Features” on page 50.
Important:  On iPhone 3GS, you must also restore iOS software to enable data 
protection. See “Restoring iPhone” on page 257.
Set a passcode:  Choose General > Passcode Lock and enter a 4-digit passcode, then 
enter the passcode again to verify it. iPhone then requires you to enter the passcode 
to unlock it or to display the passcode lock settings.
6WTPRCUUEQFGNQEMQÒChoose General > Passcode Lock, enter your passcode, and 
VCR6WTP2CUUEQFG1ÒVJGPGPVGT[QWTRCUUEQFGCICKP
Change the passcode:  Choose General > Passcode Lock, enter your passcode,  
and tap Change Passcode. Enter your passcode again, then enter and reenter your  
new passcode.
If you forget your passcode, you must restore the iPhone software. See “Updating and 
Restoring iPhone Software” on page 256.
Set how long before your passcode is required:  Choose General > Passcode Lock and 
enter your passcode. Tap Require Passcode, then select how long iPhone can be locked 
before you need to enter a passcode to unlock it.
195
Chapter 25    Settings

6WTP5KORNG2CUUEQFGQPQTQÒChoose General > Passcode Lock, then turn Simple 
2CUUEQFGQPQTQÒ
#UKORNGRCUUEQFGKUCHQWTFKIKVPWODGT6QKPETGCUGUGEWTKV[VWTPQÒ5KORNG2CUUEQFG
and use a longer passcode with a combination of numbers, letters, punctuation, and 
special characters.
6WTP8QKEG&KCNQPQTQÒChoose General > Passcode Lock, then turn Voice Dial on  
QTQÒ
Erase data after ten failed passcode attempts:  Choose General > Passcode Lock, 
enter your passcode, and tap Erase Data to turn it on.
After ten failed passcode attempts, all settings are reset, and all your information and 
media are erased by removing the encryption key to the data (which is encrypted 
using 256-bit AES encryption).
Restrictions
You can set restrictions for the use of some apps and for iPod content on iPhone. For 
GZCORNGRCTGPVUECPTGUVTKEVGZRNKEKVOWUKEHTQODGKPIUGGPQPRNC[NKUVUQTVWTPQÒ
YouTube access entirely.
Turn on restrictions:
  1  Choose General > Restrictions, then tap Enable Restrictions.
  2  Enter a four-digit passcode. 
  3  Reenter the passcode.
6WTPQÒTGUVTKEVKQPUChoose General > Restrictions, then enter the passcode. Tap 
Disable Restrictions, then reenter the passcode.
Important:  If you forget your passcode, you must restore the iPhone software from 
iTunes. See “Updating and Restoring iPhone Software” on page 256.
Set app restrictions:  Set the restrictions you want by tapping individual controls on or 
QÒ$[FGHCWNVCNNEQPVTQNUCTGQPPQVTGUVTKEVGF6CRCPKVGOVQVWTPKVQÒCPFTGUVTKEV
its use.
Safari
Safari is disabled and its icon is removed from the Home screen. You cannot use 
Safari to browse the web or access web clips. Other third-party apps may allow web 
browsing even if Safari is disabled.
YouTube
YouTube is disabled and its icon is removed from the Home screen.
Camera
Camera is disabled and its icon is removed from the Home screen. You cannot  
take photos.
196 Chapter 25    Settings

FaceTime
You cannot make or receive FaceTime video calls (iPhone 4).
iTunes
The iTunes Store is disabled and its icon is removed from the Home screen. You cannot 
preview, purchase, or download content.
Ping
You cannot access Ping or any of its features.
Installing 
Apps
The App Store is disabled and its icon is removed from the Home screen. You cannot 
install apps on iPhone.
Deleting 
Apps
You cannot delete apps from iPhone.   doesn’t appear on app icons when you’re 
customizing the Home screen.
Location
The current Location Services settings and the Find My iPhone setting (in MobileMe 
accounts in ”Mail, Contacts, Calendars”) are locked and cannot be changed.
Accounts
The current Mail, Contacts, Calendar settings are locked and you cannot add, modify, or 
delete accounts.
Restrict purchases within apps:  6WTPQÒ+P#RR2WTEJCUGU9JGPGPCDNGFVJKUHGCVWTG
allows you to purchase additional content or functionality within apps downloaded 
from the App Store.
Set content restrictions:  Tap Ratings For, then select a country from the list. You can 
then set restrictions using that country’s ratings system for the following categories  
of content:
Music & Podcasts 
Movies 
TV Shows 
Apps 
In the United States for example, to allow only movies rated PG or below, tap Movies, 
then select PG from the list. 
Content that you restrict won’t appear on iPhone.
Note:  Not all countries or regions have rating systems.
197
Chapter 25    Settings

Restrict multiplayer games:  6WTPQÒ/WNVKRNC[GT)COGU
9JGP/WNVKRNC[GT)COGUKUVWTPGFQÒ[QWECP¨VTGSWGUVCOCVEJUGPFQTTGEGKXG
invitations to play games, or add friends in Game Center.
Restrict adding friends:  6WTPQÒ#FFKPI(TKGPFU
9JGP#FFKPI(TKGPFUKUQÒ[QWECP¨VOCMGQTTGEGKXGHTKGPFTGSWGUVUKP)COG%GPVGT
If Multiplayer Games is turned on, you can continue to play with existing friends.
Date and Time
These settings apply to the time shown in the status bar at the top of the screen, and 
in world clocks and calendars.
Set whether iPhone shows 24-hour time or 12-hour time:  Choose General > Date 
6KOGVJGPVWTP*QWT6KOGQPQTQÒ*QWT6KOGOC[PQVDGCXCKNCDNGKPCNN
countries or regions.)
Set whether iPhone updates the date and time automatically:  Choose General > 
&CVG6KOGVJGPVWTP5GV#WVQOCVKECNN[QPQTQÒ
If iPhone is set to update the time automatically, it gets the correct time over the 
cellular network and updates it for the time zone you’re in.
Some carriers don’t support network time in all locations. If you’re traveling, iPhone 
may not be able to automatically set the local time.
Set the date and time manually:  Choose General > Date & Time, then turn Set 
#WVQOCVKECNN[QÒ6CR6KOG<QPGCPFGPVGTVJGPCOGQHCOCLQTEKV[KP[QWTVKOG\QPG
Tap the “Date & Time” button, then tap “Set Date & Time” and enter the date and time.
Keyboard
6WTPCWVQECRKVCNK\CVKQPQPQTQÒ%JQQUG)GPGTCN -G[DQCTFCPFVWTP#WVQ
%CRKVCNK\CVKQPQPQTQÒ
By default, iPhone capitalizes words after you type sentence-ending punctuation or a 
return character.
6WTPCWVQEQTTGEVKQPQPQTQÒ%JQQUG)GPGTCN -G[DQCTFCPFVWTP#WVQ%QTTGEVKQP
QPQTQÒ
Normally, if the default keyboard for the language you select has a dictionary, iPhone 
suggests corrections or completed words as you type.
6WTPURGNNEJGEMKPIQPQTQÒ%JQQUG)GPGTCN -G[DQCTFCPFVWTP%JGEM5RGNNKPIQP
QTQÒ
Spell checking underlines misspelled words in text you type. Tap the underlined word 
to see suggested corrections. Spell checking is on by default.
Set whether caps lock is enabled:  %JQQUG)GPGTCN -G[DQCTFCPFVWTP'PCDNG%CRU
.QEMQPQTQÒ
If caps lock is enabled and you double-tap the Shift   key on the keyboard, all letters 
you type are uppercase. The Shift key turns blue when caps lock is on.
198 Chapter 25    Settings

6WTPVJG¥¦UJQTVEWVQPQTQÒ%JQQUG)GPGTCN -G[DQCTFCPFVWTP¥¦5JQTVEWVQP 
QTQÒ
The “.” shortcut lets you double-tap the space bar to enter a period followed by a space 
when you’re typing. It’s on by default.
Add international keyboards:
  1 %JQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFU
The number of active keyboards appears before the right arrow.
  2 6CR¥#FF0GY-G[DQCTF¦VJGPEJQQUGCMG[DQCTF
You can add as many keyboards as you want. To learn about using international 
keyboards, see Appendix A, “+PVGTPCVKQPCN-G[DQCTFU,” on page 248.
Edit your keyboard list:  %JQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFUVJGP
tap Edit and do one of the following:
 To delete a keyboard, tap  , then tap Delete.
 To reorder the list, drag   next to a keyboard to a new place in the list.
Change a keyboard’s layout:  +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN
-G[DQCTFUCPFUGNGEVCMG[DQCTF;QWECPOCMGUGRCTCVGUGNGEVKQPUHQTDQVJVJGQP
screen software and external hardware keyboards for each language.
The software keyboard layout determines the layout of the keyboard that appears on 
the iPhone screen. The hardware keyboard layout determines the layout of an Apple 
9KTGNGUU-G[DQCTFEQPPGEVGFVQK2JQPG
The Edit User Dictionary setting appears when you have any of the following 
keyboards turned on:
%JKPGUG5KORNK°GF2KP[KP 
Chinese - Traditional (Pinyin) 
Chinese - Traditional (Zhuyin) 
Japanese (Romaji) 
,CRCPGUG6GP-G[ 
Add a word to the dictionary:  +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF 'FKV7UGT
&KEVKQPCT[6CRVCRVJG9QTF°GNFCPFGPVGTVJGYQTFVJGPVCRVJG;QOK2KP[KP 
QT<JW[KP°GNFCPFGPVGTVJGKPRWV
You can have multiple inputs for each word, depending on the keyboards that are 
turned on.
See Appendix A, “+PVGTPCVKQPCN-G[DQCTFU,” on page 248.
199
Chapter 25    Settings

International
7UG+PVGTPCVKQPCNUGVVKPIUVQUGVVJGNCPIWCIGHQTK2JQPGVWTPMG[DQCTFUHQTFKÒGTGPV
NCPIWCIGUQPQTQÒCPFUGVVJGFCVGVKOGCPFVGNGRJQPGPWODGTHQTOCVUHQT[QWT
country or region.
Set the language for iPhone:  Choose General > International > Language, choose the 
language you want to use, then tap Done.
Set the Voice Control language for iPhone:  Choose General > International > Voice 
Control, then choose a language.
Add international keyboards:
  1 %JQQUG)GPGTCN +PVGTPCVKQPCN -G[DQCTFU
The number of active keyboards appears next to the right arrow.
  2 6CR¥#FF0GY-G[DQCTF¦VJGPEJQQUGCMG[DQCTF
You can add as many keyboards as you want. To learn about using international 
keyboards, see Appendix A, “+PVGTPCVKQPCN-G[DQCTFU,” on page 248.
Edit your keyboard list:  %JQQUG)GPGTCN +PVGTPCVKQPCN -G[DQCTFUVJGPVCR'FKV
and do one of the following:
 To delete a keyboard, tap  , then tap Delete.
 To reorder the list, drag   next to a keyboard to a new place in the list.
Change a keyboard layout:  +P5GVVKPIUEJQQUG)GPGTCN +PVGTPCVKQPCN -G[DQCTFU
and select a keyboard. You can make separate selections for both the on-screen 
software and external hardware keyboards for each language.
The software keyboard layout determines the layout of the keyboard that appears on 
the iPhone screen. The hardware keyboard layout determines the virtual layout of an 
#RRNG9KTGNGUU-G[DQCTFEQPPGEVGFVQK2JQPG
Set the date, time, and telephone number formats:  Choose General > International > 
Region Format, and choose your region.
The Region Format also determines the language used for the days and months that 
appear in native iPhone apps.
Set the calendar format:  Choose General > International > Calendar, and choose  
the format.
Accessibility
To turn on accessibility features, choose Accessibility and choose the features you 
want. See Chapter 29, “Accessibility,” on page 229.
200 Chapter 25    Settings

2TQ°NGU
6JKUUGVVKPICRRGCTUKH[QWKPUVCNNQPGQTOQTGRTQ°NGUQPK2JQPG6CR2TQ°NGUVQUGG
KPHQTOCVKQPCDQWVVJGRTQ°NGU[QW¨XGKPUVCNNGF
Resetting iPhone
Reset all settings:  Choose General > Reset and tap Reset All Settings.
All your preferences and settings are reset. Information (such as contacts and 
ECNGPFCTUCPFOGFKCUWEJCUUQPIUCPFXKFGQUCTGP¨VCÒGEVGF
Erase all content and settings:  Connect iPhone to your computer or a power adapter. 
Choose General > Reset and tap “Erase All Content and Settings.”
This resets all settings, and erases all your information and media by removing the 
encryption key to the data (which is encrypted using 256-bit AES encryption).
Reset network settings:  Choose General > Reset and tap Reset Network Settings.
When you reset network settings, your list of previously used networks and VPN 
UGVVKPIUPQVKPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGCTGTGOQXGF9K(KKUVWTPGFQÒCPF
then back on, disconnecting you from any network you’re on. The Wi-Fi and “Ask to 
Join Networks” settings are left turned on.
6QTGOQXG820UGVVKPIUKPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGEJQQUG5GVVKPIU  
)GPGTCN 2TQ°NGVJGPUGNGEVVJGRTQ°NGCPFVCR4GOQXG
Reset the keyboard dictionary:  %JQQUG)GPGTCN 4GUGVCPFVCR4GUGV-G[DQCTF
Dictionary.
You add words to the keyboard dictionary by rejecting words iPhone suggests as you 
type. Tap a word to reject the correction and add the word to the keyboard dictionary. 
Resetting the keyboard dictionary erases all words you’ve added.
Reset the Home screen layout:  Choose General > Reset and tap Reset Home Screen 
Layout.
Reset location warnings:  Choose General > Reset and tap Reset Location Warnings.
Location warnings are requests made by apps (such as Camera, Compass, and Maps) 
VQWUGNQECVKQPUGTXKEGUK2JQPGRTGUGPVUCNQECVKQPYCTPKPIHQTCPCRRVJG°TUVVKOG
the app makes a request to use location services. If you tap Cancel in response to the 
request, the request isn’t presented again. To reset the location warnings so that you 
get a request for each app again, tap Reset Location Warnings.
201
Chapter 25    Settings

Mail, Contacts, Calendars
7UG/CKN%QPVCEVU%CNGPFCTUUGVVKPIUVQUGVWRCEEQWPVUCPFVWTPQPURGEK°ECEEQWPV
services (such as mail, contacts, calendars, bookmarks, and notes) for iPhone: 
Microsoft Exchange (mail, contacts, and calendars) 
MobileMe (mail, contacts, calendars, bookmarks, notes, and Find My iPhone) 
Google (mail, calendars, and notes) 
Yahoo! (mail, calendars, and notes) 
AOL (mail and notes) 
Other POP and IMAP mail systems 
LDAP or CardDAV accounts for Contacts 
CalDAV or iCalendar (.ics) accounts for Calendars 
Accounts
6JG#EEQWPVUUGEVKQPNGVU[QWUGVWRCEEQWPVUQPK2JQPG6JGURGEK°EUGVVKPIUVJCV
appear depend on the type of account you’re setting up. Your service provider or 
system administrator should be able to provide the information you need to enter.
For more information, see: 
“ Adding Mail, Contacts, and Calendar Accounts” on page 25
“ Adding Contacts” on page 213
“ Subscribing to Calendars” on page 116
Change an account’s settings:  Choose “Mail, Contacts, Calendars,” choose an account, 
then make the changes you want.
Changes you make to an account’s settings on iPhone aren’t synced to your computer, 
UQ[QWECPEQP°IWTG[QWTCEEQWPVUVQYQTMYKVJK2JQPGYKVJQWVCÒGEVKPIVJGCEEQWPV
settings on your computer.
Stop using an account service:  Choose “Mail, Contacts, Calendars,” choose an account, 
VJGPVWTPCPCEEQWPVUGTXKEGUWEJCU/CKN%CNGPFCTUQT0QVGUQÒ
+HCPCEEQWPVUGTXKEGKUQÒK2JQPGFQGUP¨VFKURNC[QTU[PEKPHQTOCVKQPYKVJVJCV
account service until you turn it back on.
Adjust advanced settings:  Choose “Mail, Contacts, Calendars,” choose an account, 
then do one of the following:
 To set whether drafts, sent messages, and deleted messages are stored on iPhone or 
TGOQVGN[QP[QWTGOCKNUGTXGT+/#2CEEQWPVUQPN[tap Advanced and choose Drafts 
Mailbox, Sent Mailbox, or Deleted Mailbox.
If you store messages on iPhone, you can see them even when iPhone isn’t 
connected to the Internet.
202 Chapter 25    Settings

 To set how long before messages are removed permanently from Mail on iPhone, tap 
Advanced and tap Remove, then choose a time: Never, or after one day, one week,  
or one month.
 To adjust email server settings, tap Host Name, User Name, or Password under 
Incoming Mail Server or Outgoing Mail Server. Ask your network administrator or 
Internet service provider for the correct settings.
 To adjust SSL and password settings, tap Advanced. Ask your network administrator or 
Internet service provider for the correct settings.
Delete an account from iPhone:  Choose “Mail, Contacts, Calendars,” choose an 
account, then scroll down and tap Delete Account.
Deleting an account means you can no longer access the account with your iPhone. 
All email and the contacts, calendar, and bookmark information synced with the 
account are removed from iPhone. However, deleting an account doesn’t remove the 
account or its associated information from your computer.
Fetch New Data
6JKUUGVVKPINGVU[QWVWTP2WUJQPQTQÒHQT/QDKNG/G/KETQUQHV'ZEJCPIG;CJQQ 
and any other push accounts on iPhone. Push accounts deliver new information to 
iPhone whenever new information appears on the server (some delays may occur). 
;QWOKIJVYCPVVQVWTP2WUJQÒVQUWURGPFFGNKXGT[QHGOCKNCPFQVJGTKPHQTOCVKQP 
or to conserve battery life.
9JGP2WUJKUQÒCPFYKVJCEEQWPVUVJCVFQP¨VUWRRQTVRWUJFCVCECPUVKNNDG
fetched—that is, iPhone can check with the server and see if new information is 
available. Use the Fetch New Data setting to determine how often data is requested. 
For optimal battery life, don’t fetch too often. 
Turn Push on:  Choose “Mail, Contacts, Calendars” > Fetch New Data, then tap to turn 
Push on.
Set the interval to fetch data:  Choose “Mail, Contacts, Calendars” > Fetch New Data, 
then choose how often you want to fetch data for all accounts.
To conserve battery life, fetch less frequently.
Setting Push to OFF (or setting Fetch to Manually on the Fetch New Data screen) 
overrides individual account settings.
203
Chapter 25    Settings

Mail
Mail settings, except where noted, apply to all accounts you’ve set up on iPhone.
6QVWTPCNGTVUUQWPFUHQTPGYQTUGPVOCKNQPQTQÒWUGVJG5QWPFUUGVVKPIU
Set the number of messages shown on iPhone:  Choose “Mail, Contacts, Calendars” > 
Show, then choose a setting.
Choose to see the most recent 25, 50, 75, 100, or 200 messages. To download additional 
messages when you’re in Mail, scroll to the bottom of your inbox and tap Load More 
Messages.
Note:  For Microsoft Exchange accounts, choose “Mail, Contacts, Calendars” and choose 
the Exchange account. Tap “Mail days to sync” and choose the number of days of mail 
you want to sync with the server.
Set how many lines of each message are shown in the message list:  Choose “Mail, 
Contacts, Calendars” > Preview, then choose a setting.
;QWECPEJQQUGVQUGGWRVQ°XGNKPGUQHGCEJOGUUCIG6JCVYC[[QWECPUECPCNKUVQH
messages in a mailbox and get an idea of what each message is about.
Set a minimum font size for messages:  Choose “Mail, Contacts, Calendars” > Minimum 
Font Size, then choose Small, Medium, Large, Extra Large, or Giant.
Set whether iPhone shows To and Cc labels in message lists:  Choose “Mail, Contacts, 
%CNGPFCTU¦VJGPVWTP5JQY6Q%E.CDGNQPQTQÒ
If Show To/Cc Label is on,   or   next to each message in a list shows whether you 
were sent the message directly, or as a copy.
5GVYJGVJGTK2JQPGEQP°TOUVJCV[QWYCPVVQFGNGVGCOGUUCIGChoose “Mail, 
%QPVCEVU%CNGPFCTU¦CPFKPVJG/CKNUGVVKPIUVWTP#UM$GHQTG&GNGVKPIQPQTQÒ
Set whether iPhone automatically loads remote images:  Choose “Mail, Contacts, 
%CNGPFCTU¦VJGPVWTP.QCF4GOQVG+OCIGUQPQTQÒ
Set whether mail messages are organized by thread:  Choose “Mail, Contacts, 
%CNGPFCTU¦VJGPVWTP1TICPK\G$[6JTGCFQPQTQÒ
Set whether iPhone sends you a copy of every message you send:  Choose “Mail, 
%QPVCEVU%CNGPFCTU¦VJGPVWTP#NYC[U$EE/[UGNHQPQTQÒ
Add a signature to your messages:  Choose “Mail, Contacts, Calendars” > Signature, 
then type a signature.
You can set iPhone to add a signature—your favorite quote, or your name, title, and 
phone number, for example—to the bottom of every message you send.
Set the default email account:  Choose “Mail, Contacts, Calendars” > Default Account, 
then choose an account.
This setting determines which of your accounts an email message is sent from when 
you create a message from another iPhone app—for example, when you send a photo 
from Photos or tap the email address of a business in Maps. To send the message from 
CFKÒGTGPVCEEQWPVVCRVJG(TQO°GNFKPVJGOGUUCIGCPFEJQQUGCPQVJGTCEEQWPV
204 Chapter 25    Settings

Contacts
Set how contacts are sorted:  Choose “Mail Contacts, Calendars,” then under Contacts 
tap Sort Order and do one of the following:
 6QUQTVD[°TUVPCOG°TUVtap First, Last.
 6QUQTVD[NCUVPCOG°TUVtap Last, First.
Set how contacts are displayed:  Choose “Mail Contacts, Calendars,” then under 
Contacts tap Display Order and do one of the following:
 6QUJQY°TUVPCOG°TUVtap First, Last.
 6QUJQYNCUVPCOG°TUVtap Last, First.
Import contacts from a SIM card (GSM models):  Choose “Mail, Contacts, Calendars,” 
then tap Import SIM Contacts.
The contact information on the SIM card is imported to iPhone. If Contacts is enabled 
for MobileMe, Microsoft Exchange, or a CardDAV account, you’re asked to choose 
which account you want to add the SIM contacts to.
Calendars
Set alerts to sound when you receive a meeting invitation:  Choose “Mail, Contacts, 
Calendars,” and under Calendar, tap “New Invitation Alerts” to turn it on.
Set how far back in the past to show your calendar events on iPhone:  Choose “Mail, 
Contacts, Calendars” > Sync, then choose a period of time.
Turn on Calendar time zone support:  Choose “Mail, Contacts, Calendars” > Time Zone 
Support, then turn Time Zone Support on. Select a time zone for calendars by tapping 
Time Zone and entering the name of a major city.
When Time Zone Support is on, Calendar displays event dates and times in the time 
\QPGQHVJGEKV[[QWUGNGEVGF9JGP6KOG<QPG5WRRQTVKUQÒ%CNGPFCTFKURNC[UGXGPVU
in the time zone of your current location as determined by the network time.
Set a default calendar:  Choose “Mail, Contacts, Calendars,” and under Calendar, tap 
Default Calendar to choose the default calendar for new events. This setting appears 
when more than one calendar is synced to iPhone.
Important:  Some carriers don’t support network time in all locations. If you’re traveling, 
iPhone may not display events or sound alerts at the correct local time. To manually 
set the correct time, see “Date and Time” on page 198.
Notes
The Default Account setting appears when you set up more than one account that 
syncs notes.
Set which account a new note is assigned to:  Choose “Mail, Contacts, Calendars,” and 
under Notes, tap Default Account and choose an account.
205
Chapter 25    Settings

Phone
7UG2JQPGUGVVKPIUVQHQTYCTFKPEQOKPIECNNUVWTPECNNYCKVKPIQPQTQÒEJCPIG[QWT
password, and other things. Some settings are available only on GSM models, as noted. 
Additional fees may apply. Contact your carrier for pricing and availability.
FaceTime
Activate or deactivate FaceTime (iPhone 4):  6WTP(CEG6KOGQPQTQÒ+H(CEG6KOGKUQP
your phone number will be shared with people you call.
Call Forwarding
Forward your calls (GSM models):
  1  Choose Phone > Call Forwarding and turn Call Forwarding on.
  2  On the “Forward to” screen, enter the phone number you want calls forwarded to.
For more information about call forwarding, including how to forward calls on a CDMA 
model, see “Call Forwarding” on page 70.
Call Waiting
Activate or deactivate call waiting (GSM models):  Choose Phone > Call Waiting, then 
VWTP%CNN9CKVKPIQPQTQÒ
For more information about call waiting, including how to activate or deactivate call 
waiting on a CDMA model, see “Call Waiting” on page 71.
Show My Caller ID
Show or hide your caller ID (GSM models):  Choose Phone > Show My Caller ID, then 
VWTP5JQY/[%CNNGT+&QPQTQÒ
For more information about caller ID, including how to show or hide your caller ID on a 
CDMA model, see “Caller ID” on page 71.
Using iPhone with a Teletype (TTY) Machine
In some countries or regions, Teletype (TTY) machines are used by deaf or hearing-
impaired people to communicate by typing and reading text. You can use iPhone 
with a TTY machine if you have the iPhone TTY Adapter cable, available for purchase 
separately in many countries. Go to www.apple.com/store (may not be available in all 
countries or regions) or check with your local Apple retailer.
Connect iPhone to a TTY machine:  Choose Phone, then turn TTY on. Then connect 
iPhone to your TTY machine using the iPhone TTY Adapter.
For information about using a TTY machine, see the documentation that came with 
the machine.
For information about other accessibility features of iPhone, see Chapter 29, 
“Accessibility,” on page 229.
206 Chapter 25    Settings

Calling from Abroad
5GVK2JQPGVQCFFVJGEQTTGEVRTG°ZYJGPFKCNKPIHTQOCPQVJGTEQWPVT[In Settings, 
tap Phone, then turn International Assist on. This lets you make calls to your home 
country using the numbers in your contacts and favorites lists, without having to add a 
RTG°ZQT[QWTEQWPVT[EQFG+PVGTPCVKQPCN#UUKUVYQTMUHQT75VGNGRJQPGPWODGTUQPN[
For more information, see “Using iPhone Abroad” on page 73.
Changing Your Voicemail Password
A voicemail password helps prevent others from access your voicemail. You need to 
enter the password only when you’re calling in to get your messages from another 
phone. You won’t need to enter the password when using voicemail on iPhone.
Change your voicemail password:  Choose Phone > Change Voicemail Password.
Locking Your SIM Card
You can lock your SIM card (GSM models) so it can’t be used without a Personal 
+FGPVK°ECVKQP0WODGT2+0;QWOWUVGPVGTVJG2+0GCEJVKOG[QWVWTPK2JQPGQÒCPF
turn it back on again. Some carriers require a SIM PIN in order to use iPhone.
Important:  If you enter the PIN incorrectly three times, you may need to enter a 
2GTUQPCN7PNQEMKPI-G[27-VQGPCDNG[QWT5+/ECTFCICKP4GHGTVQVJG5+/ECTF
documentation or contact your carrier. Some cellular networks may not accept an 
emergency call from iPhone if the SIM card is locked.
6WTPVJG5+/2+0QPQTQÒ
  1 %JQQUG2JQPG 5+/2+0VJGPVWTP5+/2+0QPQTQÒ
  2 'PVGT[QWT2+0VQEQP°TO7UGVJG2+0CUUKIPGFD[[QWTECTTKGTQT[QWTECTTKGT¨U 
default PIN.
Change the PIN for your SIM card:
  1  Choose Phone > SIM PIN.
  2  Turn SIM PIN on, then tap Change PIN.
  3  Enter your current PIN, then enter your new PIN.
  4 'PVGT[QWTPGY2+0CICKPVQEQP°TOVJGPVCR&QPG
Accessing Your Carrier’s Services
Depending on your carrier, you may be able to access some of your carrier’s services 
directly from iPhone. For example, you may be able to check your bill balance, call 
directory assistance, or view how many minutes you have left.
Access your carrier’s services:  Choose Phone. Then scroll down and tap the button for 
your carrier’s services.
When you request information such as your bill balance, your carrier may provide the 
KPHQTOCVKQPKPCVGZVOGUUCIG%QPVCEV[QWTECTTKGTVQ°PFQWVKHVJGTGCTGCP[EJCTIGU
for these services.
207
Chapter 25    Settings

Safari
Safari settings let you select your Internet search engine, set security options, and for 
developers, turn on debugging.
General
Select a search engine:  Choose Safari > Search Engine and select the search engine 
you want to use.
;QWECPUGV5CHCTKVQCWVQOCVKECNN[°NNQWVYGDHQTOUWUKPIEQPVCEVKPHQTOCVKQPPCOGU
and passwords you previously entered, or both.
Enable AutoFill:  Choose Safari > AutoFill, then do one of the following:
 To use information from contacts, turn Use Contact Info on, then choose My Info and 
select the contact you want to use.
5CHCTKWUGUKPHQTOCVKQPHTQO%QPVCEVUVQ°NNKPEQPVCEV°GNFUQPYGDHQTOU
 To use information from names and passwords, turn Names & Passwords on.
When this feature is on, Safari remembers names and passwords of websites you 
XKUKVCPFCWVQOCVKECNN[°NNUKPVJGKPHQTOCVKQPYJGP[QWTGXKUKVVJGYGDUKVG
 To remove all AutoFill information, tap Clear All.
Security
By default, Safari is set to show features of the web, such as some movies, animation, 
and web apps. You may wish to change security settings to help protect iPhone from 
possible security risks on the Internet.
Change security settings:  Choose Safari, then do one of the following:
 To be warned when visiting potentially fraudulent websites, turn Fraud Warning on.
Fraud warning protects you from potentially fraudulent Internet sites. When you visit 
a suspicious site, Safari warns you about its suspect nature and doesn’t load the page.
 To enable or disable JavaScript, VWTP,CXC5ETKRVQPQTQÒ
JavaScript lets web programmers control elements of the page—for example, a 
page that uses JavaScript might display the current date and time or cause a linked 
page to appear in a pop-up.
 To block or allow pop-ups, VWTP$NQEM2QRWRUQPQTQÒ$NQEMKPIRQRWRUUVQRUQPN[
pop-ups that appear when you close a page or open a page by typing its address. It 
doesn’t block pop-ups that open when you tap a link.
 To set whether Safari accepts cookies, tap Accept Cookies and choose Never, “From 
visited,” or Always.
A cookie is a piece of information that a website puts on iPhone so the website can 
remember you when you visit again. That way, webpages can be customized for you 
based on information you may have provided.
Some pages won’t work correctly unless iPhone is set to accept cookies.
208 Chapter 25    Settings

 To clear a database, tap Databases, then tap Edit. Tap   next to a database, then  
tap Delete.
Some web apps use databases to store app information on iPhone.
 To clear the history of webpages you’ve visited, tap Clear History.
 To clear all cookies from Safari, tap Clear Cookies.
 To clear the browser cache, tap Clear Cache.
The browser cache stores the content of pages so the pages open faster the next 
time you visit them. If a page you open doesn’t show new content, clearing the 
cache may help.
Developer
The debug console can help you resolve webpage errors. If it’s turned on, the console 
appears when a webpage error occurs.
6WTPVJGFGDWIEQPUQNGQPQTQÒChoose Safari > Developer, and turn Debug 
%QPUQNGQPQTQÒ
Messages
Use Messages settings to adjust settings for SMS and MMS messages. 
Note:  The MMS Messaging and Show Subject Field settings don’t appear if MMS isn’t 
supported by your carrier.
Choose whether or not to see a preview of messages on the Home screen:  Choose 
/GUUCIGUCPFVWTP5JQY2TGXKGYQPQTQÒ
Set how many times to play the message alert (iOS 4.3):  Choose Messages, then tap 
Play Alert Tone and set the number of times the alert appears if you don’t respond.
6WTP//5OGUUCIKPIQPQTQÒChoose Messages and turn MMS Messaging on or 
QÒ+H//5OGUUCIKPIKUQÒ[QWYQP¨VDGCDNGVQTGEGKXG//5°NGCVVCEJOGPVUUWEJCU
images or audio.
6WTP)TQWR/GUUCIKPIQPQTQÒChoose Messages and turn Group Messaging on or 
QÒ)TQWROGUUCIKPIOC[PQVDGCXCKNCDNGKPCNNEQWPVTKGUQTTGIKQPU
Show a subject line for messages you send or receive:  Choose Messages and turn 
Show Subject Field on.
Show a character count for messages you send or receive:  Choose Messages and 
turn Character Count on. The character count includes all characters—including 
spaces, punctuation, and returns—and appears as you type when your message 
exceeds two lines.
209
Chapter 25    Settings

iPod
Use iPod Settings to adjust settings for music and video playback on your iPod.
Music
Music settings apply to songs, podcasts, and audiobooks.
6WTP5JCMGVQ5JWÔGQPQTQÒ%JQQUGK2QFVJGPVWTP5JCMGVQ5JWÔGQPQTQÒ
9JGP5JCMGVQ5JWÔGKUQP[QWECPUJCMGK2JQPGVQUJWÔGCPFKOOGFKCVGN[EJCPIG
the currently playing song.
Set iTunes to play songs at the same sound level:  In iTunes, choose iTunes > 
Preferences if you’re using a Mac, or Edit > Preferences if you’re using a PC. Then click 
Playback and select Sound Check.
Set iPhone to use the iTunes volume settings (Sound Check):  Choose iPod and turn 
Sound Check on.
Use the equalizer to customize the sound on iPhone:  Choose iPod > EQ and choose 
a setting.
Set a volume limit for music and videos:  Choose iPod > Volume Limit and drag the 
slider to adjust the maximum volume.
Tap Lock Volume Limit to assign a code to prevent the setting from being changed.
Setting a volume limit only limits the volume for music (including podcasts and 
audiobooks) and videos (including rented movies and TV shows), and only when 
headphones, earphones, or speakers are connected to the headset jack on iPhone.
WARNING:  For important information about avoiding hearing loss, see the Important 
Product Information Guide at www.apple.com/support/manuals/iphone.
Show song lyrics and podcast information:  Choose iPod and turn Lyrics & Podcast 
Info on.
Video
Video settings apply to video content, including rented movies and TV shows. You can 
set where to resume playing videos that you previously started, turn closed captioning 
QPQTQÒCPFUGVWRK2JQPGVQRNC[XKFGQUQP[QWT68
Set where to resume playing videos:  Choose iPod > Start Playing, then select 
whether you want videos that you previously started watching to resume playing from 
VJGDGIKPPKPIQTYJGTG[QWNGHVQÒ
6WTPENQUGFECRVKQPKPIQPQTQÒ%JQQUGK2QFCPFVWTP%NQUGF%CRVKQPKPIQPQTQÒ
Note:  Not all video content is encoded for closed captioning.
210 Chapter 25    Settings

TV Out
Use these settings to control how iPhone plays videos on your TV.
6WTPYKFGUETGGPQPQTQÒ%JQQUGK2QFCPFVWTP9KFGUETGGPQPQTQÒ
Set TV signal to NTSC or PAL:  Choose iPod > TV Signal and select NTSC or PAL.
NTSC and PAL are TV broadcast standards. iPhone displays NTSC 480p/PAL 576p 
when attached to a TV using a Component AV Cable, or NTSC 480i/PAL 576i using a 
Composite AV Cable. Your TV might use NTSC or PAL, depending on where you bought 
it. If you’re not sure which to use, check the documentation that came with your TV.
For more information about using iPhone to play videos on your TV, see “Watching 
Videos on a TV” on page 102.
Photos
Slideshow
Use the Slideshow settings to specify how slideshows display your photos.
Set the length of time each slide is shown:  Choose Photos > Play Each Slide For and 
select the length of time.
5GVCVTCPUKVKQPGÒGEV%JQQUG2JQVQU 6TCPUKVKQPCPFUGNGEVCVTCPUKVKQPGÒGEV
Set whether to repeat slideshows:  %JQQUG2JQVQUCPFVWTP4GRGCVQPQTQÒ
Set photos to appear randomly or in order:  %JQQUG2JQVQUCPFVWTP5JWÔGQPQTQÒ
HDR
The HDR setting on iPhone 4 lets you choose whether to save the normal-exposure 
photo in addition to the HDR version of a photo when HDR is turned on. See “Taking 
Photos and Recording Videos” on page 126.
Choose whether to save both the normal-exposure version and the HDR version of 
photos (iPhone 4):  +P5GVVKPIUEJQQUG2JQVQUVJGPVWTP-GGR0QTOCN2JQVQQPQTQÒ
+HVJGUGVVKPIKUQÒQPN[VJG*&4XGTUKQPQHCRJQVQKUUCXGF
If you save both versions,   appears in the upper-left corner of the HDR photo 
when the controls are visible.
Notes
Use Notes settings to change the font used to display your notes, and to set the 
default account for notes you add on iPhone.
Change the font:  Choose Notes, then select the font you want to use.
Set the default account for new notes:  Choose Notes and tap Default Account. Then 
select an account, or tap On My iPhone if you don’t want notes you add on iPhone to 
be synced with an account.
211
Chapter 25    Settings

Store
Use Store settings to sign in to an Apple account, create a new Apple account, or edit 
an existing one. If you have more than one Apple account, you can use Store settings 
to sign out from one and in to another. 
By default, the Apple account that appears in Store settings is the one you’re signed in 
to when you sync iPhone with your computer. 
Sign in to an Apple account:  Choose Store, tap Sign In, then tap Use Existing Apple ID 
and enter your Apple ID and password.
View and edit your account information:  Choose Store, tap your Apple ID, then 
tap View Apple ID. Tap an item to edit it. To change your account password, tap the 
#RRNG+&°GNF
5KIPKPWUKPICFKÒGTGPV#RRNG+&Choose Store, tap Sign Out, then tap Sign In.
Create a new Apple ID:  Choose Store, tap Sign In, then tap Create New Apple ID and 
follow the onscreen instructions.
Nike + iPod
Use Nike + iPod settings to activate and customize the Nike + iPod app. See 
Chapter 27, “Nike + iPod,” on page 219.
212 Chapter 25    Settings

Contacts 26
About Contacts
Contacts makes it easy to call, email, or text your friends and associates. You can add 
contacts directly on iPhone, or sync contacts from applications on your computer. 
If you have a MobileMe or Microsoft Exchange account with Contacts enabled, or 
a supported CardDAV account, you can sync your contacts over the air without 
connecting iPhone to your computer.
You can open Contacts from the Home screen, or from the Phone app.
Adding Contacts
You can add contacts to iPhone in the following ways:
In iTunes, sync contacts from Google or Yahoo!, or sync with applications on your  
computer (see “iPhone Settings Panes in iTunes” on page 54)
Set up a MobileMe or Microsoft Exchange account on iPhone, with Contacts  
enabled (see “Setting Up MobileMe Accounts” on page 26 or “Setting Up Microsoft 
Exchange Accounts” on page 27)
+PUVCNNCRTQ°NGVJCVUGVUWRCP'ZEJCPIGCEEQWPVYKVJ%QPVCEVUGPCDNGFIQVQ 
www.apple.com/iphone/business)
Set up an LDAP or CardDAV account on iPhone 
Enter contacts directly on iPhone 
Import contacts from a SIM card (GSM models) 
The number of contacts you can add is limited only by the amount of memory  
on iPhone.
213

Set up an LDAP or CardDAV account:
  1  In Settings, tap “Mail Contacts, Calendars,” then tap Add Account.
  2  Tap Other, then tap Add LDAP Account or Add CardDAV Account.
  3  Enter your account information and tap Next to verify the account.
  4  Tap Save.
When you set up an LDAP account, you can view and search for contacts on your 
company or organization’s LDAP server. The server appears as a new group in Contacts. 
Since LDAP contacts aren’t downloaded to iPhone, you must have an Internet 
EQPPGEVKQPVQXKGYVJGO%JGEMYKVJ[QWTU[UVGOCFOKPKUVTCVQTHQTURGEK°ECEEQWPV
settings and other requirements (such as VPN).
When you set up a CardDAV account, your account contacts are synced with iPhone 
over the air. If it’s supported, you can also search for contacts on your company or 
organization’s CardDAV server.
Import contacts from another phone’s SIM card (GSM models only):  In Settings, tap 
“Mail, Contacts, Calendars,” then tap Import SIM Contacts.
The contact information on the SIM card is imported to iPhone. If you have Contacts 
enabled for both MobileMe and Microsoft Exchange, you’re asked to choose which 
account you want to add the SIM contacts to.
Important:  iPhone doesn’t store contacts on its SIM card.
Searching Contacts
;QWECPUGCTEJ°TUVNCUVCPFEQORCP[PCOGUKP[QWTEQPVCEVUQPK2JQPG+H[QWJCXG
a Microsoft Exchange account set up on iPhone, you may also be able to search your 
enterprise Global Address List (GAL) for contacts in your organization. If you have 
an LDAP account on iPhone, you can search contacts on your organization’s LDAP 
server. If you have a CardDAV account, you can search contacts synced to iPhone, or 
searchable contacts on a supported CardDAV server. 
;QWECPUGCTEJVJG°TUVNCUVCPFEQORCP[PCOG°GNFU#U[QWV[RGKPVJGUGCTEJ°GNF
contacts with matching information appear immediately.
Search contacts:  +P%QPVCEVUVCRVJGUGCTEJ°GNFCVVJGVQRQHCP[NKUVQHEQPVCEVU 
and enter your search. (To scroll quickly to the top of the list, tap the status bar.)
Search a GAL:  Tap Groups, tap Directories at the bottom of the list, then enter  
your search.
You can’t edit GAL contacts or save them to iPhone.
Search an LDAP server:  Tap Groups, tap the LDAP server name, then enter your search.
You can’t edit LDAP contacts or save them to iPhone.
214 Chapter 26    Contacts

Search a CardDAV server:  Tap Groups, tap the searchable CardDAV group at the 
bottom of the list, then enter your search.
You can’t edit searchable CardDAV contacts from the server, but you can edit synced 
CardDAV contacts on iPhone.
Contacts are included in searches from the Home screen. See “Searching” on page 43.
Managing Contacts on iPhone
Add a contact on iPhone:  Tap Contacts and tap  .
Delete a contact In Contacts, choose a contact, than tap Edit. Scroll down 
and tap Delete Contact.
Add a contact from the numeric 
keypad
6CR-G[RCFGPVGTCPWODGTVJGPVCR . Tap Create New 
Contact and enter the caller’s information, or tap “Add to 
Existing Contact” and choose a contact.
Enter a soft (two-second) pause in  
a number
Tap  , then tap Pause. One or more pauses may be 
required by a phone system before dialing an extension, 
for example. Pauses appear as commas when the number 
is saved.
Enter a hard pause in a number Tap  , then tap Wait. A hard pause appears as a 
semicolon when the number is saved. When dialing, iPhone 
pauses when it reaches the semicolon and waits until you 
tap the Dial button to continue.
Add a recent caller’s phone number  
to your contacts
Tap Recents and tap   next to the number. Then tap 
Create New Contact, or tap “Add to Existing Contact” and 
choose a contact.
Edit contact information:  Choose a contact, then tap Edit.
 Add information:(KNNKPCDNCPM°GNF
 Add an address:  Tap   Add New Address.
 #FFC°GNFVJCV¨UPQVUJQYKPI  Tap   Add Field.
 Change the ringtone for the contact:6CRVJGTKPIVQPG°GNFVJGPEJQQUGCTKPIVQPG
6QWUGVJGFGHCWNVTKPIVQPGURGEK°GFKPVJG5QWPFUUGVVKPIUEJQQUG&GHCWNV
 Delete an item:  Tap  , then tap Delete.
;QWECPEJCPIG°GNFNCDGNUD[VCRRKPIVJGNCDGNCPFEJQQUKPICFKÒGTGPVQPG6Q
create a custom label, scroll to the bottom of the list and tap Add Custom Label.
If you sync contacts from your computer and also over the air, you can link contacts to 
ETGCVGCUKPINGWPK°GFEQPVCEV
Link a contact:  In edit mode, tap   Link Contact, then choose a contact.
See “7PK°GF%QPVCEVU” on page 217.
215
Chapter 26    Contacts

Assign a photo to a contact:
  1  Tap Contacts, then choose a contact.
  2  Tap Edit and tap Add Photo, or tap the existing photo.
  3  Tap Take Photo and take a photo with the camera. Or tap Choose Existing Photo and 
choose a photo.
  4  Drag and scale the photo as desired.
  5  Tap Use Photo (new photo) or Choose (existing photo).
Using Contact Information
You can use the information on a contact’s Info screen to:
Call the contact 
Create an email message in Mail, addressed to the contact 
Open the contact’s home page in Safari 
Find the location of the contact’s address in Maps, and get directions 
Send a text message to the contact 
Share the contact information with others 
Add a phone number for the contact to your favorites list 
Make a FaceTime video call 
Use a contact’s info screen:  Tap Contacts and choose a contact. Then tap an item.
=PZP[[OL^LIZP[L
*HSS
:LUKHULTHPS
:LUKH[L_[TLZZHNL
(KKHWOVUL
U\TILY[V`V\Y
MH]VYP[LZSPZ[
:LLHTHWHUK
NL[KPYLJ[PVUZ
4HRLH
-HJL;PTL
]PKLVJHSS
A star next to a phone number means the number is in your favorites list.   appears 
on the FaceTime button if you’ve ever had a FaceTime call with the contact.
See your own phone number:  Tap Contacts and scroll to the top of the list. (Not 
available in all countries or regions.)
216 Chapter 26    Contacts

7PK°GF%QPVCEVU
When you sync contacts with multiple accounts, you might have entries for the same 
person in more than one account. To help keep redundant contacts from appearing 
KPVJG#NN%QPVCEVUNKUVQPK2JQPGEQPVCEVUHTQOFKÒGTGPVCEEQWPVUVJCVJCXGVJGUCOG
°TUVCPFNCUVPCOGUCTGNKPMGFCPFFKURNC[GFCUCUKPINGWPK°GFEQPVCEV (unless they 
JCXGFKÒGTGPVOKFFNGPCOGU9JGP[QWXKGYCWPK°GFEQPVCEVVJGVKVNG7PK°GF+PHQ
CRRGCTUCVVJGVQRQHVJGUETGGP7PK°GFEQPVCEVUCRRGCTQPN[KPVJG#NN%QPVCEVUNKUV
6JGUQWTEGCEEQWPVUQHCWPK°GFEQPVCEVCRRGCTCVVJGDQVVQOQHVJGUETGGPWPFGT
Linked Cards.
View contact information from a source account:  Tap one of the source accounts.
Unlink a contact:  Tap Edit, tap  , then tap Unlink.
Link a contact:  Tap Edit, then tap   and choose a contact.
217
Chapter 26    Contacts

+H[QWNKPMEQPVCEVUYKVJFKÒGTGPV°TUVQTNCUVPCOGUVJGPCOGUQPVJGKPFKXKFWCN
EQPVCEVUYQP¨VEJCPIGDWVQPN[QPGPCOGCRRGCTUQPVJGWPK°GFECTF6QEJQQUG
YJKEJPCOGCRRGCTUYJGPXKGYKPIVJGWPK°GFECTFVCRVJGNKPMGFECTFYKVJVJG
PCOG[QWRTGHGTVJGPVCR7UG6JKU0COG(QT7PK°GF%CTF
.KPMGFEQPVCEVUCTGP¨VOGTIGF7PNGUU[QWGFKVCWPK°GFEQPVCEVVJGEQPVCEVKP
the source account remains separate and unchanged. If you change information 
KPCWPK°GFEQPVCEVVJGEJCPIGUCTGEQRKGFVQGCEJUQWTEGCEEQWPVKPYJKEJVJCV
KPHQTOCVKQPCNTGCF[GZKUVU+H[QWCFFKPHQTOCVKQPVQCWPK°GFEQPVCEVVJCVKPHQTOCVKQP
is added to the contact in each source account.
Linked contact information also appears at the bottom of an individual contact’s Info 
UETGGPYJGPKV¨UXKGYGFKPCURGEK°EUQWTEGCEEQWPVVJCVKUPQVKPVJG#NN%QPVCEVU
NKUVYJKEJNGVU[QWUGGVJG7PK°GF+PHQUETGGPCPFVJGNKPMGFEQPVCEVHTQOGCEJQHVJG
other source accounts.
218 Chapter 26    Contacts

Nike + iPod 27
Activating Nike + iPod
When turned on in Settings, the Nike + iPod app appears on the Home screen. With a 
Nike + iPod Sensor (sold separately), the Nike + iPod app provides audible feedback on 
your speed, distance, time elapsed, and calories burned during a run or walk. You can 
send your workout information to nikeplus.com, where you can track your progress, 
set goals, and participate in challenges.
6WTP0KMGK2QFQPQTQÒIn Settings, choose Nike + iPod and turn Nike + iPod on or 
QÒ9JGP0KMGK2QFKUVWTPGFQPKVUCRRKEQPCRRGCTUQPVJG*QOGUETGGP
See the Nike + iPod documentation for information about setting up and using 
Nike + iPod.
219

Linking a Sensor
6JG°TUVVKOG[QWUVCTVCYQTMQWV[QW¨TGRTQORVGFVQCEVKXCVG[QWTUGPUQTYJKEJ
automatically links the sensor with iPhone. You can also use Nike + iPod settings to link 
a sensor with iPhone.
0KMGK2QFECPNKPMVQQPN[QPGUGPUQTCVCVKOG6QWUGCFKÒGTGPVUGPUQTWUG 
Nike + iPod settings to link the new sensor.
Link a sensor to iPhone:
  1  Put the Nike + iPod sensor in your shoe.
  2  In Settings on iPhone, choose Nike + iPod > Sensor.
  3  Tap Link New, then walk around as instructed.
  4  Tap Done when the sensor is linked.
Working Out with Nike + iPod
After activating Nike + iPod and inserting the Nike + iPod Sensor in your Nike+ ready 
shoe, you can use Nike + iPod for your workouts.
Work out using Nike + iPod:
  1  In Nike + iPod on iPhone, tap Workouts, then choose a type of workout. 
  2  Depending on the workout, you may need to set a time, distance, or calorie goal.
  3  Choose a playlist or other audio selection, then start your workout.
  4 9JGP[QW°PKUJ[QWTYQTMQWVVCR'PF9QTMQWV
To turn on spoken feedback or set other options, see “Nike + iPod Settings” on 
page 222.
220 Chapter 27    Nike + iPod

Sending Workouts to Nikeplus.com
6JG°TUVVKOG[QWEQPPGEVK2JQPGVQK6WPGUCHVGTCYQTMQWV[QW¨TGCUMGFKH[QWYCPV
to automatically send your workouts to Nike+ when you sync iPhone. Click Send to 
send your current workout to nikeplus.com and set iTunes to automatically send future 
workouts when you sync iPhone with iTunes.
If you click Don’t Send, you can set iTunes to do this later.
Set iTunes to automatically send workouts to nikeplus.com when you sync iPhone 
with iTunes:
  1  Connect iPhone to your computer. 
Make sure your computer is connected to the Internet.
  2  In iTunes, click Nike + iPod at the top of the screen, then select “Automatically send 
workout data to nikeplus.com.”
  3  Click “Visit nikeplus.com” or click Visit in the dialog that appears.
  4  Click Save Your Runs and log in, or register if you haven’t already done so.
Send workout data wirelessly to nikeplus.com from iPhone:
  1  In Nike + iPod on iPhone, tap History.
Make sure iPhone is connected to the Internet.
  2  Tap “Send to Nike+.”
  3  Enter your email address and nikeplus.com account password, then tap “Login to 
Nike +.”
If you don’t already have a nikeplus.com account, tap Join Nike+ to set one up.
To see your workouts on nikeplus.com, log in to your account and follow the  
onscreen instructions.
221
Chapter 27    Nike + iPod

Calibrating Nike + iPod
You calibrate Nike + iPod using a workout you just completed. You can only calibrate 
workouts of a quarter mile or more.
Calibrate iPhone:  
  1  Run or walk a known distance, then tap End Workout.
  2  Tap Calibrate, then enter the distance and tap Done.
Reset Nike + iPod to the default calibration:  In Settings, choose Nike + iPod, then tap 
Reset Calibration.
Nike + iPod Settings
In Settings, choose Nike + iPod to activate and adjust settings for the Nike + iPod app.
Choose a PowerSong:  Choose PowerSong and select a song from your music library.
6WTPURQMGPHGGFDCEMQPQTQÒChoose Spoken Feedback and select a male or 
HGOCNGXQKEGVQCEEQORCP[[QWTYQTMQWVQT1ÒVQVWTPQÒURQMGPHGGFDCEM
Set a distance preference:  %JQQUG&KUVCPEGVJGPUGNGEV/KNGUQT-KNQOGVGTUVQ
measure your workout distance.
Set your weight:  %JQQUG9GKIJVVJGP±KEMVQGPVGT[QWTYGKIJV
Set the screen orientation:  Choose Lock Screen, then select a screen orientation 
preference.
Set up the Nike + iPod Sensor:  Choose Sensor, then follow the onscreen instructions 
to set up your sensor (sold separately).
You can use a Nike+ compatible remote (sold separately) to control Nike + iPod 
YKTGNGUUN[$GHQTGWUKPICTGOQVGHQTVJG°TUVVKOG[QWOWUVUGVKVWRQPK2JQPG
Set up the Nike + iPod remote:  Choose Remote, then follow the onscreen instructions 
to set up your remote (third-party product sold separately).
Reset Nike + iPod to the default calibration:  Tap Reset Calibration.
222 Chapter 27    Nike + iPod

iBooks 28
About iBooks
iBooks is a great way to read and buy books. Download the free iBooks app from 
the App Store, and then get everything from classics to best sellers from the built-in 
iBookstore. Once you download a book, it’s displayed on your bookshelf. 
Add ePub books and PDFs to your bookshelf using iTunes. Then tap a book or PDF to 
start reading. iBooks remembers your location, so you can easily return to where you 
NGHVQÒ#YKFGTCPIGQHFKURNC[QRVKQPUOCMGUVJGDQQMUGCU[VQTGCF
Note:  The iBooks app and the iBookstore may not be available in all languages or 
locations.
(]HPSHISLVU[OLP)VVRZ[VYL;P[SLH]HPSHIPSP[`PZ
Z\IQLJ[[VJOHUNL
To download the iBooks app and use the iBookstore, you need an Internet connection 
and an Apple account. If you don’t have an Apple account, or if you want to make 
purchases from another Apple account, go to Settings > Store. See “Store” on page 212.
223

Syncing Books and PDFs
Use iTunes to sync your books and PDFs between iPhone and your computer. When 
iPhone is connected to your computer, the Books pane lets you select which items  
to sync.
You can sync books that you download or purchase from the iBookstore. You can also 
add DRM-free ePub books and PDFs to your iTunes library. There are several websites 
VJCVQÒGTDQQMUKPG2WDCPF2&(HQTOCV
Sync an ePub book or PDF to iPhone:  Download the book or PDF using your 
EQORWVGT6JGPKPK6WPGUEJQQUG(KNG #FFVQ.KDTCT[CPFUGNGEVVJG°NG%QPPGEV
iPhone to your computer, select the book or PDF in the Books pane in iTunes, and then 
sync iPhone.
If a PDF doesn’t appear in the Books pane, you need to change its type in iTunes. 
5GCTEJ[QWTK6WPGUNKDTCT[VQ°PFVJG2&(UGNGEVKVVJGPEJQQUG(KNG )GV+PHQ+PVJG
1RVKQPUUGEVKQPQHVJG°NGKPHQTOCVKQPYKPFQYEJQQUG$QQMHTQOVJG/GFKC-KPF
RQRWROGPWVJGPENKEM1-
Using the iBookstore
In the iBooks app, tap Store to open the iBookstore. From there, you can browse 
HGCVWTGFDQQMUQTDGUVUGNNGTUCPFDTQYUGHQTDQQMUD[CWVJQTQTVQRKE9JGP[QW°PF
a book you like, you can purchase and download it.
Note:  Some features of the iBookstore may not be available in all locations.
Get more information:  In the iBookstore, you can read a summary of the book, read 
or write a review, and download a sample of the book before buying it.
Purchase a book:  Find a book you want, tap the price, then tap Buy Now. Sign in to 
[QWT#RRNGCEEQWPVVJGPVCR1-5QOGDQQMUOC[DGHTGGHQTFQYPNQCFKPI
The purchase is charged to your Apple account. If you make additional purchases 
YKVJKPVJGPGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP
If you’ve already purchased a book and want to download it again, tap Purchases in 
VJGK$QQMUVQTGCPF°PFVJGDQQMKPVJGNKUV6JGPVCR4GFQYPNQCF
Books that you purchase are synced to your iTunes library the next time you sync 
iPhone with your computer. This provides a backup in case you delete the book  
from iPhone.
224 Chapter 28    iBooks

Reading Books
Reading a book is easy. Go to the bookshelf and tap the book you want to read. If you 
don’t see the book you’re looking for, tap the name of the current collection at the top 
of the screen to go to other collections.
Turn pages:  6CRPGCTVJGTKIJVQTNGHVOCTIKPQHCRCIGQT±KEMNGHVQTTKIJV6QEJCPIG
the direction the page turns when you tap the left margin, go to Settings > iBooks.
)QVQCURGEK°ERCIGTap near the center of the current page to show the controls. 
Drag the page navigation control at the bottom of the screen to the desired page, 
then let go.
Go to the table of contents:  Tap near the center of the current page to show the 
controls, then tap  . Tap an entry to jump to that location, or tap Resume to return to 
the current page.
Add or remove a bookmark:  Tap the ribbon button to set a bookmark. You can have 
multiple bookmarks. To remove a bookmark, tap it. You don’t need to set a bookmark 
YJGP[QWENQUGCDQQMDGECWUGK$QQMUTGOGODGTUYJGTG[QWNGHVQÒCPFTGVWTPU
there when you open the book again.
Add, remove, or edit a highlight:  Touch and hold any word until it’s selected. Use the 
grab points to adjust the selection, then tap Highlight. To remove a highlight, tap the 
highlighted text, then tap Remove Highlight. To change the color of a highlight, tap 
the highlighted text, then tap Colors and select a color from the menu.
Add, remove, or edit a note:  Touch and hold any word until it’s selected. Use the grab 
points to adjust the selection, then tap Note. Type some text, then tap Done. To view 
a note, tap the indicator in the margin near the highlighted text. To remove a note, 
tap the highlighted text, then tap Delete Note. To change the color of a note, tap the 
highlighted text, then tap Colors and select a color from the menu.
See all your bookmarks, highlights and notes:  To see the bookmarks, highlights, and 
notes you’ve added, tap  , then tap Bookmarks. To view a note, tap its indicator.
225
Chapter 28    iBooks

Enlarge an image:  Double-tap the image.
To read a book while lying down, use the portrait orientation lock to prevent 
iPhone from rotating the screen when you rotate iPhone. See “Viewing in Portrait or 
Landscape Orientation” on page 32.
Reading PDFs
You can use iBooks to read PDFs. Go to the bookshelf and tap Collections, select a 
collection, then tap the PDF you want to read.
Turn pages:  Flick left or right.
Enlarge a page:  Pinch to zoom in on the page, then scroll to see the portion you want.
)QVQCURGEK°ERCIGTap near the center of the current page to show the controls. 
Then, in the page navigation controls at the bottom of the page, drag until the desired 
page number appears, or tap a thumbnail to jump to that page.
Add or remove a bookmark:  Tap the ribbon button to set a bookmark. You can have 
multiple bookmarks. To remove a bookmark, tap it.
You don’t need to set a bookmark when you close a PDF, because iBooks remembers 
YJGTG[QWNGHVQÒCPFTGVWTPUVJGTGYJGP[QWQRGPKVCICKP
Go to the table of contents:  Tap near the center of the current page to show the 
controls, then tap  . Tap an entry to jump to that location, or tap Resume to return to 
VJGEWTTGPVRCIG+HVJGCWVJQTJCUP¨VFG°PGFCVCDNGQHEQPVGPVU[QWECPVCRCRCIG
icon instead to go to that page.
Changing a Book’s Appearance
To change the appearance of a book, access the controls by tapping near the center  
of a page.
Change the font or type size:  Tap  , then in the list that appears, tap   or   to 
reduce or enlarge the type size. To change the font, tap Fonts, then select one from the 
list. Changing the font and size also changes text formatting.
Change the brightness:  Tap  , then adjust the brightness.
Change the page and type color:  Tap  , then turn the Sepia option on to change 
the color of the page and type. This setting applies to all books.
;QWECPEJCPIGVJGYC[VJCVK$QQMULWUVK°GUVJGVGZVQHRCTCITCRJUKP5GVVKPIU K$QQMU
226 Chapter 28    iBooks

Searching Books and PDFs
You can search for the title or author of a book to quickly locate it on the bookshelf. 
;QWECPCNUQUGCTEJVJGEQPVGPVUQHCDQQMVQ°PFCNNVJGTGHGTGPEGUVQCYQTFQT
RJTCUG[QW¨TGKPVGTGUVGFKP;QWECPCNUQUGPFCUGCTEJVQ9KMKRGFKCQT)QQINGVQ°PF
other related resources.
Search for a book:  Go to the bookshelf. If necessary, change to the collection that 
you want to search. Tap the status bar to scroll to the top of the screen, then tap the 
magnifying glass. Enter a word that’s in the title of a book, or the author’s name, then 
tap Search. Matching books appear on the bookshelf.
Search in a book:  Open a book and tap near the center of the page to show the 
controls. Tap the magnifying glass, then enter a search phrase and tap Search. Tap a 
search result to go to that page in the book. 
To send your search to Google or Wikipedia, tap Search Google or Search Wikipedia. 
Safari opens and displays the result.
To quickly search for a word in a book, touch and hold the word, then tap Search.
.QQMKPIWRVJG&G°PKVKQPQHC9QTF
;QWECPNQQMWRVJGFG°PKVKQPQHCYQTFWUKPIVJGFKEVKQPCT[
Look up a word:  Select a word in a book, then tap Dictionary in the menu that 
appears. Dictionaries may not be available for all languages.
Having a Book Read to You
If you have a visual impairment, you can use VoiceOver to read a book aloud. See 
“VoiceOver” on page 230.
Some books may not be compatible with VoiceOver.
Printing or Emailing a PDF
You can use iBooks to send a copy of a PDF via email, or to print all or a portion of the 
PDF to a supported printer.
Email a PDF:  Open the PDF, then tap   and choose Email Document. A new message 
CRRGCTUYKVJVJG2&(CVVCEJGF9JGP[QW°PKUJCFFTGUUKPICPFYTKVKPI[QWTOGUUCIG
tap Send.
Print a PDF:  Open the PDF, then tap   and choose Print. Select a printer and the page 
range and number of copies, then tap Print. For more information, see “Printing” on 
page 41.
You can only email or print PDFs. These options aren’t available for ePub books.
227
Chapter 28    iBooks

Organizing the Bookshelf
Use the bookshelf to browse your books and PDFs. You can also organize items into 
collections.
Sort the bookshelf:  Go to the bookshelf and tap the status bar to scroll to the top of 
the screen, then tap   and select a sort method from the choices at the bottom of 
the screen.
Rearrange items on the bookshelf:  Touch and hold a book or PDF, then drag it to a 
new location on the bookshelf.
Delete an item from the bookshelf:  Go to the bookshelf and tap Edit. Tap each book 
or PDF that you want to delete so that a checkmark appears, then tap Delete. When 
[QW°PKUJFGNGVKPIVCR&QPG+H[QWFGNGVGCDQQM[QWRWTEJCUGF[QWECPFQYPNQCF
it again from Purchases in the iBookstore. If you’ve synced your device with your 
computer, the book also remains in your iTunes Library.
Create, rename, or delete a collection:  Tap the name of the current collection you’re 
viewing, such as Books or PDFs, to display the collections list. Tap New to add a new 
collection. To delete a collection, tap Edit, then tap   and tap Delete. You can’t edit or 
remove the built-in Books and PDFs collections. To edit the name of a collection, tap its 
PCOG9JGP[QW°PKUJVCR&QPG
Move a book or PDF to a collection:  Go to the bookshelf and tap Edit. Tap each book 
or PDF that you want to move so that a checkmark appears, then tap Move and select 
a collection. Items can be in only one collection at a time. When you add a book or 
2&(VQ[QWTDQQMUJGNHHQTVJG°TUVVKOGKV¨URWVKPVQVJG$QQMUQT2&(EQNNGEVKQP(TQO
VJGTG[QWECPOQXGKVVQCFKÒGTGPVEQNNGEVKQP;QWOKIJVYCPVVQETGCVGEQNNGEVKQPUHQT
work and school, for example, or for reference and leisure reading.
View a collection:  Tap the name of the current collection at the top of the screen, 
then pick a new one from the list that appears.
Bookmark and Note Syncing
iBooks saves your bookmarks, notes, and current page information in your Apple 
account, so they’re always up to date and you can read a book seamlessly across 
multiple devices. For PDFs, the bookmarks and current page information are synced.
6WTPDQQMOCTMU[PEKPIQPQTQÒGo to Settings > iBooks, then turn Sync Bookmarks 
QPQTQÒ
You must have an Internet connection to sync your settings. iBooks syncs information 
for all of your books when you open or quit the app. Information for individual books 
is also synced when you open or close the book.
228 Chapter 28    iBooks

Accessibility 29
Universal Access Features
In addition to the many features that make iPhone easy to use for everyone, 
accessibility features make it easier for users with visual, auditory, or other physical 
disabilities to use iPhone. These accessibility features include:
VoiceOver 
Zoom 
Large Text 
White on Black 
Mono Audio 
Speak Auto-text 
Support for braille displays 
With the exception of VoiceOver, these accessibility features work with all iPhone apps, 
including third-party apps you download from the App Store. VoiceOver works with all 
apps that come preinstalled on iPhone, and with many third-party apps.
For more information about iPhone accessibility features, go to  
www.apple.com/accessibility.
'CEJCEEGUUKDKNKV[HGCVWTGECPDGVWTPGFQPQTQÒKP#EEGUUKDKNKV[UGVVKPIUQPK2JQPG
;QWECPCNUQVWTPCEEGUUKDKNKV[HGCVWTGUQPQTQÒKPK6WPGUYJGPK2JQPGKUEQPPGEVGF 
to your computer. 
229

6WTPCEEGUUKDKNKV[HGCVWTGUQPQTQÒKPK6WPGU
  1  Connect iPhone to your computer.
  2  In iTunes, select iPhone in the Devices list.
  3 +PVJG5WOOCT[RCPGENKEM%QP°IWTG7PKXGTUCN#EEGUUKPVJG1RVKQPUUGEVKQP
  4 5GNGEVVJGCEEGUUKDKNKV[HGCVWTGUVJCV[QWYCPVVQWUGCPFENKEM1-
.CTIG6GZVECPQPN[DGVWTPGFQPQTQÒWUKPIK2JQPGUGVVKPIU5GG¥Large Text” on 
page 243.
;QWECPVWTPENQUGFECRVKQPKPIQPQTQÒKPK2QFUGVVKPIU5GG¥Videos” on page 100.
VoiceOver
VoiceOver describes aloud what appears onscreen, so that you can use iPhone without 
UGGKPIKV8QKEG1XGTURGCMUKPVJGNCPIWCIGURGEK°GFKP+PVGTPCVKQPCNUGVVKPIUYJKEJ
OC[DGKP±WGPEGFD[VJG4GIKQP.QECNGUGVVKPI
Note:  VoiceOver is available in many languages, but not all.
VoiceOver tells you about each element on the screen as it’s selected. When an 
GNGOGPVKUUGNGEVGFKV¨UGPENQUGFD[CDNCEMTGEVCPINGHQTVJGDGPG°VQHVJQUGYJQECP
see the screen) and VoiceOver speaks the name or describes the item. The enclosing 
rectangle is referred to as the VoiceOver cursor. If text is selected, VoiceOver reads the 
text. If a control (such as a button or switch) is selected and Speak Hints is turned on, 
VoiceOver may tell you the action of the item or provide instructions for you—for 
example, “double-tap to open.”
When you go to a new screen, VoiceOver plays a sound and then selects and speaks 
VJG°TUVGNGOGPVQHVJGUETGGPV[RKECNN[VJGKVGOKPVJGWRRGTNGHVEQTPGT8QKEG1XGT
also lets you know when the screen changes to landscape or portrait, and when it is 
locked or unlocked.
230 Chapter 29    Accessibility

Setting Up VoiceOver
Important:  VoiceOver changes the gestures used to control iPhone. Once VoiceOver 
is turned on, you have to use VoiceOver gestures to operate iPhone—even to turn 
8QKEG1XGTQÒCICKPVQTGUWOGUVCPFCTFQRGTCVKQP
6WTP8QKEG1XGTQPQTQÒIn Settings, choose General > Accessibility > VoiceOver and 
VCRVJG8QKEG1XGT1P1ÒUYKVEJ
;QWECPCNUQUGV6TKRNGENKEM*QOGVQVWTP8QKEG1XGTQPQTQÒ5GG¥Triple-Click 
Home” on page 245.
Note:  You can’t use VoiceOver and Zoom at the same time.
6WTPURQMGPJKPVUQPQTQÒIn Settings, choose General > Accessibility > VoiceOver, 
CPFVCRVJG5RGCM*KPVU1P1ÒUYKVEJ9JGP5RGCM*KPVUKUVWTPGFQP8QKEG1XGTOC[
tell you the action of the item or provide instructions for you—for example, “double-
tap to open.” Speak Hints is turned on by default.
Set the VoiceOver speaking rate:  In Settings, choose General > Accessibility > 
VoiceOver, and adjust the Speaking Rate slider.
Add speaking rate to the rotor:  In Settings, choose General > Accessibility and tap to 
turn on “Include in Rotor.”
You can choose the kind of feedback you get when you type. You can set VoiceOver to 
speak characters, words, both, or nothing. If you choose to hear both characters and 
words, VoiceOver speaks each character as you type it, then speaks the whole word 
YJGP[QW°PKUJKVD[GPVGTKPICURCEGQTRWPEVWCVKQP
Choose typing feedback:  In Settings, choose General > Accessibility > VoiceOver > 
Typing Feedback. You can choose Characters, Words, Characters and Words, or Nothing 
HQTUQHVYCTGMG[DQCTFUCPFHQTCP#RRNG9KTGNGUU-G[DQCTFUGG¥Using an Apple 
9KTGNGUU-G[DQCTF” on page 40).
Use phonetics In Settings, choose General > Accessibility > VoiceOver, then 
tap the Use Phonetics switch to turn it on.
Use this feature when you type or read character-by-
character, to help make clear which characters were spoken. 
9JGP7UG2JQPGVKEUKUVWTPGFQP8QKEGQXGT°TUVURGCMUVJG
character, then speaks a word beginning with the character. 
For example, if you type the character “f,” VoiceOver speaks 
“f,” and then a moment later, “foxtrot.”
Use pitch change In Settings, choose General > Accessibility > VoiceOver, then 
tap the Use Pitch Change switch to turn it on.
VoiceOver uses a higher pitch when entering a letter, and 
a lower pitch when deleting a letter. VoiceOver also uses a 
JKIJGTRKVEJYJGPURGCMKPIVJG°TUVKVGOQHCITQWRUWEJ
as a list or table) and a lower pitch when speaking the last 
item of a group.
231
Chapter 29    Accessibility

$[FGHCWNV8QKEG1XGTWUGUVJGNCPIWCIGVJCV¨UUGVHQTK2JQPG;QWECPUGVCFKÒGTGPV
language for VoiceOver.
Set the language for iPhone:  In Settings, choose General > International > Language, 
VJGPUGNGEVCNCPIWCIGCPFVCR1-5QOGNCPIWCIGUOC[DGKP±WGPEGFD[VJG4GIKQP
Local setting. In Settings, choose General > International > Region Format and select 
the format.
Set the language for VoiceOver:  In Settings, choose General > International > Voice 
Control, then choose the language.
If you change the language for iPhone, you may need to reset the language for 
VoiceOver.
Set the rotor options for web browsing:  In Settings, choose General > Accessibility > 
VoiceOver > Web Rotor. Tap to select or deselect options. To change the position of an 
item in the list, touch   next to the item, then drag up or down.
Select the languages available in the Language rotor:  In Settings, choose General 
> Accessibility > VoiceOver > Language Rotor and tap to select the language or 
languages you want to appear in the Language rotor. To change the position of a 
language in the list, touch   next to the language and drag up or down.
The Language rotor is always available when you’ve selected more than one language.
VoiceOver Gestures
9JGP8QKEG1XGTKUVWTPGFQPVJGUVCPFCTFVQWEJUETGGPIGUVWTGUJCXGFKÒGTGPVGÒGEVU
These and some additional gestures let you move around the screen and control 
individual elements when they’re selected. VoiceOver gestures include two- and 
VJTGG°PIGTUIGUVWTGUVQVCRQT±KEM(QTDGUVTGUWNVUYJGPWUKPIVYQCPFVJTGG°PIGT
IGUVWTGUTGNCZCPFNGV[QWT°PIGTUVQWEJVJGUETGGPYKVJUQOGURCEGDGVYGGPVJGO
You can use standard gestures when VoiceOver is turned on, by double-tapping  
CPFJQNFKPI[QWT°PIGTQPVJGUETGGP#UGTKGUQHVQPGUKPFKECVGUVJCVPQTOCN 
IGUVWTGUCTGKPHQTEG6JG[TGOCKPKPGÒGEVWPVKN[QWNKHV[QWT°PIGT6JGP8QKEG1XGT
gestures resume.
;QWECPWUGFKÒGTGPVVGEJPKSWGUVQGPVGT8QKEG1XGTIGUVWTGU(QTGZCORNG[QWECP
GPVGTCVYQ°PIGTVCRWUKPIVYQ°PIGTUHTQOQPGJCPFQTQPG°PIGTHTQOGCEJJCPF
;QWECPCNUQWUG[QWTVJWODU/CP[°PFVJG¥URNKVVCR¦IGUVWTGGURGEKCNN[GÒGEVKXG
instead of selecting an item and double-tapping, you can touch and hold an item with 
QPG°PIGTVJGPVCRVJGUETGGPYKVJCPQVJGT°PIGT6T[FKÒGTGPVVGEJPKSWGUVQFKUEQXGT
which works best for you.
If your gestures don’t work, try quicker movements, especially for double-tapping and 
±KEMKPIIGUVWTGU6Q±KEMVT[SWKEMN[DTWUJKPIVJGUETGGPYKVJ[QWT°PIGTQT°PIGTU
When VoiceOver is turned on, the VoiceOver Practice button appears, which gives you 
a chance to practice VoiceOver gestures before proceeding.
232 Chapter 29    Accessibility

Practice gestures:  In Settings, choose General > Accessibility > VoiceOver, then tap 
8QKEG1XGT2TCEVKEG9JGP[QW°PKUJRTCEVKEKPIVCR&QPG
If you don’t see the VoiceOver Practice button, make sure VoiceOver is turned on.
Here’s a summary of key VoiceOver gestures:
Navigating and Reading
 Tap:  Speak item.
 Flick right or left:  Select the next or previous item.
 Flick up or down:  Depends on the Rotor Control setting. See “Rotor Control” on 
page 234.
 6YQ°PIGTVCR  Stop speaking the current item.
 6YQ°PIGT±KEMWR  Read all from the top of the screen.
 6YQ°PIGT±KEMFQYP  Read all from the current position.
 6YQ°PIGT¥UETWD¦/QXGVYQ°PIGTUDCEMCPFHQTVJVJTGGVKOGUSWKEMN[OCMKPIC
“z”) to dismiss an alert or go back to the previous screen.
 6JTGG°PIGT±KEMWRQTFQYP  Scroll one page at a time.
 6JTGG°PIGT±KEMTKIJVQTNGHV  Go to the next or previous page (such as the Home 
screen, Stocks, or Safari).
 6JTGG°PIGTVCR  Speak the scroll status (which page or rows are visible).
 (QWT°PIGTVCRCVVQRQHUETGGP5GNGEVVJG°TUVKVGOQPVJGRCIG
 (QWT°PIGTVCRCVDQVVQOQHUETGGP  Select the last item on the page.
 (QWT°PIGT±KEMWR5GNGEVVJG°TUVGNGOGPVQPVJGUETGGP
 (QWT°PIGT±KEMFQYP  Select the last element on the screen.
Activating
 Double-tap:  Activate the selected item.
 Triple-tap:  Double-tap an item.
 Split-tap:  An alternative to selecting an item and double-tapping is to touch an item 
YKVJQPG°PIGTVJGPVCRVJGUETGGPYKVJCPQVJGTVQCEVKXCVGCPKVGO
 6QWEJCPKVGOYKVJQPG°PIGTVCRVJGUETGGPYKVJCPQVJGT°PIGT¥URNKVVCRRKPI¦  
Activate the item.
 &QWDNGVCRCPFJQNFUGEQPFUVCPFCTFIGUVWTG  Use a standard gesture.
The double-tap and hold gesture tells iPhone to interpret the subsequent gesture as 
UVCPFCTF(QTGZCORNG[QWECPFQWDNGVCRCPFJQNFVJGPYKVJQWVNKHVKPI[QWT°PIGT
FTCI[QWT°PIGTVQUNKFGCUYKVEJ
 6YQ°PIGTFQWDNGVCR  Answer or end a call. Play or pause in iPod, YouTube, Voice 
Memos, or Photos. Take a photo (Camera). Start or pause recording in Camera or 
Voice Memos. Start or stop the stopwatch.
233
Chapter 29    Accessibility

 6JTGG°PIGTFQWDNGVCR  Mute or unmute VoiceOver.
 6JTGG°PIGTVTKRNGVCR6WTPVJGUETGGPEWTVCKPQPQTQÒ
Rotor Control
The rotor control is a virtual dial that you can use to change the results of up and 
FQYP±KEMIGUVWTGUYJGP8QKEG1XGTKUVWTPGFQP
Operate the rotor:  4QVCVGVYQ°PIGTUQPVJGK2JQPGUETGGPVQ¥VWTP¦VJGFKCNVQ
choose between options.
The current setting appears on the screen and is spoken aloud.
6JGGÒGEVQHVJGTQVQTFGRGPFUQPYJCV[QW¨TGFQKPI(QTGZCORNGKH[QW¨TGTGCFKPI
text in an email you received, you can use the rotor to switch between hearing text 
URQMGPYQTFD[YQTFQTEJCTCEVGTD[EJCTCEVGTYJGP[QW±KEMWRQTFQYP+H[QW¨TG
browsing a webpage, you can use the rotor setting to hear all the text (either word-by-
word or character-by-character), or to jump from one element to another of a certain 
type, such as headers or links.
The following lists show the available rotor options, depending on the context of what 
you’re doing.
Reading text
Select and hear text by:
Character 
Word 
Line 
Browsing a webpage
Select and hear text by:
Character 
Word 
Line 
Heading 
Link 
Visited link 
Non-visited link 
In-page link 
234 Chapter 29    Accessibility

Form control 
Table 
Row (when navigating a table) 
List 
Landmark 
Image 
Static text 
Zoom in or out
Entering text
Move insertion point and hear text by:
Character 
Word 
Line 
Select edit function
Select language
Using a control (such as the spinner for setting the time in Clock)
Select and hear values by:
Character 
Word 
Line 
Adjust the value of the control object
Speaking (available only with the Apple Wireless Keyboard)
Adjust VoiceOver speaking by:
Volume 
Rate 
Typing echo 
Use pitch change 
Use Phonetics 
See “%QPVTQNNKPI8QKEG1XGT7UKPICP#RRNG9KTGNGUU-G[DQCTF” on page 239.
You can select which rotor options appear for web browsing, and arrange their order. 
See “Setting Up VoiceOver” on page 231.
235
Chapter 29    Accessibility

Using VoiceOver
Select items on the screen:  &TCI[QWT°PIGTQXGTVJGUETGGP8QKEG1XGTKFGPVK°GU
each element as you touch it. You can move systematically from one element to the 
PGZVD[±KEMKPINGHVQTTKIJVYKVJCUKPING°PIGT'NGOGPVUCTGUGNGEVGFHTQONGHVVQ
TKIJVVQRVQDQVVQO(NKEMTKIJVVQIQVQVJGPGZVGNGOGPVQT±KEMNGHVVQIQVQVJG
previous element.
7UGHQWT°PIGTIGUVWTGUVQUGNGEVVJG°TUVQTNCUVGNGOGPVQPCUETGGP
 5GNGEVVJG°TUVGNGOGPVQPCUETGGP(NKEMWRYKVJHQWT°PIGTU
 Select the last element on a screen:  (NKEMFQYPYKVJHQWT°PIGTU
“Tap” a selected item when VoiceOver is turned on:  Double-tap anywhere on  
the screen.
“Double-tap” a selected item when VoiceOver is turned on:  Triple-tap anywhere on 
the screen.
Speak the text of an element, character-by-character or word-by-word:  With 
VJGGNGOGPVUGNGEVGF±KEMWRQTFQYPYKVJQPG°PIGT(NKEMFQYPVQTGCFVJGPGZV
EJCTCEVGTQT±KEMWRVQTGCFVJGRTGXKQWUEJCTCEVGT7UGRJQPGVKEUVQJCXG8QKEG1XGT
also speak a word beginning with the character being spoken. See “Setting Up 
VoiceOver” on page 231.
Twist the rotor control to have VoiceOver read word-by-word.
Adjust a slider:  9KVJCUKPING°PIGT±KEMWRVQKPETGCUGVJGUGVVKPIQTFQYPVQ
decrease the setting. VoiceOver announces the setting as you adjust it.
Scroll a list or area of the screen (NKEMWRQTFQYPYKVJVJTGG°PIGTU(NKEMFQYPVQRCIG
FQYPVJTQWIJVJGNKUVQTUETGGPQT±KEMWRVQRCIGWR
When paging through a list, VoiceOver speaks the range of 
items displayed (for example, “showing rows 5 through 10”).
You can also scroll continuously through a list, instead of 
paging through it. Double-tap and hold. When you hear a 
UGTKGUQHVQPGU[QWECPOQXG[QWT°PIGTWRQTFQYPVQUETQNN
VJGNKUV%QPVKPWQWUUETQNNKPIUVQRUYJGP[QWNKHV[QWT°PIGT
Use a list index Some lists have an alphabetical index along the right side. 
6JGKPFGZECP¨VDGUGNGEVGFD[±KEMKPIDGVYGGPGNGOGPVU
you must touch the index directly to select it. With the 
KPFGZUGNGEVGF±KEMWRQTFQYPVQOQXGCNQPIVJGKPFGZ
;QWECPCNUQFQWDNGVCRVJGPUNKFG[QWT°PIGTWRQTFQYP
Reorder a list Some lists, such as Favorites in Phone, and Web Rotor and 
Language Rotor in Accessibility settings can be reordered. 
Select   on the right side of an item, double-tap and hold 
until you hear a sound, then drag up or down. VoiceOver 
speaks the item you’ve moved above or below, depending 
on the direction you’re dragging.
Unlock iPhone:  Select the Unlock switch, then double-tap the screen.
236 Chapter 29    Accessibility

Rearrange the Home screen:  On the Home screen, select the icon you want to move. 
Double-tap and hold the icon, then drag it. VoiceOver speaks the row and column 
position as you drag the icon. Release the icon when it’s in the location you want. You 
can drag additional icons. Drag an item to the left or right edge of the screen to move 
KVVQCFKÒGTGPVRCIGQHVJG*QOGUETGGP9JGP[QW°PKUJRTGUUVJG*QOG  button.
Mute VoiceOver &QWDNGVCRYKVJVJTGG°PIGTU&QWDNGVCRCICKPYKVJVJTGG
°PIGTUVQVWTPURGCMKPIDCEMQP6QVWTPQÒQPN[8QKEG1XGT
sounds, set the Ring/Silent switch to Silent.
If an external keyboard is connected, you can also press the 
Control key on the keyboard to mute or unmute VoiceOver.
Stop speaking an item 6CRQPEGYKVJVYQ°PIGTU6CRCICKPYKVJVYQ°PIGTUVQ
resume speaking. Speaking automatically resumes when 
you select another item.
6WTPVJGUETGGPEWTVCKPQPQTQÒ 6TKRNGVCRYKVJVJTGG°PIGTU9JGPUETGGPEWTVCKPKUQP
the screen contents are active even though the display is 
VWTPGFQÒ
Speak the entire screen from the top (NKEMWRYKVJVYQ°PIGTU
Speak from the current item to the 
bottom of the screen
(NKEMFQYPYKVJVYQ°PIGTU
You can hear iPhone status information by touching the top of the screen. This 
information can include the time, battery life, Wi-Fi signal strength, and more.
Making Phone Calls with VoiceOver
&QWDNGVCRVJGUETGGPYKVJVYQ°PIGTUVQCPUYGTQTGPFCECNN9JGPCRJQPGECNN
is established with VoiceOver on, the screen displays the numeric keypad by default, 
instead of showing call options. This makes it easier to use the keypad to respond to a 
menu of options when you reach an automated system.
Display call options:  5GNGEVVJG*KFG-G[RCFDWVVQPKPVJGNQYGTTKIJVEQTPGTCPF
double-tap.
Display the numeric keypad again:  5GNGEVVJG-G[RCFDWVVQPPGCTVJGEGPVGTQHVJG
screen and double-tap.
Entering and Editing Text
9JGP[QWGPVGTCPGFKVCDNGVGZV°GNF[QWECPWUGVJGQPUETGGPMG[DQCTFQTCP
external keyboard connected to iPhone to enter text.
There are two ways to enter text in VoiceOver—standard typing and “touch” typing. 
With standard typing, you select a key, then double-tap the screen to enter the 
character. With touch typing, you touch to select a key and the character is entered 
CWVQOCVKECNN[YJGP[QWNKHV[QWT°PIGT6QWEJV[RKPIECPDGSWKEMGTDWVOC[TGSWKTG
more practice than standard typing.
237
Chapter 29    Accessibility

VoiceOver also lets you use the editing features of iPhone to cut, copy, or paste in a 
VGZV°GNF
Enter text:
  1 5GNGEVCVGZV°GNFVQDTKPIWRVJGQPUETGGPMG[DQCTF
You may need to double-tap to bring up the keyboard, if it doesn’t appear 
CWVQOCVKECNN[8QKEG1XGTYKNNVGNN[QWKHVJGVGZV°GNF¥KUGFKVKPI¦QTKH[QWPGGFVQ
“double-tap to edit.”
+HVJG°GNFCNTGCF[EQPVCKPUVGZVVJGKPUGTVKQPRQKPVKURNCEGFGKVJGTCVVJGDGIKPPKPI
or at the end of the text. Double-tap to move the insertion point to the opposite end. 
VoiceOver tells you the position of the insertion point.
  2  Use the keyboard to type characters: 
 Standard typing:  5GNGEVCMG[QPVJGMG[DQCTFD[±KEMKPINGHVQTTKIJVVJGPFQWDNG
VCRVQGPVGTVJGEJCTCEVGT1TOQXG[QW°PIGTCTQWPFVJGMG[DQCTFVQUGNGEVCMG[
CPFYJKNGEQPVKPWKPIVQVQWEJVJGMG[YKVJQPG°PIGTVCRVJGUETGGPYKVJCPQVJGT
°PIGTVQGPVGTVJGEJCTCEVGT8QKEG1XGTURGCMUVJGMG[YJGPKV¨UUGNGEVGFCPFCICKP
when the character is entered.
 Touch typing:  6QWEJCMG[QPVJGMG[DQCTFVQUGNGEVKVVJGPNKHV[QWT°PIGTVQGPVGT
VJGEJCTCEVGT+H[QWVQWEJVJGYTQPIMG[OQXG[QWT°PIGTQPVJGMG[DQCTFWPVKN
you select the key you want. VoiceOver speaks the character for each key as you 
VQWEJKVDWVFQGUP¨VGPVGTCEJCTCEVGTWPVKN[QWNKHV[QWT°PIGT
Note:  Touch typing works only for the keys that actually enter text. Use standard 
typing for other keys such as Shift, Delete, and Return.
VoiceOver tells you when it thinks you’ve misspelled a word.
Choose standard or touch typing:  With VoiceOver turned on and a key selected on 
VJGMG[DQCTFWUGVJGTQVQTVQUGNGEV6[RKPI/QFGVJGP±KEMWRQTFQYP
Move the insertion point:  Use the rotor to choose whether you want to move the 
insertion point by character, by word, or by line. By default, VoiceOver moves the 
insertion point character-by-character.
Flick up or down to move the insertion point forward or backward in the text. 
VoiceOver makes a sound when the insertion point moves, and speaks the character 
that the insertion point moves across. 
When moving the insertion point by word, VoiceOver speaks each word as you 
move across it. When moving forward, the insertion point is placed at the end of 
the traversed word, before the space or punctuation that follows it. When moving 
backward, the insertion point is placed the end of the word preceding the traversed 
word, before the space or punctuation that follows it. To move the insertion point 
past the punctuation at the end of a word or sentence, use the rotor to switch back to 
character mode.
238 Chapter 29    Accessibility

When moving the insertion point by line, VoiceOver speaks each line as you move 
across it. When moving forward, the insertion point is placed at the beginning of the 
next line (except when you reach the last line of a paragraph, when the insertion point 
is moved to the end of the line just spoken). When moving backward, the insertion 
point is placed at the beginning of the line that’s spoken.
Delete a character:  Select the  , then double-tap or split-tap. You must do this 
even when touch typing. To delete multiple characters, touch and hold the Delete 
MG[VJGPVCRVJGUETGGPYKVJCPQVJGT°PIGTQPEGHQTGCEJEJCTCEVGT[QWTYCPVVQ
delete. VoiceOver speaks the character as it’s deleted. If Use Pitch Change is turned on, 
VoiceOver speaks deleted characters in a lower pitch.
Select text:  5GVVJGTQVQTVQ'FKV±KEMWRQTFQYPVQEJQQUG5GNGEVQT5GNGEV#NNVJGP
double tap. If you chose Select, the word closest to the insertion point is selected 
when you double-tap. If you chose Select All, the entire text is selected.
Pinch apart or together to increase or decrease the selection.
Cut, copy, or paste:  /CMGUWTGVJGTQVQTKUUGVVQGFKV9KVJVGZVUGNGEVGF±KEMWRQT
down to choose Cut, Copy, or Paste, then double-tap.
Undo:  5JCMGK2JQPG±KEMNGHVQTTKIJVVQEJQQUGVJGCEVKQPVQWPFQVJGPFQWDNGVCR
Enter an accented character:  In standard typing mode, select the plain character, 
then double-tap and hold until you hear a sound indicating alternate characters have 
CRRGCTGF&TCINGHVQTTKIJVVQUGNGEVCPFJGCTVJGEJQKEGU4GNGCUG[QWT°PIGTVQGPVGT
the current selection.
Change the language you’re typing in:  5GVVJGTQVQTVQ.CPIWCIGVJGP±KEMWRQT
FQYP%JQQUG¥FGHCWNVNCPIWCIG¦VQWUGVJGNCPIWCIGURGEK°GFKP+PVGTPCVKQPCNUGVVKPIU
Note:  The Language rotor appears only if you select more than one language in the 
VoiceOver Language Rotor setting. See “Setting Up VoiceOver” on page 231.
Controlling VoiceOver Using an Apple Wireless Keyboard
;QWECPEQPVTQN8QKEG1XGTWUKPICP#RRNG9KTGNGUU-G[DQCTFRCKTGFYKVJK2JQPG5GG
“7UKPICP#RRNG9KTGNGUU-G[DQCTF” on page 40.
The VoiceOver keyboard commands let you navigate the screen, select items, read 
screen contents, adjust the rotor, and perform other VoiceOver actions. All the 
keyboard commands (except one) include Control-Option, abbreviated in the table 
below as “VO.” 
VoiceOver Help speaks keys or keyboard commands as you type them. You can use 
VoiceOver Help to learn the keyboard layout and the actions associated with key 
combinations. 
239
Chapter 29    Accessibility

VoiceOver Keyboard Commands
VO = Control-Option
Read all, starting from the current position VO–A
Read from the top VO–B
Move to the status bar VO–M
Press the Home button VO–H
Select the next or previous item VO–Right Arrow or VO–Left Arrow
Tap an item VO–Space bar
&QWDNGVCRYKVJVYQ°PIGTU VO–”-”
Choose the next or previous rotor item VO–Up Arrow or VO–Down Arrow
Choose the next or previous speech rotor item VO–Command–Left Arrow or VO–Command–
Right Arrow
Adjust speech rotor item VO–Command–Up Arrow or VO–Command–
Down Arrow
Mute or unmute VoiceOver VO–S
6WTPVJGUETGGPEWTVCKPQPQTQÒ VO–Shift-S
Turn on VoiceOver help 81£-
4GVWTPVQVJGRTGXKQWUUETGGPQTVWTPQÒ
VoiceOver help
Escape
Quick Nav
6WTPQP3WKEM0CXVQEQPVTQN8QKEG1XGTWUKPIVJGCTTQYMG[U3WKEM0CXKUQÒD[FGHCWNV
6WTP3WKEM0CXQPQTQÒ Left Arrow–Right Arrow
Select the next or previous item Right Arrow or Left Arrow
5GNGEVVJGPGZVQTRTGXKQWUKVGOURGEK°GFD[
the rotor setting
Up Arrow or Down Arrow
5GNGEVVJG°TUVQTNCUVKVGO Control–Up Arrow or Control–Down Arrow
"Tap” an item Up Arrow–Down Arrow
Scroll up, down, left, or right Option–Up Arrow, Option–Down Arrow, Option–
Left Arrow, or Option–Right Arrow
Change the rotor Up Arrow–Left Arrow or Up Arrow–Right Arrow
;QWECPCNUQWUGVJGPWODGTMG[UQPVJG#RRNG9KTGNGUU-G[DQCTFVQFKCNCRJQPG
number in Phone or enter numbers in Calculator.
240 Chapter 29    Accessibility

Using Safari
When you search the web in Safari with VoiceOver on, the Search Results rotor items 
lets you hear the list of suggested search phrases.
Search the web:
  1 5GNGEVVJGUGCTEJ°GNFVJGPGPVGT[QWTUGCTEJ
  2  Select Search Results using the rotor.
  3  Flick right or left to move down or up the list and hear the suggested search phrases.
  4  Double-tap the screen to search the web using the current search phrase.
Using Maps
With VoiceOver, you can zoom in or out, select pins, and get information about locations.
Zoom in or out:  7UGVJGTQVQTVQEJQQUG\QQOOQFGVJGP±KEMWRQTFQYPVQ\QQO
in or out.
Select a pin:  6QWEJCRKPQT±KEMNGHVQTTKIJVVQOQXGHTQOQPGKVGOVQCPQVJGT
Get information about a location:  With a pin selected, double-tap to display the 
KPHQTOCVKQP±CI(NKEMNGHVQTTKIJVVQUGNGEVVJG±CIVJGPFQWDNGVCRVQFKURNC[VJG
information page.
Editing Videos and Voice Memos
You can use VoiceOver gestures to trim Camera videos and Voice Memo recordings.
Trim a voice memo:  On the Voice Memos screen, select the button to the right of the 
memo you want to trim, then double-tap. Then select Trim Memo and double-tap. 
5GNGEVVJGDGIKPPKPIQTGPFQHVJGVTKOVQQN(NKEMWRVQFTCIVQVJGTKIJVQT±KEMFQYP
to drag to the left. VoiceOver announces the amount of time the current position will 
trim from the recording. To execute the trim, select Trim Voice Memo and double-tap.
Trim a video:  While viewing a video, double-tap the screen to display the video 
EQPVTQNU5GNGEVVJGDGIKPPKPIQTGPFQHVJGVTKOVQQN6JGP±KEMWRVQFTCIVQVJGTKIJV
QT±KEMFQYPVQFTCIVQVJGNGHV8QKEG1XGTCPPQWPEGUVJGCOQWPVQHVKOGVJGEWTTGPV
position will trim from the recording. To execute the trim, select Trim and double-tap.
241
Chapter 29    Accessibility

Using a Braille Display with VoiceOver
Setting Up a Braille Display
You can use a refreshable Bluetooth braille display to read VoiceOver output in braille. 
In addition, braille displays with input keys and other controls can be used to control 
iPhone when VoiceOver is turned on. iPhone works with many wireless braille displays. 
For a list of supported displays, go to www.apple.com/accessibility.
Set up a braille display:
  1  Turn on the braille display.
  2  On iPhone, turn on Bluetooth.
In Settings, choose General > Bluetooth, then tap the Bluetooth switch.
  3  In Settings, choose General > Accessibility > VoiceOver > Braille, then choose the 
braille display.
6WTPEQPVTCEVGFDTCKNNGQPQTQÒIn Settings, choose General > Accessibility > 
VoiceOver > Braille, then tap the Contracted Braille switch.
Choosing a Language
The braille display uses the language that’s set for Voice Control. By default, this is the  
language set for iPhone in Settings > International > Language. You can use the 
8QKEG1XGTNCPIWCIGUGVVKPIVQUGVCFKÒGTGPVNCPIWCIGHQT8QKEG1XGTCPFDTCKNNGFKURNC[U
Set the language for VoiceOver:  In Settings, choose General > International > Voice 
Control, then choose the language.
If you change the language for iPhone, you may need to reset the language for 
VoiceOver and your braille display.
Controlling VoiceOver with Your Braille Display
You can set the leftmost or rightmost cell of your braille display to provide system 
status and other information:
Announcement History contains an unread message 
The current Announcement History message hasn’t been read 
VoiceOver speech is muted 
The iPhone battery is low (less than 20% charge) 
iPhone is in landscape orientation 
6JGUETGGPFKURNC[KUVWTPGFQÒ 
The current line contains additional text to the left 
The current line contains additional text to the right 
Set the leftmost or rightmost cell to display status information:  In Settings, choose 
General > Accessibility > VoiceOver > Braille > Status Cell, then tap Left or Right. 
See an expanded description of the status cell:  On your braille display, press the 
status cell’s router button.
242 Chapter 29    Accessibility

Zoom
/CP[K2JQPGCRRUNGV[QW\QQOKPQTQWVQPURGEK°EGNGOGPVU(QTGZCORNG[QWECP
double-tap or use the pinch gesture to expand webpage columns in Safari. 
Zoom is also a special accessibility feature that lets you magnify the entire screen of 
any app you’re using, to help you see what’s on the display.
6WTP<QQOQPQTQÒIn Settings, choose General > Accessibility > Zoom and tap the 
<QQO1P1ÒUYKVEJ
Note:  You can’t use VoiceOver and Zoom at the same time.
Zoom in or out:  &QWDNGVCRVJGUETGGPYKVJVJTGG°PIGTU$[FGHCWNVVJGUETGGPKU
OCIPK°GFRGTEGPV+H[QWOCPWCNN[EJCPIGVJGOCIPK°ECVKQPD[WUKPIVJGVCR
CPFFTCIIGUVWTGFGUETKDGFDGNQYK2JQPGCWVQOCVKECNN[TGVWTPUVQVJCVOCIPK°ECVKQP
YJGP[QW\QQOKPD[FQWDNGVCRRKPIYKVJVJTGG°PIGTU
+PETGCUGOCIPK°ECVKQP9KVJVJTGG°PIGTUVCRCPFFTCIVQYCTFVJGVQRQHVJG
UETGGPVQKPETGCUGOCIPK°ECVKQPQTVQYCTFVJGDQVVQOQHVJGUETGGPVQFGETGCUG
OCIPK°ECVKQP6JGVCRCPFFTCIIGUVWTGKUUKOKNCTVQCFQWDNGVCRGZEGRV[QWFQP¨V
NKHV[QWT°PIGTUQPVJGUGEQPFVCR¤KPUVGCFFTCI[QWT°PIGTUQPVJGUETGGP1PEG[QW
UVCTVFTCIIKPI[QWECPFTCIYKVJCUKPING°PIGT
Move around the screen:  9JGP\QQOGFKPFTCIQT±KEMVJGUETGGPYKVJVJTGG°PIGTU
1PEG[QWUVCTVFTCIIKPI[QWECPFTCIYKVJCUKPING°PIGTUQVJCV[QWECPUGGOQTG
QHVJGUETGGP*QNFCUKPING°PIGTPGCTVJGGFIGQHVJGFKURNC[VQRCPVQVJCVUKFGQH
VJGUETGGPKOCIG/QXG[QWT°PIGTENQUGTVQVJGGFIGVQRCPOQTGSWKEMN[9JGP[QW
open a new screen, Zoom always goes to the top-middle of the screen.
9JKNGWUKPI<QQOYKVJCP#RRNG9KTGNGUU-G[DQCTFUGG¥Using an Apple Wireless 
-G[DQCTF” on page 40), the screen image follows the insertion point, keeping it in the 
center of the display.
Large Text
Large Text lets you make the text larger in alerts, and in Calendar, Contacts, Mail, 
Messages, and Notes. You can choose 20-point, 24-point, 32-point, 40-point, 48-point, 
or 56-point text.
Set the text size:  In Settings, choose General > Accessibility, tap Large Text, then tap 
the text size you want.
243
Chapter 29    Accessibility

White on Black
Use White on Black to invert the colors on the iPhone screen, which may make it 
easier to read the screen. When White on Black is turned on, the screen looks like a 
photographic negative.
Invert the screen’s colors:  In Settings, choose General > Accessibility and tap the 
“White on Black” switch.
Mono Audio
Mono Audio combines the sound of the left and right channels into a mono signal 
played on both sides. This enables users with hearing impairment in one ear to hear 
the entire sound signal with the other ear.
6WTP/QPQ#WFKQQPQTQÒIn Settings, choose General > Accessibility and tap the 
Mono Audio switch.
Speak Auto-text
Speak Auto-text speaks the text corrections and suggestions iPhone makes when 
you’re typing.
6WTP5RGCM#WVQVGZVQPQTQÒIn Settings, choose General > Accessibility and tap 
the Speak Auto-text switch.
Speak Auto-text also works with VoiceOver or Zoom.
244 Chapter 29    Accessibility

Triple-Click Home
Triple-click Home provides an easy way to turn some of the Accessibility features on 
QTQÒYJGP[QWRTGUUVJG*QOG  button quickly three times. You can set Triple-click 
*QOGVQVWTP8QKEG1XGTQPQTQÒVWTP9JKVGQP$NCEMQPQTQÒQTRTGUGPVVJGQRVKQPUVQ
6WTP8QKEG1XGTQPQTQÒ 
6WTP9JKVGQP$NCEMQPQTQÒ 
6WTP<QQOQPQTQÒ 
6TKRNGENKEM*QOGKUVWTPGFQÒD[FGHCWNV
Set the Triple-click Home function:  In Settings, choose General > Accessibility > 
Triple-click Home and choose the function you want.
Closed Captioning and Other Helpful Features
Many iPhone features help make iPhone accessible to all users, including those with 
visual or auditory impairments.
Closed Captioning
You can turn on closed captioning for videos in iPod settings. See “Video” on page 210.
Note:  Not all video content is encoded for closed captioning.
Voice Control
Voice Control lets you make phone calls and control iPod music playback using voice 
commands. See “Voice Dialing” on page 61, and “Using Voice Control with iPod” on 
page 95.
Large Phone Keypad
Make phone calls simply by tapping entries in your contacts and favorites lists. When 
you need to dial a number, iPhone’s large numeric keypad makes it easy. See “Phone 
Calls” on page 60.
Widescreen Keyboards
Several apps let you rotate iPhone when you’re typing, so you can use a larger keyboard:
Mail 
Safari 
Messages 
Notes 
Contacts 
245
Chapter 29    Accessibility

Visual Voicemail
The play and pause controls in visual voicemail let you control the playback of 
messages. Drag the playhead on the scrubber bar to repeat a portion of the message 
that’s hard to understand. See “Checking Voicemail” on page 68.
Assignable Ringtones
You can assign distinctive ringtones to individuals in your contacts list for audible 
caller ID. You can purchase ringtones from the iTunes Store on iPhone. See “Purchasing 
Ringtones” on page 169.
Instant Messaging (IM) Chat
The App Store features many Internet Messaging (IM) apps, such as AIM, BeejiveIM, 
ICQ, and Yahoo! Messenger, that are optimized for iPhone.
Minimum Font Size for Mail Messages
To increase readability, set a minimum font size for Mail message text to Large, Extra 
Large, or Giant. See “Mail” on page 204.
TTY Support (Available in Some Areas)
Use iPhone in TTY mode with the iPhone TTY Adapter (available separately) to use 
a Teletype (TTY) machine. See “Using iPhone with a Teletype (TTY) Machine” on 
page 206.
Universal Access in Mac OS X
Take advantage of the Universal Access features in Mac OS X when you use iTunes  
to sync information and content from your iTunes library to iPhone. In the Finder, 
choose Help > Mac Help, then search for “universal access.”
For more information about iPhone and Mac OS X accessibility features, go to  
www.apple.com/accessibility.
246 Chapter 29    Accessibility

Hearing Aid Compatibility
The FCC has adopted hearing aid compatibility (HAC) rules for digital wireless phones. 
These rules require certain phones to be tested and rated under the American National 
Standard Institute (ANSI) C63.19 hearing aid compatibility standards. The ANSI standard 
for hearing aid compatibility contains two types of ratings: an “M” rating for reduced 
radio frequency interference to enable acoustic coupling with hearing aids that don’t 
operate in telecoil mode, and a “T” rating for inductive coupling with hearing aids 
operating in telecoil mode. These ratings are given on a scale from one to four, where 
four is the most compatible. A phone is considered hearing aid compatible under FCC 
rules if it is rated M3 or M4 for acoustic coupling and T3 or T4 for inductive coupling.
For current iPhone hearing aid compatibility ratings, go to  
www.apple.com/iphone/specs.html.
Hearing aid compatibility ratings aren’t a guarantee that a particular hearing aid works 
with a particular phone. Some hearing aids may work well with phones that don’t 
meet particular ratings. To ensure interoperability between a hearing aid and a phone, 
use them together before purchasing them.
This phone has been tested and rated for use with hearing aids for some of the 
wireless technologies that it uses. However, there may be some newer wireless 
technologies used in this phone that have not been tested yet for use with hearing 
CKFU+VKUKORQTVCPVVQVT[VJGFKÒGTGPVHGCVWTGUQHVJKURJQPGVJQTQWIJN[CPFKP
FKÒGTGPVNQECVKQPUWUKPI[QWTJGCTKPICKFQTEQEJNGCTKORNCPVVQFGVGTOKPGKH[QWJGCT
any interfering noise. Consult your service provider or the manufacturer of this phone 
for information on hearing aid compatibility. If you have questions about return or 
exchange policies, consult your service provider or phone retailer.
247
Chapter 29    Accessibility

International Keyboards A
Appendix
+PVGTPCVKQPCNMG[DQCTFUCNNQY[QWVQGPVGTVGZVKPOCP[FKÒGTGPVNCPIWCIGUKPENWFKPI
Asian languages and languages that are written from right to left.
#FFKPI-G[DQCTFU
;QWGPVGTFKÒGTGPVNCPIWCIGUQPK2JQPGD[WUKPIFKÒGTGPVMG[DQCTFU$[FGHCWNVQPN[
the keyboard for the language you set for iPhone (in International settings) is available. 
6QOCMGMG[DQCTFUHQTQVJGTNCPIWCIGUCXCKNCDNGWUG-G[DQCTFUGVVKPIU
Add a keyboard:
  1 +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFU
The number before the arrow shows the number of keyboards currently enabled.
  2 6CR#FF0GY-G[DQCTFVJGPEJQQUGCMG[DQCTFHTQOVJGNKUV
Repeat to add more keyboards. Some languages have multiple keyboards available.
For a list of supported iPhone keyboards, go to www.apple.com/iphone/specs.html.
Edit your keyboard list:  %JQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFUVJGP
tap Edit and do one of the following:
 To delete a keyboard, tap  , then tap Delete.
 To reorder the list, drag   next to a keyboard to a new place in the list.
248

5YKVEJKPI-G[DQCTFU
6QGPVGTVGZVKPCFKÒGTGPVNCPIWCIGUYKVEJMG[DQCTFU
Switch keyboards while typing:  Tap  . When you tap the symbol, the name of the 
PGYN[CEVKXCVGFMG[DQCTFCRRGCTUDTKG±[
You can also touch and hold   to display a list of available keyboards. To choose a 
MG[DQCTFHTQOVJGNKUVUNKFG[QWT°PIGTVQVJGPCOGQHVJGMG[DQCTFVJGPTGNGCUG
;HWVY[V\JOHUK
OVSK[VZ^P[JO
RL`IVHYKZ
Many keyboards provide letters, numbers, and symbols that aren’t visible on  
the keyboard.
Type letters, numbers, or symbols that aren’t on the keyboard:  Touch and hold the 
related letter, number, or symbol, then slide to choose a variation. On a Thai keyboard, 
for example, you can choose native numbers by touching and holding the related 
Arabic number.
Chinese
;QWECPWUGMG[DQCTFUVQGPVGT%JKPGUGWUKPIUGXGTCNFKÒGTGPVKPRWVOGVJQFU
KPENWFKPI2KP[KP%CPILKG9WDK*WCCPF<JW[KP;QWECPCNUQWUG[QWT°PIGTVQYTKVG
Chinese characters on the screen.
'PVGTKPI5KORNK°GFQT6TCFKVKQPCN%JKPGUG2KP[KP
Use the QWERTY keyboard to enter Pinyin for Chinese characters. As you type, 
suggested Chinese characters appear. Tap a suggestion to choose it, or continue 
entering Pinyin to see more options.
If you keep entering Pinyin without spaces, sentence suggestions appear.
Entering Chinese Cangjie
Use the keyboard to build Chinese characters from the component Cangjie keys. 
As you type, suggested Chinese characters appear. Tap a character to choose it, or 
EQPVKPWGV[RKPIWRVQ°XGVQVCNEQORQPGPVUVQUGGOQTGEJCTCEVGTQRVKQPU
249
Appendix A    +PVGTPCVKQPCN-G[DQCTFU

'PVGTKPI5KORNK°GF%JKPGUG5VTQMG9WDK*WC
7UGVJGMG[RCFVQDWKNF%JKPGUGEJCTCEVGTUWUKPIWRVQ°XGUVTQMGUKPVJGEQTTGEV
writing sequence: from left to right, top to bottom, outside to inside, and from inside 
to the closing stroke (for example, the Chinese character 圈 (circle) should begin with 
the vertical stroke 丨).
As you type, suggested Chinese characters appear (the most commonly used 
EJCTCEVGTUCRRGCT°TUV6CRCEJCTCEVGTVQEJQQUGKV
If you’re not sure of the correct stroke, enter an asterisk (*). To see more character 
options, type another stroke, or scroll through the character list.
Tap the match (匹配) key to show only characters that match exactly what you 
typed. For example, if you type 一一 (one one) and tap the match (匹配) key, the less 
commonly used 二 (two) appears as an exact match.
Entering Traditional Chinese Zhuyin
Use the keyboard to enter Zhuyin letters. As you type, suggested Chinese characters 
appear. Tap a suggestion to choose it, or continue entering Zhuyin letters to see more 
options. After you type an initial letter, the keyboard changes to show more letters.
If you keep entering Zhuyin without spaces, sentence suggestions appear.
'PVGTKPI*CPFYTKVVGP5KORNK°GFQT6TCFKVKQPCN%JKPGUG
9TKVG%JKPGUGEJCTCEVGTUFKTGEVN[QPVJGUETGGPYKVJ[QWT°PIGT#U[QWYTKVGEJCTCEVGT
strokes, iPhone recognizes them and shows matching characters in a list, with the 
closest match at the top. When you choose a character, its likely follow-on characters 
appear in the list as additional choices.
You can get some complex characters by writing two or more component characters. 
For example, enter 魚°UJVJGP巤 (bristle), to get 鱲RCTVKCNPCOGQH*QPI-QPI
International Airport), which appears in the character list with an arrow next to it. Tap 
the character to replace the characters you entered.
9KVJ5KORNK°GF%JKPGUGJCPFYTKVKPI4QOCPEJCTCEVGTUCTGCNUQTGEQIPK\GF
%QPXGTVKPI$GVYGGP5KORNK°GFCPF6TCFKVKQPCN%JKPGUG
Select the character or characters you want to convert, then tap Replace. See 
“Editing—Cut, Copy, and Paste” on page 39.
250 Appendix A    +PVGTPCVKQPCN-G[DQCTFU

Drawing Chinese Characters
9JGP5KORNK°GFQT6TCFKVKQPCN%JKPGUGJCPFYTKVKPIHQTOCVUCTGVWTPGFQP[QWECP
GPVGT%JKPGUGEJCTCEVGTUYKVJ[QWT°PIGTCUUJQYP
;V\JOWHK
Japanese
;QWECPGPVGT,CRCPGUGWUKPIVJG-CPC39'46;QT'OQLKMG[DQCTFU;QWECPCNUQ
enter facemarks.
Entering Japanese Kana
7UGVJG-CPCMG[RCFVQUGNGEVU[NNCDNGU(QTOQTGU[NNCDNGQRVKQPUVCRVJGCTTQYMG[
and select another syllable or word from the window.
Entering Japanese QWERTY
Use the QWERTY keyboard to input code for Japanese syllables. As you type, 
suggested syllables appear. Tap the syllable to choose it.
Entering Emoji Picture Characters
Use the Emoji keyboard. Available only on iPhone models purchased and used in Japan.
Entering Facemarks
7UKPIVJG,CRCPGUG-CPCMG[DQCTFVCRVJG¥@A@¦MG[
Using the Japanese Romaji keyboard (QWERTY-Japanese layout), tap the Number   
MG[VJGPVCRVJG¥@A@¦MG[
7UKPIVJG%JKPGUG5KORNK°GFQT6TCFKVKQPCN2KP[KPQT6TCFKVKQPCN<JW[KPMG[DQCTFU
tap the Symbols  MG[VJGPVCRVJG¥@A@¦MG[
251
Appendix A    +PVGTPCVKQPCN-G[DQCTFU

-QTGCP
7UGVJG5GV-QTGCPMG[DQCTFVQV[RG*CPIWNNGVVGTU6QV[RGFQWDNGEQPUQPCPVUQT
compound vowels, touch and hold the letter, then slide to choose the double letter.
Vietnamese
Touch and hold a character to see the available diacritical marks, then slide to choose 
the one you want.
You can also type the following key sequences to enter characters with diacritical marks:
 aa—âCEKTEWO±GZ
aw —ă (a caron)
 ee—êGEKTEWO±GZ
 oo—ôQEKTEWO±GZ
ow —ơ (o hook)
 w—ư (u hook)
 dd—đ (d dash)
 as—á (a acute)
 af—à (a grave)
 ar—ả (a question mark)
 ax—ã (a rising accent)
 aj—ạ (a drop tone)
252 Appendix A    +PVGTPCVKQPCN-G[DQCTFU

Creating Dictionaries
When using certain Chinese or Japanese keyboards, you can create a dictionary 
of word and input pairs. When you type a word from the dictionary while using a 
supported keyboard, the associated input is substituted for the word. The dictionary is 
available for the following keyboards:
%JKPGUG5KORNK°GF2KP[KP 
Chinese - Traditional (Pinyin) 
Chinese - Traditional (Zhuyin) 
Japanese (Romaji) 
,CRCPGUG6GP-G[ 
Add a word to the dictionary:  +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF 'FKV7UGT
&KEVKQPCT[6CRVCRVJG9QTF°GNFCPFGPVGTVJGYQTFVJGPVCRVJG;QOK2KP[KPQT
<JW[KP°GNFCPFGPVGTVJGKPRWV
You can have multiple inputs for each word, based on which keyboards are turned on.
Delete a word from the dictionary:  Tap the word in the User Dictionary list, then tap 
Delete Word.
253
Appendix A    +PVGTPCVKQPCN-G[DQCTFU

Support and Other Information B
Appendix
Apple iPhone Support Site
Comprehensive support information is available online at  
www.apple.com/support/iphone. You can also use Express Lane for personalized 
support (not available in all countries or regions). Go to expresslane.apple.com. 
Restarting and Resetting iPhone
If something isn’t working right, try restarting iPhone, force quitting an app, or 
resetting iPhone.
Restart iPhone:  2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPWPVKNVJGTGFUNKFGT
CRRGCTU5NKFG[QWT°PIGTCETQUUVJGUNKFGTVQVWTPQÒK2JQPG6QVWTPK2JQPGDCEMQP
RTGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPWPVKNVJG#RRNGNQIQCRRGCTU
+H[QWECP¨VVWTPQÒK2JQPGQTKHVJGRTQDNGOEQPVKPWGU[QWOC[PGGFVQTGUGVK2JQPG
#TGUGVUJQWNFDGFQPGQPN[KHVWTPKPIK2JQPGQÒCPFQPFQGUP¨VTGUQNXGVJGRTQDNGO
Force quit an app:  2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPHQTCHGYUGEQPFU
until a red slider appears, then press and hold the Home   button until the app quits.
You can also remove an app from the recents list to force it to quit. See “Opening and 
Switching Apps” on page 29.
Reset iPhone:  2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPCPFVJG*QOGDWVVQPCV
the same time for at least ten seconds, until the Apple logo appears.
254

Backing Up iPhone
iTunes creates backups of settings, downloaded apps and data, and other information 
on iPhone. You can use a backup to restore these items to your iPhone after a software 
restore or to transfer the information to another iPhone. See “Updating and Restoring 
iPhone Software” on page 256.
Backing up iPhone or restoring from a backup isn’t the same as syncing content and 
other items (such as music, podcasts, ringtones, photos, videos, and apps that you 
download via iTunes) with your iTunes library. Backups include settings, downloaded 
apps and data, and other information on iPhone. After you restore iPhone, you need to 
sync again to get your music, videos, photos, apps, and other content back on iPhone. 
See “Restoring from a Backup” on page 257.
Apps downloaded from the App Store are backed up the next time you sync with 
iTunes. Afterwards, only app data is backed up when you sync with iTunes.
Creating a Backup
iTunes creates a backup of iPhone when you:
Sync with iTunes 
By default, iTunes syncs iPhone each time you connect iPhone to your computer. 
See “Syncing with iTunes” on page 53. iTunes won’t automatically back up an iPhone 
VJCVKUP¨VEQP°IWTGFVQU[PEYKVJVJCVEQORWVGT;QWECPCNUQU[PEOCPWCNN[D[
clicking Sync in iTunes. Note that iTunes creates a backup only once each time 
K2JQPGKUEQPPGEVGFVQ[QWTEQORWVGTDGHQTGVJG°TUVU[PEVJCVQEEWTU+H[QWU[PE
again, iTunes doesn’t create another backup.
Update iPhone 
K6WPGUDCEMUWRK2JQPGDGHQTGWRFCVKPIK2JQPGGXGPKHKVKUP¨VEQP°IWTGFVQU[PE
with iTunes on that computer.
Restore iPhone (if you choose to back up) 
iTunes asks if you want to back up iPhone before restoring it.
For more information about backups, including the settings and information stored in 
a backup, go to support.apple.com/kb/HT1766.
255
Appendix B    Support and Other Information

Removing a Backup
You can remove a backup of iPhone from the list of backups in iTunes. You may want 
to do this, for example, if a backup was created on someone else’s computer.
Remove a backup:
  1  In iTunes, open iTunes Preferences.
 Mac:  Choose iTunes > Preferences.
 Windows:  Choose Edit > Preferences.
  2  Click Devices (iPhone doesn’t need to be connected).
  3  Select the backup you want to remove, then click Delete Backup.
  4 %QP°TO[QWYKUJVQTGOQXGVJGUGNGEVGFDCEMWRD[ENKEMKPI&GNGVG$CEMWR
  5 %NKEM1-VQENQUGVJGK6WPGU2TGHGTGPEGU9KPFQY
Updating and Restoring iPhone Software
You can use iTunes to update or restore iPhone software.
 If you update, the iPhone software is updated. Your downloaded apps, settings,  
CPFFCVCCTGP¨VCÒGEVGF
Note:  In some cases, an update may also involve restoring iPhone.
 If you restore, the latest version of iPhone software is reinstalled, settings are restored 
to their default, and all data stored on iPhone is deleted, including downloaded 
apps, songs, videos, contacts, photos, calendar information, and any other data. If 
you’ve backed up iPhone with iTunes on your computer, you can restore data from 
the backup at the end of the restore process.
Deleted data is no longer accessible via the iPhone user interface, but it isn’t erased 
from iPhone. For information about erasing all content and settings, see “Resetting 
iPhone” on page 201.
If you use a Bluetooth headset or car kit with iPhone and you restore settings, you 
must pair the Bluetooth device with iPhone again to use it.
For more information about updating and restoring iPhone software, go to  
support.apple.com/kb/HT1414.
256 Appendix B    Support and Other Information

Updating iPhone
Make sure you have an Internet connection and have installed the latest version  
of iTunes from www.apple.com/itunes.
Update iPhone:  
  1  Connect iPhone to your computer.
  2  In iTunes, select iPhone in the Devices list, then click Summary at the top of the screen.
  3  Click “Check for Update.” iTunes tells you if there’s a newer version of the iPhone 
software available.
  4  Click Update to install the latest version of the software.
Restoring iPhone
Make sure you have an Internet connection and have installed the latest version of 
iTunes from www.apple.com/itunes.
Restore iPhone:  
  1  Connect iPhone to your computer.
  2  In iTunes, select iPhone in the Devices list, then click Summary at the top of the screen.
  3  Click “Check for Update.” iTunes tells you if there’s a newer version of the iPhone 
software available.
  4  Click Restore. Follow the onscreen instructions to complete the restore process. When 
restoring, it is recommended that you back up iPhone when prompted.
When the iPhone software has been restored, you can either set it up as a new iPhone, 
or restore your music, videos, app data, and other content from a backup.
After you restore from a backup, previous data is no longer accessible through the 
iPhone user interface, but it isn’t erased from iPhone. For information about erasing all 
content and settings, see “Resetting iPhone” on page 201.
Restoring from a Backup
You can restore the settings, app data, and other information from a backup, or use 
this feature to transfer these items to another iPhone. Make sure you have an Internet 
connection and have installed the latest version of iTunes from www.apple.com/itunes.
Important:  Restoring from a backup is not the same as restoring iPhone from the 
Summary pane in iTunes. See “Restoring iPhone” on page 257. Restoring from a backup 
does not fully restore iPhone software. Also, restoring iPhone from a backup restores 
all data in the backup, including data for apps. If you choose an old backup, restoring 
from it could replace the app data with data that is not current.
257
Appendix B    Support and Other Information

If you restore iPhone from a backup of some other iPhone or iPod touch, some 
passwords and settings may not be restored. (Additional, but still not all, passwords 
and settings may be restored if the backup is encrypted.) For more information about 
the settings and information stored in a backup, go to support.apple.com/kb/HT1766.
Restore iPhone from a backup:  
  1  Connect iPhone to the computer you normally sync with.
  2  In iTunes, Control-click iPhone in the Devices list and choose “Restore from Backup” 
from the menu that appears.
  3  Choose the backup that you want to restore from the pop-up menu, then click Restore.
If your backup is encrypted, enter your password.
Safety, Software, and Service Information
This table describes where to get more iPhone-related safety, software, and service 
information.
To learn about Do this
Using iPhone safely See the Important Product Information Guide  at 
www.apple.com/support/manuals/iphone for the 
latest safety and regulatory information.
iPhone service and support, tips, forums, and 
Apple software downloads
Go to www.apple.com/support/iphone.
Service and support from your carrier Contact your carrier or go to your carrier’s 
website.
The latest information about iPhone Go to www.apple.com/iphone.
Using iTunes Open iTunes and choose Help > iTunes Help.  
For an online iTunes tutorial (may not be 
available in all countries and regions), go to  
www.apple.com/support/itunes.
Creating an Apple ID Go to appleid.apple.com.
MobileMe Go to www.me.com.
Using iPhoto on Mac OS X Open iPhoto and choose Help > iPhoto Help.
Using Address Book on Mac OS X Open Address Book and choose Help > Address 
Book Help.
Using iCal on Mac OS X Open iCal and choose Help > iCal Help.
Microsoft Outlook, Windows Address Book,  
or Adobe Photoshop Elements
See the documentation that came with  
those apps.
258 Appendix B    Support and Other Information

To learn about Do this
Finding your iPhone serial number, 
International Mobile Equipment Identity (IMEI), 
QT/QDKNG'SWKROGPV+FGPVK°GT/'+&
;QWECP°PF[QWTK2JQPGUGTKCNPWODGTCPF+/'+
(GSM models) or MEID (CDMA model) on the 
iPhone packaging. Or, on iPhone, choose Settings 
> General > About. In iTunes on your computer, 
hold down the Control key and choose Help 
> About iTunes (Windows) or iTunes > About 
iTunes (Mac), then release the Control key. (Press 
the Space bar to pause the scrolling.)
Obtaining warranty service First follow the advice in this guide and online 
resources. Then go to www.apple.com/support 
or see the Important Product Information Guide at 
www.apple.com/support/manuals/iphone.
Battery replacement service Go to  
www.apple.com/support/iphone/service/battery.
Using iPhone in an Enterprise Environment
Go to www.apple.com/iphone/business to learn more about enterprise features of 
iPhone, including:
Microsoft Exchange 
+PUVCNNKPIEQP°IWTCVKQPRTQ°NGU 
CalDAV 
CardDAV 
IMAP 
LDAP 
VPN 
Using iPhone with Other Carriers
Some carriers let you unlock iPhone for use with their network. To determine if your 
ECTTKGTQÒGTUVJKUQRVKQPIQVQsupport.apple.com/kb/HT1937. 
Contact your carrier for authorization and setup information. You’ll need to connect 
iPhone to iTunes to complete the process. Additional fees may apply.
For troubleshooting information, go to support.apple.com/kb/TS3198.
259
Appendix B    Support and Other Information

Disposal and Recycling Information
Apple Used Mobile Phone Recycling Program (available in some areas):  For free 
recycling of your old mobile phone, a prepaid shipping label, and instructions, see: 
www.apple.com/recycling
iPhone Disposal and Recycling:  You must dispose of iPhone properly according to 
local laws and regulations. Because iPhone contains electronic components and a 
battery, iPhone must be disposed of separately from household waste. When iPhone 
reaches its end of life, contact local authorities to learn about disposal and recycling 
QRVKQPUQTUKORN[FTQRKVQÒCV[QWTNQECN#RRNGTGVCKNUVQTGQTTGVWTPKVVQ#RRNG6JG
battery will be removed and recycled in an environmentally friendly manner. For more 
information, see:  www.apple.com/recycling
European Union—Electronics and Battery Disposal Information:  
This symbol means that according to local laws and regulations your product and 
its battery should be recycled separately from household waste. When this product 
reaches its end of life, take it to a collection point designated by local authorities for 
the recycling of electronic equipment. The improper disposal of waste electronic 
GSWKROGPVHTQOVJGEQPUWOGTOC[DGUWDLGEVVQ°PGU6JGUGRCTCVGEQNNGEVKQPCPF
recycling of your product and its battery at the time of disposal will help conserve 
natural resources and ensure that it is recycled in a manner that protects human 
health and the environment.
For collection and recycling services for iPhone, go to:  
www.apple.com/recycling/nationalservices/europe.html
Battery Replacement for iPhone:  The rechargeable battery in iPhone should be 
replaced only by an authorized service provider. For battery replacement services go 
to:  www.apple.com/support/iphone/service/battery
Deutschland:  Dieses Gerät enthält Batterien. Bitte nicht in den Hausmüll werfen. 
Entsorgen Sie dieses Gerätes am Ende seines Lebenszyklus entsprechend der 
maßgeblichen gesetzlichen Regelungen.
Nederlands:  Gebruikte batterijen kunnen worden ingeleverd bij de chemokar of in een 
speciale batterijcontainer voor klein chemisch afval (kca) worden gedeponeerd.
260 Appendix B    Support and Other Information

Türkiye:  EEE yönetmeliğine (Elektrikli ve Elektronik Eşyalarda Bazı Zararlı Maddelerin 
Kullanımının Sınırlandırılmasına Dair Yönetmelik) uygundur.
 Brazil—Disposal Information:  
Brasil—Informações sobre descarte e reciclagem:  O símbolo indica que este produto 
e/ou sua bateria não devem ser descartadas no lixo doméstico. Quando decidir 
descartar este produto e/ou sua bateria, faça-o de acordo com as leis e diretrizes 
ambientais locais. Para informações sobre o programa de reciclagem da Apple, pontos 
de coleta e telefone de informações, visite www.apple.com/br/environment.
Apple and the Environment
At Apple, we recognize our responsibility to minimize the environmental impacts  
of our operations and products. For more information, go to:  
www.apple.com/environment
iPhone Operating Temperature
If the interior temperature of iPhone exceeds normal operating temperatures, you may 
experience the following as it attempts to regulate its temperature:
iPhone stops charging 
the screen dims 
the cellular signal is weak 
a temperature warning screen appears 
Important:  You cannot use iPhone while the temperature warning screen is displayed, 
except to make an emergency call. If iPhone can’t regulate its internal temperature, it 
goes into deep sleep mode until it cools. You cannot make an emergency call when 
iPhone is in this mode. Move iPhone to a cooler location and wait a few minutes 
before trying to use iPhone again.
261
Appendix B    Support and Other Information

 Index
1xRTT
network  22, 23, 63
status icon  17
3G
enabling  23
network  22, 23, 63
status icon  17
12-hour time  19 8
24-hour time  198
480p format  170
720p format  102, 121, 17 0
A
accessibility
features  229
hearing aid compatibility  247
Large Text  243
Mono Audio  244
setting up iPhone using VoiceOver  21
settings  200
Speak Auto-text  244
Triple-click Home  245
TTY machine  206
VoiceOver  230
White on Black  244
Zoom  243
accounts
about  25
Google, Yahoo!, and AOL  28
Microsoft Exchange  27
MobileMe  26
“push”  52, 203
restricting  197
settings  202
activating iPhone  21
adding a call  63
adjusting brightness  191
Adobe Photoshop Elements  57, 117
airplane mode
settings  187
status icon  17
turning on  187
AirPlay
music playback  93
streaming to a TV  89, 102, 121, 131
viewing photos, videos, and slideshows  121
viewing web videos on a TV  89
watching videos  102
watching YouTube videos on a TV  131
AirPrint  41
See also printing
alarm status icon  18
alarms
deleting  152
setting  152
VWTPKPIQPQTQÒ152
album artwork  96
album tracks  97
alerts
adjusting volume  12, 191
calendar  116
Ping  168
VWTPKPIQPQTQÒ191
voicemail  68
alternate audio language  101
answering calls  46
anti-phishing. See Safari fraud warning
AOL  148
App Store
about  175
browsing  176
deleting apps  179
Genius  176
restricting  197
store account  175, 212
syncing  53
syncing purchased content  180
updating apps  180
verifying purchases  174
Apple ID
about  258
creating in App Store  178
creating in Game Center  182
creating in iTunes  21
creating in iTunes Store  169, 170, 171
Index
262

creating in MobileMe  26
creating in Store settings  212
Apple TV  89, 93, 102, 121, 131
#RRNG9KTGNGUU-G[DQCTF40, 231
apps
deleting  179
force quitting  30, 51, 254
opening  29
overview  14
removing from recents list  30
restricting deletion  197
switching between  30
viewing recent  29
attachments, email  79
audio
alternate language  101
mono  244
audiobooks, syncing  53
Auto-Brightness  191
AutoFill  88, 208
auto-lock, setting time for  195
AV cables  103, 121
B
backing up iPhone  55
backups
creating  255
removing  256
restoring from  257
battery
charging  48
low on power  49
maximizing life  49
replacing  49, 259
status icon  18
birthdays, viewing in Calendar  112
Bluetooth
car kit  47, 194, 256
°PFKPICFFTGUU192
headset  161, 256
pairing devices  47
status  48
status icon  18
VWTPKPIQPQTQÒ194
unpairing device  48
using with Phone  63
bookmarking
map locations  145
webpages  89
YouTube videos  130, 131
bookmarks, syncing  53, 56, 89
books
accessibility  227
annotating  225
brightness  226
FG°PKPIYQTFU227
°PFKPI224
iBooks  223
purchasing  224
reading  225, 226
searching  227
syncing  53, 224
text size  226
braille, display using VoiceOver  242
brightness
adjusting  191
iBooks  226
setting to adjust automatically  191
browse buttons, changing  105
browser cache, clearing  209
browsing
album artwork  96
App Store  176
iTunes Store  166
YouTube videos  129
business, using iPhone  259
DWUKPGUUGU°PFKPI144
C
cable, Dock Connector to USB  11, 21
cables
Component AV cable  89, 102, 121, 131
Composite AV cable  89, 102, 121, 131
Digital AV Adapter  89, 102, 121, 131
VGA Adapter  89, 102, 131
cache, clearing browser  209
Calculator
UEKGPVK°E155
standard  154
CalDAV  111
Calendar
about  111
adding an event  113
birthdays  112
CalDAV  111
deleting an event  114
KORQTVKPIKEU°NGUHTQOGOCKN116
searching  113
updating an event  114
views  112
calendars, syncing  53, 55, 111
calibrating Nike + iPod  222
call forwarding
setting up  70
settings  206
status icon  17
call options  63
call waiting
VWTPKPIQPQTQÒ71
ECNNYCKVKPIVWTPKPIQPQTQÒ206
caller ID
VWTPKPIQPQTQÒ71, 206
Index 263

Camera
deleting photos  127
exposure  127
±CUJUGVVKPIU127
focus  127
front camera  66, 12 7
HDR photos  126
main camera  66, 127
restricting  196
seeing photos and videos you’ve taken  127
taking photos  12 6
upload photos to your computer  12 8
Cangjie  249
caps lock, enabling  198
car kit  47, 194, 256
CardDAV  213
carrier services  207
Cc  204
cell signal, status icon  17
cellular data network  23
charging battery  48
Chinese keyboard  249, 253
cleaning iPhone  51
clearing playlists  100
clocks, adding  151
ENQUGFECRVKQPKPIVWTPKPIQPQTQÒ210
Compass
current coordinates  158
heading  158
true and magnetic north  15 8
complete an album  170
Component AV Cable  103, 121
Composite AV Cable  103, 121
computer requirements  19
conference calls  64
connecting to Internet  22
contacts
adding and editing  215
adding from Maps  145
adding from text messages  110
assigning photo to  124
CardDAV  213
favorite  70
GAL (Global Address List)  81, 214
LDAP (Lightweight Directory Access 
Protocol)  214
seeing info from Phone  63
seeing location of  138
send info by email  82
setting how displayed  205
setting how sorted  205
syncing  53, 55, 213
using to call someone  60
using to make a FaceTime video call  65
Yahoo! Address Book  55
controls, using  29
converting, videos  103
cookies  208
copying
images  122
photos and videos in MMS messages  108
text  39
Cover Flow  96
current approximate location  142, 158
cutting and pasting text  39
D
data protection  50, 195
data roaming  23, 73, 193
data, erasing  26, 50, 196, 201
date and time, setting  198
date format  200
debug console  209
declining calls  62
deleting
alarms  152
all content and settings  50, 201
apps  179
clocks  151
contacts  215
contacts from Favorites  70
email account  203
email messages  82
notes  149
photos  127
playlists  100
removing  256
songs from a playlist  99
videos  103
YouTube playlists  133
YouTube videos from a playlist  133
developer settings  209
dialing
hard pause  61, 215
manually  61
redial last phone number  61
soft pause  61, 215
dictionary  253
Digital AV Adapter  89, 102, 121, 131
directions, getting  142
disconnecting iPhone from computer  22
Dock Connector  160
Dock Connector to USB cable  11, 21
downloading
apps  178
podcasts  172
E
earphones
about  11, 46
center button  11, 61, 62, 63, 93, 95, 101
See also headset
Index
264

EDGE
network  22, 23, 63
status icon  17
editing
playlists  99
text  39
text conversations  109
text using VoiceOver  237
videos  128
GÒGEVUUQWPFUVWTPKPIQPQTQÒ191
emergency calls  67
Emoji  251
ending calls  46
enterprise, using iPhone in  259
ePub books  224
equalizer  210
erasing data  26, 50, 196, 201
EV-DO
network  22, 23, 63
status icon  17
Exchange. See Microsoft Exchange
exposure  127
external keyboards  40
F
facemarks  251
FaceTime
about  65
calling someone you've texted  110
in contact information  216
restricting  197
saving as favorite  70
settings  206
VWTPKPIQPQTQÒ206
favorites
calling a contact from  60, 70
managing  70
sending text messages  108
Fetch New Data  203
°NGHQTOCVUUWRRQTVGF79
°NGUJCTKPI56
Find My iPhone  26, 51
±CUJUGVVKPIUHQT%COGTC127
focus  127
folders, Home screen  33
force quit an app  30, 51, 254
formats
date, time, and telephone number  200
forwarding messages  82
G
GAL (Global Address List)  81, 214
Game Center
about  181
account information  186
achievements  184
downloading games  182
friends  185
inviting friends  183
leaderboards  184
playing games  183
recently played games  185
restricting friend requests  198
restricting multiplayer games  198
setting up  181
status information  186
Genius Mixes  92, 98
Genius playlists  58, 94, 98
Genius
App Store  176
iTunes Store  167
gestures, VoiceOver  232
getting help  258
getting started  19
Google  148
Contacts  55
searching the web  88
GPRS
network  22, 23, 63
status icon  17
GPS  139
grab points  40
H
HAC  247
hands-free phone calls  63, 19 4
hard pause  61, 215
hardware keyboards  40
HD video  102, 121, 17 0
HDMI cable  103, 121
HDR photos  126, 211
headset
center button  127, 130, 161
using with Voice Memos  160
See also earphones
headset button. See mic button
hearing aid compatibility  247
help, getting  258
JKIJFG°PKVKQP*&XKFGQ102, 121, 17 0
hold, putting calls on  63
Home screen  12, 29
adding web clips  90
customizing  33
folders  33
wallpaper  36, 124, 192
Home Sharing  104
hybrid view  141
I
iBooks
about  223
brightness  226
Index 265

FG°PKPIYQTFU227
°PFKPICPFRWTEJCUKPIDQQMU224
organizing the bookshelf  228
printing or emailing a PDF  227
reading books  225
reading PDFs  226
searching  227
syncing bookmarks and notes  228
syncing books and PDFs  224
text size  226
iBookstore  223
iCal  55, 258
ICCID number  192
icons
apps  14
status  17
images
copying  122
pasting  122
IMAP
accounts  75, 148
searching email  84
IMEI number  192, 259
installing apps from the App Store  178
international keyboards  199, 200, 248
Internet connection, sharing  24
Internet, connecting to  22
iPhoto  57, 258
iPod
changing browse buttons  105
converting videos for iPhone  103
deleting videos  103
Genius Mixes  98
Genius playlists  98
headset controls  46
on-the-go playlists  133
playing songs using Voice Control  95
playlists  99
TGRGCVKPIQTUJWÔKPIUQPIU94
searching  97, 101
settings  210
5JCMGVQ5JWÔG92, 210
sleep timer  104
iTunes Store
about  165
account  20, 165, 17 0, 175, 212
browsing  166
checking download status  172
Genius recommendations  167
purchasing ringtones  169
purchasing songs and albums  170
restricting  197
streaming or downloading podcasts  172
syncing purchased content  173
verifying purchases  174
iTunes U, syncing  53, 56
iTunes
getting help  258
settings panes  54
J
Japanese keyboard  251, 253
JavaScript  208
K
-CPC251
kaomoji (facemarks)  251
keyboards
#RRNG9KTGNGUU-G[DQCTF40
Emoji  251
external  237
hardware  40
international  248
layouts  40
switching  249
switching languages  40
typing on  37
-G[PQVG°NGU79
keypad
adding a contact from  215
dialing manually  60, 245
displaying by default with VoiceOver  237
entering information during a call  63
making an emergency call  67
pasting a number to  61
-QTGCMG[DQCTF252
L
languages, switching keyboard  40
Large Text  243
LDAP (Lightweight Directory Access Protocol)  214
.'&±CUJ127
links
in email  78
on webpages  86
location. See Maps
location services
resetting location warnings  201
restricting  197
settings  194
status icon  18, 139
using with Camera  125
using with Compass  157
using with Maps  137
location warnings  201
Lock screen wallpaper  36, 124, 192
lock status icon  17
locking iPhone  11, 12, 17
lyrics, displaying  93
Index
266

M
Mac system requirements  19
magnetic north  157
Mail
account setup  75, 202
attachments  79
Cc  204
checking for new messages  76, 82
deleting email account  203
deleting messages  82
forwarding messages  82
links  78
load additional messages  77
marking messages as unread  77
opening drafts  81
organizing email  83
password settings  203
printing messages and attachments  80
reading messages  76
replying to messages  81
resizing text column  77
saving drafts  81
searching  84
seeing recipients  77
sending email to someone you’ve texted  110
sending messages  81
sending photos and videos  81
sending webpage URL via email  87
sending YouTube video links  130, 131
settings  202, 203
sharing contact information  82
signatures  204
storing email on iPhone or server  202
syncing email account settings  53
viewing attachments  79
Yahoo! email account  52
zooming in a message  77
Maps
adding location to a contact  145
bookmarking location  145
current approximate location  139, 142
dropped pin  140
°PFKPICNQECVKQP138
°PFKPIDWUKPGUUGU144
getting directions  142
GPS  139
hybrid view  141
satellite view  141
seeing location of a contact  138
sharing a location  145
VTCÓEEQPFKVKQPU144
zooming  138
MEID number  192, 259
merging calls  64
Messages
contacting someone you’ve texted  110
editing conversations  109
following links in messages  110
previews  110
replying to messages  107
saving a photo or video clip  108
saving conversations  107
sending a photo or video clip  108, 109
sending messages  106
sending messages to a group  107
setting alert sounds  110
settings  209
show earlier messages  107
mic button  46
microphone
about  46
built-in  160
muting  63
microphone, external  160
/KETQUQHVCRRNKECVKQP°NGU79
Microsoft Exchange  81, 213
push accounts  52
searching email  84
setting up account  27
syncing  27, 111
Microsoft Internet Explorer  56, 89
Microsoft Outlook  55, 56, 14 8
missed calls
number of  68
returning  60
MMS
about  106
sending a link to a location  145
sending an address  140
sending a voice memo  163
sending photos and videos  117
settings  209
See also Messages
MobileMe  148, 213
getting help  258
push accounts  52
searching email  84
security features  51
sending photos to a gallery  122
setting up account  26
syncing  89, 111
model number  192
OQFGO°TOYCTGXGTUKQP192
Mono Audio  244
movies
rented  56, 102, 103
syncing  53
music
lyrics  93
managing manually  55
Index 267

previewing  170
purchasing  170
searching  97
syncing  53, 56
See also iPod
music videos, syncing  53
muting a call  63, 66
N
navigating. See panning, scrolling
network activity status icon  17
networks  189
Nike + iPod
activating  219
calibrating  222
linking a sensor  220
sending workouts to nikeplus.com  221
settings  212, 222
working out with  220
nikeplus.com  221
north, true and magnetic  157
Notes  149
searching  150
syncing  53, 148
NTSC  211
0WODGTU°NGU79
numeric keypad
adding a contact from  215
dialing manually  60, 245
displaying by default with VoiceOver  237
entering information during a call  63
making an emergency call  67
pasting a number to  61
O
1P1Ò5NGGR9CMGUYKVEJ12, 127
opening apps  29
orientation, changing  85
Outlook Express. See Windows Address Book
Outlook. See Microsoft Outlook
overview, iPhone apps  14
P
2CIGU°NGU79
pairing with Bluetooth headset  47
PAL  211
panning
maps  138
webpages  86
parental controls. See Restrictions
passcode  195
password, changing voicemail  207
pasting
images  122
photos and videos in MMS messages  108
text  39
pause, while dialing  61, 215
pausing songs and videos  46
PC system requirements  19
PDFs
emailing  227
printing  89, 227
reading in iBooks  226
syncing  224
viewing in Mail  79
Personal Hotspot  24
phone network name  192
Phone
adding and editing contacts  215
adding calls  63
answering calls  46, 62
call waiting  71, 206
caller ID  71
calling internationally  73
calling someone you’ve texted  110
carrier services  207
changing voicemail password  207
conference calls  64
declining calls  46, 62
emergency calls  67
ending calls  46, 63
FaceTime video calls  65, 197
forwarding calls  70, 206
hands-free  63
locking SIM card  207
making calls  60
merging calls  64
missed calls  68
muting calls  63, 66
putting calls on hold  63
ring mode  72
second calls  64
setting up voicemail  68
settings  206
silencing calls  62
silent mode  72
switching between calls  46, 64
VWTPKPIECNNGT+&QPQTQÒ206
turning on vibrate  72
unpairing Bluetooth device  48
using Bluetooth devices  63
using favorites  70
using speakerphone  63
using TTY machine  206
video calls  197, 206
voice dialing  61
voicemail  68
voicemail alerts  68
photo albums  120
photos
assigning to contacts  124
emailing  122
Index
268

printing  124
saving MMS attachments  108
sending in email messages  81
sending in MMS messages  108
syncing  53, 57, 117
taking  12 6
using as wallpaper  36, 124, 192
Photos
playing music during slideshow  120
settings  120, 211
viewing slideshows  120
zooming photos  119
See also Camera
pictures. See Camera, Photos
PIN number  207
Ping
alerts  168
following artists and friends  167
in iTunes Store  167
restricting  197
while listening to music  94
Pinyin  249, 253
play, status icon  18
playlist folders  56, 92
playlists  99
podcasts
downloading  172
streaming  172
syncing  53, 56
pop-ups  208
Portrait orientation lock status icon  18
power adapter  11
power, low  49
previewing
music  170
ringtones  169
text messages  110
videos  170
Print Center  42
printing
AirPrint printers  41
cancelling  42
email messages and attachments  80
overview  41
photos  124
setting up  41
status  42
webpages  89
RTQ°NGUUGVVKPIU201
purchased content, syncing  173, 180
purchasing
apps  175
music  165, 17 0
ringtones  169
videos  170
push accounts  52, 203
R
reading email  76
recent calls  60
rechargeable batteries  49
redialing last phone number  61
removing backups  256
renting movies and TV shows  56, 102, 103, 17 0
repeating songs  94
replacing battery  49, 259
replying to messages  81
requirements for using iPhone  19
resetting iPhone  51, 254
resizing webpage columns  86
restarting  51, 254
restoring iPhone software  256
restoring settings and information  257
restrictions, setting  196
ring mode  13, 72, 191
ringer
adjusting volume  12, 191
VWTPKPIQPQTQÒ191
Ring/Silent switch  13, 72
ringtones
previewing  169
purchasing  169
setting  72, 191
syncing  53
roaming  73
Romaji  253
rotor control  234
S
Safari
anti-phishing  208
AutoFill  88, 208
bookmarking webpages  89
clearing cache  209
cookies  208
creating a new or adding to an existing 
contact  87
creating a preaddressed Mail message  87
Debug Console  209
developer settings  209
fraud warning  208
Home screen web clips  90
JavaScript  208
navigating  87
opening webpages  85, 87
pop-ups  208
printing webpages  89
reloading webpages  86
TGUK\KPIEQNWOPUVQ°VUETGGP86
restricting  196
saving images to your Photo Library  87
searching  88
Index 269

security  208
settings  208
stopping webpages from loading  86
syncing bookmarks  53, 56
V[RKPIKPVGZV°GNFU88
zooming webpages  86
satellite view  141
screen  191
setting to adjust automatically  191
using  29
screen reader  21
screenshot, taking a  127
scrolling
about  30
maps  138
webpages  86
search engine  208
searching
App Store  176
audio content  97
calendars  113
global  43
iTunes Store  166
Mail messages  84
notes  150
Spotlight Search setting  195
video content  101
webpage text  88
Wikipedia  43
YouTube videos  130
security
erase data after ten failed passcode attempts  196
features  50
Find My iPhone  26, 51
setting passcode for iPhone  195
web  208
selecting text  39
sending
email  81
photos and video clips  108
photos from Photos  122
text messages  106
voice memos  109
sensor, Nike + iPod  220
UGTKCNPWODGT°PFKPI192, 259
service and support information  258
settings
accessibility  200
accounts  202
airplane mode  187
alarms  152
alerts  110, 116
auto-capitalization  198
auto-correction  39, 198
auto-lock  195
Bluetooth  194
brightness  191
Calendar  112, 116
data roaming  193
date and time  112, 198
developer  209
email server  203
Fetch New Data  203
HDR photos  211
international  200
iPod  210
keyboard  198
language  200
location services  194
Mail, Contacts, Calendars  202
Mail  202
messages  209
network  193
Nike + iPod  212, 222
PQVK°ECVKQPU190
passcode lock  195
Phone  206
Photos  120, 211
RTQ°NGU201
resetting  201
restrictions  196
Safari  88, 208
screen brightness  191
search  195
security  208
5JCMGVQ5JWÔG210
slideshow  120
sound  110, 11 6
Store  212
temperature  147
TV out  211
usage statistics  192
vibrate  72
video  210
VoiceOver  229
VPN  193
wallpaper  36, 192
Wi-Fi  189
5JCMGVQ5JWÔG92, 210
sharing Internet connection  24
sharing photos and videos
in email messages  81
in MMS messages  108
UJWÔKPIUQPIU94
signatures, email  204
silencing calls  62
silent mode  13, 72, 191
SIM card, locking  207
5KORNK°GF%JKPGUG250
sleep. See locking iPhone
sleep timer  104
slideshows  120
Index
270

settings  211
viewing  120
SMS  106
See also Messages
soft pause  61, 215
software
getting help  258
updating and restoring  256
version  192
sound
adjusting ringer and alerts volume  191
adjusting volume  12, 46
calendar alert  116
setting limit  210
setting ringtone  191
VWTPKPIQPQTQÒ191
Sound Check  210
UQWPFGÒGEVU12
Speak Auto-text  244
speakerphone  63
spell checking  39
Spotlight Search settings  195
SSL  203
UVCPFCTFFG°PKVKQP5&XKFGQ170
star next to a phone number  216
Starbucks, browsing and purchasing music  166
status icons  17
stock information, Yahoo!  13 6
Stocks, adding and deleting quotes  135
stopwatch, using  153
storage capacity  192
Store, settings  212
streaming podcasts  172
subtitles  101
UWT°PIVJGYGD85
switching between calls  64
switching between cameras  66, 12 7
syncing
bookmarks and notes in iBooks  228
calendars  111
getting calls during  22
Google Contacts  55
iTunes library contents  53
Microsoft Exchange  27, 111
MobileMe  26, 27, 111
notes  148
photos  117
preventing  57
purchased songs  173
“Sync in progress” message  22
voice memos  164
webpage bookmarks  89
system requirements  19
T
taking photos  12 6
telephone. See Phone
telephone number format  200
6GP-G[253
text
cutting or copying  39
entering and editing using VoiceOver  237
increasing size  243
pasting  39
typing  37
typing in webpages  88
text messaging. See Messages
time format  200
time zone support  112, 116, 198, 205
time, setting  198
timer
setting  153
sleep  153
touchscreen, using  29
Traditional Chinese  250
VTCÓEEQPFKVKQPUEJGEMKPI144
transferring
°NGU56
purchased content  58, 173, 180
settings and information  255, 257
VTCPUKVKQPGÒGEVUUGVVKPI211
trimming videos  128
Triple-click Home setting  245
troubleshooting
backing up  255
restarting  51, 254
software update and restore  256
true north  157
TTY machine, using  206
TTY status icon  18
VWTPKPIK2JQPGQPQTQÒ11
TV shows
rented  56, 102, 103
TV shows, syncing  53
TV signal settings  211
TV, viewing content on  89, 102, 121, 131
typing
facemarks  251
international keyboards  248
keyboard  37
spell checking  39
KPYGDRCIGVGZV°GNFU88
word substitution  253
U
UMTS
network  22, 23, 63
status icon  17
undoing edits  40
Index 271

unlocking iPhone  12
unpairing Bluetooth device  48
unread messages, marking  77
updating iPhone software  256
usage statistics
battery percentage  192
resetting  193
seeing  192
USB Power Adapter  121
USB
cable  11, 21
port  21
power adapter  11
user dictionary  253
V
VGA Adapter  89, 102, 131
vibrate, setting  72, 191
video calls  65, 216
restricting  197
VWTPKPIQPQTQÒ206
video settings  210
videos
alternate audio language  101
converting for iPhone  103
deleting  103
editing  128
previewing  170
purchasing  170
saving MMS attachments  108
searching  101
sending in MMS messages  108
subtitles  101
syncing  53, 56
trimming  128
watching on a TV  89, 102, 121, 131
See also iPod, Music, YouTube
Vietnamese keyboard  252
virtual private network. See VPN
Voice Control
making a FaceTime call  65
making phone calls  44, 61
playing songs  44, 95
using with headset  46
Voice Memos
attaching to MMS messages  163
emailing  163
recording  160
syncing  164
trimming  163
voicemail
about  68
alerts  68
changing password  207
checking and managing  68
greeting  68
setting up  68
VoiceOver
about  230
braille displays  242
entering and editing text  237
gestures  232
rotor control  234
setting up iPhone using  21
volume
adjusting  12, 46
adjusting for ringer and alerts  191
setting limit  210
VPN
accessing networks using  24
EQP°IWTKPI193
status icon  17
VWTPKPIQPQTQÒ194
W
waking iPhone  12
wallpaper  36, 124, 192
warranty service  259
watching videos on a TV  89, 102, 121, 131
weather information, Yahoo!  147
Weather
adding cities  146
deleting cities  147
temperature settings  147
viewing  146
web. See Safari
web clips, adding to Home screen  90
webpages
bookmarking  89
syncing  53, 56
White on Black  244
Wi-Fi
addresses  192
forgetting a network  189
joining a network  23, 189
settings  189
status icon  17
VWTPKPIQPQTQÒ189
Wikipedia, searching  43
Windows Address Book  55
Windows system requirements  19
“Works with iPhone” logo  160
World Clock  151
Wubi Hua  250
Y
Yahoo!  148
Address Book  55
search using  88
stock information  136
weather information  147
Index
272
 %Apple Inc. 
© 2011 Apple Inc. All rights reserved.
Apple, the Apple logo, AirPlay, Aperture, Apple TV, 
Cover Flow, FaceTime, Finder, iBooks, iCal, iMovie, 
K2JQPGK2JQVQK2QFK2QFVQWEJK6WPGU-G[PQVG
Mac, Macintosh, Mac OS, Numbers, Pages, QuickTime, 
Safari, Spotlight, and the Works with iPhone logo are 
trademarks of Apple Inc., registered in the U.S. and  
other countries.
AirPrint, iPad, the Made for iPhone logo, Multi-Touch, 
4GVKPCCPF5JWÔGCTGVTCFGOCTMUQH#RRNG+PE
Apple, Apple Store, iDisk, and iTunes Store are service 
marks of Apple Inc., registered in the U.S. and other 
countries.
App Store, iBookstore, iTunes Extras, and MobileMe are 
service marks of Apple Inc.
IOS is a trademark or registered trademark of Cisco in 
the U.S. and other countries and is used under license.
2KPIKUCTGIKUVGTGFVTCFGOCTMQH-CTUVGP/CPWHCEVWTKPI
Corporation and is used in the U.S. under license.
6JG0KMGK2QF5RQTV-KVKUEQXGTGFD[QPGQTOQTG
of U.S. patent numbers 6,018,705, 6,052,654, 6,493,652, 
6,298,314, 6,611,789, 6,876,947, and 6,882,955, either 
alone or when used in combination with a Nike + iPod 
enabled iPod media player or iPhone 3GS or later.
The Bluetooth® word mark and logos are registered 
trademarks owned by Bluetooth SIG, Inc. and any use of 
such marks by Apple Inc. is under license.
Adobe and Photoshop are trademarks or registered 
trademarks of Adobe Systems Incorporated in the U.S. 
and/or other countries.
Other company and product names mentioned herein 
may be trademarks of their respective companies.
Mention of third-party products is for informational 
purposes only and constitutes neither an endorsement 
nor a recommendation. Apple assumes no responsibility 
with regard to the performance or use of these 
products. All understandings, agreements, or warranties, 
if any, take place directly between the vendors and the 
RTQURGEVKXGWUGTU'XGT[GÒQTVJCUDGGPOCFGVQGPUWTG
that the information in this manual is accurate. Apple is 
not responsible for printing or clerical errors.
019-2024/2011-03

