Apple E2422B Smart Cellular Phone User Manual User Guide
Apple Inc. Smart Cellular Phone User Guide
  
    Apple   >  
Contents
User Guide
APPLE CONFIDENTIAL â First Draft (1.10.11) iPhone User Guide For iOS 4.2.5 Software APPLE CONFIDENTIAL â First Draft (1.10.11) Contents 11 13 16 Chapter 1: iPhone at a Glance 19 19 19 20 20 21 21 22 25 Chapter 2: Getting Started 29 29 33 36 45 47 48 50 51 52 53 55 55 Chapter 3: Basics 56 56 56 56 Chapter 4: Syncing and File Sharing iPhone Overview Buttons iPhone Apps Status Icons Viewing the User Guide on iPhone What You Need Installing the SIM Card Activating iPhone Setting Up iPhone Disconnecting iPhone from Your Computer Connecting to the Internet Adding Mail, Contacts, and Calendar Accounts Using Apps Customizing the Home Screen Typing Printing Searching Voice Control Apple Earphones with Remote and Mic Bluetooth Devices Battery Security Features Cleaning iPhone Restarting or Resetting iPhone About Syncing Syncing Accounts Syncing with iTunes APPLE CONFIDENTIAL â First Draft (1.10.11) 58 61 61 62 62 iPhone Settings Panes in iTunes Automatic iTunes Syncing Manually Managing Content Transferring Purchased Content to Another Computer File Sharing 64 64 72 74 74 74 76 77 Chapter 5: Phone 79 79 79 82 83 84 84 86 87 Chapter 6: Mail 89 89 92 92 93 94 Chapter 7: Safari 95 95 95 104 108 108 Chapter 8: iPod 110 110 112 112 113 Chapter 9: Messages Phone Calls Visual Voicemail Contacts Favorites Call Forwarding, Call Waiting, and Caller ID Ringtones and the Ring/Silent Switch International Calls Setting Up Email Accounts Checking and Reading Email Using Links and Detected Data Viewing Attachments Printing Messages and Attachments Sending Email Organizing Email Searching Email Viewing Webpages Searching Printing Webpages, PDFs, and Other Documents Bookmarks Web Clips Getting Music, Videos, and More Music and Other Audio Videos Setting a Sleep Timer Changing the Browse Buttons Sending and Receiving Messages Searching Messages Sharing Photos and Videos Sending Voice Memos Contents APPLE CONFIDENTIAL â First Draft (1.10.11) 113 113 114 Editing Conversations Using Contact Information and Links Managing Previews and Alerts 115 115 115 116 117 117 118 120 120 120 Chapter 10: Calendar 121 121 121 122 124 124 124 125 127 127 128 Chapter 11: Photos 129 129 130 131 132 132 Chapter 12: Camera 133 133 134 135 136 136 137 138 Chapter 13: YouTube About Calendar Syncing Calendars Viewing Your Calendars Searching Calendars Adding and Updating Events on iPhone Responding to Meeting Invitations Subscribing to Calendars Importing Calendar Files from Mail Alerts About Photos Syncing Photos and Videos with Your Computer Viewing Photos and Videos Deleting Photos and Videos Slideshows Viewing Photos, Videos, and Slideshows on a TV Sharing Photos and Videos Printing Photos Assigning a Photo to a Contact Wallpaper About Camera Taking Photos and Recording Videos Viewing and Sharing Photos and Videos Trimming Videos Uploading Photos and Videos to Your Computer Finding and Viewing Videos Controlling Video Playback Managing Videos Getting More Information Using YouTube Account Features Changing the Browse Buttons Sending Videos to YouTube Contents APPLE CONFIDENTIAL â First Draft (1.10.11) 139 Chapter 14: Stocks 139 Viewing Stock Quotes 140 Getting More Information 141 141 146 147 148 149 149 Chapter 15: Maps Finding and Viewing Locations Getting Directions 5JQYKPI6TCĂE%QPFKVKQPs Finding and Contacting Businesses Sharing Location Information Bookmarking Locations 150 Chapter 16: Weather 150 Viewing Weather Summaries 151 Getting More Weather Information 152 152 152 152 154 154 Chapter 17: Notes 155 155 155 156 156 Chapter 18: Clock About Notes Syncing Notes Writing and Reading Notes Searching Notes Emailing Notes World Clocks Alarms Stopwatch Timer 158 Chapter 19: Calculator 158 Using the Calculator 158 Standard Memory Functions 159 5EKGPVK°E%CNEWNCVQT-G[s 161 Chapter 20: Compass 161 Getting Compass Readings 162 Compass and Maps 164 164 165 166 166 167 Chapter 21: Voice Memos Recording Voice Memos Listening to Voice Memos Managing Voice Memos Trimming Voice Memos Sharing Voice Memos Contents APPLE CONFIDENTIAL â First Draft (1.10.11) 167 Syncing Voice Memos 169 169 170 171 172 173 174 175 175 176 176 177 177 Chapter 22: iTunes Store 178 178 178 180 181 181 182 183 183 Chapter 23: App Store 184 184 184 185 189 191 Chapter 24: Game Center 193 193 194 195 195 195 196 196 197 197 Chapter 25: Settings About the iTunes Store Finding Music, Videos, and More Following Artists and Friends Purchasing Ringtones Purchasing Music or Audiobooks Purchasing or Renting Videos Streaming or Downloading Podcasts Checking Download Status Syncing Purchased Content Changing the Browse Buttons Viewing Account Information Verifying Downloads About the App Store Browsing and Searching Info Screen Downloading Apps Deleting Apps Writing Reviews Updating Apps Syncing Purchased Apps About Game Center Setting Up Game Center Games Friends Your Status and Account Information Airplane Mode Wi-Fi VPN Personal Hotspot 0QVK°ECVKQPs Carrier Sounds and the Ring/Silent Switch Brightness Wallpaper Contents APPLE CONFIDENTIAL â First Draft (1.10.11) 197 208 212 214 215 216 217 218 218 218 General Mail, Contacts, Calendars Phone Safari Messages iPod Photos Notes Store Nike + iPod 219 219 219 220 221 222 223 Chapter 26: Contacts 225 225 226 226 226 227 227 Chapter 27: Nike + iPod 229 229 230 230 231 232 232 233 233 233 233 234 234 Chapter 28: iBooks About Contacts Adding Contacts Searching Contacts Managing Contacts on iPhone Using Contact Information 7PK°GF%QPVCEVs Activating Nike + iPod Linking a Sensor Working Out with Nike + iPod Sending Workouts to Nikeplus.com Calibrating Nike + iPod Nike + iPod Settings About iBooks Syncing Books and PDFs Using the iBookstore Reading Books Reading PDFs Changing a Bookâs Appearance Searching Books and PDFs .QQMKPIWRVJG&G°PKVKQPQHC9QTd Having a Book Read to You Printing or Emailing a PDF Organizing the Bookshelf Bookmark and Note Syncing 235 Chapter 29: Accessibility 235 Universal Access Features Contents APPLE CONFIDENTIAL â First Draft (1.10.11) 236 249 250 250 250 250 251 251 253 VoiceOver Zoom Large Text White on Black Mono Audio Speak Auto-text Triple-Click Home Closed Captioning and Other Helpful Features Hearing Aid Compatibility 254 254 254 254 256 257 258 259 259 260 260 Appendix A: Support and Other Information 262 Index Apple iPhone Support Site Restarting and Resetting iPhone Backing Up iPhone Updating and Restoring iPhone Software Safety, Software, and Service Information Using iPhone in an Enterprise Environment Using iPhone with Other Carriers Disposal and Recycling Information Apple and the Environment iPhone Operating Temperature Contents APPLE CONFIDENTIAL â First Draft (1.10.11) iPhone at a Glance iPhone Overview iPhone 4 /LHKZL[°QHJR ;VW TPJYVWOVUL 9PUN:PSLU[ Z^P[JO 6U6MM :SLLW>HRL 9LJLP]LY :[H[\Z°IHY 4HPUJHTLYH =VS\TL I\[[VUZ 3,+MSHZO -YVU[JHTLYH (WWPJVUZ (WWSL9L[PUH KPZWSH` :04°JHYK°[YH` .:4TVKLSVUS` /VTL°I\[[VU +VJR JVUULJ[VY L3KRQH )V[[VT TPJYVWOVUL :WLHRLY APPLE CONFIDENTIAL â First Draft (1.10.11) iPhone 3GS 6U6MM :SLLW>HRL /LHKZL[QHJR 9LJLP]LY :04JHYK[YH` 9PUN:PSLU[ Z^P[JO *HTLYH =VS\TL I\[[VUZ :[H[\ZIHY ;V\JOZJYLLU (WWPJVUZ /VTLI\[[VU +VJR JVUULJ[VY :WLHRLY 4PJYVWOVUL L3KRQH ;QWT*QOGUETGGPOC[NQQMFKĂGTGPVFGRGPFKPIQPVJGOQFGNQHK2JQPG[QWJCXG and whether you have rearranged its icons. Accessories The following accessories are included with iPhone: (WWSL,HYWOVULZ ^P[O9LTV[LHUK4PJ +VJR*VUULJ[VY[V<:)*HISL <:)WV^LYHKHW[LY :04LQLJ[[VVS Note: The SIM eject tool is not included in all countries or regions. 10 Chapter 1 iPhone at a Glance APPLE CONFIDENTIAL â First Draft (1.10.11) Item What you can do with it Apple Earphones with Remote and Mic Listen to music, videos, and phone calls. Use the built-in microphone to talk. Press the center button to answer or end a call. When listening to iPod, press the button to play or pause a song, or press twice quickly to skip to the next track. Use the + and â buttons to adjust the volume (iPhone 3GS or later). Press and hold the center button to use Voice Control (iPhone 3GS or later). Dock Connector to USB Cable Use the cable to connect iPhone to your computer to sync and charge. The cable can be used with the optional dock or plugged directly into iPhone. USB power adapter Connect the power adapter to iPhone using the included cable, then plug it into a standard power outlet to charge iPhone. SIM eject tool (not included in all countries or regions) Eject the SIM card tray. Buttons #HGYUKORNGDWVVQPUOCMGKVGCU[VQVWTPK2JQPGQPQTQĂCFLWUVVJGXQNWOGCPF switch between ring and silent modes. 1P1Ă5NGGR9CMG$WVVQP 9JGP[QW¨TGPQVCEVKXGN[WUKPIK2JQPG[QWECPNQEMKVVQVWTPQĂVJGFKURNC[CPFUCXG the battery. When iPhone is locked, nothing happens if you touch the screen. iPhone can still receive calls, text messages, and other updates. You can also:  listen to music  adjust the volume using the buttons on the side of iPhone (or on the iPhone earphones) while youâre on a phone call or listening to music  use the center button on iPhone earphones to answer or end a call, or to control audio playback (see âControlling Audio Playbackâ on page 96) By default, iPhone locks if you donât touch the screen for a minute. 6U6MM:SLLW >HRLI\[[VU Chapter 1 iPhone at a Glance 11 APPLE CONFIDENTIAL â First Draft (1.10.11) Lock iPhone 2TGUUVJG1P1Ă5NGGR9CMGDWVVQP Unlock iPhone Press the Home DWVVQPQTVJG1P1Ă5NGGR Wake button, then drag the slider. 6WTPK2JQPGEQORNGVGN[QĂ 2TGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPHQT a few seconds until the red slider appears, then FTCIVJGUNKFGT9JGPK2JQPGKUQĂKPEQOKPIECNNU go straight to voicemail. Turn iPhone on 2TGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQP until the Apple logo appears. For information about changing how long before iPhone locks, see âAuto-Lockâ on page 201. For information about setting iPhone to require a passcode to unlock it, see âPasscode Lockâ on page 201. Home Button Press the Home button at any time to go to the Home screen, which contains your iPhone apps. Tap any app icon to get started. To see apps youâve recently used, doubleclick the Home button (iPhone 3GS or later). See âOpening and Switching Appsâ on page 29. Volume Buttons When youâre on the phone or listening to songs, movies, or other media, the buttons on the side of iPhone adjust the audio volume. Otherwise, the buttons control the XQNWOGHQTVJGTKPIGTCNGTVUCPFQVJGTUQWPFGĂGEVU WARNING: For important information about avoiding hearing loss, see the Important Product Information Guide at www.apple.com/support/manuals/iphone. To adjust the volume, use the buttons on the side of iPhone. =VS\TL \W =VS\TL KV^U To set a volume limit for music and videos on iPhone, see âMusicâ on page 216. 12 Chapter 1 iPhone at a Glance APPLE CONFIDENTIAL â First Draft (1.10.11) Ring/Silent Switch Flip the Ring/Silent switch to put iPhone in ring mode or silent mode. 9PUN :PSLU[ In ring mode, iPhone plays all sounds. In silent mode, iPhone doesnât ring or play alerts CPFQVJGTUQWPFGĂGEVU Important: Clock alarms, audio apps such as iPod, and many games still play sounds through the built-in speaker when iPhone is in silent mode. By default, when you get a call, iPhone vibrates whether itâs in ring mode or silent OQFG+HK2JQPGKUKPTKPIOQFG[QWECPUKNGPEGCECNND[RTGUUKPIVJG1P1Ă5NGGR Wake button or one of the volume buttons. Press a second time to send the call to voicemail. For information about changing sound and vibrate settings, see âSounds and the Ring/ Silent Switchâ on page 196. iPhone Apps The apps in the following table are included with iPhone. Note: App functionality and availability may vary, depending on the country or region where you purchase and use iPhone. Chapter 1 iPhone at a Glance 13 APPLE CONFIDENTIAL â First Draft (1.10.11) Phone Mail Safari iPod Messages Calendar Photos 14 Make calls, with quick access to recent callers, favorites, and all your contacts. Dial manually using the numeric keypad. Or just use voice dialing. Visual voicemail presents a list of your voicemail messagesâjust tap to listen to any message, in any order. Make FaceTime video calls to other iPhone 4 or iPod touch (4th generation) users over Wi-Fi. See Chapter 5, âPhone,â on page 64. iPhone works with MobileMe, Microsoft Exchange, and many of the most popular email systemsâincluding Yahoo!, Google, and AOLâas well as most industry-standard POP3 and IMAP email systems. View and print PDFs and other attachments. Save attached photos and graphics to your Camera Roll album. See Chapter 6, âMail,â on page 79. Browse websites over a cellular data network or over Wi-Fi. Rotate iPhone sideways HQTYKFGUETGGPXKGYKPI&QWDNGVCRVQ\QQOKPQTQWV¤5CHCTKCWVQOCVKECNN[°VUVJG webpage column to the iPhone screen for easy reading. Open multiple pages. Sync bookmarks with Safari or Microsoft Internet Explorer on your computer. Add Safari web clips to the Home screen for fast access to favorite websites. Save images from websites to your Photo Library. Print webpages, PDFs, and other documents that open in Quick Look. See Chapter 7, âSafari,â on page 89. Listen to your songs, audiobooks, and podcasts. Create playlists, or use Genius to create playlists for you. Listen to Genius Mixes of songs from your library. Watch movies and video podcasts in widescreen. Use AirPlay to stream your music or videos wirelessly to an Apple TV or compatible audio system. See Chapter 8, âiPod,â on page 95. Send and receive SMS text messages. View a list of your previous conversations, and tap a conversation to see the messages you sent and received. Send photos, video clips (iPhone 3GS or later), contact information, and voice memos to MMS devices. See Chapter 9, âMessages,â on page 110. View and search your MobileMe, iCal, Microsoft Entourage, Microsoft Outlook, or Microsoft Exchange calendars. Enter events on iPhone and they sync back to the calendar on your computer. Subscribe to calendars. See the birthdays youâve entered in Contacts. Set alerts to remind you of events, appointments, and deadlines. See Chapter 10, âCalendar,â on page 115. View photos and videos you take with iPhone, save them from Mail or MMS messages, or sync them from your computer. View videos (iPhone 3GS or later) in portrait or landscape orientation. Zoom in on photos for a closer look, or print them. Watch a slideshow. Email photos and videos, send them in MMS messages, or publish them to a MobileMe gallery. Assign images to contacts, and use them as wallpaper. View photos by place, and if you sync with iPhoto 8.0 (part of iLife â09) or later, view photos by events and faces. See Chapter 11, âPhotos,â on page 121. Chapter 1 iPhone at a Glance APPLE CONFIDENTIAL â First Draft (1.10.11) Camera YouTube Stocks Maps Take photos, and record videos (iPhone 3GS or later). View them on iPhone, email them, send them in an MMS message, or upload them to your computer. Tap to focus on a URGEK°EQDLGEVQTCTGC6TKOCPFUCXGXKFGQENKRU7RNQCFXKFGQUFKTGEVN[VQ;QW6WDG Take a friendâs picture and set iPhone to display it when that person calls you. See Chapter 12, âCamera,â on page 129. Play videos from YouTubeâs online collection. Search for any video, or browse featured, most viewed, most recently updated, and top-rated videos. Set up and log in to your YouTube accountâthen rate videos, sync your favorites, view subscriptions, and more. Use AirPlay to stream YouTube videos to an Apple TV. Upload your own videos taken with iPhone. See Chapter 13, âYouTube,â on page 133. Watch your favorite stocks, updated automatically from the Internet. View company news and current trading information, such as opening or average price, trading volume, or market capitalization. Rotate iPhone to see detailed charts in landscape QTKGPVCVKQP&TCI[QWT°PIGTCNQPIVJGEJCTVUVQVTCEMRTKEGRQKPVUQTWUGVYQ°PIGTU to see a range between points. See Chapter 14, âStocks,â on page 139. See a street map, satellite view, or hybrid view of locations around the world. Zoom in for a closer look, or check out the Google Street View. Find and track your current (approximate) location. See which way youâre facing (iPhone 3GS or later, using its builtin compass). Get detailed driving, public transit, or walking directions and see current JKIJYC[VTCĂEEQPFKVKQPU(KPFDWUKPGUUGUKPVJGCTGCCPFECNNYKVJCUKPINGVCR5GG Chapter 15, âMaps,â on page 141. Get current weather conditions and a six-day forecast. Add your favorite cities for a quick weather report anytime. See Chapter 16, âWeather,â on page 150. Weather Notes Clock Jot notes on the goâreminders, grocery lists, brilliant ideas. Send them in email. Sync notes to Mail on your Mac, or Microsoft Outlook or Outlook Express on your PC. Sync notes over the air (iPhone 3GS or later) with your MobileMe, Google, Yahoo!, or IMAP accounts. See Chapter 17, âNotes,â on page 152. In the Utilities folder. View the time in cities around the worldâcreate clocks for your favorites. Set one or more alarms. Use the stopwatch, or set a countdown timer. See Chapter 18, âClock,â on page 155. In the Utilities folder. Add, subtract, multiply, and divide. Rotate iPhone sideways to use GZRCPFGFUEKGPVK°EHWPEVKQPU5GG%JCRVGT19, âCalculator,â on page 158. Calculator Chapter 1 iPhone at a Glance 15 APPLE CONFIDENTIAL â First Draft (1.10.11) Compass Voice Memos iTunes App Store Game Center Settings Contacts In the Utilities folder. Use the built-in digital compass (iPhone 3GS or later) to determine your heading. Get your current coordinates. Choose between true north and magnetic north. See Chapter 20, âCompass,â on page 161. In the Utilities folder. Record voice memos on iPhone. Play them back on iPhone or sync them with iTunes to listen to voice memos on your computer. Attach voice memos to email or MMS messages. See Chapter 21, âVoice Memos,â on page 164. Search the iTunes Store for music, movies, TV shows, audiobooks, and more. Browse, preview, and download new releases, or see whatâs popular in the top charts. Rent movies and TV shows to view on iPhone. Stream and download podcasts. Follow your HCXQTKVGCTVKUVUCPFHTKGPFUVQ°PFQWVYJCVOWUKEVJG[¨TGNKUVGPKPIVQCPFVCNMKPICDQWV See Chapter 22, âiTunes Store,â on page 169. Search the App Store for iPhone apps you can purchase or download using your Wi-Fi or cellular data network connection. Read reviews or write your own reviews for your favorite apps. Download and install the app on your Home screen. See Chapter 23, âApp Store,â on page 178. Discover new games and share your game experiences with friends around the world (iPhone 3GS or later). Invite a friend, or request a match with other worthy opponents. Check player rankings on the leaderboards. Earn achievements for extras points. See Chapter 24, âGame Center,â on page 184. Set up accounts and adjust all iPhone settings in one convenient place. Set your own volume limit for listening comfort. Set your ringtone, wallpaper, screen brightness, and settings for network, phone, mail, web, music, video, photos, and more. Use Location Services settings to set location privacy options for Maps, Camera, Compass, and applicable third-party apps. Set auto-lock and a passcode for security. Restrict access to explicit iTunes content and certain apps. Reset iPhone. See Chapter 25, âSettings,â on page 193. Get contact information synced from MobileMe, Mac OS X Address Book, Yahoo! Address Book, Google Contacts, Windows Address Book (Outlook Express), Microsoft Outlook, or Microsoft Exchange. Search, add, change, or delete contacts, which get synced back to your computer. See Chapter 26, âContacts,â on page 219. Nike + iPod (which appears when you activate it in Settings) turns iPhone into a workout companion. Track your pace, time, and distance from one workout to the next, and choose a song to power through your routine. (iPhone 3GS or later. Requires select Nike + iPod Nike shoes and a Nike + iPod Sensor, sold separately.) See Chapter 27, âNike + iPod,â on page 225. iBooks Download the free iBooks app from the App Store for a great way to buy and read books. Get everything from classics to best sellers from the built-in iBookstore. Add ePub books and PDFs to your bookshelf using iTunes. Print PDFs. See Chapter 28, âiBooks,â on page 229. Status Icons The icons in the status bar at the top of the screen give information about iPhone: 16 Chapter 1 iPhone at a Glance APPLE CONFIDENTIAL â First Draft (1.10.11) Status icon What it means Cell signal* Shows whether youâre in range of the cellular network and can make and receive calls. The more bars, the stronger the signal. If thereâs no signal, the bars are replaced with âNo service.â Airplane mode Shows that airplane mode is onâyou cannot use the phone, access the Internet, or use BluetoothÂŽ devices. Non-wireless features are available. See âAirplane Modeâ on page 193. 3G Shows that your carrierâs 3G (GSM models) or EV-DO (CDMA model) network is available, and iPhone can connect to the Internet over that network. See âHow iPhone Connects to the Internetâ on page 22. EDGE Shows that your carrierâs EDGE network is available, and iPhone can connect to the Internet over that network. (GSM models only.) See âHow iPhone Connects to the Internetâ on page 22. GPRS Shows that your carrierâs GPRS (GSM models) or 1xRTT (CDMA model) network is available, and iPhone can connect to the Internet over that network. See âHow iPhone Connects to the Internetâ on page 22. Wi-Fi* Shows that iPhone is connected to the Internet over a Wi-Fi network. The more bars, the stronger the connection. See âJoining a Wi-Fi Networkâ on page 22. Network activity Shows over-the-air syncing or other network activity. Some third-party apps may also use the icon to show an active process. Call Forwarding Shows that Call Forwarding is set up on iPhone (GSM models only). See âCall Forwardingâ on page 212. VPN Shows that youâre connected to a network using VPN. See âNetworkâ on page 198. Lock Shows that iPhone is locked. See â1P1Ă Sleep/Wake Buttonâ on page 11. TTY Shows that iPhone is set to work with a TTY machine. See âUsing iPhone with a Teletype (TTY) Machineâ on page 213. Chapter 1 iPhone at a Glance 17 APPLE CONFIDENTIAL â First Draft (1.10.11) Status icon What it means Play Shows that a song, audiobook, or podcast is playing. See âPlaying Songs and Other Audioâ on page 96. Portrait orientation lock Shows that the iPhone screen is locked in portrait orientation. See âViewing in Portrait or Landscape Orientationâ on page 32. Alarm Shows that an alarm is set. See âAlarmsâ on page 155. Location services Shows that some app is using location services. See âLocation Servicesâ on page 200. Bluetooth* Blue or white icon: Bluetooth is on and a device, such as a headset or car kit, is connected. Gray icon: Bluetooth is on, but no device is connected. No icon: Bluetooth KUVWTPGFQĂ5GGÂĽBluetooth Devicesâ on page 51. Battery Shows battery level or charging status. See âBatteryâ on page 52. 6JGWUGQHEGTVCKPCEEGUUQTKGUYKVJK2JQPGOC[CĂGEVYKTGNGUURGTHQTOCPEG 18 Chapter 1 iPhone at a Glance APPLE CONFIDENTIAL â First Draft (1.10.11) Getting Started  WARNING: To avoid injury, read all operating instructions in this guide and safety information in the iPhone Important Product Information Guide at www.apple.com/ support/manuals/iphone before using iPhone. Viewing the User Guide on iPhone The iPhone User Guide, optimized for viewing on iPhone, is available at help.apple.com/ iphone. View the guide on iPhone: In Safari, tap bookmark. , then tap the iPhone User Guide Add an icon for the guide to the Home screen: When viewing the guide, tap , then tap âAdd to Home Screen.â The iPhone User Guide is available in many languages. 8KGYVJGIWKFGKPCFKĂGTGPVNCPIWCIGTap âChange Languageâ at the bottom of the screen on the main contents page, then choose the language you want. What You Need To use iPhone, you need:  A wireless service plan with a carrier that provides iPhone service in your area  A Mac or a PC with a USB 2.0 port and one of the following operating systems:  Mac OS X v10.5.8 or later  Windows 7, Windows Vista, or Windows XP Home or Professional (SP3)  Screen resolution on your computer set to 1024 x 768 or higher  iTunes 10.1.2 or later, available at www.itunes.com/download  QuickTime 7.6.2 or later (for playing videos recorded by iPhone 3GS or later on your computer)  An Apple ID (such as an iTunes Store account or MobileMe account) for purchases from the iTunes Store or App Store 19 APPLE CONFIDENTIAL â First Draft (1.10.11)  An Internet connection for your computer (broadband is recommended) Installing the SIM Card If your SIM card (GSM models only) was not preinstalled, you must install it before you can use iPhone. Installing the SIM Card in iPhone 4 4PJYV:04 JHYK[YH` 7HWLYJSPW VY:04 LQLJ[[VVS 4PJYV:04 JHYK Installing the SIM Card in iPhone 3GS 7HWLYJSPWVY :04LQLJ[[VVS :04 JHYK :04JHYK[YH` Install the SIM card: 1 Insert the end of a paper clip or SIM eject tool into the hole on the SIM card tray. 2WUJ°TON[UVTCKIJVKPWPVKNVJGVTC[RQRUQWV 2 Pull out the SIM card tray and place the SIM card in the tray as shown. 3 With the tray aligned and the SIM card on top as shown, carefully replace the tray. Activating iPhone You must activate iPhone by signing up for a service plan with an iPhone service carrier in your area and registering iPhone with the network. Your iPhone may have been activated at the time of purchase. If it isnât activated, contact your iPhone retailer or cellular service provider. For more information about iPhone, go to www.apple.com/iphone. 20 Chapter 2 Getting Started APPLE CONFIDENTIAL â First Draft (1.10.11) Setting Up iPhone Before you can use iPhone, you must set it up in iTunes. During setup, you can create a new Apple ID or specify an existing Apple ID for making purchases with iPhone. (The iTunes Store may not be available in all countries or regions.) iTunes also records the serial number of your iPhone in case you need it. Set up iPhone: 1 Download and install the latest version of iTunes from www.itunes.com/download. 2 Connect iPhone to a USB 2.0 port on your Mac or PC using the cable that came with iPhone. 3 Follow the onscreen instructions. In the Set Up Your iPhone screen, select âAutomatically sync contacts, calendars and DQQMOCTMUÂŚVQEQP°IWTGVJQUGKVGOUVQU[PECWVQOCVKECNN[YJGP[QWEQPPGEVK2JQPG to your computer. You can also customize your sync settings in iTunes. See âSyncing with iTunesâ on page 56. Note: If you have a visual impairment, VoiceOver (iPhone 3GS or later) can help you set up iPhone without a sighted assistant. VoiceOver describes aloud what appears on the screen, so you can use iPhone without seeing it. When you connect iPhone to your computer, iTunes detects whether youâre using a compatible screen reader on your computer, such as VoiceOver (Mac) or GW Micro Window-Eyes (PC), and automatically enables VoiceOver on iPhone. A sighted user can also enable VoiceOver on iPhone using Accessibility settings. (VoiceOver may not be available in all languages.) See âVoiceOverâ on page 236. Disconnecting iPhone from Your Computer You can disconnect iPhone from your computer at any time. However, if you disconnect it while a sync is in progress, some data may not get synced until the next time you connect iPhone to your computer. When iPhone is syncing with your computer, iPhone shows âSync in Progress.â If you FKUEQPPGEVK2JQPGDGHQTGKV°PKUJGUU[PEKPIUQOGFCVCOC[PQVIGVVTCPUHGTTGF9JGP the sync is complete, iTunes shows âiPhone sync is complete.â Chapter 2 Getting Started 21 APPLE CONFIDENTIAL â First Draft (1.10.11) Cancel a sync: Drag the slider on iPhone. If you get a call during a sync, the sync is canceled and you can disconnect iPhone to CPUYGTVJGECNN%QPPGEVK2JQPGCHVGTVJGECNNVQ°PKUJU[PEKPI Connecting to the Internet iPhone connects to the Internet whenever you use Mail, Safari, YouTube, Stocks, Maps, Weather, the App Store, or the iTunes Store. How iPhone Connects to the Internet iPhone connects to the Internet using either a Wi-Fi network or a cellular data network. iPhone does the following, in order, until connected:  Connects over the last Wi-Fi network you used thatâs available.  If no previously used Wi-Fi networks are available, iPhone shows a list of Wi-Fi networks in range. Tap a network and, if necessary, enter the password to join. Networks that require a password show the lock icon next to them. You can prevent iPhone from automatically showing available networks. See âWi-Fiâ on page 194.  If no Wi-Fi networks are available or you choose not to join any, iPhone connects to the Internet over a cellular data network ( , , or ). You can prevent iPhone from using cellular data in Settings. See âNetworkâ on page 198. If no Wi-Fi networks are available and a cellular data network isnât available, iPhone cannot connect to the Internet. Note: Unless you have a 3G connection on a GSM model, you cannot use the Internet over a cellular data network when youâre on a call. You must have a Wi-Fi connection to use Internet apps while also talking on the phone. Many Wi-Fi networks can be used free of charge including, in some countries or regions, Wi-Fi hotspots provided by your iPhone carrier. Some Wi-Fi networks require a fee. To join a Wi-Fi network at a hotspot where charges apply, you can usually open Safari to see a webpage that allows you to sign up for service. Joining a Wi-Fi Network The Wi-Fi settings let you turn on Wi-Fi and join Wi-Fi networks. Turn on Wi-Fi: Choose Settings > Wi-Fi and turn Wi-Fi on. Join a Wi-Fi network: Choose Settings > Wi-Fi, wait a moment as iPhone detects networks in range, then select a network (fees may apply to join some Wi-Fi networks). If necessary, enter a password and tap Join (networks that require a password appear with a lock icon). 22 Chapter 2 Getting Started APPLE CONFIDENTIAL â First Draft (1.10.11) Once you join a Wi-Fi network manually, iPhone automatically connects to it whenever the network is in range. If more than one previously used network is in range, iPhone joins the one last used. When iPhone is connected to a Wi-Fi network, the Wi-Fi icon in the status bar at the top of the screen shows the connection strength. The more bars you see, the stronger the connection. (QTKPHQTOCVKQPCDQWVEQP°IWTKPI9K(KUGVVKPIUUGGÂĽWi-Fiâ on page 194. Cellular Data Network Access 3G, EDGE, and GPRS (GSM models) and EV-DO and 1xRTT (CDMA model) allow Internet connectivity over the cellular network available through your iPhone carrierâs wireless service. Check the carrierâs network coverage in your area for availability. You can tell iPhone is connected to the Internet via the cellular data network if you see the 3G/EV-DO ( ), EDGE ( ), or GPRS/1xRTT ( ) icon in the status bar at the top of the screen. Note: On EDGE and GPRS connections, you may not be able to receive calls while iPhone is actively transferring data over a cellular networkâdownloading a webpage, for example. Incoming calls then go directly to voicemail. On EV-DO connections, data transfers are paused during incoming calls. On 1xRTT connections, incoming calls go directly to voicemail during data transfers. Turn 3G on: (GSM models only.) In Settings, choose General > Network and tap Enable 3G. If youâre outside your carrierâs network, you may be able to access the Internet through another carrier. To enable email, web browsing, and other data services whenever possible, turn Data Roaming on. Turn Data Roaming on: In Settings, choose General > Network and turn Data Roaming on. Important: Roaming charges may apply. To avoid data roaming charges, make sure &CVC4QCOKPIKUVWTPGFQĂ Internet Access on an Airplane #KTRNCPGOQFGVWTPUQĂVJGK2JQPGEGNNWNCT9K(K$NWGVQQVJCPF)25VTCPUOKVVGTUCPF receivers to avoid interfering with aircraft operation. Airplane mode disables many of the iPhone features. In some countries or regions, where allowed by the aircraft operator and applicable laws and regulations, you can turn on Wi-Fi while airplane mode is on, to:  Send and receive email  Browse the Internet Chapter 2 Getting Started 23 APPLE CONFIDENTIAL â First Draft (1.10.11)  Sync your contacts, calendars, browser bookmarks, and notes (iPhone 3GS or later) over the air  Stream YouTube videos  Get stock quotes  Get map locations  Get weather reports  Purchase music and apps You may also be allowed to turn on Bluetooth to use Bluetooth devices with iPhone. For more information, see âAirplane Modeâ on page 193. VPN Access VPN (virtual private network) provides secure access over the Internet to private networks, such as the network at your company or school. Use Network settings to EQP°IWTGCPFVWTPQP8205GGÂĽNetworkâ on page 198. Sharing an Internet Connection You can use iPhone to share an Internet connection for a computer connected to iPhone via Wi-Fi, Bluetooth, or USB. On GSM models this is called tethering; on a CDMA model this is called personal hotspot. On a CDMA model, you can also share an Internet connection for an iPod, iPad, and even other iPhones connected to iPhone via Wi-Fi. Note: Internet sharing may not be available in all countries or regions. Additional fees may apply. Contact your carrier for more information. You need to set up Internet sharing with your carrier before it can be used. If you havenât done this, the Set Up Internet Tethering button appears in your Network settings in place of the Internet Tethering or Personal Hotspot button. Tap Set Up Internet Tethering to contact your carrier. Internet sharing works over the cellular data network. You canât use Internet sharing if iPhone is connected to the Internet via Wi-Fi. If iPhone is connected to the cellular data network via 3G, you can make and receive phone calls while sharing an Internet connection (GSM models only). Share an Internet connection: 1 In Settings, choose General > Network > Internet Tethering (GSM models) or Personal Hotspot (CDMA model). 2 Turn on Internet Tethering or Personal Hotspot. 3 Connect a computer or other device to iPhone:  Wi-Fi: On the device, choose the name of your iPhone from the list of available Wi-Fi networks, then enter the Wi-Fi password for your iPhone when prompted. 24 Chapter 2 Getting Started APPLE CONFIDENTIAL â First Draft (1.10.11)  USB: Connect your computer to iPhone, using the Dock Connector to USB Cable. In your computerâs Network services settings, choose iPhone. 1PC/CECRQRWRYKPFQYCRRGCTUVJG°TUVVKOG[QWEQPPGEVUC[KPIÂĽ#PGY PGVYQTMKPVGTHCEGJCUDGGPFGVGEVGFÂŚ%NKEM0GVYQTM2TGHGTGPEGUEQP°IWTGVJG network settings for iPhone, then click Apply. On a PC, use the Network Control 2CPGNVQEQP°IWTGVJGK2JQPGEQPPGEVKQP  Bluetooth: On iPhone, choose Settings > General > Bluetooth and turn on Bluetooth. Then refer to the documentation that came with your computer system software to pair and connect iPhone with your device. When youâre connected, a blue band appears at the top of the screen. Internet sharing remains on when you connect with USB, even when you arenât actively using the Internet connection. Change the Wi-Fi password for iPhone: (CDMA model only.) In Settings, choose General > Network > Personal Hotspot > Wi-Fi Password, then enter a password of at least 8 characters. Changing the password disconnects any computers sharing the Internet connection. Monitor your cellular data network usage: In Settings, choose General > Usage. Adding Mail, Contacts, and Calendar Accounts About Accounts iPhone works with MobileMe, Microsoft Exchange, and many of the most popular Internet-based email, contacts, and calendar service providers. If you donât already have an email account, you can get a free account online at www.yahoo.com, www. google.com, or www.aol.com. You can also try MobileMe, free for 60 days, at www. me.com. You can add contacts using an LDAP or CardDAV account if your company or organization supports it. See âAdding Contactsâ on page 219. You can add a CalDAV calendar account. See âSyncing Calendarsâ on page 115. You can subscribe to iCal (.ics) calendars or import them from Mail. See âSubscribing to Calendarsâ and âImporting Calendar Files from Mailâ on page 120. Setting Up MobileMe Accounts To use MobileMe on iPhone, you need to set up a MobileMe Free Account or a MobileMe Paid Subscription. A MobileMe Free Account lets you use Find My iPhone (not available in all countries or regions), a feature that helps you locate and protect the information on your iPhone if itâs lost or stolen. See âSecurity Featuresâ on page 53. Chapter 2 Getting Started 25 APPLE CONFIDENTIAL â First Draft (1.10.11) A MobileMe Paid Subscription lets you use Find My iPhone, plus the following features:  Mail account at me.com  Over-the-air syncing for contacts, calendars, bookmarks, and notes  MobileMe Gallery for sharing photos and videos  /QDKNG/GK&KUMHQTUVQTKPICPFUJCTKPI°NGU You can try out these features with a 60-day free trial at www.apple.com/mobileme. A MobileMe Free Account is available to any customer with an iPhone 4 running iOS 4.2 or later. If youâve already created an account for the App Store or Game Center, you can use that Apple ID for your MobileMe Free Account. You can create a new Apple +&KH[QWFQP¨VCNTGCF[JCXGQPGQTKH[QWYCPVCFKĂGTGPV#RRNG+&HQT[QWT/QDKNG/G account. Set up a MobileMe Free Account: 1 In Settings, tap âMail, Contacts, Calendars.â 2 Tap Add Account, then tap MobileMe. 3 Enter your Apple ID and password, or tap Create Free Apple ID. 4 Follow the onscreen instructions. Verify your email address, if required. 5 Make sure Find My iPhone is turned on. Only one MobileMe account at a time can be used for Find My iPhone and for syncing contacts, calendars, bookmarks, and notes. To use Gallery, iDisk, and Find My iPhone on iPhone, download the free MobileMe Gallery, MobileMe iDisk, and Find My iPhone apps from the App Store. Setting Up Microsoft Exchange Accounts To use Microsoft Exchange on iPhone, you need to add an account with your Microsoft Exchange account settings. See your service provider or system administrator for those settings. iPhone uses the Exchange ActiveSync protocol to sync email, calendars, and contacts over the air with the following versions of Microsoft Exchange:  Exchange Server 2003 Service Pack 2  Exchange Server 2007 Service Pack 1  Exchange Server 2010 When setting up the account, you can choose which Exchange services you want to use with iPhone:  Mail  Contacts 26 Chapter 2 Getting Started APPLE CONFIDENTIAL â First Draft (1.10.11)  Calendars Services you turn on are synced automatically over the air without having to connect iPhone to your computer. See âSyncing Accountsâ on page 56. You can set up multiple Exchange accounts. Set up an Exchange account: 1 In Settings, tap âMail, Contacts, Calendars.â 2 Tap Add Account, then tap Microsoft Exchange. 3 Enter your complete email address, domain (optional), user name, password, and a description. The description can be whatever you like. iPhone supports Microsoftâs Autodiscovery service, which uses your user name and password to determine the address of the Exchange server. If the serverâs address canât be determined, youâre asked to enter it. (Enter the complete address in the Server °GNF 1PEG[QWEQPPGEVVQVJG'ZEJCPIGUGTXGT[QWOC[DGRTQORVGFVQEJCPIG[QWT passcode to match the policies set on the server. 4 Tap the items you want to use on iPhone (mail, contacts, and calendars) and set how many days of email you want to sync to iPhone. Setting Up Google, Yahoo!, and AOL Accounts For many popular accounts (Google, Yahoo!, AOL), iPhone enters most of the settings for you. When setting up the account, you can choose which account services you want to use with iPhone. Services you turn on are synced automatically over the air without having to connect iPhone to your computer. See âSyncing Accountsâ on page 56. Set up an account: 1 In Settings, tap âMail, Contacts, Calendars.â 2 Tap Add Account, then tap Google, Yahoo!, or AOL. 3 Enter your name, complete email address, password, and a description. The description can be whatever you like. 4 Tap the items you want to use on iPhone. Available items depend upon the service provider. Setting Up Other Accounts Choose Other Accounts to set up other accounts for mail (such as POP), contacts (such as LDAP or CardDAV), or calendars (such as CalDAV). Contact your service provider or system administrator to get the account settings you need. Set up an account: 1 In Settings, tap âMail, Contacts, Calendars.â Chapter 2 Getting Started 27 APPLE CONFIDENTIAL â First Draft (1.10.11) 2 Tap Add Account, then tap Other. 3 Choose the account type you want to add (Mail, Contacts, or Calendars). 4 Enter your account information and tap Save. 28 Chapter 2 Getting Started APPLE CONFIDENTIAL â First Draft (1.10.11) Basics Using Apps 6JGJKIJTGUQNWVKQP/WNVK6QWEJUETGGPCPFUKORNG°PIGTIGUVWTGUOCMGKVGCU[VQWUG iPhone apps. Opening and Switching Apps You open an app on iPhone by tapping its icon on the Home screen. Return to the Home screen: Press the Home button below the display. Switch to another Home screen: Flick left or right, or tap to the left or right of the row of dots. )QVQVJG°TUV*QOGUETGGPPress the Home button. On iPhone 3GS or later, you can quickly switch between the apps youâre using; multitasking also allows certain apps to run in the background. 29 APPLE CONFIDENTIAL â First Draft (1.10.11) View the most recently used apps (iPhone 3GS or later): Double-click the Home button. The four most recently used app are shown at the bottom of the screen. Flick left to see more apps. Note: 1PK2JQPG)FQWDNGENKEMKPIVJG*QOGDWVVQPRGTHQTOUVJGCEVKQPURGEK°GF by the Home Button setting. See âHome Buttonâ on page 200. Remove an app from the recents list: Touch and hold the app icon until it begins to jiggle, then tap . The app is added to recent apps again the next time you open it. Scrolling Drag up or down to scroll. On some screens such as webpages, you can also scroll side to side. &TCIIKPI[QWT°PIGTVQUETQNNYQP¨VEJQQUGQTCEVKXCVGCP[VJKPIQPVJGUETGGP 30 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) Flick to scroll quickly. You can wait for the scrolling to come to a stop, or touch anywhere on the screen to stop it immediately. Touching the screen to stop scrolling wonât choose or activate anything. To quickly scroll to the top of a list, webpage, or email, just tap the status bar. Find items in an indexed list: Tap a letter to jump to items starting with that letter. &TCI[QWT°PIGTCNQPIVJGKPFGZVQUETQNNSWKEMN[VJTQWIJVJGNKUV 0UKL_ Choose an item: Tap an item in the list. &GRGPFKPIQPVJGNKUVVCRRKPICPKVGOECPFQFKĂGTGPVVJKPIU¤HQTGZCORNGKVOC[ open a new list, play a song, open an email, or show someoneâs contact information so you can call that person. Chapter 3 Basics 31 APPLE CONFIDENTIAL â First Draft (1.10.11) Zooming In or Out When viewing photos, webpages, email, or maps, you can zoom in and out. Pinch your °PIGTUVQIGVJGTQTCRCTV(QTRJQVQUCPFYGDRCIGU[QWECPFQWDNGVCR VCRVYKEG quickly) to zoom in, then double-tap again to zoom out. For maps, double-tap to zoom KPCPFVCRQPEGYKVJVYQ°PIGTUVQ\QQOQWV Viewing in Portrait or Landscape Orientation Many iPhone apps let you view the screen in either portrait or landscape orientation. 4QVCVGK2JQPGCPFVJGFKURNC[TQVCVGUVQQCFLWUVKPICWVQOCVKECNN[VQ°VVJGPGY screen orientation. You may prefer landscape orientation for viewing webpages in Safari, or when entering text, for example. In landscape orientation:  Webpages scale to the wider screen, making the text and images larger.  The onscreen keyboard is larger, which may help increase your typing speed and accuracy. The following apps support both portrait and landscape orientation:  Mail  Safari  Messages  Notes  Contacts 32 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11)  Stocks  iPod  Photos  Camera  Calculator Movies viewed in iPod and YouTube appear only in landscape orientation. Street views in Maps also appear only in landscape orientation. Lock the screen in portrait orientation (iPhone 3GS or later): Double-click the Home DWVVQPÂąKEMVJGDQVVQOQHVJGUETGGPHTQONGHVVQTKIJVVJGPVCR . The portrait orientation lock ( ) icon appears in the status bar when the screen orientation is locked. Customizing the Home Screen You can customize the layout of icons on the Home screenâincluding the Dock icons along the bottom of the screen. If you want, arrange them over multiple Home screens. You can also organize apps by grouping them in folders. Rearranging Icons You can arrange the icons on your Home screen in any order you want. Rearrange icons: 1 Touch and hold any icon on the Home screen until it begins to jiggle. 2 Arrange the icons by dragging them. 3 Press the Home button to save your arrangement. You can also add links to your favorite webpages on the Home screen. See âWeb Clipsâ on page 94. When iPhone is connected to your computer, you can rearrange icons on the Home screen and the order of the screens. In iTunes, select iPhone in the Devices list, then click Apps at the top of the screen. Chapter 3 Basics 33 APPLE CONFIDENTIAL â First Draft (1.10.11) Move an icon to another screen: While arranging icons, drag an icon to the side of the screen. Create additional Home screens: 9JKNGCTTCPIKPIKEQPUÂąKEMVQVJGTKIJVOQUV*QOG screen, then drag an icon to the right edge of the screen until a new screen appears. You can create up to 11 screens. The number of dots above the Dock shows the number of screens you have, and which screen youâre viewing. Reset your Home screen to the default layout: Choose Settings > General > Reset and tap Reset Home Screen Layout. Resetting the Home screen removes any folders youâve created and applies the default wallpaper to your Home screen. Organizing with Folders Folders let you organize icons on the Home screen. You can put up to 12 icons in a folder. iPhone automatically names a folder when you create it, based on the icons you use to create the folder, but you can change the name anytime you want. Like icons, folders can be rearranged by dragging them around the Home screen. You can move folders to a new Home screen or to the Dock. Create a folder: Touch and hold an icon until the Home screen icons begin to jiggle, then drag the icon onto another icon. 34 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) iPhone creates a new folder that includes the two icons, and shows the folderâs name. ;QWECPVCRVJGPCOG°GNFCPFGPVGTCFKĂGTGPVPCOG You can also create folders within iTunes. Create a folder using iTunes: With iPhone connected to your computer, select iPhone in the Devices list in iTunes. Click Apps at the top of the screen, and on the Home screen near the top of the window, drag an app on top of another. Add an icon to a folder While arranging icons, drag the icon onto the folder. Remove an icon from a folder While arranging icons, tap to open the folder, then drag the icon out of the folder. Open a folder Tap the folder. You can then tap an app icon to open that app. Close a folder Tap outside the folder, or press the Home button. Delete a folder Move all icons out of the folder. The folder is deleted automatically when empty. Rename a folder While arranging icons, tap to open the folder, then tap the name at the top and use the keyboard to enter a new name. Press the Home button to save your changes. 9JGP[QW°PKUJQTICPK\KPI[QWT*QOGUETGGPRTGUUVJG*QOG changes. button to save your Many apps, such as Phone, Messages, Mail, and the App Store, display a badge on their Home screen icon with a number (to indicate incoming items) or exclamation mark (to indicate a problem). If these apps are contained in a folder, the badge appears on the folder. A numbered badge shows the total number of items you havenât attended to, such as incoming phone calls, email messages, text messages, and updated apps to download. An alert badge indicates a problem with an app in the folder. Chapter 3 Basics 35 APPLE CONFIDENTIAL â First Draft (1.10.11) Adding Wallpaper You can set an image or photo as wallpaper for the Lock screen. On iPhone 3GS or later, you can also set wallpaper for your Home screen. You can choose an image that came with iPhone, a photo from your Camera Roll, or a photo synced to iPhone from your computer. The Lock screen wallpaper also appears when youâre on a call with someone you donât have a contact photo for. Set wallpaper (iPhone 3GS or later): 1 In Settings, choose Wallpaper, tap the image of the Lock and Home screens, then tap Wallpaper or an album. 2 Tap to choose an image or photo. If you chose a photo, drag to position it and pinch to zoom in or out, until it looks the way you want. 3 Tap Set, then choose whether you want to use the photo as wallpaper for your Lock Screen, Home screen, or both. Set wallpaper (iPhone 3G): 1 Choose Settings > Wallpaper, then tap Wallpaper or an album. 2 Tap to choose an image or photo. If you choose a photo, drag it to position it and pinch to zoom in or out, until it looks the way you want. 3 Tap Set Wallpaper. Typing The onscreen keyboard appears anytime you need to type. 36 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) Entering Text Use the keyboard to enter text, such as contact information, email, text messages, and web addresses. The keyboard corrects misspellings, predicts what you're typing, and learns as you use it. Depending on the app youâre using, the intelligent keyboard may suggest corrections as you type, to help prevent mistyped words. Enter text: 1 6CRCVGZV°GNFUWEJCUKPCPQVGQTPGYEQPVCEVVQDTKPIWRVJGMG[DQCTF 2 Tap keys on the keyboard. 5VCTVD[V[RKPIYKVJLWUV[QWTKPFGZ°PIGT#U[QWIGVOQTGRTQ°EKGPV[QWECPV[RG more quickly using two thumbs. #U[QWV[RGGCEJNGVVGTCRRGCTUCDQXG[QWTVJWODQT°PIGT+H[QWVQWEJVJGYTQPI MG[[QWECPUNKFG[QWT°PIGTVQVJGEQTTGEVMG[6JGNGVVGTKUP¨VGPVGTGFWPVKN[QW TGNGCUG[QWT°PIGTHTQOVJGMG[ Delete the previous character Tap Type uppercase Tap the Shift key before tapping a letter. Or touch and hold the Shift key, then slide to a letter. Quickly type a period and space Double-tap the space bar. (You can turn VJKUHGCVWTGQPQTQĂKP5GVVKPIU )GPGTCN -G[DQCTF Turn caps lock on Double-tap the Shift key. The Shift key turns blue, and all letters you type are uppercase. Tap VJG5JKHVMG[CICKPVQVWTPECRUNQEMQĂ ;QWECP VWTPVJKUHGCVWTGQPQTQĂKP5GVVKPIU )GPGTCN -G[DQCTF Chapter 3 Basics 37 APPLE CONFIDENTIAL â First Draft (1.10.11) Show numbers, punctuation, or symbols Tap the Number key. Tap the Symbol key to see additional punctuation and symbols. Type letters or symbols that arenât on the keyboard Touch and hold the related letter or symbol, then slide to choose a variation. Dictionary For many languages, iPhone has dictionaries to help you type. The appropriate dictionary is activated when you select a supported keyboard. For a list of supported languages, see www.apple.com/iphone/specs.html. iPhone uses the active dictionary to suggest corrections or complete the word youâre typing. You donât need to interrupt your typing to accept the suggested word. :\NNLZ[LK ^VYK Accept or reject dictionary suggestions: B To reject the suggested word, °PKUJV[RKPIVJGYQTFCU[QWYCPVKVVJGPVCRVJGÂĽZÂŚVQ dismiss the suggestion before typing anything else. Each time you reject a suggestion for the same word, iPhone becomes more likely to accept your word. Note: If youâre entering Chinese or Japanese, tap one of the suggested alternatives. B To use the suggested word, type a space, punctuation mark, or return character. iPhone also underlines words youâve already typed that might be misspelled. Use spell checking to replace a misspelled word: Tap the underlined word, then tap one of the suggested corrections. 38 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) If none of the suggestions is correct, you can correct the spelling of the selected word by retyping it. To leave the word unchanged, tap somewhere else in the message area. 6WTPCWVQEQTTGEVKQPQPQTQĂ%JQQUG)GPGTCN -G[DQCTFVJGPVWTP#WVQ %QTTGEVKQPQPQTQĂ#WVQ%QTTGEVKQPKUQPD[FGHCWNV 6WTPURGNNEJGEMKPIQPQTQĂ%JQQUG)GPGTCN -G[DQCTFVJGPVWTP%JGEM5RGNNKPI QPQTQĂ5RGNNEJGEMKPIKUQPD[FGHCWNV EditingâCut, Copy, and Paste The touchscreen makes it easy to make changes to text youâve entered. An onscreen magnifying glass helps you position the insertion point precisely where you need it. Grab points on selected text let you quickly select more or less text. You can also cut, copy, and paste text and photos within apps, or across multiple apps. Position the insertion point: Touch and hold to bring up the magnifying glass, then drag to position the insertion point. Select text: Tap the insertion point to display the selection buttons. Tap Select to select the adjacent word or tap Select All to select all text. You can also double-tap to select a word. In read-only documents, such as webpages, or email or text messages youâve received, touch and hold to select a word. Drag the grab points to select more or less text. Chapter 3 Basics 39 APPLE CONFIDENTIAL â First Draft (1.10.11) Cut or copy text: Select text, then tap Cut or Copy. Paste text: Tap the insertion point and tap Paste. The last text that you cut or copied is inserted. Or select text and tap Paste to replace the text. Undo the last edit: Shake iPhone and tap Undo. International Keyboards +PVGTPCVKQPCNMG[DQCTFUCNNQY[QWVQGPVGTVGZVKPOCP[FKĂGTGPVNCPIWCIGUKPENWFKPI languages that are written from right to left. If you want to enter text in other languages, you can use Settings to make additional keyboards available when you type. For a list of supported keyboards, go to www.apple.com/iphone/specs.html. Add a keyboard: 1 +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFU The number before the arrow indicates the number of keyboards currently enabled. 2 6CR#FF0GY-G[DQCTFVJGPEJQQUGCMG[DQCTFHTQOVJGNKUV Repeat to add more keyboards. Some languages have multiple keyboards available. Switch keyboards when youâre typing: Tap . When you tap the symbol, the name of VJGPGYN[CEVKXCVGFMG[DQCTFCRRGCTUDTKGÂą[ You can also touch and hold to display a list of available keyboards. To choose a MG[DQCTFHTQOVJGNKUVUNKFG[QWT°PIGTVQVJGPCOGQHVJGMG[DQCTFVJGPTGNGCUG ;HWVY[V\JOHUK OVSK[VZ^P[JO RL`IVHYKZ Edit your keyboard list: %JQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFUVJGP tap Edit and do one of the following:  To delete a keyboard, tap  To reorder the list, drag 40 Chapter 3 Basics , then tap Delete. next to a keyboard to a new place in the list. APPLE CONFIDENTIAL â First Draft (1.10.11) Type letters, numbers, or symbols that arenât on Touch and hold the related letter, number, or the keyboard symbol, then slide to choose a variation. On the Thai keyboards, for example, you can choose native numbers by touching and holding the related Arabic number. Enter Japanese Kana 7UGVJG-CPCMG[RCFVQUGNGEVU[NNCDNGU(QTOQTG syllable options, tap the arrow key and select another syllable or word from the window. Enter Japanese QWERTY Use the QWERTY keyboard to input code for Japanese syllables. As you type, suggested syllables appear. Tap the syllable to choose it. Enter Emoji picture characters Use the Emoji keyboard. Available only on iPhones purchased and used in Japan. Enter facemarks 7UKPIVJG,CRCPGUG-CPCMG[DQCTFVCRVJGÂĽ@A@ÂŚ key. Using the Japanese Romaji keyboard (QWERTYJapanese layout), tap the Number key, then VCRVJGÂĽ@A@ÂŚMG[ 7UKPIVJG%JKPGUG 5KORNK°GFQT6TCFKVKQPCN Pinyin or (Traditional) Zhuyin keyboards, tap the Symbols MG[VJGPVCRVJGÂĽ@A@ÂŚMG[ Enter Korean 7UGVJG5GV-QTGCPMG[DQCTFVQV[RG*CPIWN letters. To type double consonants or compound vowels, touch and hold the letter, then slide to choose the double letter. 'PVGT5KORNK°GFQT6TCFKVKQPCN%JKPGUG2KP[KP Use the QWERTY keyboard to enter Pinyin for Chinese characters. As you type, suggested Chinese characters appear. Tap a suggestion to choose it, or continue entering Pinyin to see more options. If you keep entering Pinyin without spaces, sentence suggestions appear. Enter Chinese Cangjie Use the keyboard to build Chinese characters from the component Cangjie keys. As you type, suggested Chinese characters appear. Tap a character to choose it, or continue typing up VQ°XGVQVCNEQORQPGPVUVQUGGOQTGEJCTCEVGT options. Chapter 3 Basics 41 APPLE CONFIDENTIAL â First Draft (1.10.11) 42 'PVGT5KORNK°GF%JKPGUG5VTQMG 9WDK*WC Use the keypad to build Chinese characters using WRVQ°XGUVTQMGUKPVJGEQTTGEVYTKVKPIUGSWGPEG from left to right, top to bottom, outside to inside, and from inside to the closing stroke (for GZCORNGVJG%JKPGUGEJCTCEVGT EKTENG UJQWNF DGIKPYKVJVJGXGTVKECNUVTQMG As you type, suggested Chinese characters appear (the most commonly used characters CRRGCT°TUV 6CRCEJCTCEVGTVQEJQQUGKV If youâre not sure of the correct stroke, enter an asterisk (*). To see more character options, type another stroke, or scroll through the character list. 6CRVJGOCVEJ MG[VQUJQYQPN[EJCTCEVGTU that match exactly what you typed. For example, KH[QWV[RG QPGQPG CPFVCRVJGOCVEJ MG[VJGNGUUEQOOQPN[WUGF VYQ CRRGCTUCU an exact match. Enter Traditional Chinese Zhuyin Use the keyboard to enter Zhuyin letters. As you type, suggested Chinese characters appear. Tap a suggestion to choose it, or continue entering Zhuyin letters to see more options. After you type an initial letter, the keyboard changes to show more letters. If you keep entering Zhuyin without spaces, sentence suggestions appear. 'PVGTJCPFYTKVVGP5KORNK°GFQT6TCFKVKQPCN Chinese Write Chinese characters directly on the screen YKVJ[QWT°PIGT#U[QWYTKVGEJCTCEVGTUVTQMGU iPhone recognizes them and shows matching characters in a list, with the closest match at the top. When you choose a character, its likely follow-on characters appear in the list as additional choices. You can get some complex characters by writing two or more component characters. For example, GPVGT °UJ VJGP DTKUVNG VQIGV RCTVKCN PCOGQH*QPI-QPI+PVGTPCVKQPCN#KTRQTV YJKEJ appears in the character list with an arrow next to it. Tap the character to replace the characters you entered. 9KVJ5KORNK°GF%JKPGUGJCPFYTKVKPI4QOCP characters are also recognized. Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) %QPXGTVDGVYGGP5KORNK°GFCPF6TCFKVKQPCN Chinese Select the character or characters you want to convert, then tap Replace. See âEditingâCut, Copy, and Pasteâ on page 39. Enter Vietnamese Touch and hold a character to see the available diacritical marks, then slide to choose the one you want. You can also type the following key sequences to enter characters with diacritical marks:  CC¤j CEKTEWOÂąGZ  CY¤ CECTQP  GG¤q GEKTEWOÂąGZ  QQ¤z QEKTEWOÂąGZ  QY¤ QJQQM  Y¤ WJQQM  FF¤ FFCUJ  asâĂĄ (a acute)  afâĂ (a grave)  CT¤ CSWGUVKQPOCTM  axâĂŁ (a rising accent)  CL¤ CFTQRVQPG 9JGP5KORNK°GFQT6TCFKVKQPCN%JKPGUGJCPFYTKVKPIHQTOCVUCTGVWTPGFQP[QWECP GPVGT%JKPGUGEJCTCEVGTUYKVJ[QWT°PIGTCUUJQYP ;V\JOWHK When using certain Chinese or Japanese keyboards, you can create a dictionary of word and input pairs. When you type a word from the dictionary while using a supported keyboard, the associated input is substituted for the word. The dictionary is available for the following keyboards:  %JKPGUG5KORNK°GF 2KP[KP  Chinese - Traditional (Pinyin)  Chinese - Traditional (Zhuyin)  Japanese (Romaji) Chapter 3 Basics 43 APPLE CONFIDENTIAL â First Draft (1.10.11)  ,CRCPGUG 6GP-G[ Add a word to the dictionary: +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF 'FKV7UGT &KEVKQPCT[6CR VCRVJG9QTF°GNFCPFGPVGTVJGYQTFVJGPVCRVJG;QOK2KP[KPQTBluetooth, tap next to the device name, then tap âForget this Device.â ;QWECPCRRN[FKĂGTGPVNC[QWVUVQCYKTGNGUUMG[DQCTF5GGÂĽ+PVGTPCVKQPCN-G[DQCTFUâ on page 40 and â-G[DQCTF.C[QWVUâ on page 44. 44 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) Printing About AirPrint AirPrint lets you print wirelessly to AirPrint-capable printers. You can print from the following iOS apps:  Mailâemail messages and attachments that can be viewed in Quick Look  Photosâphotos  Safariâwebpages, PDFs, and other attachments that can be viewed in Quick Look  iBooksâPDFs Other apps available from the App Store may also support AirPrint. AirPrint-capable printers donât require setup; they just need to be connected to the same Wi-Fi network as iPhone. (If youâre not sure whether your printer is AirPrintcapable, refer to its documentation.) For more information, go to support.apple.com/kb/HT4356. Printing a Document AirPrint uses your Wi-Fi network to send print jobs wirelessly to your printer. iPhone must be connected to the same wireless network as the AirPrint printer. Print a document: 1 Tap or (depending on the app youâre using), then tap Print. 2 Tap Select Printer to select a printer. 3 Set printer options such as number of copies and double-sided output (if the printer supports it). Some apps also let you set a range of pages to print. 4 Tap Print. Chapter 3 Basics 45 APPLE CONFIDENTIAL â First Draft (1.10.11) See the status of a print job: Double-click the Home button, then tap Print Center. The Print Center app appears as the most recent app when a document is printing. A badge on the app icon shows how many documents are queued for printing. If youâre printing more than one document, select a print job to see its status summary. Cancel a print job: Double-click the Home button, tap Print Center, select the print job (if youâre printing more than one document), then tap Cancel Printing. 46 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) Searching You can search many apps on iPhone, including Mail, Calendar, iPod, Notes, Messages (iPhone 3GS or later), and Contacts. You can search an individual app, or search all apps at once using Search. Go to Search: 1PVJGOCKP*QOGUETGGPÂąKEMNGHVVQTKIJVQTRTGUUVJG*QOG button. From the Search screen, press the Home page. button to return to the main Home screen Search iPhone: 1PVJG5GCTEJUETGGPGPVGTVGZVKPVJG5GCTEJ°GNF5GCTEJTGUWNVU appear as you type. Tap an item in the list to open it. Tap Search to dismiss the keyboard and see more results. Icons next to the search results show which app the results are from. iPhone may display a top hit for you at the top of the list, based on your previous searches. The Safari search results include options to search the web or to search Wikipedia. App Whatâs searched Contacts First, last, and company names Mail 6Q(TQOCPF5WDLGEV°GNFUQHCNNCEEQWPVU VJG text of messages isnât searched) Calendar Event titles, invitees, locations, and notes iPod Music (names of songs, artists, and albums) and the titles of podcasts, videos, and audiobooks Messages (iPhone 3GS or later) Names and text of messages Notes Text of notes Chapter 3 Basics 47 APPLE CONFIDENTIAL â First Draft (1.10.11) Search also searches the names of the native and installed apps on iPhone, so if you have a lot of apps, you may want to use Search to locate and open apps. Open apps from Search: Enter the app name, then tap to open the app directly from the search results. Use the Spotlight Search setting to specify which contents are searched and the order the results are presented in. See âSpotlight Searchâ on page 201. Voice Control Voice Control (iPhone 3GS or later) lets you make phone calls and control iPod music playback using voice commands. Note: Voice Control may not be available in all languages. Use Voice Control: Press and hold the Home button until the Voice Control screen appears and you hear a beep. You can also press and hold the center button on the iPhone earphones. Use the following commands to make calls or play songs. 48 Call someone in contacts Say âcallâ or âdial,â then say the name of the person. If the person has more than one phone number, you can add âhomeâ or âmobile,â for example. Make a FaceTime call someone in contacts (iPhone 4 only) Say âFaceTime,â then say the name of the person. If the person has more than one phone number, you can add âhomeâ or âmobile,â for example. Dial a number Say âcallâ or âdial,â then say the number. Control music playback Say âplayâ or âplay music.â To pause, say âpauseâ or âpause music.â You can also say ânext songâ or âprevious song.â Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) Play an album, artist, or playlist Say âplay,â then say âalbum,â âartist,â or âplaylistâ and the name. 5JWĂGVJGEWTTGPVRNC[NKUV 5C[ÂĽUJWĂGÂŚ Find out more about the currently playing song Say âwhatâs playing,â âwhat song is this,â âwho sings this song,â or âwho is this song by.â Use Genius to play similar songs Say âGenius,â âplay more like this,â or âplay more songs like this.â Find out the current time Say âwhat time is it?â or âwhat is the time?â Cancel Voice Control Say âcancelâ or âstop.â For best results:  Speak into the iPhone microphone as if you were making a phone call. You can also use the microphone on your Bluetooth headset or compatible Bluetooth car kit.  Speak clearly and naturally.  Say only iPhone commands and names, and numbers. Pause slightly between commands.  Use full names. For more about using Voice Control, including information about using Voice Control KPFKĂGTGPVNCPIWCIGUIQVQsupport.apple.com/kb/HT3597. Voice Control normally expects you to speak voice commands in the language thatâs set for iPhone (the setting in General > International > Language). Voice Control settings let you change the language for speaking voice commands. Some languages CTGCXCKNCDNGKPFKĂGTGPVFKCNGEVUQTCEEGPVU Change the language or country: In Settings, choose General > International > Voice Control and tap the language or country. Voice Control for the iPod app is always on, but for better security you can prevent voice dialing when iPhone is locked. Prevent voice dialing when iPhone is locked: In Settings, choose General > Passcode .QEMCPFVWTP8QKEG&KCNQĂ7PNQEMK2JQPGVQWUGXQKEGFKCNKPI See âVoice Dialingâ on page 65 and âUsing Voice Control with iPodâ on page 100. Chapter 3 Basics 49 APPLE CONFIDENTIAL â First Draft (1.10.11) Apple Earphones with Remote and Mic The Apple Earphones with Remote and Mic included with iPhone feature a microphone, volume buttons, and an integrated button that allows you to answer and end calls easily, and control audio and video playback. *LU[LYI\[[VU Plug in the earphones to listen to music or make a phone call. Press the center button to control music playback and answer or end calls, even when iPhone is locked. Pause a song or video Press the center button. Press again to resume playback. Skip to the next song Press the center button twice quickly. Return to previous song Press the center button three times quickly. Fast-forward Press the center button twice quickly and hold. Rewind Press the center button three times quickly and hold. Adjust the volume (iPhone 3GS or later) Press the + or â button. Answer an incoming call Press the center button. End the current call Press the center button. Decline an incoming call Press and hold the center button for about two UGEQPFUVJGPNGVIQ6YQNQYDGGRUEQP°TO[QW declined the call. Switch to an incoming or on-hold call and put the current call on hold Press the center button. Press again to switch DCEMVQVJG°TUVECNN Switch to an incoming or on-hold call and end the current call Press and hold the center button for about two UGEQPFUVJGPNGVIQ6YQNQYDGGRUEQP°TO[QW GPFGFVJG°TUVECNN Use Voice Control (iPhone 3GS or later) Press and hold the center button. See âVoice Controlâ on page 48. If you get a call while the earphones are plugged in, you can hear the ringtone through both the iPhone speaker and the earphones. 50 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) Bluetooth Devices ;QWECPWUGK2JQPGYKVJVJG#RRNG9KTGNGUU-G[DQCTFCPFQVJGT$NWGVQQVJFGXKEGU such as Bluetooth headsets, car kits, and stereo headphones. Third-party Bluetooth headphones may support volume and playback controls. See the documentation that ECOGYKVJ[QWT$NWGVQQVJFGXKEG(QTUWRRQTVGF$NWGVQQVJRTQ°NGUIQVQsupport. apple.com/kb/HT3647. Pairing a Bluetooth Device with iPhone WARNING: For important information about avoiding hearing loss and about driving safely, see the Important Product Information Guide at www.apple.com/support/ manuals/iphone. $GHQTG[QWECPWUGC$NWGVQQVJFGXKEGYKVJK2JQPG[QWOWUV°TUVRCKTVJGO Pair a Bluetooth headset, car kit, or other device with iPhone: 1 Follow the instructions that came with the device to make it discoverable or to set it to search for other Bluetooth devices. 2 In Settings, choose General > Bluetooth and turn Bluetooth on. 3 Choose the device on iPhone, and enter its passkey or PIN number. See the instructions about the passkey or PIN that came with the device. After you pair a Bluetooth device to work with iPhone, you must make a connection to have iPhone use the device for your calls. See the documentation that came with the device. When iPhone is connected to a Bluetooth headset or car kit, outgoing calls are routed through the device. Incoming calls are routed through the device if you answer using the device, and through iPhone if you answer using iPhone. Pair an Apple Wireless Keyboard with iPhone: 1 In Settings, choose General > Bluetooth and turn Bluetooth on. 2 2TGUUVJGRQYGTDWVVQPQPVJG#RRNG9KTGNGUU-G[DQCTFVQVWTPKVQP 3 On iPhone, select the keyboard listed under Devices. 4 Type the passkey on the keyboard as instructed, then press Return. Note: ;QWECPRCKTQPN[QPG#RRNG9KTGNGUU-G[DQCTFYKVJK2JQPGCVCVKOG6QRCKTC FKĂGTGPVMG[DQCTF[QWOWUV°TUVWPRCKTVJGEWTTGPVQPG For more information, see â7UKPICP#RRNG9KTGNGUU-G[DQCTFâ on page 44. Bluetooth Status The Bluetooth icon appears in the iPhone status bar at the top of the screen:  or : Bluetooth is on and a device is connected to iPhone. (The color depends on the current color of the status bar.) Chapter 3 Basics 51 APPLE CONFIDENTIAL â First Draft (1.10.11)  : Bluetooth is on but no device is connected. If youâve paired a device with iPhone, KVOC[DGQWVQHTCPIGQTVWTPGFQĂ Â No Bluetooth icon: $NWGVQQVJKUVWTPGFQĂ Unpairing a Bluetooth Device from iPhone You can unpair a Bluetooth device if you donât want to use it with iPhone any more. Unpair a Bluetooth device: 1 In Settings, choose General > Bluetooth and turn Bluetooth on. 2 Tap next to the device name, then tap âForget this Device.â Battery iPhone has an internal rechargeable battery. Charging the Battery WARNING: For important safety information about charging iPhone, see the Important Product Information Guide at www.apple.com/support/manuals/iphone. The battery icon in the upper-right corner shows the battery level or charging status. You can also display the percentage of the battery charge (iPhone 3GS or later). See âUsageâ on page 198. *OHYNPUN *OHYNLK Charge the battery: Connect iPhone to a power outlet using the included Dock Connector to USB Cable and USB power adapter. Charge the battery and sync iPhone: Connect iPhone to your computer using the included Dock Connector to USB Cable. Or connect iPhone to your computer using the included cable and the Dock, available separately. 52 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) Unless your keyboard has a high-powered USB 2.0 port, you must connect iPhone to a USB 2.0 port on your computer. Important: The iPhone battery may drain instead of charge if iPhone is connected to a EQORWVGTVJCV¨UVWTPGFQĂQTKUKPUNGGRQTUVCPFD[OQFG If you charge the battery while syncing or using iPhone, it may take longer to charge. Important: If iPhone is very low on power, it may display one of the following images, indicating that iPhone needs to charge for up to ten minutes before you can use it. If iPhone is extremely low on power, the display may be blank for up to two minutes before one of the low-battery images appears. VY Maximizing Battery Life iPhone uses lithium-ion batteries. To learn more about how to maximize the lifespan and battery life of your iPhone, go to www.apple.com/batteries. Replacing the Battery Rechargeable batteries have a limited number of charge cycles and may eventually need to be replaced. The iPhone battery isnât user replaceable; it can only be replaced by an authorized service provider. For more information, go to www.apple.com/ support/iphone/service/battery. Security Features Security features help protect the information on iPhone from being accessed by others. Chapter 3 Basics 53 APPLE CONFIDENTIAL â First Draft (1.10.11) Passcodes and Data Protection You can set a passcode that you must enter each time you turn on or wake up iPhone. Set a passcode: Choose Settings > General > Passcode Lock and enter a 4-digit passcode, then enter the passcode again to verify it. iPhone then requires you to enter the passcode to unlock it or to display the passcode lock settings. Setting a passcode turns on data protection (iPhone 3GS or later). Data protection uses your passcode as the key for encrypting mail messages and their attachments stored on iPhone. (Data protection may also be used by some apps available in the App Store.) A notice at the bottom of the Passcode Lock screen in Settings indicates when data protection is enabled. 6QKPETGCUGVJGUGEWTKV[QHK2JQPGVWTPQĂ5KORNG2CUUEQFGCPFWUGCNQPIGTRCUUEQFG with a combination of numbers, letters, punctuation, and special characters. See âPasscode Lockâ on page 201. Important: On an iPhone 3GS that didnât ship with iOS 4 or later, you must also restore iOS software to enable data protection. See âRestoring iPhoneâ on page 256. Prevent voice dialing when iPhone is locked: In Settings, choose General > Passcode .QEMCPFVWTP8QKEG&KCNQĂ7PNQEMK2JQPGVQWUGXQKEGFKCNKPI Find My iPhone Find My iPhone helps you locate and secure your iPhone using the free Find My iPhone app on another iPhone, iPad, or iPod touch, or using a Mac or PC with a web browser. Find My iPhone includes:  Locate on a map: View the approximate location of your iPhone on a full-screen map  Display a Message or Play a Sound: Lets you compose a message that will appear on your iPhone screen, or play a sound at full volume for two minutes, even if the Ring/Silent switch is set to silent  Remote Passcode Lock: Lets you remotely lock your iPhone and create a 4-digit passcode, if you havenât set one previously  Remote Wipe: Lets you protect your privacy by erasing all media and data on iPhone, restoring it to factory settings Use Find My iPhone: You need to turn on Find My iPhone on iPhone before you can use these features. See âSetting Up MobileMe Accountsâ on page 25. To locate your missing iPhone and use the other Find My iPhone features, download the free Find My iPhone app from the App Store on another iOS device, or sign in to me.com in a web browser on a Mac or PC. 54 Chapter 3 Basics APPLE CONFIDENTIAL â First Draft (1.10.11) Note: Find My iPhone requires a MobileMe account. MobileMe is Appleâs online service, which provides Find My iPhone for free to iPhone 4 customers, and additional features with a paid subscription. MobileMe may not be available in all countries or regions. For more information, see âSetting Up MobileMe Accountsâ on page 25, or go to www.apple.com/mobileme. Cleaning iPhone Clean iPhone immediately if it comes in contact with any contaminants that may cause stains, such as ink, dyes, makeup, dirt, food, oils, or lotions. To clean iPhone, disconnect CNNECDNGUCPFVWTPQĂK2JQPG RTGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPVJGP slide the onscreen slider). Then use a soft, slightly damp, lint-free cloth. Avoid getting moisture in openings. Donât use window cleaners, household cleaners, compressed air, aerosol sprays, solvents, alcohol, ammonia, or abrasives to clean iPhone. The front cover of iPhone 3GS and the front and back covers of iPhone 4 are made of glass and have an oleophobic coating. To clean these surfaces, simply wipe with a soft, lint-free cloth. The ability of this coating to repel oil will diminish over time with normal usage, and TWDDKPIVJGUETGGPYKVJCPCDTCUKXGOCVGTKCNYKNNHWTVJGTFKOKPKUJKVUGĂGEVCPFOC[ scratch the glass. For more information about handling iPhone, see the iPhone Important Product Information Guide at www.apple.com/support/manuals/iphone. Restarting or Resetting iPhone If something isnât working right, try restarting iPhone, force quitting an app, or resetting iPhone. Restart iPhone: 2TGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPWPVKNVJGTGFUNKFGT CRRGCTU5NKFG[QWT°PIGTCETQUUVJGUNKFGTVQVWTPQĂK2JQPG6QVWTPK2JQPGDCEMQP RTGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPWPVKNVJG#RRNGNQIQCRRGCTU +H[QWECP¨VVWTPQĂK2JQPGQTKHVJGRTQDNGOEQPVKPWGU[QWOC[PGGFVQTGUGVK2JQPG #TGUGVUJQWNFDGFQPGQPN[KHVWTPKPIK2JQPGQĂCPFQPFQGUP¨VTGUQNXGVJGRTQDNGO Force quit an app: 2TGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPHQTCHGYUGEQPFU until a red slider appears, then press and hold the Home button until the app quits. On iPhone 3GS or later, you can also remove an app from the recents list to force it to quit. See âOpening and Switching Appsâ on page 29. Reset iPhone: 2TGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPCPFVJG*QOGDWVVQPCV the same time for at least ten seconds, until the Apple logo appears. For more troubleshooting suggestions, see Appendix A, âSupport and Other Information,â on page 254. Chapter 3 Basics 55 APPLE CONFIDENTIAL â First Draft (1.10.11) Syncing and File Sharing About Syncing Syncing copies information from your computer or online account to iPhone, then keeps the information in sync by copying changes made in one location to the other. You use iTunes on your computer to sync contacts, calendars, and other information; iOS apps; photos and videos; and music and other iTunes content. By default, syncing occurs whenever you connect iPhone to your computer. ;QWECPCNUQEQP°IWTGK2JQPGVQCEEGUUCEEQWPVUYKVJQPNKPGUGTXKEGRTQXKFGTUUWEJCU MobileMe, Microsoft Exchange, Google, Yahoo!, and others. Your information on those services is synced over the air. Syncing Accounts MobileMe, Microsoft Exchange, Google, Yahoo!, and other online service providers sync informationâwhich might include contacts, calendars, browser bookmarks, and notes (iPhone 3GS or later)âvia your Internet connection (over the air), so that you donât have to connect iPhone to your computer. The Internet connection can be over your cellular network or your local Wi-Fi network. Some service providersâincluding MobileMe and Microsoft Exchangeâpush information updates. This means that syncing happens whenever any information is changed. The Push setting in Fetch New Data must be turned on (itâs on by default). For iPhone 3G users, iPhone must also be awake or connected to your computer or a power adapter. Other providers sync by periodically âfetchingâ changes that have occurred. Use the Fetch setting to determine how frequently this happens. See âFetch New Dataâ on page 209. For information about setting up accounts on iPhone, see âAdding Mail, Contacts, and Calendar Accountsâ on page 25. Syncing with iTunes You can set iTunes to sync any or all of the following:  Contactsânames, phone numbers, addresses, email addresses, and more 56 APPLE CONFIDENTIAL â First Draft (1.10.11)  Calendarsâappointments and events  Email account settings  Webpage bookmarks  Notes  Ringtones  Music  Photos and videos (in your computerâs photo application or folder)  iTunes U collections  Podcasts  Books and audiobooks  Movies, TV shows, and music videos  Apps downloaded from the App Store You can adjust sync settings whenever iPhone is connected to your computer. Ringtones, music, audiobooks, podcasts, books, iTunes U collections, videos, and apps are synced from your iTunes library. If you donât already have content in iTunes, the iTunes Store (not available in all countries or regions) makes it easy to preview content and download it to iTunes. You can also add music to your iTunes library from your CDs. To learn about iTunes and the iTunes Store, open iTunes and choose Help > iTunes Help. Contacts, calendars, notes, and webpage bookmarks are synced with applications on your computer, as described in the following section. New entries or changes you make on iPhone are synced to your computer, and vice versa. iTunes also lets you sync photos and videos from an application or from a folder. Email account settings are synced only from your computerâs email application to K2JQPG6JKUCNNQYU[QWVQEWUVQOK\G[QWTGOCKNCEEQWPVUQPK2JQPGYKVJQWVCĂGEVKPI email account settings on your computer. Note: You can also set up email accounts directly on iPhone. See âAdding Mail, Contacts, and Calendar Accountsâ on page 25. Purchases you make on iPhone in the iTunes Store or the App Store are synced back to your iTunes library. You can also purchase or download content and apps from the iTunes Store on your computer, and then sync them to iPhone. You can set iPhone to sync with only a portion of whatâs on your computer. For example, you might want to sync only a group of contacts from your address book, or only unwatched video podcasts. Chapter 4 Syncing and File Sharing 57 APPLE CONFIDENTIAL â First Draft (1.10.11) Important: You should be logged in to your own user account on your computer before connecting iPhone. Set up iTunes syncing: 1 Connect iPhone to your computer, and open iTunes. 2 In iTunes, select iPhone in the Devices list. 3 %QP°IWTGVJGU[PEUGVVKPIUKPGCEJQHVJGUGVVKPIURCPGU See the following section for descriptions of the panes. 4 Click Apply in the lower-right corner of the screen. By default, âOpen iTunes when this iPhone is connectedâ is selected. iPhone Settings Panes in iTunes The following sections provide an overview of each of the iPhone settings panes. For more information, open iTunes and choose Help > iTunes Help. Note: Buttons for additional panes may appear in iTunes, depending on the types of content in your iTunes library. Summary Pane Select âOpen iTunes when this iPhone is connectedâ to have iTunes open and sync iPhone automatically whenever you connect it to your computer. Deselect this option if you want to sync only by clicking the Sync button in iTunes. For more information, see âAutomatic iTunes Syncingâ on page 61. Select âSync only checked songs and videosâ if you want iTunes to skip unchecked items in your iTunes library when syncing. 5GNGEVÂĽ2TGHGTUVCPFCTFFG°PKVKQPXKFGQUÂŚKH[QWYCPVK6WPGUVQU[PEUVCPFCTFFG°PKVKQP KPUVGCFQHJKIJFG°PKVKQPXKFGQU K2JQPGQPN[ 58 Chapter 4 Syncing and File Sharing APPLE CONFIDENTIAL â First Draft (1.10.11) Select âConvert higher bit rate songs to 128 kbps AACâ if you want iTunes to convert NCTIGTCWFKQ°NGUVQVJGUVCPFCTFK6WPGUCWFKQHQTOCVFWTKPIU[PEKPI 5GNGEVÂĽ/CPWCNN[OCPCIGOWUKECPFXKFGQUÂŚVQVWTPQĂCWVQOCVKEU[PEKPIKPVJG/WUKE and Video settings panes. See âManually Managing Contentâ on page 61. Select âEncrypt iPhone backupâ if you want to encrypt the information stored on your computer when iTunes makes a backup. Encrypted backups are indicated by a lock icon, and a password is required to restore the information to iPhone. See âBacking Up iPhoneâ on page 254. %NKEM%QP°IWTG7PKXGTUCN#EEGUUVQVWTPQP#EEGUUKDKNKV[HGCVWTGU K2JQPG)5QTNCVGT See Chapter 29, âAccessibility,â on page 235. Info Pane 6JG+PHQRCPGNGVU[QWEQP°IWTGVJGU[PEUGVVKPIUHQT[QWTEQPVCEVUECNGPFCTUGOCKN accounts, and web browser.  Contacts Sync contacts with applications such as Mac OS X Address Book, Yahoo! Address Book, and Google Contacts on a Mac, or with Yahoo! Address Book, Google Contacts, Windows Address Book (Outlook Express), Windows Contacts (Vista and Windows 7), or Microsoft Outlook 2003, 2007, or 2010 on a PC. (On a Mac, you can sync contacts with multiple applications. On a PC, you can sync contacts with one application at a time.) +H[QWU[PEYKVJ;CJQQ#FFTGUU$QQM[QWQPN[PGGFVQENKEM%QP°IWTGVQGPVGT[QWT new login information when you change your Yahoo! ID or password after youâve set up syncing.  Calendars Sync calendars from applications such as iCal on a Mac, or from Microsoft Outlook 2003, 2007, or 2010 on a PC. (On a Mac, you can sync calendars with multiple applications. On a PC, you can sync calendars with only one application at a time.)  Mail Accounts Sync email account settings from Mail on a Mac, and from Microsoft Outlook 2003, 2007, or 2010 or Outlook Express on a PC. Account settings are transferred only from your computer to iPhone. Changes you make to an email account on iPhone donât CĂGEVVJGCEEQWPVQP[QWTEQORWVGT Note: The password for your Yahoo! email account isnât saved on your computer, so it canât be synced and must be entered on iPhone. In Settings, choose âMail, Contacts, Calendars,â tap your Yahoo! account, and enter the password.  Web Browser You can sync bookmarks on iPhone with Safari on a Mac, or with Safari or Microsoft Internet Explorer on a PC. Chapter 4 Syncing and File Sharing 59 APPLE CONFIDENTIAL â First Draft (1.10.11)  Notes Sync notes in the Notes app on iPhone with notes in Mail on a Mac or with Microsoft Outlook 2003, 2007, or 2010 on a PC.  Advanced These options let you replace the information on iPhone with the information on your computer during the next sync. Apps Pane Use the Apps Pane to sync App Store apps, arrange apps on the iPhone Home screen, or copy documents between iPhone and your computer. Select âAutomatically sync new appsâ to sync new apps to iPhone that you downloaded or synced from another device. If you delete an app on iPhone, you can reinstall it from the Apps pane as long as it was previously synced. ;QWECPETGCVGFQEWOGPVUQPK2JQPGYKVJCRRUVJCVUWRRQTV°NGUJCTKPICPFVJGP copy those documents to your computer. You can also copy documents from your EQORWVGTVQK2JQPGCPFWUGVJGOYKVJCRRUVJCVUWRRQTV°NGUJCTKPI5GGÂĽFile Sharingâ on page 62. Ringtones Pane Use the Ringtones pane to select the ringtones you want to sync to iPhone. Music, Movies, TV Shows, Podcasts, iTunes U, and Books Panes Use these panes to specify the media you want to sync. You can sync all music, movies, TV shows, podcasts, iTunes U collections, books and audiobooks, or select the content you want. If you create a playlist folder (collection of playlists) in iTunes, the folder and its playlists will be synced to iPhone. You canât create playlist folders directly on iPhone. If you listen to part of a podcast or audiobook, your place in the story is included if you sync the content with iTunes. If you started listening to the story on iPhone, you can RKEMWRYJGTG[QWNGHVQĂWUKPIK6WPGUQP[QWTEQORWVGT¤QTXKEGXGTUC If you want to watch a rented movie from your computer on iPhone, sync it to iPhone using the Movies pane in iTunes. Only songs and videos encoded in formats that iPhone supports are synced to iPhone. For information about which formats iPhone supports, go to www.apple.com/iphone/ specs.html. Important: If you delete an item from iTunes, it will also be deleted from iPhone the next time you sync. 60 Chapter 4 Syncing and File Sharing APPLE CONFIDENTIAL â First Draft (1.10.11) Photos Pane On a Mac, you can sync photos with Aperture or iPhoto 4.0.3 or later, and videos with iPhoto 6.0.6 or later. On a PC, you can sync photos with Adobe Photoshop Elements 8.0 or later. You can also sync photos and videos from any Mac or PC folder that contains images. Automatic iTunes Syncing By default, iPhone syncs whenever you connect it to iTunes. You can prevent iPhone from syncing when you connect iPhone to a computer other than the one you usually sync with. 6WTPQĂCWVQOCVKEU[PEKPIHQTK2JQPG 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the Devices list, then click Summary at the top of the screen. 3 Deselect âOpen iTunes when this iPhone is connected.â 9JGPCWVQOCVKEU[PEKPIKUVWTPGFQĂ[QWECPUVKNNU[PED[ENKEMKPIVJG5[PEDWVVQP Prevent automatic syncing for all iPods, iPhones, and iPads: 1 In iTunes, choose iTunes > Preferences (on a Mac) or Edit > Preferences (on a PC). 2 Click Devices, then select âPrevent iPods, iPhones, and iPads from syncing automatically.â If this checkbox is selected, iPhone wonât sync, even if âOpen iTunes when this iPhone is connectedâ is selected in the Summary pane. Prevent automatic syncing one time, without changing settings: Open iTunes, connect iPhone to your computer, then press and hold Command-Option (on a Mac) or Shift-Control (on a PC) until you see iPhone appear in the sidebar. Sync manually: In iTunes, select iPhone in the sidebar, then click Sync in the bottomright corner of the window. Or, if youâve changed any sync settings, click Apply. Manually Managing Content The manually managing feature lets you choose just the music, videos, and podcasts you want to have on iPhone. Set up iPhone for manually managing content: 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the sidebar. 3 Click Summary at the top of the screen and select âManually manage music and videos.â 4 Click Apply. Chapter 4 Syncing and File Sharing 61 APPLE CONFIDENTIAL â First Draft (1.10.11) Add items to iPhone: Drag a song, video, podcast, or playlist in your iTunes library to iPhone (in the sidebar). Shift-click or Command-click (Mac) or Control-click (Windows) to select multiple items to add at the same time. iTunes syncs the content immediately. If you deselect âManually manage music and videos,â the content you added manually is removed from iPhone the next time iTunes syncs content. Remove items from iPhone: With iPhone connected to your computer, select iPhone in the iTunes sidebar, and click its disclosure triangle to show contents. Select a content area, such as Music or Movies, then select the items you want to delete and press the Delete key on the keyboard. Removing an item from iPhone doesnât delete it from your iTunes library. Note: Genius does not work if you manually manage content. See âUsing Genius on iPhoneâ on page 102. Transferring Purchased Content to Another Computer You can transfer content on iPhone that was purchased using iTunes on one computer to an iTunes library on another authorized computer. The computer must be authorized to play content purchased using your Apple ID. Authorize a computer: Open iTunes on the computer and choose Store > Authorize Computer. Transfer purchased content: Connect iPhone to the other computer. In iTunes, choose File > Transfer Purchases from iPhone. File Sharing (KNG5JCTKPINGVU[QWVTCPUHGT°NGUDGVYGGPK2JQPGCPF[QWTEQORWVGT;QWECPUJCTG °NGUETGCVGFYKVJCEQORCVKDNGCRRCPFUCXGFKPCUWRRQTVGFHQTOCV #RRUVJCVUWRRQTV°NGUJCTKPICRRGCTKPVJG(KNG5JCTKPI#RRUNKUVKPK6WPGU(QT each app, the Files list shows the documents that are on iPhone. See the appâs FQEWOGPVCVKQPHQTJQYKVUJCTGU°NGUPQVCNNCRRUUWRRQTVVJKUHGCVWTG 6TCPUHGTC°NGHTQOK2JQPGVQ[QWTEQORWVGT 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the Devices list, then click Apps at the top of the screen. 3 In the File Sharing section, select an app from the list on the left. 4 1PVJGTKIJVUGNGEVVJG°NG[QWYCPVVQVTCPUHGTVJGPENKEMÂĽ5CXGVQÂŚCPFEJQQUGC destination on your computer. 62 Chapter 4 Syncing and File Sharing APPLE CONFIDENTIAL â First Draft (1.10.11) 6TCPUHGTC°NGHTQO[QWTEQORWVGTVQK2JQPG 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the Devices list, then click Apps at the top of the screen. 3 In the File Sharing section, click Add. 4 5GNGEVC°NGVJGPENKEM%JQQUG /CE QT1- 2% 6JG°NGKUVTCPUHGTTGFVQ[QWTFGXKEGCPFECPDGQRGPGFWUKPICPCRRVJCVUWRRQTVU VJCV°NGV[RG6QVTCPUHGTOQTGVJCPQPG°NGUGNGEVGCEJCFFKVKQPCN°NG &GNGVGC°NGHTQOK2JQPG5GNGEVVJG°NGKPVJG(KNGUNKUVVJGPVCR&GNGVG Chapter 4 Syncing and File Sharing 63 APPLE CONFIDENTIAL â First Draft (1.10.11) Phone Phone Calls Making a call on iPhone is as simple as tapping a name and number in your contacts, tapping one of your favorites, or tapping a recent call to return it. Making Calls Buttons at the bottom of the Phone screen give you quick access to your favorites, recent calls, your contacts, and a numeric keypad for dialing manually. WARNING: For important information about driving safely, see the Important Product Information Guide at www.apple.com/support/manuals/iphone. 5\TILYVM\UOLHYK ]VPJLTHPSTLZZHNLZ 5\TILYVMTPZZLKJHSSZ 64 Use Contacts to call someone Tap Contacts, choose a contact, then tap a phone number. Call a favorite Tap Favorites, then choose a contact. Return a recent call Tap Recents, then tap a name or number in the list. If the call was a FaceTime video call (indicated by ), tap the item to make a new video call. Dial a number 6CR-G[RCFGPVGTVJGPWODGTVJGPVCR%CNN APPLE CONFIDENTIAL â First Draft (1.10.11) If you copy a phone number to the clipboard, you can paste it to the numeric keypad and dial it. Paste a number to the keypad: Tap the screen above the keyboard, then tap Paste. If the phone number you copied included letters, iPhone converts them to the appropriate digits. Redial the last number you dialed: 6CR-G[RCFVJGPVCR%CNN6CR%CNNCICKPVQFKCN the number. Voice Dialing You can use Voice Control (iPhone 3GS or later) to call someone in your contacts or FKCNCURGEK°EPWODGT Note: Voice Control may not be available in all languages. Use Voice Control to make a phone call: Press and hold the Home button until the Voice Control screen appears and you hear a beep. Then use the commands described below to make a call. You can also press and hold the center button on the iPhone earphones to use Voice Control. Call someone in contacts Say âcallâ or âdialâ then say the name of the person. If the person has more than one number, specify which one you want to call. Examples:  Call John Appleseed  Call John Appleseed at home  Call John Appleseed, mobile Dial a number Say âcallâ or âdial,â then say the number. For best results, speak the full name of the person youâre calling. If you speak only the °TUVPCOGCPF[QWJCXGOQTGVJCPQPGEQPVCEVYKVJVJCVPCOGK2JQPGCUMUYJKEJQH those contacts you want to call. If thereâs more than one number for the person youâre calling, say which number to use. Otherwise, iPhone asks you. When voice dialing a number, speak each digit separatelyâfor example, say âfour one °XG°XG°XG°XGQPGVYQQPGVYQÂŚ Note: For the â800â area code in the U.S., you can say âeight hundred.â Prevent voice dialing when iPhone is locked: In Settings, choose General > Passcode .QEMCPFVWTP8QKEG&KCNQĂ7PNQEMK2JQPGVQWUGXQKEGFKCNKPI Chapter 5 Phone 65 APPLE CONFIDENTIAL â First Draft (1.10.11) Receiving Calls When you receive a call, tap Answer. If iPhone is locked, drag the slider. You can also press the center button on your iPhone earphones to answer a call. *LU[LYI\[[VU Silence a call: 2TGUUVJG1P1Ă5NGGR9CMGDWVVQPQTGKVJGTXQNWOGDWVVQP;QWECP still answer the call after silencing it, until it goes to voicemail. Decline a call: Do one of the following to send a call directly to voicemail.  2TGUUVJG1P1Ă5NGGR9CMGDWVVQPVYKEGSWKEMN[ 6U6MM:SLLW >HRLI\[[VU  Press and hold the center button on the iPhone earphones for about two seconds. 6YQNQYDGGRUEQP°TOVJCVVJGECNNYCUFGENKPGF  Tap Decline (if iPhone is awake when a call comes in). Block calls and maintain Wi-Fi access to the Internet: In Settings, turn on Airplane Mode, then tap Wi-Fi to turn it on. While On a Call When youâre on a call, the screen shows call options. The call options may vary, depending on which iPhone youâre using. 66 Chapter 5 Phone APPLE CONFIDENTIAL â First Draft (1.10.11) Mute your line Tap Mute. You can still hear the caller, but the caller canât hear you. Use the numeric keypad to enter information 6CR-G[RCF Use the speakerphone or a Bluetooth device Tap Speaker. The Button is labeled Audio Source when a Bluetooth device is available, which lets you select the Bluetooth device, iPhone, or Speaker Phone. See contact information Tap Contacts. Put a call on hold iPhone 4: Touch and hold Mute. iPhone 3G or iPhone 3GS: Tap Hold. Neither party can hear the other. When a call is on hold, tap Hold again to return to the call. Make another call Tap Add Call. You can use other apps during a callâto check your schedule in Calendar, for example. Use another app during a call: Press the Home button, then tap an app icon. To return to the call, tap the green bar at the top of the screen. Note: Unless you have a 3G connection on a GSM model, you cannot use the Internet over a cellular data network when youâre on a call. You must have a Wi-Fi connection to use Internet apps while also talking on the phone. End a call: Tap End Call. Or press the center button on your iPhone earphones. Second Calls During a call, you can make or receive another call. If you receive a second call, iPhone beeps and shows the callerâs information and a list of options. Note: Making and receiving a second call may be an optional service in some countries or regions. Contact your carrier for more information. Respond to a second incoming call:  To ignore the call and send it to voicemail, tap Ignore.  6QJQNFVJG°TUVECNNCPFCPUYGTVJGPGYQPGtap Hold Call + Answer.  6QGPFVJG°TUVECNNCPFCPUYGTVJGPGYQPGtap End Call + Answer (GSM models) or tap End Call and drag the slider when the second call rings back (CDMA model). If youâre on a FaceTime video call, you can either end the video call and answer the incoming call, or decline the incoming call. Make a second call: 6CR#FF%CNN6JG°TUVECNNKURWVQPJQNF Switch between calls: Tap Swap. The active call is put on hold. Chapter 5 Phone 67 APPLE CONFIDENTIAL â First Draft (1.10.11) On a CDMA model, you canât switch between calls if the second call was outgoing, but you can merge the calls to create a conference. If you end the second call, or the conference, both calls are terminated. Create a conference call: Tap Merge Calls. See âConference Callsâ on page 68 below. On a CDMA model, you canât merge calls if the second call was incoming. Conference Calls You can talk to more than one person at a time, and merge a second call (on a CDMA OQFGN QTWRVQ°XGECNNU QP)5/OQFGNU FGRGPFKPIQP[QWTECTTKGT Note: Conference calling may be an optional service in some countries or regions. Contact your carrier for information. Create a conference call: 1 Make a call. 2 6CR#FF%CNNCPFOCMGCPQVJGTECNN6JG°TUVECNNKURWVQPJQNF 3 Tap Merge Calls. The calls are merged on one line and everyone can hear each other. 4 4GRGCVUVGRUVYQCPFVJTGGVQCFFWRVQ°XGECNNU )5/OQFGNUQPN[ Drop one call (GSM models only.) Tap Conference and tap next to a call. Then tap End Call. Talk privately with a call (GSM models only.) Tap Conference, then tap Private next to a call. Tap Merge Calls to resume the conference. Add an incoming call (GSM models only.) Tap Hold Call + Answer, then tap Merge Calls. If your service includes conference calling, iPhone always has a second line available in addition to the conference call. Note: You canât make a FaceTime video call when youâre on a conference call. FaceTime FaceTime video calls let you see as well as hear the person youâre talking to. Both the caller and recipient must have an iPhone 4 or an iPod touch (4th generation), and a Wi-Fi connection. No setup is needed for FaceTime on iPhone 4. By default, FaceTime uses the front camera so the person youâre calling can see your face. Switch to the main camera to share what you see around you. Note: FaceTime may not be available in all countries or regions. How you make a FaceTime video call depends on whether youâre calling another iPhone 4 or an iPod touch (4th generation). Make a FaceTime call: 68 Chapter 5 Phone APPLE CONFIDENTIAL â First Draft (1.10.11) To an iPhone 4: Call the personâs phone number, then tap FaceTime. Or, in Contacts, tap FaceTime. To an iPod touch (4th generation): In Contacts, tap FaceTime. The contact information must include the email address that the person youâre calling uses to sign in to FaceTime. appears on the FaceTime button in Contacts if youâve previously had a FaceTime call with that person. 4HRLH -HJL;PTL ]PKLVJHSS The person youâre calling must accept the video call by tapping Accept. Make a FaceTime call using Voice Control: Press and hold the Home button until the Voice Control screen appears and you hear a beep. Then say âFaceTime,â followed by the name of the person to call. If you had a previous FaceTime video call with someone, you can make another video call to that person by tapping the entry for that call in Recents. Previous FaceTime video calls are indicated by Chapter 5 Phone 69 APPLE CONFIDENTIAL â First Draft (1.10.11) When the voice call is established, you see the image from the other personâs iPhone. A picture-in-picture window shows the image from your iPhone that the other person sees. You can drag the window to any corner. You can use FaceTime in portrait or landscape orientation. Video calls use the top microphone on iPhone. If you move away from your Wi-Fi network, or it otherwise becomes unavailable, youâll get an option to redial the number for a voice call. Note: When you make a FaceTime video call, your phone number is displayed even if [QWTECNNGT+&KUDNQEMGFQTVWTPGFQĂ Mute a FaceTime video call Tap at the bottom of the screen. You can still hear and see the caller. The caller can see, but not hear you. Switch between the front and main cameras Tap Use another app during a FaceTime video call Press the Home button, then tap an app icon. You can still talk, but wonât see each other. To return to the video call, tap the green bar at the top of the screen. End a FaceTime video call Tap at the bottom of the screen. at the bottom of the screen. 6QDNQEM(CEG6KOGXKFGQECNNU[QWECPVWTPQĂ(CEG6KOGKP5GVVKPIU 6WTP(CEG6KOGQPQTQĂIn Settings, choose Phone and tap the FaceTime switch. FaceTime is on by default. You can also disable FaceTime in Restrictions. See âRestrictionsâ on page 202. 70 Chapter 5 Phone APPLE CONFIDENTIAL â First Draft (1.10.11) Using a Bluetooth Device for Calls You can make and receive calls using a Bluetooth device paired with iPhone. See âPairing a Bluetooth Device with iPhoneâ on page 51. For information about using a Bluetooth device to make and receive calls, see the documentation that came with the device. Listen to calls through iPhone when a Bluetooth device is connected: Do one of the following:  Answer a call by tapping the iPhone screen.  During a call, tap Audio on iPhone. Choose iPhone to hear calls through iPhone or Speaker Phone to use the speakerphone.  6WTPQĂ$NWGVQQVJ+P5GVVKPIUEJQQUG)GPGTCN $NWGVQQVJCPFFTCIVJGUYKVEJVQ 1Ă Â 6WTPQĂVJG$NWGVQQVJFGXKEGQTOQXGQWVQHTCPIG;QWOWUVDGYKVJKPCDQWV feet of a Bluetooth device for it to be connected to iPhone. Emergency Calls If iPhone is locked with a passcode, you may still be able to make an emergency call. Make an emergency call when iPhone is locked: On the Enter Passcode screen, tap Emergency Call, then dial the number using the numeric keypad. In the U.S., location information (if available) is provided to emergency service providers when you dial 911. On a CDMA model, when an emergency call ends, iPhone enters âEmergency call mode,â to allow a call back from emergency services. While in this mode, data transmission and text messages are blocked. To exit emergency call mode, tap the DCEMDWVVQPRTGUUVJG1P1Ă5NGGR9CMGDWVVQPQTVJG*QOG button, or use the keypad to dial a non-emergency call. Emergency call mode also ends automatically after a few minutes, as determined by your carrier. Important: You should not rely on wireless devices for essential communications, such as medical emergencies. Use of any cellular phone to call emergency services may not work in all locations. Emergency numbers and services vary by country or region. Only emergency numbers valid in the country or region where youâre making the call will work, and sometimes an emergency call cannot be placed due to network unavailability or environmental interference. Some cellular networks may not accept an emergency call from iPhone if it doesnât have a SIM card or if the SIM card is locked (GSM models), or if you havenât activated your iPhone. If youâre on a FaceTime video call, you must end that call before you can call an emergency number. Chapter 5 Phone 71 APPLE CONFIDENTIAL â First Draft (1.10.11) Visual Voicemail On iPhone, visual voicemail lets you see a list of your messages and choose which ones to listen to or delete, without having to listen to instructions or prior messages. Note: Visual voicemail may not be available in all countries or regions, or may be an optional service. Contact your carrier for more information. If visual voicemail isnât available, tap Voicemail and follow the voice prompts to retrieve your messages. 5\TILYVMTPZZLKJHSSZHUK\UOLHYK ]VPJLTHPSTLZZHNLZHWWLHYZVU[OL /VTLZJYLLU7OVULPJVU Setting Up Voicemail 6JG°TUVVKOG[QWVCR8QKEGOCKNK2JQPGRTQORVU[QWVQETGCVGCXQKEGOCKNRCUUYQTF and record your voicemail greeting. Change your greeting: 1 Tap Voicemail, tap Greeting, then tap Custom. 2 Tap Record when youâre ready to start. 3 9JGP[QW°PKUJVCR5VQR6QTGXKGYVCR2NC[ To rerecord, repeat steps 2 and 3. 4 Tap Save. Use your carrierâs default greeting Tap Voicemail, tap Greeting, then tap Default. Set an alert sound for new voicemail In Settings, choose Sounds and turn New Voicemail on. The alert sounds once for each new XQKEGOCKN+HVJG4KPI5KNGPVUYKVEJKUQĂK2JQPG wonât sound alerts. Change the voicemail password In Settings, choose Phone > Change Voicemail Password. Checking Voicemail When you tap Phone, iPhone shows the number of missed calls and unheard voicemail messages. 5\TILYVM\UOLHYK ]VPJLTHPSTLZZHNLZ 5\TILYVMTPZZLKJHSSZ 72 Chapter 5 Phone APPLE CONFIDENTIAL â First Draft (1.10.11) Tap Voicemail to see a list of your messages. Call Forwarding, then turn on Call Forwarding. 74 Chapter 5 Phone APPLE CONFIDENTIAL â First Draft (1.10.11) 2 On the âForward toâ screen, enter the phone number you want calls forwarded to. When Call Forwarding is on, the call forwarding ( ) icon appears in the status bar at the top of the screen (GSM models only). You must be in range of the cellular network when you set iPhone to forward calls, or calls wonât be forwarded. 1PC%&/#OQFGN[QWVWTPECNNHQTYCTFKPIQPQTQĂD[FKCNKPIURGEKCNEQFGU Turn on call forwarding (CDMA model): On the Phone keypad, enter *72, then tap Call. 6WTPQĂECNNHQTYCTFKPI %&/#OQFGN On the Phone keypad, enter *73, then tap Call. Call Waiting Call waiting lets you know that youâre receiving another call when youâre already on the phone. You can choose to ignore the incoming call, put the current call on hold and answer the incoming call, or end the current call and answer the incoming call. 9JGPECNNYCKVKPIKUQĂKPEQOKPIECNNUIQFKTGEVN[VQXQKEGOCKNKH[QW¨TGQPVJGRJQPG 1P)5/OQFGNUWUGVJG%CNN9CKVKPIUGVVKPIVQVWTPECNNYCKVKPIQPQTQĂ 6WTPECNNYCKVKPIQPQTQĂ )5/OQFGNU In Settings, choose Phone > Call Waiting, VJGPVWTP%CNN9CKVKPIQPQTQĂ On a CDMA model, call waiting is on by default. You can disable call waiting for a call youâre making by appending a special code to the number with you dial it. Disable call waiting for a call (CDMA model): Enter *70 at the end of the number youâre dialing. To disable call waiting for another call, you must again append *70 to the number when you dial it. Caller ID Caller ID displays your name or phone number to the person you call, if the recepientâs equipment has that capability and you havenât blocked caller ID on your phone service. Note: When you make a FaceTime call, your phone number is displayed even if your ECNNGT+&KUVWTPGFQĂQTDNQEMGF 1P)5/OQFGWUGVJG5JQY/[%CNNGT+&VQVWTPECNNGT+&QPQTQĂ 6WTPECNN+&QPQTQĂ )5/OQFGNU In Settings, choose Phone > Show My Caller ID, VJGPVWTP5JQY/[%CNNGT+&QPQTQĂ On a CDMA model, caller ID is on by default. You can block your ID for a call youâre making by appending a special code to the number when you dial it. Chapter 5 Phone 75 APPLE CONFIDENTIAL â First Draft (1.10.11) Disable caller ID for a call (CDMA model): Enter *67 at the end of the number youâre dialing. Ringtones and the Ring/Silent Switch iPhone comes with ringtones you can use for incoming calls, Clock alarms, and the Clock timer. You can also purchase ringtones from songs in iTunes. Ring/Silent Switch and Vibrate Modes #UYKVEJQPVJGUKFGQHK2JQPGOCMGUKVGCU[VQVWTPVJGTKPIGTQPQTQĂ 6WTPVJGTKPIGTQPQTQĂFlip the switch on the side of iPhone. 9PUN :PSLU[ Important: Clock alarms still sound even if you set the Ring/Silent switch to silent. Set iPhone to vibrate: In Settings, choose Sounds. Separate controls let you set vibrate for both ring mode and silent mode. For more information, see âSounds and the Ring/Silent Switchâ on page 196. Setting Ringtones You can set the default ringtone for calls, and for Clock alarms and timers. You can also assign individual ringtones to contacts so you know whoâs calling. Set the default ringtone: In Settings, choose Sounds > Ringtone, then choose a ringtone. Assign a ringtone to a contact: From Phone, tap Contacts and choose a contact. Tap Edit, then tap Ringtone and choose a ringtone. Purchasing Ringtones You can purchase ringtones from the iTunes Store on iPhone. See âPurchasing Ringtonesâ on page 172. 76 Chapter 5 Phone APPLE CONFIDENTIAL â First Draft (1.10.11) International Calls Making International Calls from Your Home Area For information about making international calls from your home area, including rates and other charges that may apply, contact your carrier or go to your carrierâs website. Using iPhone Abroad (GSM models only.) You can use iPhone to make calls in many countries around the world. iPhone 3GS and iPhone 4 are multi-band phones, ensuring broad international coverage. Enable international roaming: Contact your carrier for information about availability and fees. 5GVK2JQPGVQCFFVJGEQTTGEVRTG°ZYJGPFKCNKPIHTQOCPQVJGTEQWPVT[In Settings, tap Phone, then turn International Assist on. This lets you make calls to your home country using the numbers in your contacts and favorites, without having to add a RTG°ZQT[QWTEQWPVT[EQFG+PVGTPCVKQPCN#UUKUVYQTMUHQT75VGNGRJQPGPWODGTUQPN[ When you make a call using International Assist, âInternational Assistâ appears on the iPhone screen, alternating with the âcalling âŚâ message, until your call is connected. Note: International Assist may not be available in all areas. Set the carrier to use: In Settings, tap Carrier, then select the carrier you prefer. This option is available only when youâre traveling outside your carrierâs network. You can make calls only on carriers that have roaming agreements with your iPhone service provider. For more information, see âCarrierâ on page 196. Important: Voice and data roaming charges may apply. To avoid data roaming charges, VWTP&CVC4QCOKPIQĂ 6WTP&CVC4QCOKPIQPQTQĂIn Settings, choose General > Network, then tap to turn &CVC4QCOKPIQPQTQĂ&CVC4QCOKPIKUVWTPGFQĂD[FGHCWNV 6WTPKPI&CVC4QCOKPIQĂJGNRUVQCXQKFFCVCTQCOKPIEJCTIGUYJGPVTCXGNKPIQWVUKFG your carrierâs network by disabling data transmission over the cellular network. You can still access the Internet if you have a Wi-Fi connection. If Wi-Fi network access isnât available, however, you cannot:  Make or receive FaceTime video calls  Send or receive email  Browse the Internet  Sync your contacts, calendars, or bookmarks with MobileMe or Exchange  Stream YouTube videos  Get stock quotes  Get map locations Chapter 5 Phone 77 APPLE CONFIDENTIAL â First Draft (1.10.11)  Get weather reports  Purchase music or apps Other third-party apps that use data roaming may also be disabled. +H&CVC4QCOKPIKUVWTPGFQĂ[QWECPUVKNNOCMGCPFTGEGKXGRJQPGECNNUCPFUGPFCPF receive text messages. Voice roaming charges may apply. Visual voicemail is delivered if thereâs no charge; if your carrier charges for delivery of visual voicemail when TQCOKPIVWTPKPI&CVC4QCOKPIQĂRTGXGPVUVJGFGNKXGT[QHXKUWCNXQKEGOCKN To enable email, web browsing, and other data services, turn Data Roaming on. Important: If Data Roaming is turned on, you may incur charges when roaming outside your carrierâs network for the use of any of the features listed above, as well as for delivery of visual voicemail. Check with your carrier for information about roaming charges. ;QWECPCNUQVWTPQĂEGNNWNCTFCVCVQRTGXGPVCP[EGNNWNCTFCVCWUCIG 6WTPQĂ%GNNWNCT&CVCIn Settings, choose General > Network, then tap the Cellular &CVCUYKVEJVQVWTPKVQĂ Get voicemail when visual voicemail isnât available: Dial your own number, or touch and hold â1â on the numeric keypad. ;QWECPWUG#KTRNCPG/QFGVQVWTPQĂEGNNWNCTUGTXKEGUCPFVJGPVWTP9K(KQPVQIGV access to the Internet, while preventing voice roaming charges. 7UGCKTRNCPGOQFGVQVWTPQĂEGNNWNCTUGTXKEGUIn Settings, tap Airplane Mode to turn it on, then tap Wi-Fi and turn Wi-Fi on. See âAirplane Modeâ on page 193. Incoming phone calls are sent to voicemail. To make and receive calls again and get [QWTXQKEGOCKNOGUUCIGUVWTPCKTRNCPGOQFGQĂ 78 Chapter 5 Phone APPLE CONFIDENTIAL â First Draft (1.10.11) Mail Mail works with MobileMe, Microsoft Exchange, and many of the most popular email systemsâincluding Yahoo!, Google, and AOLâas well as other industry-standard POP3 and IMAP email systems. You can send and receive photos, videos, and graphics, and view PDFs and other attachments. You can also print messages, and attachments that open in Quick Look. Setting Up Email Accounts You can set up email accounts on iPhone in either of the following ways:  Set up an account directly on iPhone. See âAdding Mail, Contacts, and Calendar Accountsâ on page 25.  In iTunes, use the iPhone settings panes to sync email accounts settings from your computer. See âiPhone Settings Panes in iTunesâ on page 58. Checking and Reading Email The Mail icon on the Home screen shows the number of unread messages in your inboxes. You may have other unread messages in other mailboxes. 5\TILYVM\UYLHK LTHPSZPU`V\YPUIV_LZ 79 APPLE CONFIDENTIAL â First Draft (1.10.11) In Mail, the Mailboxes screen gives you quick access to all your inboxes and other mailboxes. Tap an inbox for an account to see its messages. To see incoming messages for all your accounts, tap All Inboxes. If you have only one mail account set up and turned on, then youâll see only one inbox on the Mailboxes screen. 0UJVTPUN TLZZHNLZMVYHSS HJJV\U[Z 5\TILYVM\UYLHK TLZZHNLZ When you open a mailbox, Mail retrieves and displays the most recent messages, and shows the number of unread messages at the top of the screen. Unread messages have a blue dot next to them. The number of messages retrieved is determined by your Mail settings. See âMailâ on page 210. If you organize messages by thread, related messages appear as a single entry in the mailbox. Message threads have a number next to the right arrow, showing the number of messages in the thread. A blue dot indicates that one or more messages in the thread are unread. The message displayed is the oldest unread message, or the most recent message if all the messages are read. 5\TILYVM TLZZHNLZPU [OYLHK Fetch New Data, VJGPVWTP2WUJQPQTQĂ5GGÂĽFetch New Dataâ on page 209. Using Links and Detected Data iPhone detects web links, phone numbers, email addresses, and other types of information that you can use to open a webpage, make a phone call, create a preaddressed email message, create or add information to a contact, or perform some other useful action. Detected data appears as blue underlined text. Tap the data to use its default action, or touch and hold it to see other actions. 82 Link or image Tap to open the webpage in Safari. Touch and hold to:  Open the webpage in Safari  Copy the link Phone number Tap the number, then tap Call to dial the number. Touch and hold to:  Dial the number  Send a text message  Create a new contact with the number  Add the number to an existing contact Address Tap to display the location in Maps. Touch and hold to:  Display the location in Maps  Create a new contact with the address  Add the address to an existing contact  Copy the address Email address Tap to create a new preaddressed email message. Touch and hold to:  Create a new email message  Create a new contact with the address  Add the address to an existing contact  Copy the address Day, date, or time Tap the item, then tap Create Event to create an event in Calendar. Tracking number (may not be available in all countries or regions) Tap to open the shipperâs webpage for the status of a package. Chapter 6 Mail APPLE CONFIDENTIAL â First Draft (1.10.11) Viewing Attachments iPhone displays image attachments in many commonly used formats (JPEG, GIF, and TIFF) inline with the text in email messages. iPhone can play many types of audio CVVCEJOGPVUUWEJCU/2##%9#8CPF#+((;QWECPFQYPNQCFCPFXKGY°NGU UWEJCU2&(YGDRCIGVGZV2CIGU-G[PQVG0WODGTUCPF/KETQUQHV9QTF'ZEGNCPF PowerPoint documents) that are attached to messages you receive. 8KGYCPCVVCEJGF°NGTap the attachment to open it in Quick Look. ;QWOC[PGGFVQFQYPNQCFVJGCVVCEJOGPV°TUVD[VCRRKPI (if it appears at the end of the message in a dotted box with the document name). ;HWH[[HJOTLU[ [VKV^USVHK You can view attachments in portrait or landscape orientation. +HVJGHQTOCVQHCPCVVCEJGF°NGKUP¨VUWRRQTVGFD[K2JQPG[QWECPUGGVJGPCOGQHVJG °NGDWV[QWECP¨VQRGPKVK2JQPGUWRRQTVUVJGHQNNQYKPIFQEWOGPVV[RGU .doc Microsoft Word .docx Microsoft Word (XML) .htm webpage .html webpage .key -G[PQVG .numbers Numbers .pages Pages .pdf Preview, Adobe Acrobat .ppt Microsoft PowerPoint .pptx Microsoft PowerPoint (XML) .rtf Rich Text Format Chapter 6 Mail 83 APPLE CONFIDENTIAL â First Draft (1.10.11) .txt text .vcf contact information .xls Microsoft Excel .xlsx Microsoft Excel (XML) 1RGPCPCVVCEJGF°NGYKVJCPQVJGTCRRTouch and hold the attachment, then choose an app. If no apps are available, you can choose to open the attachment in Quick Look. Save an attached photo to your Camera Roll album: Tap the photo, then tap Save +OCIG+HVJGRJQVQJCUP¨VDGGPFQYPNQCFGF[GVVCRVJGFQYPNQCFPQVKEG°TUV Save an attached video to your Camera Roll album: Touch and hold the attachment, then tap Save Video. If the video hasnât been downloaded yet, tap the download PQVKEG°TUV Printing Messages and Attachments You can print email messages, and attachments that can be viewed in Quick Look. Print an email message: Tap , then tap Print. Tap Select Printer to select a printer, then set printer options such as number of copies and double-sided output (if the printer supports it). Then tap Print. To print an inline image without the rest of the email message, save the image (tap the image and tap Save Image), then open Photos or Camera and print the image from your Camera Roll album. Print an attachment: Tap the attachment to view it in Quick Look, then tap and tap Print. Tap Select Printer to select a printer, then set printer options such as the range of pages, number of copies, and double-sided output (if the printer supports it). Then tap Print. For more information, see âPrintingâ on page 45. Sending Email You can send an email message to anyone who has an email address. Compose and send a message: 1 Tap . 2 6[RGCPCOGQTGOCKNCFFTGUUKPVJG6Q°GNFQTVCR contacts. to add a name from your As you type an email address, matching email addresses from your contacts list appear below. Tap an address to add it. To add more names, tap Return or . 84 Chapter 6 Mail APPLE CONFIDENTIAL â First Draft (1.10.11) Note: If youâre composing a message from your Microsoft Exchange account and have access to your enterprise Global Address List (GAL), matching addresses from the EQPVCEVUQPK2JQPGCRRGCT°TUVHQNNQYGFD[OCVEJKPI)#.CFFTGUUGU 3 Tap Cc/Bcc/From if you want to copy or blind copy the message to others, or change the account you send the message from. If you have more than one email account, QTKH[QWJCXGGOCKNCNKCUGUHQT[QWT/QDKNG/GCEEQWPV[QWECPVCRVJG(TQO°GNFVQ change the account or alias youâre sending from. 4 Enter a subject, then your message. ;QWECPVCR4GVWTPVQOQXGHTQOQPG°GNFVQCPQVJGT 5 Tap Send. Send a photo or video (iPhone 3GS or later) in an email message In Photos, choose a photo or video, tap , then tap Email Photo or Email Video. You can also copy and paste photos and videos. To send multiple photos or videos at the same time, tap when viewing thumbnails in an album, then tap to select the photos and videos, tap Share, and tap Email. Paste and send a photo or video in an email message In Photos, touch and hold a photo or video until the Copy command appears. Tap Copy. Go to Mail and create a new message. Tap to place the insertion point where you want the video, then tap the insertion point to display the edit commands and tap Paste. To copy multiple videos, in Photos, open an album, tap , tap to select photos and videos, then tap Copy. Save a draft of a message to complete later Tap Cancel, then tap Save. The message is saved in the Drafts mailbox. Open the most recently saved draft to open the most recently Touch and hold saved draft from the last account you were working in. Chapter 6 Mail 85 APPLE CONFIDENTIAL â First Draft (1.10.11) Reply to a message Tap . Tap Reply to reply only to the sender or tap Reply All to reply to the sender and all recipients. Type your return message, then tap Send. Files or images attached to the initial message arenât sent back. Forward a message Open a message and tap , then tap Forward. Add one or more email addresses, type your message, then tap Send. When you forward a message, you can include VJG°NGUQTKOCIGUCVVCEJGFVQVJGQTKIKPCN message. Share contact information In Contacts, choose a contact, tap Share Contact at the bottom of the Info screen, then tap Email. Organizing Email You can organize messages in any mailbox, folder, or search results window. You can delete messages one at a time, or select a group to delete all at once. You can also move messages from one mailbox or folder to another in the same account or DGVYGGPFKĂGTGPVCEEQWPVU Delete a message: Open the message and tap . You can also delete a message directly from the mailbox message list by swiping left or right over the message title, then tapping Delete. ;VZOV^[OL +LSL[LI\[[VU Z^PWLSLM[VY YPNO[V]LY [OLTLZZHNL Note: For Google accounts, tap Archive. Messages arenât deleted, but are moved to your account archive. 86 Chapter 6 Mail APPLE CONFIDENTIAL â First Draft (1.10.11) Delete multiple messages: When viewing a list of messages, tap Edit, select the messages you want to delete, then tap Delete. Move a message to another mailbox or folder: When viewing a message, tap choose a mailbox or folder. , then Tap Accounts to choose a mailbox or folder for another account. Move multiple messages: When viewing a list of messages, tap Edit, select the messages you want to move, then tap Move and choose a mailbox or folder. Searching Email ;QWECPUGCTEJVJG6Q(TQOCPF5WDLGEV°GNFUQHGOCKNOGUUCIGU/CKNUGCTEJGUVJG downloaded messages in the currently open mailbox. For MobileMe, Exchange, and some IMAP mail accounts, you can also search messages on the server. Search email messages: Open a mailbox, scroll to the top, and enter text in the Search °GNF6CR(TQO6Q5WDLGEVQT#NNVQEJQQUGYJKEJ°GNFU[QWYCPVVQUGCTEJ6QUETQNN SWKEMN[VQVJGUGCTEJ°GNFCVVJGVQRQHVJGNKUVVCRVJGUVCVWUDCT Search results for the messages already downloaded to iPhone appear automatically as you type. Tap Search to dismiss the keyboard and see more of the results. Search messages on the server: Tap âContinue Search on Serverâ at the end of the search results. Note: Search results of messages on servers may vary depending on the type of account. Some servers may search only whole words. Chapter 6 Mail 87 APPLE CONFIDENTIAL â First Draft (1.10.11) Mail messages are included in searches from the Home screen. See âSearchingâ on page 47. 88 Chapter 6 Mail APPLE CONFIDENTIAL â First Draft (1.10.11) Safari Safari lets you surf the web and view webpages on iPhone as if you were on your computer. Create bookmarks on iPhone and sync them with your computer. Add web clips to quickly access your favorite sites directly from the Home screen. Print webpages, PDFs, and other documents that open in Quick Look. Viewing Webpages You can view webpages in either portrait or landscape orientation. Rotate iPhone and VJGYGDRCIGTQVCVGUVQQCWVQOCVKECNN[CFLWUVKPIVQ°VVJGRCIG Opening Webpages Open a webpage: 6CRVJGCFFTGUU°GNF QPVJGNGHVUKFGQHVJGVKVNGDCT VJGPV[RGVJG YGDCFFTGUUCPFVCR)Q+HVJGCFFTGUU°GNFKUP¨VXKUKDNGVCRVJGUVCVWUDCTCVVJGVQRQH VJGUETGGPVQSWKEMN[UETQNNVQVJGCFFTGUU°GNFCVVJGVQRQHVJGYGDRCIG As you type, web addresses that start with those letters appear. These are bookmarked RCIGUQTTGEGPVRCIGU[QW¨XGQRGPGF6CRCPCFFTGUUVQIQVQVJCVRCIG-GGRV[RKPI if you want to enter a web address thatâs not in the list. 'TCUGVJGVGZVKPVJGCFFTGUU°GNF6CRVJGCFFTGUU°GNFVJGPVCR . 89 APPLE CONFIDENTIAL â First Draft (1.10.11) Zooming and Scrolling Zoom in or out: Double-tap a column on a webpage to expand the column. Doubletap again to zoom out. You can also pinch to zoom in or out manually. Scroll around a webpage Drag up, down, or sideways. When scrolling, you can touch and drag anywhere on the page without activating any links. Scroll within a frame on a webpage 7UGVYQ°PIGTUVQUETQNNYKVJKPCHTCOGQPC YGDRCIG7UGQPG°PIGTVQUETQNNVJGGPVKTG webpage. Scroll quickly to the top of a webpage Tap the status bar at the top of the iPhone screen. Navigating Webpages Links on webpages typically take you to another place on the web. Follow a link on a webpage: Tap the link. You can also use web links to make a phone call, display a location in Maps, play streaming audio, or create a preaddressed Mail message. To return to Safari after a link opens another app, press the Home button and tap Safari. 90 See a linkâs destination address Touch and hold the link. The address pops up PGZVVQ[QWT°PIGT;QWECPVQWEJCPFJQNFCP image to see if it has a link. Stop a webpage from loading Tap Reload a webpage Tap Return to the previous or next page Tap or Chapter 7 Safari at the bottom of the screen. APPLE CONFIDENTIAL â First Draft (1.10.11) Return to a recently viewed page Tap and tap History. To clear the history list, tap Clear. Create a preaddressed Mail message Touch and hold an email web link, then tap New Message. Create a new or add to an existing contact Touch and hold a web link containing contact information, then tap Create New Contact or Add to Existing Contact. Send a webpage URL via email Tap Save an image or photo to your Camera Roll album Touch and hold the image, then tap Save Image. and tap âMail Link to this Page.â Opening Multiple Pages You can have up to eight pages open at a time. Some links automatically open a new page instead of replacing the current one. The number inside the at the bottom of the screen shows how many pages are open. If thereâs no number inside, just one page is open. For example: = one page is open = three pages are open Open a new page: Tap Go to another page: Tap Close a page: Tap and tap New Page. CPFÂąKEMNGHVQTTKIJV6CRVJGRCIG[QWYCPVVQXKGY and tap Entering Text and Filling Out Forms 5QOGYGDRCIGUJCXGVGZV°GNFUCPFHQTOUVQ°NNQWV;QWECPUGV5CHCTKVQTGOGODGT PCOGUCPFRCUUYQTFUQHYGDUKVGU[QWXKUKVCPF°NNQWVVGZV°GNFUCWVQOCVKECNN[YKVJ information from Contacts. See âSafariâ on page 214. Chapter 7 Safari 91 APPLE CONFIDENTIAL â First Draft (1.10.11) Bring up the keyboard 6CRKPUKFGCVGZV°GNF /QXGVQCPQVJGTVGZV°GNF 6CRCPQVJGTVGZV°GNFQTVCRVJG0GZVQT2TGXKQWU button. Submit a form 1PEG[QW°PKUJ°NNKPIQWVCHQTOVCR)QQT Search. Most pages also have a link you can tap to submit the form. Close the keyboard without submitting the form Tap Done. 'PCDNG#WVQ(KNNVQJGNR[QW°NNQWVYGDHQTOUIn Settings, choose Safari > AutoFill, then do one of the following:  To use information from contacts, turn Use Contact Info on, then choose My Info and select the contact you want to use. 5CHCTKWUGUKPHQTOCVKQPHTQO%QPVCEVUVQ°NNKPEQPVCEV°GNFUQPYGDHQTOU  To use information from names and passwords, turn Names & Passwords on. When this feature is on, Safari remembers names and passwords of websites you XKUKVCPFCWVQOCVKECNN[°NNUKPVJGKPHQTOCVKQPYJGP[QWTGXKUKVVJGYGDUKVG  To remove all AutoFill information, tap Clear All. Searching 7UGVJGUGCTEJ°GNFVQGPVGTYQTFUCPFRJTCUGUHQTUGCTEJKPIDQVJVJGYGDCPFVJG current webpage. As you type, suggested and recent searches appear. Search the web: 1 6CRVJGUGCTEJ°GNF QPVJGTKIJVUKFGQHVJGVKVNGDCT 2 Type a word or phrase that describes what youâre looking for, then tap a suggestion from the list or tap Search. 3 Tap a link in the list of search results to open a webpage. Find the search word or phrase on the current webpage: Scroll to the bottom of the TGUWNVUNKUVVJGPVCRVJGGPVT[DGNQY1P6JKU2CIGVQ°PFVJG°TUVQEEWTTGPEGQHVJG UGCTEJYQTFQTRJTCUG6Q°PFUWDUGSWGPVQEEWTTGPEGUVCR0GZV By default, Safari searches using Google. You can use other search engines. 5GV5CHCTKVQUGCTEJWUKPICFKĂGTGPVUGCTEJGPIKPGIn Settings, choose Safari > 5GCTEJ'PIKPGVJGPEJQQUGCFKĂGTGPVUGCTEJGPIKPG Printing Webpages, PDFs, and Other Documents You can print webpages, PDFs, and other documents that open in Quick Look from Safari. 92 Chapter 7 Safari APPLE CONFIDENTIAL â First Draft (1.10.11) Print a webpage, PDF, or Quick Look document: Tap , then tap Print. Tap Select Printer to select a printer, then set printer options such as number of copies and double-sided output (if the printer supports it). If youâre printing a PDF or other Quick Look document, you may be able to set the range of pages you want to print. Then tap Print. For more information, see âPrintingâ on page 45. Bookmarks You can bookmark webpages you want to return to later. Bookmark a webpage: Open the page and tap . Then tap Add Bookmark. When you save a bookmark you can edit its title. By default, bookmarks are saved at the top level of Bookmarks. Tap Bookmarks to choose another folder. If you use Safari on a Mac, or Safari or Microsoft Internet Explorer on a PC, you can sync bookmarks with the web browser on your computer. Sync bookmarks with your computer: 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the Devices list. 3 Click Info at the top of the screen, select âSync ⌠bookmarksâ under Other, then click Apply. See âiPhone Settings Panes in iTunesâ on page 58. Sync bookmarks with MobileMe: In Settings on iPhone, select Bookmarks in your MobileMe account. See âSetting Up MobileMe Accountsâ on page 25. Open a bookmarked webpage: Tap see the bookmarks inside. , then choose a bookmark or tap a folder to Edit a bookmark or bookmark folder: Tap , choose the folder that has the bookmark or folder you want to edit, then tap Edit. Then do one of the following:  To make a new folder, tap New Folder.  To delete a bookmark or folder, tap , then tap Delete.  To reposition a bookmark or folder, drag  6QGFKVVJGPCOGQTCFFTGUUQTVQRWVKVKPCFKĂGTGPVHQNFGTtap the bookmark or folder. 9JGP[QW°PKUJVCR&QPG Chapter 7 Safari 93 APPLE CONFIDENTIAL â First Draft (1.10.11) Web Clips Add web clips to the Home screen for fast access to your favorite webpages. Web clips appear as icons on the Home screen, and you can arrange your web clips along with the other icons. See âCustomizing the Home Screenâ on page 33. Add a web clip: Open the webpage and tap . Then tap âAdd to Home Screen.â When you open a web clip, Safari automatically zooms and scrolls to the area of the webpage that was displayed when you saved the web clip. The displayed area is also used to create the icon for the web clip on your Home screen, unless the webpage comes with its own custom icon. When you add a web clip, you can edit its name. If the name is too long (more than about 10 characters), it may appear abbreviated on the Home screen. Web clips arenât bookmarks, and arenât synced by MobileMe or iTunes. Delete a web clip: 1 Touch and hold any icon on the Home screen until the icons start to jiggle. 2 Tap in the corner of the web clip you want to delete. 3 Tap Delete, then press the Home 94 Chapter 7 Safari button to save your arrangement. APPLE CONFIDENTIAL â First Draft (1.10.11) iPod Use the iPod app to enjoy your favorite music, widescreen videos, and more. Browse your content on iPhone by playlists, artists, songs, videos, or other categories, or browse your album artwork using Cover Flow. Play your music on AirPlay speakers or sound systems, or watch your videos on a TV using AirPlay and Apple TV. Getting Music, Videos, and More There are two ways to get music, videos, and other content onto iPhone:  Transfer music, videos, and more onto iPhone by syncing content from iTunes on [QWTEQORWVGT;QWECPU[PECNNQH[QWTOGFKCQT[QWECPUGNGEVURGEK°EUQPIU videos, podcasts, and iTunes U collections. See âSyncing with iTunesâ on page 56.  Use the iTunes Store on iPhone to purchase and download songs, albums, TV shows, movies, music videos, ringtones, and audiobooks directly to iPhone. You can also stream and download audio and video podcasts, as well as iTunes U content. After listening to a podcast or watching a TV show, you can tap a built-in link to get more episodes from the iTunes Store. See Chapter 22, âiTunes Store,â on page 169. Music and Other Audio The high-resolution Multi-Touch display makes listening to songs on iPhone as much a visual experience as a musical one. You can scroll through your playlists, or use Cover Flow to browse your album artwork. WARNING: For important information about avoiding hearing loss, see the Important Product Information Guide at www.apple.com/support/manuals/iphone. 95 APPLE CONFIDENTIAL â First Draft (1.10.11) Playing Songs and Other Audio You can browse content on iPhone by playlists, artists, songs, videos, and other categories, or browse your album artwork using Cover Flow. Playlist folders, which you can sync from iTunes, let you organize playlists into groups. Browse your collection: Tap Playlists, Artists, or Songs. Tap More to browse Albums, Audiobooks, Compilations, Composers, Genres, iTunes U, Podcasts, or Videos. You can replace the browse buttons at the bottom of the screen with buttons you use more frequently. See âChanging the Browse Buttonsâ on page 108. Get more podcast episodes: 6CR2QFECUVU VCR/QTG°TUVKH2QFECUVUKUP¨VXKUKDNG VJGP tap a podcast to see a list of episodes. Tap âGet More EpisodesâŚâ to see a list of more episodes in the iTunes Store. Browse Genius Mixes: 6CR)GPKWU VCR/QTG°TUVKH)GPKWUKUP¨VXKUKDNG +H)GPKWU doesnât appear, you need to turn on Genius in iTunes, and then sync iPhone with iTunes. See âUsing Genius on iPhoneâ on page 102. Play a song: Tap the song. 5JCMGVQUJWĂG5JCMGK2JQPGVQVWTPUJWĂGQPCPFEJCPIGUQPIU5JCMGCP[VKOGVQ change to another song. ;QWECPVWTP5JCMGVQ5JWĂGQPQTQĂKP5GVVKPIU K2QF KV¨UQPD[FGHCWNV 5GG âMusicâ on page 216. Controlling Audio Playback When you play a song, the Now Playing screen appears. )HJR ;YHJR3PZ[ 7SH`7H\ZL 5L_[-HZ[MVY^HYK (PY7SH` 7YL]PV\Z 9L^PUK 96 Chapter 8 iPod =VS\TL APPLE CONFIDENTIAL â First Draft (1.10.11) Pause a song Tap , or press the center button on the iPhone earphones. Resume playback Tap , or press the center button on the iPhone earphones. Raise or lower the volume Drag the volume slider or use the buttons on the side of iPhone. You can also use the volume buttons on the iPhone earphones (iPhone 3GS or later). Play music on an AirPlay sound system or Apple Tap and choose a sound system. If doesnât TV appear or if you donât see the AirPlay system youâre looking for, make sure iPhone is on the same wireless network. Switch from AirPlay back to iPhone Tap Restart a song or a chapter in an audiobook or podcast Tap Skip to the next song or chapter in an audiobook or podcast Tap , or press the center button on the iPhone earphones twice quickly. Go to the previous song or chapter in an audiobook or podcast twice, or press the center button on the Tap iPhone earphones three times quickly. Rewind or fast-forward or . The longer you hold Touch and hold the control, the faster the song rewinds or fastforwards. On the iPhone earphones, press the center button twice quickly and hold to fast forward, or three times quickly and hold to rewind. Return to the iPod browse lists Tap , or swipe to the right over the album artwork. Return to the Now Playing screen Tap Now Playing. Display a songâs lyrics Tap the album artwork when playing a song. (Lyrics appear if youâve added them to the song using the songâs Info window in iTunes.) and choose iPhone from the list. Display audio playback controls from another app or from the Lock screen (iPhone 3GS or later): Double-click the Home DWVVQPVJGPÂąKEMHTQONGHVVQTKIJV along the bottom of the screen. The controls operate the currently playing app, or the most recent app that played, if the audio is paused. The icon for the active app appears on the right. You can tap the icon to open the app. Chapter 8 iPod 97 APPLE CONFIDENTIAL â First Draft (1.10.11) If iPhone is locked and music is playing, double-click the Home button. Note: On iPhone 3G, if youâre listening to music while using another app, or if iPhone is locked, you can display the playback controls by double-clicking the Home button. See âHome Buttonâ on page 200. Additional Audio Controls To display additional controls, tap the album artwork on the Now Playing screen. 6JGTGRGCV)GPKWUCPFUJWĂGEQPVTQNUCRRGCTCNQPIYKVJVJGUETWDDGTDCT;QWECP see elapsed time, remaining time, and the song number. The songâs lyrics also appear, if youâve added them to the song in iTunes. Use the scrubber bar to skip to any point along the timeline. You can adjust the scrub TCVGHTQOJKIJURGGFVQ°PGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCF along the scrubber bar. 9LWLH[ .LUP\Z 7SH`OLHK 98 :O\MMSL :JY\IILYIHY Set iPhone to repeat songs Tap . Tap again to set iPhone to repeat only the current song. = iPhone is set to repeat all songs in the current album or list. = iPhone is set to repeat the current song over and over. = iPhone isnât set to repeat songs. Skip to any point in a song Drag the playhead along the scrubber bar. Slide [QWT°PIGTFQYPVQCFLWUVVJGUETWDTCVG6JG scrub rate becomes slower the farther down you UNKFG[QWT°PIGT Make a Genius playlist Tap . The Genius playlist appears, with buttons that let you create a new Genius playlist, refresh the current one, or save the playlist. See âUsing Genius on iPhoneâ on page 102. 5GVK2JQPGVQUJWĂGUQPIU Tap . Tap again to set iPhone to play songs in order. K2JQPGKUUGVVQUJWĂGUQPIU = iPhone is set to play songs in order. Chapter 8 iPod APPLE CONFIDENTIAL â First Draft (1.10.11) 5JWĂGVJGVTCEMUKPCP[RNC[NKUVCNDWOQTQVJGT 6CR5JWĂGCVVJGVQRQHVJGNKUV(QTGZCORNGVQ list of songs UJWĂGCNNVJGUQPIUQPK2JQPGEJQQUG5QPIU 5JWĂG 9JGVJGTQTPQVK2JQPGKUUGVVQUJWĂGKH[QWVCR 5JWĂGCVVJGVQRQHCNKUVQHUQPIUK2JQPGRNC[U the songs from that list in random order. Hide lyrics In Settings, choose iPod, then turn Lyrics & 2QFECUV+PHQQĂ Podcast and Audiobook Controls Additional controls and information appear on the Now Playing screen when you begin playback. The email, 30-second repeat, and playback speed controls appear along with the scrubber bar. You can see elapsed time, remaining time, and the episode or chapter number. Use the scrubber bar to skip to any point along the timeline. You can adjust the scrub TCVGHTQOJKIJURGGFVQ°PGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCF along the scrubber bar. ,THPS ZLJVUKYLWLH[ 7SH`IHJR ZWLLK :JY\IILYIHY 7SH`OLHK Send an email link to this podcast Tap Skip to any point Drag the playhead along the scrubber bar. Slide [QWT°PIGTFQYPVQCFLWUVVJGUETWDTCVG6JG scrub rate becomes slower the farther down you UNKFG[QWT°PIGT Play back the last 30 seconds Tap Set the playback speed Tap Show or hide the controls Tap in the center of the screen. Hide podcast information In Settings, choose iPod, then turn Lyrics & 2QFECUV+PHQQĂ Chapter 8 iPod . Tap again to change the speed. = Play at double speed. = Play at half speed. = Play at normal speed. 99 APPLE CONFIDENTIAL â First Draft (1.10.11) Using Voice Control with iPod You can use Voice Control (iPhone 3GS or later) to control music playback on iPhone. Note: Voice Control may not be available in all languages. Use Voice Control: Press and hold the Home button until the Voice Control screen appears and you hear a beep. Then use the commands described below to play songs. You can also press and hold the center button on the iPhone earphones to bring up Voice Control. Control music playback Say âplayâ or âplay music.â To pause, say âpauseâ or âpause music.â You can also say ânext songâ or âprevious song.â Play an album, artist, or playlist Say âplay,â then say âalbum,â âartist,â or âplaylistâ and the name. 5JWĂGVJGEWTTGPVRNC[NKUV 5C[ÂĽUJWĂGÂŚ Find out more about the currently playing song Say âwhatâs playing,â âwhat song is this,â âwho sings this song,â or âwho is this song by.â Use Genius to play similar songs Say âGenius,â âplay more like this,â or âplay more songs like this.â Cancel Voice Control Say âcancelâ or âstop.â Browsing Album Artwork in Cover Flow When youâre browsing music, you can rotate iPhone sideways to see your iTunes content in Cover Flow and browse your music by album artwork. 100 Chapter 8 iPod APPLE CONFIDENTIAL â First Draft (1.10.11) Browse album artwork Drag left or right. See the tracks on an album Tap the album artwork or Play any track Tap the track. Drag up or down to scroll through the tracks. Return to the artwork Tap the title bar. Or tap Play or pause the current song Tap or . You can also press the center button on the iPhone earphones. again. Viewing All Tracks on an Album See all the tracks on the album that contains the current song: On the Now Playing screen, tap . Tap a track to play it. Tap the album artwork thumbnail to return to the Now Playing screen. 9H[PUNIHY )HJR[V5V^ 7SH`PUN ZJYLLU (SI\T[YHJRZ In track list view, you can assign ratings to songs. You can use ratings to create smart playlists in iTunes that dynamically update to include, for example, your highest rated songs. Rate a song: &TCI[QWT°PIGTCETQUUVJGTCVKPIDCTVQIKXGVJGUQPI\GTQVQ°XGUVCTU Chapter 8 iPod 101 APPLE CONFIDENTIAL â First Draft (1.10.11) Searching Audio Content You can search the titles, artists, albums, and composers of songs, podcasts, and other content youâve synced to iPhone. Search music: 'PVGTVGZVKPVJGUGCTEJ°GNFCVVJGVQRQHCUQPINKUVRNC[NKUVCTVKUVNKUV or other view of your iPod content. (Tap the status bar to scroll quickly to the top of a NKUVCPFTGXGCNVJGUGCTEJ°GNF Search results appear as you type. Tap Search to dismiss the keyboard and see more of the results. Audio content is included in searches from the Home screen. See âSearchingâ on page 47. Using Genius on iPhone )GPKWU°PFUUQPIUKP[QWTK6WPGUNKDTCT[VJCVIQITGCVVQIGVJGT#)GPKWURNC[NKUVKUC collection of songs that are picked for you to go with a song you choose from your library. A Genius Mix is a selection of songs of the same kind of music. Genius Mixes are recreated each time you listen to them, so theyâre always new and fresh. You can create Genius playlists in iTunes and sync them to iPhone. You can also create and save Genius playlists directly on iPhone. )GPKWU/KZGUCTGETGCVGFCWVQOCVKECNN[HQT[QWD[K6WPGUK6WPGUETGCVGUFKĂGTGPV mixes depending on the variety of music you have in your iTunes library. For example, you may have Genius Mixes that highlight R&B songs, or Alternative Rock songs. 6QWUG)GPKWUQPK2JQPG°TUVVWTPQP)GPKWUKPK6WPGUVJGPU[PEK2JQPGYKVJK6WPGU Genius Mixes are synced automatically, unless you manually manage your music and choose which mixes you want to sync in iTunes. Genius is a free service, but it requires an Apple ID. When you sync a Genius Mix, iTunes may select and sync songs from your library that [QWJCXGP¨VURGEK°ECNN[EJQUGPVQU[PE 102 Chapter 8 iPod APPLE CONFIDENTIAL â First Draft (1.10.11) Browse Genius Mixes: 6CR)GPKWU VCR/QTG°TUVKH)GPKWUKUP¨VXKUKDNG 6JGPWODGT of dots at the bottom of the screen shows the number of mixes youâve synced from iTunes, and indicates which mix youâre viewing. Flick left or right to access your other mixes. Play a Genius Mix: Tap the mix or tap . Make a Genius playlist on iPhone: 1 6CR2NC[NKUVU VCR/QTG°TUVKH2NC[NKUVUKUP¨VXKUKDNG VJGPVCR)GPKWU2NC[NKUV 2 Tap a song in the list. Genius creates a playlist with additional songs that go great with that song. You can also make a Genius playlist of songs that go great with the song youâre playing. Tap the album artwork on the Now Playing screen to display additional controls, then tap . Save a Genius playlist: In the playlist, tap Save. The playlist is saved in Playlists with the title of the song you picked. You can make and save as many Genius playlists as you want. If you save a Genius playlist created on iPhone, it syncs back to iTunes the next time you connect. Refresh a Genius playlist: In the playlist, tap Refresh. 4GHTGUJKPICRNC[NKUVETGCVGUCRNC[NKUVQHFKĂGTGPVUQPIUVJCVIQITGCVYKVJVJGUQPI you picked. You can refresh any Genius playlist, whether it was created in iTunes and synced to iPhone, or created directly on iPhone. /CMGC)GPKWURNC[NKUVWUKPICFKĂGTGPVUQPITap Genius Playlist, then tap New and pick a song. Delete a saved Genius playlist: Tap the Genius playlist, then tap Delete. Once a Genius playlist is synced back to iTunes, you wonât be able to delete it directly from iPhone. You can use iTunes to edit the playlist name, stop syncing, or delete the playlist. Chapter 8 iPod 103 APPLE CONFIDENTIAL â First Draft (1.10.11) Creating Playlists You can create and edit your own playlists on iPhone. You can also edit playlists synced from iTunes on your computer. Create a playlist: 1 6CR2NC[NKUVU VCR/QTG°TUVKH2NC[NKUVUKUP¨VXKUKDNG VJGPVCRÂĽ#FF2NC[NKUVÂÂŚ 2 Type a name for your playlist, then tap Save. 3 Browse for songs using the buttons at the bottom of the screen. Tap any song or video to add it to the playlist. Tap Add All Songs at the top of any list of songs to add all the songs in the list. 4 9JGP[QW°PKUJVCR&QPG When you make a playlist and then sync iPhone to your computer, the playlist is synced to your iTunes library. Edit a playlist: 1 6CR2NC[NKUVU VCR/QTG°TUVKH2NC[NKUVUKUP¨VXKUKDNG VJGPVCRVJGRNC[NKUV[QWYCPVVQ edit. 2 Tap Edit, then do one of the following:  To move a song higher or lower in the list, drag next to the song.  To delete a song from the playlist, tap next to a song, then tap Delete. Deleting a song from a playlist doesnât delete it from iPhone.  To add more songs, tap 3 9JGP[QW°PKUJVCR&QPG When you edit a playlist and then sync iPhone to your computer, the playlist is synced to your iTunes library. Delete a playlist: In Playlists, tap the playlist you want to delete, then tap Delete (scroll VQVJGVQRQHVJGNKUVVQTGXGCNVJG&GNGVGDWVVQP %QP°TOD[VCRRKPI&GNGVG2NC[NKUV Clear a playlist: In Playlists, tap the playlist you want to clear, then tap Clear (scroll to VJGVQRQHVJGNKUVVQTGXGCNVJG%NGCTDWVVQP %QP°TOD[VCRRKPI%NGCT2NC[NKUV Videos With iPhone, you can view video content such as movies, music videos, and video podcasts. If a video contains chapters, you can skip to the next or previous chapter, or bring up a list and start playing at any chapter that you choose. If a video provides alternate language features, you can choose an audio language or display subtitles. Playing Videos Play a video: 6CR8KFGQU VCR/QTG°TUVKH8KFGQUKUP¨VXKUKDNG VJGPVCRVJGXKFGQ 104 Chapter 8 iPod APPLE CONFIDENTIAL â First Draft (1.10.11) Display playback controls: Tap the screen to show the controls. Tap again to hide them. Get more podcast or TV show episodes: 6CR8KFGQU VCR/QTG°TUVKH8KFGQUKUP¨V visible), then tap a podcast or TV show to see a list of episodes. Tap âGet More EpisodesâŚâ to see a list of more episodes in the iTunes Store. Controlling Video Playback Videos play in landscape orientation to take full advantage of the widescreen display. The scrubber bar lets you skip to any point along the timeline. You can adjust the UETWDTCVGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCFCNQPIVJGUETWDDGT bar. :JY\IILYIHY 7SH`OLHK :JHSL 7SH`7H\ZL (PY7SH` 9LZ[HY[9L^PUK =VS\TL 5L_[-HZ[ MVY^HYK Pause a video Tap , or press the center button on the iPhone earphones (iPhone 3GS). Resume playback Tap , or press the center button on the iPhone earphones (iPhone 3GS). Raise or lower the volume Drag the volume slider. You can also use the volume buttons on the iPhone earphones (iPhone 3GS or later). Play a video on Apple TV using AirPlay Tap and choose an Apple TV. If doesnât appear or if you donât see the Apple TV youâre looking for, make sure iPhone is on the same wireless network. Switch from AirPlay back to iPhone Tap Skip to the next chapter (if available) Tap , or press the center button on the iPhone earphones (iPhone 3GS or later) twice quickly. Go to the previous chapter (if available) Tap , or press the center button on the iPhone earphones (iPhone 3GS or later) three times quickly. 5VCTVRNC[KPICVCURGEK°EEJCRVGT KHCXCKNCDNG Tap Chapter 8 iPod and choose iPhone from the list. , then choose a chapter from the list. 105 APPLE CONFIDENTIAL â First Draft (1.10.11) Rewind or fast-forward Touch and hold Skip to any point in a video Drag the playhead along the scrubber bar. Slide [QWT°PIGTFQYPVQCFLWUVVJGUETWDTCVG6JG scrub rate becomes slower the farther down you UNKFG[QWT°PIGT or 5VQRYCVEJKPICXKFGQDGHQTGKV°PKUJGURNC[KPI Tap Done. Or press the Home 5ECNGCXKFGQVQ°NNVJGUETGGPQT°VVQVJG screen VQOCMGVJGXKFGQ°NNVJGUETGGP6CR Tap VQOCMGKV°VVJGUETGGP;QWECPCNUQFQWDNGVCR VJGXKFGQVQUYKVEJDGVYGGP°VVKPICPF°NNKPIVJG screen. 9JGP[QWUECNGCXKFGQVQ°NNVJGUETGGPVJG sides or top may be cropped from view. When [QWUECNGKVVQ°VVJGUETGGP[QWOC[UGGDNCEM bars on the sides or above and below the video. Select an alternate audio language (if available) Tap list. Show or hide subtitles (if available) button. , then choose a language from the Audio Tap VJGPEJQQUGCNCPIWCIGQT1ĂHTQOVJG Subtitles list. Searching for Videos You can search the titles of movies, TV shows, and video podcasts youâve synced to iPhone. Search for a video: 'PVGTVGZVKPVJGUGCTEJ°GNFCVVJGVQRQHVJGNKUVQHXKFGQU Search results appear as you type. Tap Search to dismiss the keyboard and see more of the results. Video content is included in searches from the Home screen. See âSearchingâ on page 47. Watching Rented Movies and TV Shows You can rent movies from the iTunes Store and watch them on iPhone. You can download rented movies and TV shows directly to iPhone, or transfer movies from iTunes on your computer to iPhone. (Rented movies and TV shows may not be available in all countries or regions.) See âPurchasing or Renting Videosâ on page 174. A movie or TV show must be completely downloaded before you can start watching it. You can pause a download and resume it later. 106 Chapter 8 iPod APPLE CONFIDENTIAL â First Draft (1.10.11) Rented movies and TV shows expire after a certain time, and once you start a movie or 68UJQY[QWJCXGCNKOKVGFCOQWPVQHVKOGVQ°PKUJYCVEJKPIKV6JGVKOGTGOCKPKPI appears near the title. Rented items are automatically deleted when they expire. Before renting a movie or TV show, check the iTunes Store for the rental period. View a rented movie or TV show: 1PK2JQPGEJQQUGK2QF 8KFGQU VCR/QTG°TUVKH Videos isnât visible), then select the movie or TV show. On iPhone 3G and iPhone 3GS, you can transfer rented movies between iPhone and your computer. On iPhone 4, you can transfer rented movies between iPhone and your computer only if they were rented in iTunes on your computer. Movies rented on iPhone 4 cannot be transferred to your computer. Transfer a rented movie between iPhone and your computer: 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the Devices list, then click Movies. 3 Click Move next to the item you want to transfer, then click Apply. Your computer must be connected to the Internet. Watching Videos on a TV You can watch videos on your TV by connecting iPhone to your TV or AV receiver with an AV cable. Or, you can stream videos wirelessly to your TV using AirPlay and Apple TV. Connect using an AV cable: Use the Apple Component AV Cable, Apple Composite AV Cable, or other authorized iPhone-compatible cable. You can also use these cables with the Apple Universal Dock to connect iPhone to your TV. The Apple Universal Dock includes a remote that lets you control playback from a distance. Stream videos using AirPlay: Start video playback, then tap and choose your Apple TV from the list. If doesnât appear or if you donât see your Apple TV in the list of AirPlay devices, make sure itâs on the same wireless network as iPhone. To return playback to iPhone, tap again and choose iPhone from the list. Apple cables and docks are available for purchase separately. Go to www.apple.com/ ipodstore (may not be available in all countries or regions) or check with your local Apple retailer. Converting Videos for iPhone You can add videos other than those purchased from the iTunes Store to iPhone, such as videos you create in iMovie on a Mac, or videos you download from the Internet and then add to iTunes. If you try to add a video from iTunes to iPhone and a message says the video canât play on iPhone, you can convert the video. Chapter 8 iPod 107 APPLE CONFIDENTIAL â First Draft (1.10.11) Convert a video to work with iPhone: Select the video in your iTunes library and choose Advanced > âCreate iPod or iPhone Version.â Then add the converted video to iPhone. Deleting Videos from iPhone You can delete videos from iPhone to save space. Delete a video: In the videos list, swipe left or right over the video, then tap Delete. Deleting a video from iPhone (other than a rented movie or TV show) doesnât delete the video from your iTunes library. It may reappear on iPhone if the video in iTunes is still set to sync. Important: If you delete a rented movie or TV show from iPhone, itâs deleted permanently and cannot be transferred back to your computer. Setting a Sleep Timer You can set iPhone to stop playing music or videos after a period of time. Set a sleep timer: (TQOVJG*QOGUETGGPEJQQUG%NQEM 6KOGTVJGPÂąKEMVQUGVVJG number of hours and minutes. Tap When Timer Ends and choose Sleep iPod, tap Set, then tap Start to start the timer. When the timer ends, iPhone stops playing music or video, closes any other open app, and then locks itself. Changing the Browse Buttons You can replace the browse buttons at the bottom of the screen with buttons you use more frequently. For example, if you often listen to podcasts, you can replace the Songs button with Podcasts. 108 Chapter 8 iPod APPLE CONFIDENTIAL â First Draft (1.10.11) Change the browse buttons: Tap More and tap Edit, then drag a button to the bottom of the screen, over the button you want to replace. You can drag the buttons at the bottom of the screen left or right to rearrange them. 6CR&QPGYJGP[QW°PKUJ6CR/QTGCVCP[VKOGVQCEEGUUVJGDWVVQPU[QWTGRNCEGF Chapter 8 iPod 109 APPLE CONFIDENTIAL â First Draft (1.10.11) Messages Sending and Receiving Messages WARNING: For important information about driving safely, see the Important Product Information Guide at www.apple.com/support/manuals/iphone. Messages lets you exchange text messages with anyone using an SMS-capable phone. Messages also supports MMS, so you can send photos, video clips (iPhone 3GS or later), contact information, and voice memos to other MMS-capable devices. You can enter multiple addressees and send a message to several people at the same time. Note: SMS or MMS support may not be available in all countries or regions. Additional fees may apply for use of Messages. Contact your carrier for more information. The Messages icon on the Home screen shows the number of unread messages you have. 5\TILYVM \UYLHKTLZZHNLZ You can use Messages whenever youâre in range of the cellular network. If you can make a call, you can send a message. Depending on your phone plan, you may be charged for the messages you send or receive. Send a message: Tap , then enter a phone number or name, or tap and choose a EQPVCEVHTQO[QWTEQPVCEVUNKUV6CRVJGVGZV°GNFCDQXGVJGMG[DQCTFV[RGCOGUUCIG and tap Send. Messages longer than 160 characters sent from a CDMA model may be split into OWNVKRNGOGUUCIGUYJGPTGEGKXGFQPRJQPGUWUKPICFKĂGTGPVECTTKGT5GGÂĽ6WTP EJCTCEVGTEQWPVKPIQPQTQĂÂŚDGNQY 110 APPLE CONFIDENTIAL â First Draft (1.10.11) If the message canât be sent (if youâre out of cellular network range, for example), an alert badge appears on the Messages icon on the Home screen. If Messages is in a folder, the alert badge appears on the folder. (SLY[IHKNL Important: Messages containing Emoji or other non-ASCII characters sent from a CDMA model are not delivered to phones on a GMS network, and no alert appears. Your conversations are saved in the Messages list. Conversations that contain unread messages have a blue dot next to them. Tap a conversation in the list to see that conversation or add to it. ;L_[TLZZHNLZ `V\ZLU[ ;L_[TLZZHNLZ MYVT[OLV[OLY WLYZVU iPhone displays the 50 most recent messages in the conversation. To see earlier messages, scroll to the top and tap Load Earlier Messages. Send a message to a group of people: Tap , then add recipients. If you enter a phone number manually (instead of selecting it from Contacts), tap Return before entering another entry. The Group Messaging setting must be turned on (in Settings > Messages). Replies from any of the recipients are sent only to you, not to the other people you texted. Reply or send a message to a person (or group) youâve texted before: Tap an entry in the Messages list, then type a new message in the conversation and tap Send. Send a message to a favorite or to a recent call: 1 Tap Phone on the Home screen, then tap Favorites or Recents. 2 Tap next to a name or number, then tap Text Message. Chapter 9 Messages 111 APPLE CONFIDENTIAL â First Draft (1.10.11) 3 If multiple phone numbers appear, tap the one you want to text. When MMS is available, Messages allows you to include a subject in your text OGUUCIGU;QWECPVWTPVJKUHGCVWTGQPQTQĂKP/GUUCIGUUGVVKPIU+VKUVWTPGFQPD[ default. +PENWFGQTTGOQXGVJGUWDLGEV°GNFIn Settings, tap Messages, then tap Show Subject Field. Note: 6JGUWDLGEV°GNFCPFVJG5JQY5WDLGEV(KGNFUGVVKPIFQP¨VCRRGCTKH//5KUP¨V supported by your carrier. 6WTPEJCTCEVGTEQWPVKPIQPQTQĂIn Settings, tap Messages, then tap the Character Count switch. The character count includes all charactersâincluding spaces, punctuation, and returnsâand appears as you type when your message exceeds two lines. You may want to count characters, for example, when carrier fees apply. Note: 6JGEJCTCEVGTEQWPVFQGUPQVCRRGCTKH[QWGPVGTVGZVKPVJGUWDLGEV°GNFQT attach a photo or video. 6WTP//5OGUUCIKPIQPQTQĂIn Settings, tap Messages, then tap MMS Messaging. ;QWOC[YCPVVQVWTP//5/GUUCIKPIQĂHQTGZCORNGVQRTGXGPVUGPFKPIQTTGEGKXKPI attachments when fees apply. Note: The MMS Messaging setting doesnât appear if MMS isnât supported by your carrier. Searching Messages You can search the content of message threads from the Messages list (iPhone 3GS or later). Search the Messages list: 6CRVJGVQRQHVJGUETGGPVQFKURNC[VJGUGCTEJ°GNFVJGP VCRVJGUGCTEJ°GNFCPFGPVGTVJGVGZV[QW¨TGNQQMKPIHQT Messages are included in searches from the Home screen. See âSearchingâ on page 47. Sharing Photos and Videos You can take a photo or make a video (iPhone 3GS or later) from within Messages and include it in your conversation with another MMS-capable device. You can save photos or videos you receive in Messages to your Camera Roll album. If MMS isnât supported by your carrier, videos. doesnât appear and you canât send photos or Send a photo or video: Tap and tap âTake Photo or Videoâ (iPhone 3GS or later; on earlier models, tap âTake Photoâ), or âChoose Existingâ and select an item from a photo album and tap Choose. 112 Chapter 9 Messages APPLE CONFIDENTIAL â First Draft (1.10.11) The size limit of attachments is determined by your carrier. If necessary, iPhone may compress the photo or video. To learn about taking photos and videos, see Chapter 12, âCamera,â on page 129. Save a photo or video attachment to your Camera Roll album: Tap the photo or video in the conversation, tap , then tap Save Image or Save Video. Copy a photo or video: Touch and hold the attachment, then tap Copy. You can paste the photo or video to an Mail message or another MMS message. Sending Voice Memos You can send voice memos in a message to another MMS-capable device. Send a voice memo: In Voice Memos, tap , tap the voice memo you want to send, then tap Share and tap MMS. Address the message and tap Send. Editing Conversations If you want to keep a conversation but not the entire thread, you can delete the parts you donât want. You can also delete entire conversations from the Messages list. Edit a conversation: Tap Edit. Tap the circles along the left side to select the parts of VJGEQPXGTUCVKQP[QWYCPVVQFGNGVGVJGPVCR&GNGVG9JGP[QW¨TG°PKUJGFVCR&QPG %NGCTCNNVGZVCPF°NGUYKVJQWVFGNGVKPIVJGEQPXGTUCVKQPTap Edit, then tap Clear All. 6CR%NGCT%QPXGTUCVKQPVQEQP°TO Forward a conversation: Select a conversation, then tap Edit. Tap the circles on the left side of the screen to select the parts of the conversation you want to include, then tap Forward, enter one or more recipients, and tap Send. Delete a conversation: Tap Edit, then tap next to the conversation and tap Delete. You can also swipe left or right over the conversation and tap Delete. ;VZOV^[OL +LSL[LI\[[VU Z^PWLSLM[VYYPNO[ V]LY[OLTLZZHNL Using Contact Information and Links Call, FaceTime, or email someone youâve texted: Tap a message in the Text Messages list and scroll to the top of the conversation. (Tap the status bar to scroll quickly to the top of the screen.)  To call the person, tap Call. Chapter 9 Messages 113 APPLE CONFIDENTIAL â First Draft (1.10.11)  To call the person using FaceTime, tap FaceTime.  To email the person, tap Contact Info, then tap an email address. Follow a link in a message: Tap the link. A link may open a webpage in Safari, make a phone call in Phone, open a preaddressed message in Mail, or display a location in Maps. To return to your text messages, press the Home button and tap Messages. Add someone youâve texted to your contacts list: Tap a phone number in the Messages list, then tap âAdd to Contacts.â Send contact information: In Contacts, tap the person whose information you want to share. Tap Share Contact at the bottom of the screen, then tap MMS. Address the message and tap Send. Save contact information received: Tap the contact bubble in the conversation and tap Create New Contact or âAdd to Existing Contact.â Managing Previews and Alerts By default, iPhone displays a preview of new messages when iPhone is locked or when [QWCTGWUKPICPQVJGTCRR;QWECPVWTPVJKURTGXKGYQPQTQĂKP5GVVKPIU;QWECPCNUQ enable alerts for text messages. 6WTPRTGXKGYUQPQTQĂIn Settings, choose Messages and tap Show Preview. Repeat previews: In Settings, choose Messages and tap Repeat Alert. If you donât TGURQPFVQVJG°TUVRTGXKGYQHCPGYOGUUCIGVJGRTGXKGYYKNNDGFKURNC[GFVYKEG more. Set whether an alert sounds when you get a text message or preview: In Settings, choose Sounds, then tap New Text Message. Tap the alert sound you want, or None if you donât want an audible alert. Important: +HVJG4KPI5KNGPVUYKVEJKUQĂVGZVCNGTVUYQP¨VUQWPF 114 Chapter 9 Messages APPLE CONFIDENTIAL â First Draft (1.10.11) Calendar 10 About Calendar Calendar gives you ready access to your calendars and events. You can view individual calendars, or several calendars at once. You can view your events by day, by month, or in a list. You can search the titles, invitees, locations, and notes of events. If youâve entered birthdays for your contacts, you can view those birthdays in Calendar. You can sync iPhone with the calendars on your computer, and with services such as MobileMe, Microsoft Exchange, Yahoo!, and Google. You can also make, edit, or cancel appointments on iPhone and have them sync back to your computer or calendar account. If you have a MobileMe, Microsoft Exchange, Google, Yahoo!, or CalDAV account, your calendars can sync over the air without connecting iPhone to your computer. MobileMe Shared Calendars that youâve joined from your computer also sync with iPhone. ;QWECPUWDUETKDGVQTGCFQPN[K%CNGPFCT KEU ECNGPFCTUQTKORQTVKEU°NGUHTQOGOCKN If you have a Microsoft Exchange account with Calendars enabled, or a supported CalDAV account, you can receive and respond to meeting invitations from others, and invite people to events youâve scheduled. Syncing Calendars You can sync Calendar in either of the following ways:  In iTunes, use the iPhone Info pane to sync with iCal or Microsoft Entourage on a Mac, or Microsoft Outlook 2003, 2007, or 2010 on a PC, when you connect iPhone to your computer. See âiPhone Settings Panes in iTunesâ on page 58. 115 APPLE CONFIDENTIAL â First Draft (1.10.11)  In Settings on iPhone, turn on Calendars in your MobileMe, Microsoft Exchange, Google, or Yahoo! accounts to sync your calendar information over the air, or set up a CalDAV account if your company or organization supports it. See âAdding Mail, Contacts, and Calendar Accountsâ on page 25. Viewing Your Calendars You can view a single calendar, selected calendars, or all calendars at once. Select calendars to view: Tap Calendars, then tap to select the calendars you want to view. To quickly select or deselect all calendars, tap Show All Calendars or Hide All Calendars. To view your contactsâ birthdays, tap Birthdays at the bottom of the screen. Tap Done to view the selected calendars. The events for all selected calendars appear in a single calendar on iPhone. You can view your calendar events in a list, by day, or by month. Switch views: Tap List, Day, or Month.  List view: All your appointments and events appear in a scrollable list.  Day view: Scroll up or down to see the events in a day. Tap or to see the previous or next dayâs events.  Month view: Tap a day to see its events. Tap or to see the previous or next month. (KKHUL]LU[ +H`Z^P[OKV[Z OH]LZJOLK\SLK L]LU[Z ,]LU[ZMVY ZLSLJ[LKKH` 9LZWVUK[V JHSLUKHYPU]P[H[PVU .V[V[VKH` :^P[JO]PL^Z See the details of an event: Tap the event. Set iPhone to adjust event times for a selected time zone: 1 In Settings, choose âMail, Contacts, Calendars.â 2 Under Calendars, tap Time Zone Support, then turn Time Zone Support on. 3 Tap Time Zone, then search for a major city in the time zone you want. 116 Chapter 10 Calendar APPLE CONFIDENTIAL â First Draft (1.10.11) When Time Zone Support is on, Calendar displays event dates and times in the time \QPGQHVJGEKV[[QWUGNGEVGF9JGP6KOG Create iPod or iPhone Version. For more information, go to support.apple.com/kb/HT1211. Viewing Photos and Videos Photos and videos you take with iPhone, sync from your computer, or save from an email or MMS message can be viewed in Photos. If you sync photos with iPhoto 8.0 (part of iLife â09) or later, you can view your photos and videos by the events and faces [QW¨XGKFGPVK°GF;QWECPCNUQUGGVJGRNCEGUYJGTG[QWTRJQVQUCPFXKFGQUYGTG taken if theyâre tagged with location data. View photos and videos: 1 In Photos, tap a photo album. Tap the buttons at the bottom of the screen to view your photos and videos by albums, events, faces, or places if available. Photos are sorted by creation date. If you tap Places, a map shows each location that youâve tagged photos from. Tap a pin, then tap to see your photos and videos from that location. 2 Tap a thumbnail to see the photo or video in full screen. Show or hide the controls: Tap the full-screen photo or video to show the controls. Tap again to hide the controls. Play a video: Tap in the center of the screen. To replay a video, tap to show the controls. 122 Chapter 11 Photos at the bottom of the screen. If you donât see , tap the screen APPLE CONFIDENTIAL â First Draft (1.10.11) View a photo or video in landscape orientation: Rotate iPhone sideways. The photo QTXKFGQTQVCVGUCWVQOCVKECNN[CPFKHKV¨UKPYKFGUETGGPHQTOCVGZRCPFUVQ°VVJG screen. Zoom in on part of a photo: Double-tap where you want to zoom in. Double-tap again to zoom out. You can also pinch to zoom in or out. 8KGYXKFGQKPHWNNUETGGPQT°VXKFGQVQUETGGPDouble tap the screen to scale the XKFGQVQ°NNVJGUETGGP&QWDNGVCRCICKPVQ°VVJGXKFGQVQVJGUETGGP Pan around a photo: Drag the photo. See the next or previous photo or video: Flick left or right. Or tap the screen to show the controls, then tap or . Chapter 11 Photos 123 APPLE CONFIDENTIAL â First Draft (1.10.11) Deleting Photos and Videos You can delete photos and videos from Camera Roll on iPhone. Delete photos and videos: 1 Tap in the upper-right corner of the screen. 2 Tap to select the photos and videos you want to delete. The Delete button indicates the number of items you select. 3 Tap Delete. Slideshows You can view a photo album as a slideshow, complete with background music. View a photo album as a slideshow: Tap an album, then tap . Videos play automatically when they appear during the slideshow. Stop a slideshow: Tap the screen. Set slideshow settings: In Settings, choose Photos and set the following options:  To set the length of time each slide is shown, tap Play Each Slide For and choose a time.  6QUGVVTCPUKVKQPGĂGEVUYJGPOQXKPIHTQORJQVQVQRJQVQtap Transition and choose a transition type.  To set whether slideshows repeat, VWTP4GRGCVQPQTQĂ Â To set whether photos and videos are shown in random order, VWTP5JWĂGQPQTQĂ Play music during a slideshow: In iPod, play a song, then choose Photos on the Home screen and start a slideshow. Viewing Photos, Videos, and Slideshows on a TV You can view photos, videos, and slideshows on your TV by connecting iPhone to your TV or AV receiver with an AV cable. Or, you can stream photos and slideshows wirelessly to your TV using AirPlay and Apple TV. Connect using an AV cable: Use the Apple Component AV Cable, Apple Composite AV Cable, or other authorized iPhone-compatible cable. You can also use these cables with the Apple Universal Dock to connect iPhone to your TV or AV receiver. The Apple Universal Dock includes a remote that lets you control playback from a distance. Stream content using AirPlay: View a photo or slideshow, then tap and choose your Apple TV from the list. If doesnât appear or if you donât see your Apple TV in the list of AirPlay devices, make sure itâs on the same wireless network as iPhone. To return playback to iPhone, tap again and choose iPhone from the list. 124 Chapter 11 Photos APPLE CONFIDENTIAL â First Draft (1.10.11) Apple cables and docks are available for purchase separately. Go to www.apple.com/ ipodstore (may not be available in all countries or regions) or check with your local Apple retailer. Sharing Photos and Videos You can send photos and videos in email and MMS messages, add photos and videos to MobileMe galleries, and publish videos to YouTube. You can also copy and paste photos and videos, save photos and videos from email messages to Photos, and save images from webpages to Photos. Sending a Photo or Video in an Email or MMS Message Send a photo or video (iPhone 3GS or later) in an email message: 1 Choose a photo or video and tap . If you donât see , tap the screen to show the controls. 2 Tap Email Photo/Video. The photo or video appears in a new mail message window. 3 Compose your message, then tap Send. 4 If sending a photo, you may be asked if you want to reduce the message size by scaling the image. Tap the size you want to use. Send multiple photos or videos at the same time: When viewing thumbnails in an album, tap , then tap to select the photos or videos you want to send, tap Share, and tap Email. Send a photo or video via MMS: Choose a photo or video and tap , then tap MMS. The size limit of attachments is determined by your carrier. If necessary, iPhone may compress the photo or video. To learn about taking photos and videos, see Chapter 12, âCamera,â on page 129. Copying and Pasting Photos and Videos You can copy a photo or video from Photos and paste it in an email or MMS message. Some third-party apps may also support copying and pasting photos and videos. Copy a photo or video: *QNF[QWT°PIGTQPVJGUETGGPWPVKNVJG%QR[DWVVQPCRRGCTU then tap Copy. Copy multiple photos or videos: 1 Tap in the upper-right corner of the screen. 2 Tap to select the photos and videos you want to copy. The Copy button indicates the number of items you select. 3 Tap Copy. Chapter 11 Photos 125 APPLE CONFIDENTIAL â First Draft (1.10.11) Paste a photo or video: Tap to place the insertion point where you want to place the photo or video, then tap the insertion point and tap Paste. Adding a Photo or Video to a MobileMe Gallery If you have a MobileMe account, you can add photos and videos directly from iPhone to a gallery youâve created. You can also add photos and videos to someone elseâs MobileMe gallery if that person has enabled email contributions. Before you can add photos or videos to a gallery in your MobileMe account, you must:  Set up your MobileMe account on iPhone  Publish a MobileMe gallery, and allow adding photos via email or iPhone For more information about creating a gallery and adding photos and videos to it, see MobileMe Help. Add a photo or video to your gallery: Choose a photo or video and tap , then tap âSend to MobileMe.â Enter a title and description, if you like, then select the album to add the photo or video to and tap Publish. If you donât see , tap the screen to show the controls. iPhone tells you when the photo or video has been published, and gives you options to view it on MobileMe or email a link to a friend. Add a photo or video to someone elseâs gallery: Choose a photo or video and tap then tap âEmail Photo/Video.â Enter the albumâs email address, then click Send. Publishing Videos to YouTube If you have a YouTube account, you can publish videos directly from iPhone 3GS or later to YouTube. Some videos may not be transferable, depending on the length of the movie or other factors. Publish a video to YouTube: 1 While viewing a video, tap , then tap âSend to YouTube.â 2 Sign in to your YouTube account. 3 Enter publishing information such as Title, Description, and Tags. 4 Tap Category to choose a category. 5 Tap Publish. Saving Photos and Videos from Email Messages, MMS Messages, and Webpages Save a photo from an email message to your Camera Roll album: Tap the photo, then tap Save Image. If the photo hasnât been downloaded yet, tap the download PQVKEG°TUV 126 Chapter 11 Photos APPLE CONFIDENTIAL â First Draft (1.10.11) Save a video from an email message to your Camera Roll album: Touch and hold the attachment, then tap Save Video. If the video hasnât been downloaded yet, tap the FQYPNQCFPQVKEG°TUV Save a photo from a webpage to your Camera Roll album: Touch and hold the photo, then tap Save Image. Save a photo or video from an MMS message to your Camera Roll album: Tap the image in the conversation, tap , and tap Save Image or Save Video. If you donât see , tap the screen to show the controls. You can download the photos and videos in your Camera Roll album to your computerâs photo application by connecting iPhone to your computer. Printing Photos You can use AirPrint to print photos from iPhone. Print a photo: Tap , then tap Print. Tap Select Printer to select a printer, set the number of copies, then tap Print. Print multiple photos: While viewing a photo album, tap . Select the photos you want to print, then tap Print. Tap Select Printer to select a printer, set the number of copies, then tap Print. For more information, see âPrintingâ on page 45. Assigning a Photo to a Contact You can assign a photo to a contact. When that person calls, iPhone displays the photo. Assign a photo to a contact: 1 Choose Camera on the Home screen, then take someoneâs picture. Or choose any photo already on iPhone, and tap . 2 Tap âAssign to Contactâ and choose a contact. 3 Position and size the photo until it looks the way you want. Drag the photo to pan, and pinch to zoom in or out. 4 Tap Set Photo. You can also assign a photo to a contact in Contacts by tapping Edit and then tapping âAdd Photo.â Chapter 11 Photos 127 APPLE CONFIDENTIAL â First Draft (1.10.11) Wallpaper You can set a photo as wallpaper for the Lock screen. On iPhone 3GS or later, you can also set wallpaper for your Home screen. The Lock screen wallpaper also appears when youâre on a call with someone you donât have a contact photo for. Set a photo as wallpaper (iPhone 3GS or later): 1 Choose any photo and tap , then tap Use As Wallpaper. 2 Drag the photo to position it and pinch to zoom in or out, until it looks the way you want. 3 Tap Set, then choose whether you want to use the photo as wallpaper for your Lock Screen, Home screen, or both. You can also choose from several wallpaper pictures included with iPhone by choosing Settings > Wallpaper from the Home screen. See âAdding Wallpaperâ on page 36. Set a photo as wallpaper (iPhone 3G): 1 Choose any photo and tap , then tap Use As Wallpaper. 2 Drag the photo to position it and pinch to zoom in or out, until it looks the way you want. 3 Tap Set Wallpaper. You can also choose from several wallpaper pictures included with iPhone by choosing Settings > Wallpaper from the Home screen. 128 Chapter 11 Photos APPLE CONFIDENTIAL â First Draft (1.10.11) Camera 12 About Camera With iPhone, you have a great still camera and video camera (iPhone 3GS or later) YJGTGXGT[QWIQK2JQPGJCUCOCKPECOGTCVJCVVCMGURJQVQUCPFJKIJFG°PKVKQP XKFGQCP.'&ÂąCUJHQTRJQVQUCPFXKFGQUVCMGPYKVJVJGOCKPECOGTCCPFCHTQPV camera that lets you make FaceTime video calls and take photos and videos of yourself. The main camera is on the back of iPhone. You use the screen to control the camera and to see the photo or video youâre taking. Tap-to-focus lets you tap anywhere on VJGUETGGPVQHQEWUQPCURGEK°EQDLGEVQTCTGCQH[QWTUJQVCPFCWVQOCVKECNN[CFLWUV the exposure. The macro autofocus feature (about 10 cm) and a 5x digital zoom let you take great close-ups. (The video and tap-to-focus features are available only on iPhone 3GS or later.) If location services is turned on, photos and videos (iPhone 3GS or later) are tagged with location dataâincluding your current geographical coordinates provided by GPS, Wi-Fi, or cell-tower information. You can use location data with some apps and photo-sharing websites to track and post where you took the photos. For example, the Photos app organizes photos by places. Note: +HNQECVKQPUGTXKEGUKUVWTPGFQĂYJGP[QWQRGP%COGTC[QWOC[DGCUMGFVQ turn it on. If you donât want to include location data with your photos and videos, you can use Camera without turning on location services. See âLocation Servicesâ on page 200. 129 APPLE CONFIDENTIAL â First Draft (1.10.11) Taking Photos and Recording Videos Taking photos and recording videos with iPhone is as easy as point and tap. :L[3,+ MSHZOTVKL ;\YU/+9 VUVYVMM :^P[JOJHTLYHZ -VJ\ZHYLH AVVT *HTLYH=PKLV Z^P[JO ;O\TIUHPSVM SHZ[ZOV[ ;HW[V [HRLWOV[V Take a photo: Aim iPhone and tap Make sure the Camera/Video switch is set to When you take a photo or start a video recording, iPhone makes a shutter sound. You can use the volume buttons on the side of the iPhone to control the volume of the shutter sound. You donât hear a sound if you set the Ring/Silent switch to silent. See âSounds and the Ring/Silent Switchâ on page 196. Note: +PUQOGTGIKQPUVJGUQWPFGĂGEVUHQT%COGTCCTGRNC[GFGXGPKHVJG4KPI5KNGPV switch is set to silent. On iPhone 4, you can turn on HDR to take HDR (high dynamic range) photos. HDR blends the best parts of three separate exposures into a single photo. For best results, iPhone and the subject should be stationary. 6WTP*&4QPQTQĂTap the HDR button at the top of the screen. The button indicates YJGVJGT*&4KUQPQTQĂ *&4KUQĂD[FGHCWNV Note: 9JGP*&4KUQPVJGÂąCUJKUVWTPGFQĂ With HDR, you can save both the normal-exposure version and the HDR version of a photo in the Camera Roll, or save just the HDR version. By default, both are saved. Choose whether to save both the normal-exposure version and the HDR version of photos: +P5GVVKPIUEJQQUG2JQVQUVJGPVWTP-GGR0QTOCN2JQVQQPQTQĂ+HVJG UGVVKPIKUVWTPGFQĂQPN[VJG*&4XGTUKQPQHCRJQVQKUUCXGF 130 Chapter 12 Camera APPLE CONFIDENTIAL â First Draft (1.10.11) If you save both versions, appears in the upper-left corner of the HDR photo when you view the photos in Camera Roll (if the controls are visible). Record a video: Slide the Camera/Video switch to , then tap to start recording. The record button blinks while Camera is recording. Tap again to stop recording. You can also press the center button on the iPhone earphones to start or stop recording. A rectangle on the screen shows the area where the camera is focused and setting the exposure. Tap the screen to bring up the camera controls. Change the focus area and set the exposure: Tap anywhere to focus the camera and adjust the exposure for the selected area. Zoom in or out: Tap the screen, then drag the slider at the bottom of the screen to zoom in or out (main camera, in camera mode only). 5GV.'&ÂąCUJOQFG6CRVJGÂąCUJDWVVQPKPVJGWRRGTNGHVEQTPGTQHVJGUETGGPVJGP VCR1Ă#WVQQT1P Switch between the main and front cameras: Tap the screen. in the upper-right corner of Review a photo or video youâve just taken: Tap the thumbnail of your last shot, in the lower-left corner of the screen. Use the left and right arrows at the bottom of the screen to review other photos and XKFGQUKPVJG%COGTC4QNNQTLWUVÂąKEMNGHVQTTKIJV6CR&QPGVQTGVWTPVQECOGTCQT video mode. If you donât see the controls, tap the screen to display them. Delete a photo or video: Tap . If you donât see , tap the screen to display the controls. Take a screenshot: 3WKEMN[RTGUUCPFTGNGCUGVJG1P1Ă5NGGR9CMGCPF*QOG DWVVQPUCVVJGUCOGVKOG#ÂąCUJQHVJGUETGGPNGVU[QWMPQYVJGUETGGPUJQVYCU taken. The screenshot is added to the Camera Roll album. Viewing and Sharing Photos and Videos The photos and videos you take with Camera are saved in the Camera Roll album on iPhone. You can view the Camera Roll album from either Camera or Photos. View photos and videos in the Camera Roll album: In Camera, tap the thumbnail image in the lower-left corner of the screen. In Photos, tap the Camera Roll album. Tap VJGNGHVQTTKIJVDWVVQPQTÂąKEMNGHVQTTKIJVVQÂąKRVJTQWIJVJGRJQVQUCPFXKFGQU When viewing a photo or video in the Camera Roll album, tap the screen to display the controls. If you save both the normal and the HDR versions of a photo, appears in the upper-left corner of the HDR photo (when the controls are visible). Chapter 12 Camera 131 APPLE CONFIDENTIAL â First Draft (1.10.11) For more information about viewing and sharing photos and videos, see:  â Viewing Photos and Videosâ on page 122  âSharing Photos and Videosâ on page 125 Trimming Videos You can trim the frames from the beginning and end of a video that you just recorded, or any other video in the Camera Roll album. You can replace the original video or save the trimmed version as a new video clip. Trim a video: 1 While viewing a video, tap the screen to display the controls. 2 Drag either end of the frame viewer at the top of the video, then tap Trim. 3 Tap Trim Original or âSave as New Clip.â Important: If you choose Trim Original, the trimmed frames are permanently deleted from the original video. If you choose âSave as New Clip,â a new trimmed video clip is UCXGFKPVJG%COGTC4QNNCNDWOCPFVJGQTKIKPCNXKFGQKUWPCĂGEVGF Uploading Photos and Videos to Your Computer You can upload the photos and videos you take with Camera to photo applications on your computer, such as iPhoto on a Mac. Upload photos and videos to your computer: Connect iPhone to your computer.  Mac: Select the photos and videos you want and click the Import or Download button in iPhoto or other supported photo application on your computer.  PC: Follow the instructions that came with your photo application. If you delete the photos and videos from iPhone when you upload them to your computer, theyâre removed from the Camera Roll album. You can use the Photos settings pane in iTunes to sync photos and videos (videos can be synced with Macs only) to the Photos app on iPhone. See âiPhone Settings Panes in iTunesâ on page 58. 132 Chapter 12 Camera APPLE CONFIDENTIAL â First Draft (1.10.11) YouTube 13 Finding and Viewing Videos YouTube features short videos submitted by people from around the world. To use some features on iPhone, you need to sign in to a YouTube account when asked. For information about requirements and how to get a YouTube account, go to www. youtube.com. Note: YouTube may not be available in all languages and locations. Browse videos: Tap Featured, Most Viewed, or Favorites. Or tap More to browse by Most Recent, Top Rated, History, Subscriptions, or Playlists.  Featured: 8KFGQUTGXKGYGFCPFHGCVWTGFD[;QW6WDGUVCĂ Â Most Viewed: Videos most seen by YouTube viewers. Tap All for all-time most viewed videos, or Today or This Week for most-viewed videos of the day or week.  Favorites: Videos youâve added to Favorites. When you sign in to a YouTube account, account favorites appear and any existing favorites can be synced to your account.  Most Recent: Videos most recently submitted to YouTube.  Top Rated: Videos most highly rated by YouTube viewers. To rate videos, go to www. youtube.com.  History: Videos youâve viewed most recently.  Subscriptions: Videos from YouTube accounts to which youâve subscribed. You must be signed in to a YouTube account to use this feature.  Playlists: Videos youâve added to playlists. You must be signed in to a YouTube account to use this feature. You can replace the browse buttons at the bottom of the screen with buttons you use more frequently. See âChanging the Browse Buttonsâ on page 137. 133 APPLE CONFIDENTIAL â First Draft (1.10.11) Search for a video: 1 6CR5GCTEJ VCR/QTG°TUVKH5GCTEJKUP¨VXKUKDNG VJGPVCRVJG;QW6WDGUGCTEJ°GNF 2 Type a word or phrase that describes what youâre looking for, then tap Search. YouTube shows results based on video titles, descriptions, tags, and user names. Listed videos show title, rating, number of views, length, and the account name that posted the video. Play a video: Tap the video. The video begins to download to iPhone and a progress bar appears. When enough of the video has downloaded, it begins to play. You can also tap to start the video. Controlling Video Playback When a video starts playing, the controls disappear so they donât obscure the video. Show or hide the video controls: Tap the screen. 7SH`OLHK +V^USVHKWYVNYLZZ :JY\IILYIHY :JHSL 7SH`7H\ZL 5L_[ -HZ[MVY^HYK (PY7SH` ,THPS )VVRTHYR 134 7YL]PV\ZYL^PUK =VS\TL Play or pause a video Tap or . You can also press the center button on the iPhone earphones (iPhone 3GS or later). Adjust the volume Drag the volume slider, or use the volume buttons on the side of iPhone. You can also use the volume buttons on the iPhone earphones (iPhone 3GS or later). Play a video on Apple TV using AirPlay Tap and choose an Apple TV. If doesnât appear or if you donât see the Apple TV youâre looking for, make sure itâs on the same wireless network as iPhone. Switch from AirPlay back to iPhone Tap Restart a video Tap Skip to the next or previous video in a list twice to skip to the previous video. Tap Tap to skip to the next video. Rewind or fast-forward Touch and hold Chapter 13 YouTube and choose iPhone from the list. or APPLE CONFIDENTIAL â First Draft (1.10.11) Skip to any point in a video Drag the playhead along the scrubber bar. 5VQRYCVEJKPICXKFGQDGHQTGKV°PKUJGURNC[KPI Tap Done, or press the Home button. 5YKVEJDGVYGGPUECNKPICXKFGQVQ°NNVJGUETGGP Double-tap the video. You can also tap OCMGVJGXKFGQ°NNVJGUETGGPQTVCR QT°VVQVJGUETGGP KV°VVJGUETGGP Add a video to Favorites using video controls Start playing a video and tap Email a link to the video using video controls Start playing a video and tap to to make Managing Videos Tap next to a video to see related videos and more controls for managing videos. Add the video to Favorites Tap âAdd to Favorites.â Add the video to a playlist Tap âAdd to Playlist,â then select an existing playlist or tap to create a new playlist. Email a link to the video Tap Share Video. Browse and view related videos Tap a video in the list of related videos to view, or next to a video for more information. tap Chapter 13 YouTube 135 APPLE CONFIDENTIAL â First Draft (1.10.11) Getting More Information Tap next to the video to show the videoâs comments, description, date added, and other information. Rate the video or add a comment On the More Info screen, tap âRate, Comment, or Flag,â then choose âRate or Comment.â You must be signed in to a YouTube account to use this feature. See more videos from this account On the More Info screen, tap More Videos. Subscribe to this YouTube account On the More Info screen, tap More Videos, then tap âSubscribe to â at the bottom of the video list. You must be signed in to a YouTube account to use this feature. Using YouTube Account Features If you have a YouTube account, you can access account features such as subscriptions, comments and ratings, and playlists. To create a YouTube account, go to www.youtube. com. Show favorites youâve added to your account: In Favorites, tap Sign In, then enter your username and password to see your account favorites. Any existing favorites youâve added to iPhone can be merged with your account favorites when you sign in. Delete a favorite: In Favorites, tap Edit, tap next to a video, then tap Delete. Show subscriptions youâve added to your account: In Subscriptions, tap Sign In, then enter your username and password to see your account subscriptions. Tap an account in the list to see all videos for that account. Unsubscribe from a YouTube account: In Subscriptions, tap an account in the list, then tap Unsubscribe. 136 Chapter 13 YouTube APPLE CONFIDENTIAL â First Draft (1.10.11) View playlists: In Playlists, tap a playlist to see the list of videos youâve added. Tap any video in the playlist to begin playing videos from that point in the playlist. Edit a playlist: In Playlists, tap Edit, then do one of the following:  To delete the entire playlist, tap  To create a new playlist, tap Add a video to a playlist: Tap a playlist. next to a playlist, then tap Delete. , then enter a name for the playlist. next to a video, then tap âAdd to Playlistâ and choose Delete a video from a playlist: 1 In Playlists, tap a playlist, then tap Edit. 2 Tap next to a playlist, then tap Delete. Changing the Browse Buttons You can replace the Featured, Most Viewed, Bookmarks, and Search buttons at the bottom of the screen with ones you use more frequently. For example, if you watch top-rated videos often but donât watch many featured videos, you could replace the Featured button with Top Rated. Change the browse buttons: Tap More and tap Edit, then drag a button to the bottom of the screen, over the button you want to replace. You can drag the buttons at the bottom of the screen left or right to rearrange them. 9JGP[QW°PKUJVCR&QPG When youâre browsing for videos, tap More to access the browse buttons that arenât visible. Chapter 13 YouTube 137 APPLE CONFIDENTIAL â First Draft (1.10.11) Sending Videos to YouTube If you have a YouTube account, you can send videos directly to YouTube (iPhone 3GS or later). See âPublishing Videos to YouTubeâ on page 126. 138 Chapter 13 YouTube APPLE CONFIDENTIAL â First Draft (1.10.11) Stocks 14 Viewing Stock Quotes Stocks lets you see the latest available quotes for your selected stocks, funds, and indexes. Quotes are updated every time you open Stocks when connected to the Internet. Quotes may be delayed by up to 20 minutes or more, depending upon the reporting service. Add a stock, fund, or index to the stock reader: 1 Tap , then tap . 2 Enter a symbol, company name, fund name, or index, then tap Search. 3 Select an item from the search results and tap Done. View charts in landscape orientation: Rotate iPhone sideways. Flick left or right to view the other charts in your stock reader. Show the progress of a stock, fund, or index over time: Tap the stock, fund, or index in your list, then tap 1d, 1w, 1m, 3m, 6m, 1y, or 2y. The chart adjusts to show progress over one day, one week, one month, three months, six months, one year, or two years. When you view a chart in landscape orientation, you can touch the chart to display the XCNWGHQTCURGEK°ERQKPVKPVKOG 139 APPLE CONFIDENTIAL â First Draft (1.10.11) 7UGVYQ°PIGTUVQUGGVJGEJCPIGKPXCNWGQXGTCURGEK°ERGTKQFQHVKOG Delete a stock: Tap and tap Change the order of the list: Tap place in the list. next to a stock, then tap Delete. . Then drag next to a stock or index to a new Switch the view to percentage change, price change, or market capitalization: Tap any of the values along the right side of the screen. Tap again to switch to another view. Or tap and tap %, Price, or Mkt Cap, then tap Done. Getting More Information See the summary, chart, or news page about a stock, fund, or index: Select the stock, HWPFQTKPFGZKP[QWTNKUVVJGPÂąKEMVJGRCIGUWPFGTPGCVJVJGUVQEMTGCFGTVQXKGYVJG summary, chart, or recent news page. On the news page, you can scroll up and down to read headlines, or tap a headline to view the article in Safari. See more information at Yahoo.com: Select the stock, fund, or index in your list, then tap 140 Chapter 14 Stocks APPLE CONFIDENTIAL â First Draft (1.10.11) Maps 15 WARNING: For important information about driving and navigating safely, see the Important Product Information Guide at www.apple.com/support/manuals/iphone. Maps provides street maps, satellite photos, a hybrid view, and street views of NQECVKQPUKPOCP[QHVJGYQTNF¨UEQWPVTKGUCPFTGIKQPU;QWECPIGVVTCĂEKPHQTOCVKQP and detailed driving, public transit, or walking directions. Find and track your current (approximate) location, and use your current location to get driving directions to or from another place. The built-in digital compass lets you see which way youâre facing. (iPhone 3GS or later). Important: Maps, directions, and location-based apps depend on data services. These data services are subject to change and may not be available in all geographic areas, resulting in maps, directions, or location-based information that may be unavailable, inaccurate, or incomplete. Compare the information provided on iPhone to your surroundings, and defer to posted signs to resolve any discrepancies. +HNQECVKQPUGTXKEGUKUVWTPGFQĂYJGP[QWQRGP/CRU[QWOC[DGCUMGFVQVWTPKV on. You can use Maps without turning on location services. See âLocation Servicesâ on page 200. Finding and Viewing Locations You can search for locations, get your current location, mark a location with the drop pin, and get satellite and Google Street Views. Searching for Locations You can search for locations in many waysâby address, intersection, area, landmark, bookmark, contact, or zip code, for example. 141 APPLE CONFIDENTIAL â First Draft (1.10.11) Find a location and see a map: 1 6CRVJGUGCTEJ°GNFVQDTKPIWRVJGMG[DQCTF 2 Type an address or other search information. 3 Tap Search. A pin marks the location. Tap the pin to see the name or description of the location. ;HW[VNL[ PUMVYTH[PVUHIV\[ [OLSVJH[PVUNL[ KPYLJ[PVUZHKK[OL SVJH[PVU[V`V\Y IVVRTHYRZVY JVU[HJ[ZSPZ[VY LTHPSHSPUR[V .VVNSL4HWZ Locations can include places of interest added by Google My Maps users (âUsercreated contentâ), and sponsored links that appear as special icons (for example, ). Zoom in to a part of a map 2KPEJVJGOCRYKVJVYQ°PIGTU1TFQWDNGVCR the part you want to zoom in on. Double-tap again to zoom in even closer. Zoom out 2KPEJVJGOCR1TVCRVJGOCRYKVJVYQ°PIGTU 6CRYKVJVYQ°PIGTUCICKPVQ\QQOQWVHWTVJGT Pan or scroll to another part of the map Drag up, down, left, or right. See the location of a contactâs address: Tap and choose a contact. KPVJGUGCTEJ°GNFVJGPVCR%QPVCEVU To locate an address in this way, the contact must include at least one address. If the contact has more than one address, choose the one you want to locate. You can also °PFVJGNQECVKQPQHCPCFFTGUUD[VCRRKPIVJGCFFTGUUFKTGEVN[KP%QPVCEVU Finding Your Current Location #SWKEMVCR°PFU[QWTEWTTGPV CRRTQZKOCVG NQECVKQP 142 Chapter 15 Maps APPLE CONFIDENTIAL â First Draft (1.10.11) Find your current location and turn tracking mode on: Tap Your current location is indicated by a blue marker. If your location canât be determined precisely, a blue circle also appears around the marker. The size of the circle depends on how precisely your location can be determinedâthe smaller the circle, the greater the precision. As you move around, iPhone updates your location, adjusting the map so that the location indicator remains in the center of the screen. If you tap again until it is no longer highlighted, or if you drag the map, iPhone continues to update your location DWVUVQRUEGPVGTKPIKVUQVJGNQECVKQPKPHQTOCVKQPOC[OQXGQĂVJGUETGGP iPhone uses location services to determine your location. Location services uses available information from cellular network data, local Wi-Fi networks (if you have WiFi turned on), and GPS (may not be available in all locations). When an app is using location services, appears in the status bar. Location services may not be available in all countries or regions. +HNQECVKQPUGTXKEGUKUVWTPGFQĂ[QW¨NNDGRTQORVGFVQVWTPKVQP;QWECP¨V°PFCPF VTCEM[QWTEWTTGPVNQECVKQPKHNQECVKQPUGTXKEGUKUVWTPGFQĂ5GGÂĽLocation Servicesâ on page 200. 6QEQPUGTXGDCVVGT[NKHGVWTPNQECVKQPUGTXKEGUQĂYJGP[QW¨TGPQVWUKPIKV+P5GVVKPIU choose General > Location Services. Get information about your current location: Tap the blue marker, then tap . iPhone displays the address of your current location, if available. You can use this information to:  Get directions  Add the location to contacts  Send the address via email or MMS Chapter 15 Maps 143 APPLE CONFIDENTIAL â First Draft (1.10.11)  Bookmark the location Show which way youâre facing (iPhone 3GS or later): Tap again. (The icon changes to .) Maps uses the built-in compass to determine which way youâre facing. The angle shows the accuracy of the compass readingâthe smaller the angle, the greater the accuracy. Maps uses true north to determine your heading, even if you have magnetic north set in Compass. If the compass needs calibrating, iPhone asks you to wave the phone KPC°IWTGGKIJV+HVJGTG¨UKPVGTHGTGPEG[QWOC[DGCUMGFVQOQXGHTQOVJGUQWTEGQH interference. See Chapter 20, âCompass,â on page 161. Marking a Location with the Drop Pin The drop pin lets you mark a location by hand. Mark a location: Touch and hold the location on the map. The drop pin appears where youâre touching the map. Move the drop pin: Touch and hold, then drag the pin to a new location, or touch and hold a new location until a new pin drops, replacing the previous one. 144 Chapter 15 Maps APPLE CONFIDENTIAL â First Draft (1.10.11) Satellite View and Street View You can see a satellite view of a map, or a combined satellite and street map view. You can also see a Google Street View of a location. See a satellite view or hybrid view: Tap , then tap Satellite or Hybrid to see just a satellite view or a combined street map and satellite view. To return to map view, tap Map. Chapter 15 Maps 145 APPLE CONFIDENTIAL â First Draft (1.10.11) See the Google Street View of a location: Tap . Flick left or right to pan through the 360° panoramic view. (The inset shows your current view.) Tap an arrow to move down the street. To return to map view, tap the map inset in the lower-right corner. ;HW[VYL[\YU[VTHW]PL^ Street View may not be available in all areas. Getting Directions You can get step-by-step directions for driving, taking public transit, or walking to a destination. Get directions: 1 Tap Directions. 2 'PVGTUVCTVKPICPFGPFKPINQECVKQPUKPVJG5VCTVCPF'PF°GNFU$[FGHCWNVK2JQPGUVCTVU with your current approximate location (if available). Tap KPGKVJGT°GNFVQEJQQUG a location in Bookmarks (including your current location and the dropped pin, if available), Recents, or Contacts. If KUP¨VUJQYKPIFGNGVGVJGEQPVGPVUQHVJG°GNF For example, if a friendâs address is in your contacts list, you can tap Contacts and tap your friendâs name instead of having to type the address. To reverse the directions, tap 3 Tap Route (if you entered locations manually), then select directions by car ( ), directions by public transit ( ), or directions by walking ( ). The travel options available depend on the route. 4 Do one of the following: 146 Chapter 15 Maps APPLE CONFIDENTIAL â First Draft (1.10.11)  To view all the directions in a list, tap , then tap List. Tap any item in the list to see a map showing that leg of the trip. Tap Route Overview to return to the overview screen.  To view directions one step at a time, tap Start, then tap trip. Tap to see the next leg of the to go back. If youâre driving or walking, the approximate distance and travel time appear at the top QHVJGUETGGP+HVTCĂEFCVCKUCXCKNCDNGVJGFTKXKPIVKOGKUCFLWUVGFCEEQTFKPIN[ If youâre taking public transit, the overview screen shows each leg of the trip and the mode of transportation, including where you need to walk. The top of the screen UJQYUVJGVKOGQHVJGDWUQTVTCKPCVVJG°TUVUVQRVJGGUVKOCVGFCTTKXCNVKOGCPFVJG total fare. Tap to set your departure or arrival time, and to choose a schedule for the trip. Tap the icon at a stop to see the departure time for that bus or train, and to get a link to the transit providerâs website or contact info. When you tap Start and step through the route, detailed information about each leg of the trip appears at the top of the screen. ;QWECPCNUQIGVFKTGEVKQPUD[°PFKPICNQECVKQPQPVJGOCRVCRRKPIVJGRKPVJCV points to it, tapping , then tapping Directions To Here or Directions From Here. Switch start and end points, for reverse directions: Tap If you donât see , tap Edit. See recently viewed directions: Tap KPVJGUGCTEJ°GNFVJGPVCR4GEGPVU 5JQYKPI6TCĂE%QPFKVKQPU 9JGPCXCKNCDNG[QWECPUJQYVTCĂEEQPFKVKQPUHQTOCLQTUVTGGVUCPFJKIJYC[UQPVJG map. 5JQYQTJKFGVTCĂEEQPFKVKQPUTap Chapter 15 Maps VJGPVCR5JQY6TCĂEQT*KFG6TCĂE 147 APPLE CONFIDENTIAL â First Draft (1.10.11) 5VTGGVUCPFJKIJYC[UCTGEQNQTEQFGFVQKPFKECVGVJGÂąQYQHVTCĂE .YH`$UVKH[H J\YYLU[S`H]HPSHISL .YLLU$WVZ[LK ZWLLKSPTP[ @LSSV^$ZSV^LY [OHU[OLWVZ[LK ZWLLKSPTP[ 9LK$Z[VWHUKNV +H[QWFQP¨VUGGVTCĂE[QWOC[PGGFVQ\QQOQWVVQCNGXGNYJGTG[QWECPUGGOCLQT TQCFU6TCĂEEQPFKVKQPUCTGPQVCXCKNCDNGKPCNNCTGCU Finding and Contacting Businesses Find businesses in an area: 1 Find a locationâfor example, a city and state or country, or a street addressâor scroll to a location on a map. 2 6[RGVJGMKPFQHDWUKPGUUKPVJGVGZV°GNFCPFVCR5GCTEJ Pins appear for matching locations in the area. For example, if you locate your city and then type âmoviesâ and tap Search, pins mark movie theaters in your city. Tap the pin that marks a business to see its name or description. (KPFDWUKPGUUGUYKVJQWV°PFKPIVJGNQECVKQP°TUVType things like:  restaurants san francisco ca  apple inc new york Contact a business or get directions: Tap the pin that marks a business, then tap next to the name. From there, you can do the following:  Tap a phone number to call, an email address to send email to, or a web address to visit.  For directions, tap Directions To Here or Directions From Here.  To add the business to your contacts list, tap âAdd to Contactsâ at the bottom of the screen, then tap âCreate New Contactâ or âAdd to Existing Contact.â  Share the location of the business by email or text message. 148 Chapter 15 Maps APPLE CONFIDENTIAL â First Draft (1.10.11) See a list of the businesses found in the search: From the Map screen, tap List. Tap a business to see its location. Or tap next to a business to see its information. *HSS =PZP[ ^LIZP[L .L[ KPYLJ[PVUZ ;HW[VZOV^ JVU[HJ[PUMV Sharing Location Information You can add a location youâve found to your contacts list. You can also send links to a Google Maps location using email or MMS. Add a location to your contacts list: Find a location, tap the pin that points to it, tap next to the name or description, then tap âAdd to Contactsâ at the bottom of the screen and tap âCreate New Contactâ or âAdd to Existing Contact.â Email a link to a Google Maps location: Find a location, tap the pin that points to it, tap next to the name or description, then tap Share Location at the bottom of the screen and tap Email. Send a link via MMS to a Google Maps location: Find a location, tap the pin that points to it, tap next to the name or description, then tap Share Location at the bottom of the screen and tap MMS. Bookmarking Locations ;QWECPDQQMOCTMNQECVKQPUVJCV[QWYCPVVQ°PFCICKPNCVGT Bookmark a location: Find a location, tap the pin that points to it, tap next to the name or description, then tap âAdd to Bookmarksâ at the bottom of the Info screen. See a bookmarked location or recently viewed location: Tap then tap Bookmarks or Recents. Chapter 15 Maps KPVJGUGCTEJ°GNF 149 APPLE CONFIDENTIAL â First Draft (1.10.11) 16 Weather Viewing Weather Summaries Tap Weather on the Home screen to get the current temperature and six-day forecast for one or more cities around the world. ;VKH`ÂťZOPNOHUKSV^ *\YYLU[JVUKP[PVUZ *\YYLU[[LTWLYH[\YL :P_KH`MVYLJHZ[ (KKHUKKLSL[LJP[PLZ 5\TILYVMJP[PLZZ[VYLK If the weather board is light blue, itâs daytime in that cityâbetween 6:00 a.m. and 6:00 p.m. If the board is dark purple, itâs nighttimeâbetween 6:00 p.m. and 6:00 a.m. Add a city: 1 Tap , then tap . 2 Enter a city name or zip code, then tap Search. 3 Choose a city in the search list. Switch to another city: Flick left or right, or tap to the left or right of the row of dots. The number of dots below the weather board shows how many cities are stored. Reorder cities: Tap 150 , then drag next to a city to a new place in the list. APPLE CONFIDENTIAL â First Draft (1.10.11) Delete a city: Tap and tap next to a city, then tap Delete. Display the temperature in Fahrenheit or Celsius: Tap , then tap °F or °C. Getting More Weather Information You can see a more detailed weather report, news and websites related to the city, and more. See information about a city at Yahoo.com: Tap Chapter 16 Weather 151 APPLE CONFIDENTIAL â First Draft (1.10.11) Notes 17 About Notes You can create notes on iPhone and sync notes with supported applications on your computer and online accounts. You can search for text in a list of notes. Syncing Notes You can sync Notes in either of the following ways:  In iTunes, use the iPhone settings panes to sync with Mail on a Mac or with Microsoft Outlook 2003, 2007, or 2010 on a PC when you connect iPhone to your computer. See âiPhone Settings Panes in iTunesâ on page 58.  In Settings, turn on Notes in MobileMe, Google, Yahoo!, AOL, or other IMAP account to sync your notes over the air (iPhone 3GS or later) with those accounts. See âAdding Mail, Contacts, and Calendar Accountsâ on page 25. Writing and Reading Notes When you sync Notes with an application on your computer or with online accounts, the Accounts screen shows each those accounts, plus a button to display all notes in a single list. See all notes: Tap All Notes. 152 APPLE CONFIDENTIAL â First Draft (1.10.11) 5GGPQVGUHQTCURGEK°ECEEQWPVTap the account name. Change the font used to display notes: In Settings, choose Notes, then select the font you want to use. 0QVGUCTGNKUVGFD[NCUVOQFK°GFFCVGYKVJVJGOQUVTGEGPVN[OQFK°GFPQVGCVVJGVQR ;QWECPUGGVJG°TUVHGYYQTFUQHGCEJPQVGKPVJGNKUV4QVCVGK2JQPGVQXKGYPQVGUKP landscape orientation and type using a larger keyboard. Add a note: Tap , then type your note and tap Done. 0GYPQVGUCTGCFFGFVQVJGFGHCWNVCEEQWPVURGEK°GFKP0QVGUUGVVKPIU5GGÂĽNotesâ on page 218. Read a note: Tap the note. Tap or to see the next or previous note. Edit a note: Tap anywhere on the note to bring up the keyboard. Delete a note: Tap the note, then tap . Chapter 17 Notes 153 APPLE CONFIDENTIAL â First Draft (1.10.11) Searching Notes You can search the text of notes. Search for notes: 1 6CRVJGUVCVWUDCTVQUETQNNVQVJGUGCTEJ°GNFCVVJGVQRQHVJGPQVGNKUV 2 'PVGTVGZVKPVJGUGCTEJ°GNF Search results appear as you type. Tap Search to dismiss the keyboard and see more of the results. Notes are included in searches from the Home screen. See âSearchingâ on page 47. Emailing Notes Email a note: Tap the note, then tap . To email a note, iPhone must be set up for email. See âSetting Up Email Accountsâ on page 79. 154 Chapter 17 Notes APPLE CONFIDENTIAL â First Draft (1.10.11) 18 Clock World Clocks You can add clocks to show the time in other major cities and time zones around the world. View clocks: Tap World Clock. If the clock face is white, itâs daytime in that city. If the clock face is black, itâs nighttime. +H[QWJCXGOQTGVJCPHQWTENQEMUÂąKEMVQUETQNNVJTQWIJVJGO Add a clock: 1 Tap World Clock. 2 Tap , then type the name of a city. Cities matching what youâve typed appear below. 3 Tap a city to add a clock for that city. If you donât see the city youâre looking for, try a major city in the same time zone. Delete a clock: Tap World Clock and tap Edit. Then tap Delete. next to a clock and tap Rearrange clocks: Tap World Clock and tap Edit. Then drag place in the list. next to a clock to a new Alarms You can set multiple alarms. Set each alarm to repeat on days you specify, or to sound only once. Set an alarm: 1 Tap Alarm and tap . 2 Adjust any of the following settings: 155 APPLE CONFIDENTIAL â First Draft (1.10.11)  To set the alarm to repeat on certain days, tap Repeat and choose the days.  6QEJQQUGVJGTKPIVQPGVJCVUQWPFUYJGPVJGCNCTOIQGUQĂtap Sound.  To set whether the alarm gives you the option to hit snooze, VWTP5PQQ\GQPQTQĂ+H Snooze is on and you tap Snooze when the alarm sounds, the alarm stops and then sounds again in ten minutes.  To give the alarm a description, tap Label. iPhone displays the label when the alarm sounds. If at least one alarm is set and turned on, of the screen. appears in the iPhone status bar at the top Important: Some carriers donât support network time in all locations. If youâre traveling, iPhone alerts may not sound at the correct local time. See âDate and Timeâ on page 204. 6WTPCPCNCTOQPQTQĂ6CR#NCTOCPFVWTPCP[CNCTOQPQTQĂ+HCPCNCTOKUVWTPGF QĂKVYQP¨VUQWPFCICKPWPNGUU[QWVWTPKVDCEMQP +HCPCNCTOKUUGVVQUQWPFQPN[QPEGKVVWTPUQĂCWVQOCVKECNN[CHVGTKVUQWPFU;QWECP turn it on again to reenable it. Change settings for an alarm: Tap Alarm and tap Edit, then tap you want to change. Delete an alarm: Tap Alarm and tap Edit, then tap Delete. next to the alarm next to the alarm and tap Stopwatch Use the stopwatch to time an event: 1 Tap Stopwatch. 2 Tap Start to start the stopwatch.  To record lap times, tap Lap after each lap.  To pause the stopwatch, tap Stop. Tap Start to resume.  To reset the stopwatch, tap Reset when the stopwatch is paused. If you start the stopwatch and switch to another app, the stopwatch keeps running. Timer Set the timer: 6CR6KOGTVJGPÂąKEMVQUGVVJGPWODGTQHJQWTUCPFOKPWVGU6CR5VCTV to start the timer. Choose the sound: Tap When Timer Ends. Set a sleep timer: Set the timer, then tap When Timer Ends and choose Sleep iPod. When you set a sleep timer, iPhone stops playing music or video when the timer ends. 156 Chapter 18 Clock APPLE CONFIDENTIAL â First Draft (1.10.11) If you start the timer and then switch to another iPhone app, the timer keeps running. Chapter 18 Clock 157 APPLE CONFIDENTIAL â First Draft (1.10.11) Calculator 19 Using the Calculator Tap numbers and functions in Calculator just as you would with a standard calculator. When you tap the add, subtract, multiply, or divide button, a white ring appears around the button to let you know the operation to be carried out. Rotate iPhone to IGVCPGZRCPFGFUEKGPVK°EECNEWNCVQT Standard Memory Functions  C: Tap to clear the displayed number.  MC: Tap to clear the memory.  M+: Tap to add the displayed number to the number in memory. If no number is in memory, tap to store the displayed number in memory.  Mâ: Tap to subtract the displayed number from the number in memory.  MR: Tap to replace the displayed number with the number in memory. If the button has a white ring around it, there is a number stored in memory. The stored number remains in memory when you switch between the standard and UEKGPVK°EECNEWNCVQTU 158 APPLE CONFIDENTIAL â First Draft (1.10.11) 5EKGPVK°E%CNEWNCVQT-G[U 4QVCVGK2JQPGVQNCPFUECRGQTKGPVCVKQPVQFKURNC[VJGUEKGPVK°EECNEWNCVQT 2nd Changes the trigonometric buttons (sin, cos, tan, sinh, cosh, and tanh) to their inverse functions (sin-1, cos-1, tan-1, sinh-1, cosh-1, and tanh-1). It also changes ln to log2, and ex to 2x. Tap 2nd again to return the buttons to their original functions. Opens a parenthetical expression. Expressions can be nested. Closes a parenthetical expression. Calculates percentages, adds markups, and subtracts discounts. To calculate a percentage, use it with the multiplication (x) key. For example, to calculate 8% of 500, enter 500 x 8 % = which returns 40. To add a markup or subtract a discount, use it with the plus (+) or minus (â) key. For example, to compute the total cost of a $500 item with an 8% sales tax, enter 500 + 8 % = which returns 540. 1/x Returns the reciprocal of a value in decimal format. x2 Squares a value. x3 Cubes a value. 6CRDGVYGGPXCNWGUVQTCKUGVJG°TUVXCNWGVQVJGRQYGTQHVJGUGEQPFXCNWG(QT example, to compute 34, enter 3 yx 4 = which returns 81. x! Calculates the factorial of a value. Calculates the square root of a value. Use between values to calculate the x root of y. For example to compute 4381, enter 81 x3y 4 = which returns 3. 3y Chapter 19 Calculator 159 APPLE CONFIDENTIAL â First Draft (1.10.11) log Returns the log base 10 of a value. sin Calculates the sine of a value. sin-1 Calculates the arc sine of a value. (Available when the 2nd button is tapped.) cos Calculates the cosine of a value. cos Calculates the arc cosine of a value. (Available when the 2nd button is tapped.) tan Calculates the tangent of a value. tan-1 Calculates the arc tangent of a value. (Available when the 2nd button is tapped.) ln Calculates the natural log of a value. log2 Calculates the log base 2. (Available when the 2nd button is tapped.) sinh Calculates the hyperbolic sine of a value. sinh Calculates the inverse hyperbolic sine of a value. (Available when the 2nd button is tapped.) -1 -1 cosh Calculates the hyperbolic cosine of a value. cosh Calculates the inverse hyperbolic cosine of a value. (Available when the 2nd button is tapped.) -1 tanh Calculates the hyperbolic tangent of a value. tanh Calculates the inverse hyperbolic tangent of a value. (Available when the 2nd button is tapped.) ex Tap after entering a value to raise the constant âeâ (2.718281828459045âŚ) to the power of that value. 2x Calculates 2 to the power of the displayed value. For example, 10 2x = 1024. (Available when the 2nd button is tapped.) Rad Changes the mode to express trigonometric functions in radians. Deg Changes the mode to express trigonometric functions in degrees.  Enters the value of  (3.141592653589793âŚ). EE An operator that multiplies the currently displayed value by 10 to the power of the next value you enter. Rand Returns a random number between 0 and 1. -1 160 Chapter 19 Calculator APPLE CONFIDENTIAL â First Draft (1.10.11) Compass 20 Getting Compass Readings The built-in compass (iPhone 3GS or later) shows which direction youâre facing, along with the geographical coordinates of your current location. You can choose magnetic north, or have Compass adjust the declination to show true north. Important: 6JGCEEWTCE[QHVJGFKIKVCNEQORCUUOC[DGPGICVKXGN[CĂGEVGFD[ magnetic or other environmental interference, including interference caused by the close proximity of the magnets contained in the iPhone earbuds. The digital compass should only be used for basic navigation assistance and should not be solely relied on to determine precise locations, proximity, distance, or direction. 6JGEQORCUUPGGFUVQDGECNKDTCVGFVJG°TUVVKOG[QWWUGKVCPFOC[PGGFVQDG calibrated occasionally after that. iPhone alerts you whenever calibration is needed. Note: +HNQECVKQPUGTXKEGUKUVWTPGFQĂYJGP[QWQRGP%QORCUU[QWOC[DGCUMGFVQ turn it on. You can use Compass without turning on location services. See âLocation Servicesâ on page 200. 161 APPLE CONFIDENTIAL â First Draft (1.10.11) Calibrate iPhone: 9CXGK2JQPGKPC°IWTGGKIJV;QWOC[DGCUMGFVQOQXGCYC[ from a source of interference. See the direction youâre facing: Hold iPhone level to the ground. The compass needle rotates to point north. Your current direction appears at the top of the screen. The coordinates of your current location are displayed at the bottom of the screen. Switch between true north and magnetic north: Tap want. and tap the setting you Compass and Maps 6JG%QORCUUCRRNGVU[QW°PF[QWTEWTTGPVNQECVKQPKP/CRU/CRUCNUQWUGUVJGDWKNV in compass to show the direction youâre facing. See your current location in Maps: Tap at the bottom of the Compass screen. Maps opens and indicates your current location with a blue marker. 162 Chapter 20 Compass APPLE CONFIDENTIAL â First Draft (1.10.11) Show the direction youâre facing: In Maps, tap twice. The icon changes to . The angle shows the accuracy of the compass readingâthe smaller the angle, the greater the accuracy. See âFinding and Viewing Locationsâ on page 141. Chapter 20 Compass 163 APPLE CONFIDENTIAL â First Draft (1.10.11) 21 Voice Memos Recording Voice Memos Voice Memos lets you use iPhone as a portable recording device using the built-in microphone, iPhone or Bluetooth headset mic, or supported external microphone. Note: External microphones must be designed to work with the iPhone headset jack or Dock Connector. These include Apple-branded earbuds and authorized third-party accessories marked with the Apple âMade for iPhoneâ or âWorks with iPhoneâ logo. You can adjust the recording level by moving the microphone closer to or further away from what youâre recording. For better recording quality, the loudest level on the level meter should be between â3dB and 0 dB. (\KPVSL]LSTL[LY .V[V]VPJLTLTVZ 9LJVYKI\[[VU 164 APPLE CONFIDENTIAL â First Draft (1.10.11) Record a voice memo: 1 Tap to start recording. You can also press the center button on the iPhone earphones. 2 Tap to pause or to stop recording. You can also press the center button on the iPhone earphones. Recordings using the built-in microphone are mono, but you can record stereo using an external stereo microphone. When you start a voice recording, iPhone makes a short ringing sound. The sound isnât played if youâve set the Ring/Silent switch to silent. See âSounds and the Ring/Silent Switchâ on page 196. Note: +PUQOGEQWPVTKGUQTTGIKQPUVJGUQWPFGĂGEVUHQT8QKEG/GOQUCTGRNC[GFGXGP if the Ring/Silent switch is set to silent. To use other apps while recording your voice memo, you can lock iPhone or press the Home button. Play a voice memo you just recorded: Tap . Listening to Voice Memos 7SH`OLHK :JY\IILYIHY Play a voice memo youâve previously recorded: 1 Tap . /GOQUCTGNKUVGFKPEJTQPQNQIKECNQTFGTYKVJVJGOQUVTGEGPVOGOQ°TUV 2 Tap a memo, then tap . Tap to pause, then tap again to resume playback. Skip to any point in a voice memo: Drag the playhead along the scrubber bar. Listen through the built-in speaker: Tap Speaker. Chapter 21 Voice Memos 165 APPLE CONFIDENTIAL â First Draft (1.10.11) Managing Voice Memos Delete a voice memo: Tap a memo in the list, then tap Delete. See more information: Tap next to the memo. The Info screen displays information about the length, recording time and date, and provides additional editing and sharing functions. Add a label to a voice memo: On the Info screen tap , then select a label in the list on the Label screen. To create a custom label, choose Custom at the bottom of the list, then type a name for the label. Trimming Voice Memos You can trim the beginning or ending of a voice memo to eliminate unwanted pauses or noise. Trim a voice memo: 1 On the Voice Memos screen, tap 2 Tap Trim Memo. 166 Chapter 21 Voice Memos next to the memo you want to trim. APPLE CONFIDENTIAL â First Draft (1.10.11) 3 Using the time markers as a guide, drag the edges of the audio region to adjust the beginning and end of the voice memo. To preview your edit, tap . 4 Tap Trim Voice Memo. Important: Edits you make to voice memos canât be undone. Sharing Voice Memos You can share your voice memos as attachments in email or MMS messages. Share a voice memo: 1 Select a voice memo on the Voice Memos screen, then tap Share. You can also tap Share on the Info screen of a voice memo. 2 Choose Email to open a new message in Mail with the memo attached, or choose MMS to open a new message in Messages. #OGUUCIGCRRGCTUKHVJG°NG[QW¨TGVT[KPIVQUGPFKUVQQNCTIG Syncing Voice Memos iTunes syncs voice memos to your iTunes library when you connect iPhone to your computer. This lets you listen to voice memos on your computer and provides a backup if you delete them from iPhone. Voice memos are synced to the Voice Memos playlist. iTunes creates the playlist if it doesnât exist. When you sync voice memos to iTunes, they remain in the Voice Memos app until you delete them. If you delete a voice memo on iPhone, it isnât deleted from the Voice Memos playlist in iTunes. However, if you delete a voice memo from iTunes, it is deleted from iPhone the next time you sync with iTunes. You can sync the iTunes Voice Memos playlist to the iPod app on iPhone using the Music pane in iTunes. Chapter 21 Voice Memos 167 APPLE CONFIDENTIAL â First Draft (1.10.11) Sync the Voice Memos playlist to iPhone: 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the Devices list. 3 Select Music at the top of the screen. 4 Select the âInclude voice memosâ checkbox and click Apply. 168 Chapter 21 Voice Memos APPLE CONFIDENTIAL â First Draft (1.10.11) iTunes Store 22 About the iTunes Store You can search for, browse, preview, purchase, and download music, ringtones, audiobooks, TV shows, movies, and music videos from the iTunes Store directly to iPhone. You can listen to audio or watch video podcasts from the iTunes Store, either by streaming them from the Internet or by downloading them directly to iPhone. And, [QWECPHQNNQY[QWTHCXQTKVGCTVKUVUCPFHTKGPFUVQ°PFQWVYJCVOWUKEVJG[¨TGNKUVGPKPI VQCPFVCNMKPICDQWV°PFQWVYJGP[QWTHCXQTKVGCTVKUVUCTGQPVQWTPGCT[QWCPF whoâs planning to go, and more. Note: The iTunes Store may not be available in all countries or regions, and iTunes Store content may vary by country or region. To access the iTunes Store, iPhone must be connected to the Internet. See âConnecting to the Internetâ on page 22. To purchase items or write reviews, you need an Apple ID. By default, iPhone gets your Apple ID information from iTunes. If you donât have an Apple ID, or if you want to make purchases using another Apple ID, go to Settings > Store. See âStoreâ on page 218. You donât need an Apple ID to play or download podcasts. 169 APPLE CONFIDENTIAL â First Draft (1.10.11) Finding Music, Videos, and More Browse content: Tap one of the content categories at the bottom of the screen, such as Music or Videos. Or tap More to browse other content. Choose a sort method at the top of the screenâfor example New Releases or Genres (the categories may vary). Search for content: 6CR5GCTEJ VCR/QTG°TUVKH5GCTEJKUP¨VXKUKDNG VCRVJGUGCTEJ °GNFCPFGPVGTQPGQTOQTGYQTFUVJGPVCR5GCTEJ5GCTEJTGUWNVUCTGITQWRGFD[ category, such as Movies, Albums, or Podcasts. Tap an item in a list to see more details on its Info screen. You can read reviews, write your own review, or email a link about the item to a friend. Depending on the item, you can also buy, download, or rent it. Note: If you join a Starbucks Wi-Fi network in a select Starbucks location (available in the U.S. only), the Starbucks icon appears at the bottom of the screen. You can preview and purchase the currently playing and other songs from featured Starbucks Collections. 170 Chapter 22 iTunes Store APPLE CONFIDENTIAL â First Draft (1.10.11) Explore artist and friend recommendations: 6CR2KPI VCR/QTG°TUVKH2KPIKUP¨V XKUKDNG VQ°PFQWVYJCV¨UPGYHTQO[QWTHCXQTKVGCTVKUVUQTUGGYJCVOWUKE[QWTHTKGPFU are excited about. For information, see the following section, âFollowing Artists and Friends.â Following Artists and Friends Use iTunes Ping to connect with the worldâs most passionate music fans. Follow favorite artists to learn about new releases and upcoming concerts and tours, get an insiderâs perspective through their photos and videos, and learn about their musical KPÂąWGPEGU4GCFHTKGPFU¨EQOOGPVUCDQWVVJGOWUKEVJG[¨TGNKUVGPKPIVQCPFUGGYJCV theyâre buying and which concerts they plan to attend. Finally, express your musical likes and post comments for your own followers. 6QETGCVGCPFGZRNQTGOWUKECNEQPPGEVKQPU[QWPGGFVQETGCVGCRTQ°NG %TGCVG[QWTK6WPGU2KPIRTQ°NGOpen the iTunes application on your Mac or PC, click Ping, and follow the onscreen instructions. Explore iTunes Ping on iPhone: 1RGPVJGK6WPGUCRRVCR2KPI VCR/QTG°TUVKH2KPI isnât visible), then:  Tap Activity to see the latest from and about the people you follow. Updates include purchases, reviews, likes, comments, and posts.  Tap People to see who youâre following and whoâs following you, or to search for artists or friends.  6CR/[2TQ°NGVQTGXKGY[QWTRTQ°NGKPHQTOCVKQP Follow an artist: 6CR(QNNQYQPVJGKTRTQ°NGRCIG  By searching: 6CR2GQRNGGPVGTVJGCTVKUV¨UPCOGKPVJGUGCTEJ°GNFCVVJGVQRQHVJG page, then tap Search. Tap the artist in the list of results, then tap Follow.  While browsing: 6CR2TQ°NGCVVJGDQVVQOQHCP[CNDWORCIGVJGPVCR(QNNQY Chapter 22 iTunes Store 171 APPLE CONFIDENTIAL â First Draft (1.10.11) Follow a friend: %JQQUGCUVCTVKPIITQWRQHHTKGPFUYJGP[QWUGVWR[QWTRTQ°NGWUKPI iTunes on your Mac or PC. After that, you can choose to follow others using Ping on iPhone.  By searching: 6CR2GQRNGGPVGT[QWTHTKGPF¨UPCOGKPVJGUGCTEJ°GNFVJGPVCR Search. Tap your friendâs name in the list of matches, then tap Follow.  While exploring Ping: Tap a personâs name, then tap Follow. 9JGP[QWHQNNQYUQOGQPGVJG[FQP¨VCWVQOCVKECNN[HQNNQY[QW+P[QWTRTQ°NG[QWECP choose to approve or decline requests to be followed as they arrive, or simply accept all new followers without review (the default). Share your thoughts: As you browse albums and songs, tap Post to comment on a piece of music or tap Like just to say you like it. Your friends will see your thoughts in their iTunes Ping Activity feed. Share concert plans: 6CR%QPEGTVUQP[QWTRTQ°NGRCIGVQUGGWREQOKPIEQPEGTVUD[ the artists you follow, and see which of your friends are going to a concert. Tap Tickets to buy your own ticket, or tap Iâm Going to let others know youâll be there too. (Not available in all countries or regions.) Purchasing Ringtones You can preview and purchase ringtones from the iTunes Store and download them to iPhone. Note: Ringtones may not be available in all countries or regions. Browse for ringtones: 6CR4KPIVQPGU VCR/QTG°TUVKH4KPIVQPGUKUP¨VXKUKDNG QTWUG 5GCTEJVQ°PFCURGEK°EUQPIKPVJGK6WPGU5VQTG Preview a ringtone: Tap the item to preview. Double-tap the item for more information. 172 Chapter 22 iTunes Store APPLE CONFIDENTIAL â First Draft (1.10.11) Purchase and download a ringtone: 1 Tap the price, then tap Buy Now. 2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1- When you purchase a ringtone, you can set it as your default ringtone, or assign it to a contact. If you donât have an Apple ID, tap Create New Apple ID to set one up. Your purchase is charged to your Apple ID. For additional purchases made within the PGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP You can change your default ringtone or assign individual ringtones to contacts in Settings > Sounds. See âSounds and the Ring/Silent Switchâ on page 196. Ringtones you purchase on iPhone are synced to your iTunes library when you connect iPhone to your computer. You can sync purchased ringtones to more than one iPhone, if theyâre all synced using the Apple ID that you used to purchase the ringtones. You canât edit ringtones you purchase from the iTunes Store. You can create custom ringtones in Garage Band. For information, see Garage Band Help. Purchasing Music or Audiobooks 9JGP[QW°PFCUQPICNDWOQTCWFKQDQQM[QWNKMGKPVJGK6WPGU5VQTG[QWECP purchase and download it to iPhone. You can preview an item before you purchase it to make sure itâs what you want. Preview a song or audiobook: Tap the item. Purchase and download a song, album, or audiobook: 1 Tap the price, then tap Buy Now. 2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1- If you donât have an Apple ID, tap Create New Apple ID to set one up. Your purchase is charged to your Apple ID. For additional purchases made within the PGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP An alert appears if youâve previously purchased one or more songs from an album. Tap Buy if you want to purchase the entire album including the songs youâve already purchased, or tap Cancel if you want to purchase any remaining songs individually. Some albums include bonus content, which is downloaded to your iTunes library on your computer. Not all bonus content is downloaded directly to iPhone. Once you purchase an item, it begins downloading and appears on the Downloads screen. See âChecking Download Statusâ on page 175. Chapter 22 iTunes Store 173 APPLE CONFIDENTIAL â First Draft (1.10.11) Purchased songs are added to a Purchased playlist on iPhone. If you delete the Purchased playlist, iTunes creates a new one when you buy an item from the iTunes Store. ;QWECPTGFGGOK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ make purchases. When youâre signed in, your remaining store credit appears with your Apple ID information at the bottom of most iTunes Store screens. Enter a redemption code: 6CR/WUKE VCR/QTG°TUVKH/WUKEKUP¨VXKUKDNG VJGPVCR Redeem at the bottom of the screen and follow the onscreen instructions. Purchasing or Renting Videos The iTunes Store lets you purchase and download movies, TV shows, and music videos (may not be available in all countries or regions). Some movies and TV shows can also DGTGPVGFHQTCNKOKVGFVKOG8KFGQEQPVGPVOC[DGCXCKNCDNGKPUVCPFCTFFG°PKVKQP 5& QTR HQTOCVJKIJFG°PKVKQP *&QTR HQTOCVQTDQVJ Preview a video: Tap Preview. Purchase or rent a video: 1 Tap Buy or Rent. 2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1- If you donât have an Apple ID, tap Create New Apple ID to set one up. Your purchase KUEJCTIGFVQ[QWT#RRNG+&(QTCFFKVKQPCNRWTEJCUGUOCFGYKVJKPVJGPGZV°HVGGP minutes, you donât have to enter your password again. Once you purchase an item, it begins downloading and appears on the Downloads screen. See âChecking Download Statusâ on page 175. Rented movies and TV shows donât begin playing until the download completes. See âWatching Rented Movies and TV Showsâ on page 106. When the download is complete, purchased videos are added to the Purchased playlist on iPhone. Purchased content is synced to the Purchased playlist for your iPhone in iTunes the next time you connect iPhone to your computer. See âSyncing Purchased Contentâ on page 176. Note: If you purchase HD video on iPhone 3G or iPhone 3GS, the video is downloaded to iPhone in SD format. To view or sync videos in the Purchased playlist in iTunes on your computer, you must be signed in using your Apple ID. Sync purchased videos in iTunes: Connect iPhone to your computer. In iTunes, select iPhone in the Devices list, click the appropriate button (Movies, TV Shows, or Music for music videos), select the items you want to sync, then click Sync. 174 Chapter 22 iTunes Store APPLE CONFIDENTIAL â First Draft (1.10.11) If you purchase a video in HD format, you can choose to sync it in either SD or HD format. You may want to sync an HD video in SD format for a quicker download, or to save room on iPhone. Select SD or HD format: In iTunes, Control-click or right-click a video marked âHD-SDâ CPFEJQQUG5VCPFCTF&G°PKVKQPQT*KIJ&G°PKVKQPHTQOVJG8GTUKQPOGPW ;QWECPTGFGGOK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ make purchases. When youâre signed in, your remaining store credit appears with your Apple ID information at the bottom of most iTunes Store screens. Enter a redemption code: 6CR/WUKE VCR/QTG°TUVKH/WUKEKUP¨VXKUKDNG VJGPVCR Redeem at the bottom of the screen and follow the onscreen instructions. Streaming or Downloading Podcasts You can listen to audio podcasts or watch video podcasts streamed over the Internet from the iTunes Store. You can also download audio and video podcasts to iPhone. Podcasts you download to iPhone are synced to your iTunes library when you connect iPhone to your computer. 6CR2QFECUVU VCR/QTG°TUVKH2QFECUVUKUP¨VXKUKDNG VQDTQYUGRQFECUVUKPVJGK6WPGU Store. To see a list of episodes, tap a podcast. Video podcasts are indicated by the video icon. Stream a podcast: Tap the podcast title. Download a podcast: Tap the Free button, then tap Download. Downloaded podcasts appear in the Podcasts list in iPod. Listen to or watch a podcast youâve downloaded: In iPod, tap Podcasts (tap More °TUVKH2QFECUVUKUP¨VXKUKDNG VJGPVCRVJGRQFECUV8KFGQRQFECUVUCNUQCRRGCTKP[QWT list of videos. Get more episodes of the podcast youâve downloaded: In the Podcasts list in iPod, tap the podcast, then tap Get More Episodes. Delete a podcast: In the Podcasts list in iPod, swipe left or right over the podcast, then tap Delete. Checking Download Status You can check the Downloads screen to see the status of in-progress and scheduled downloads, including purchases youâve pre-ordered. See the status of items being downloaded: 6CR&QYPNQCFU VCR/QTG°TUVKH Downloads isnât visible). To pause a download, tap . Chapter 22 iTunes Store 175 APPLE CONFIDENTIAL â First Draft (1.10.11) If a download is interrupted, iPhone starts the download again the next time it has an Internet connection. Or, if you open iTunes on your computer, iTunes completes the download to your iTunes library (if your computer is connected to the Internet and signed in using the same Apple ID). See the status of pre-ordered items: 6CR&QYPNQCFU VCR/QTG°TUVKH&QYPNQCFUKUP¨V visible). Pre-ordered items appear in a list until the item is released. Tap the item for release date information. Once the item is available for download, appears next to the download. Download a pre-ordered item: Tap the item, then tap Pre-ordered items donât download automatically when theyâre released. Return to the Downloads screen to begin the download. Syncing Purchased Content iTunes automatically syncs everything youâve downloaded or purchased on iPhone to your iTunes library when you connect iPhone to your computer. This lets you access the downloads on your computer and provides a backup if you delete purchased content from iPhone. Purchased content is synced to the âPurchased on â playlist. iTunes creates the playlist if it doesnât exist. iTunes also copies your purchases to the Purchased playlist that iTunes uses for purchases you make on your computer, if that playlist exists and is set to sync with iPhone. Downloaded podcasts are synced to the Podcast list in your iTunes library. Changing the Browse Buttons You can replace the Music, Podcasts, Videos, and Search buttons at the bottom of the screen with ones you use more frequently. For example, if you download audiobooks often but donât watch many videos, you could replace the Videos button with Audiobooks. 176 Chapter 22 iTunes Store APPLE CONFIDENTIAL â First Draft (1.10.11) Change the browse buttons: Tap More, tap Edit, then drag a button to the bottom of the screen, over the button you want to replace. You can drag the buttons at the bottom of the screen left or right to rearrange them. 9JGP[QW°PKUJVCR&QPG When youâre browsing, tap More to access the browse buttons that arenât visible. Viewing Account Information To view iTunes Store information for your Apple ID on iPhone, tap your Apple ID (at the bottom of most iTunes Store screens). Or go to Settings > Store and tap View Apple ID. You must be signed in to view your account information. See âStoreâ on page 218. Verifying Downloads You can use iTunes on your computer to verify that all the music, videos, apps, and other items you bought from the iTunes Store or App Store are in your iTunes library. You might want to do this if a download was interrupted. Verify your purchases: 1 Make sure your computer is connected to the Internet. 2 In iTunes, choose Store > Check for Available Downloads. 3 Enter your Apple ID and password, then click Check. Purchases not yet on your computer are downloaded. The Purchased playlist displays your purchases. However, because you can add or remove items in this list, it might not be accurate. To see all of your purchases, sign in using your Apple ID, choose Store > View My Account, and click Purchase History. Chapter 22 iTunes Store 177 APPLE CONFIDENTIAL â First Draft (1.10.11) App Store 23 About the App Store You can search for, browse, review, purchase, and download apps from the App Store directly to iPhone. Apps that you download and install from the App Store on iPhone are backed up to your iTunes library the next time you sync iPhone with your computer. When you sync iPhone, you can also install apps youâve purchased or downloaded from the iTunes Store on your computer. Note: The App Store may not be available in all countries or regions, and App Store content may vary by country or region. To browse the App Store, iPhone must be connected to the Internet. See âConnecting to the Internetâ on page 22. To download apps, you also need an Apple ID (may not be available in all countries or regions). By default, iPhone gets your Apple ID settings from iTunes. If you donât have an Apple ID, or if you want to make purchases using another Apple ID, go to Settings > Store. See âStoreâ on page 218. Browsing and Searching Browse the featured selections to see new, notable, or recommended apps, or browse 6QRVQUGGVJGOQUVRQRWNCTCRRU+H[QW¨TGNQQMKPIHQTCURGEK°ECRRWUG5GCTEJ 178 APPLE CONFIDENTIAL â First Draft (1.10.11) Browse apps: Tap Featured, Categories, or Top 25. Choose a category, or choose a sort method at the top of the screen to browse by lists such as New, Whatâs Hot, Genius, Top Paid, or Top Free. Browse using Genius: Tap Genius to see a list of recommended apps based on whatâs already in your app collection. To turn Genius on, follow the onscreen instructions. Genius is a free service, but it requires an Apple ID. Search for apps: 6CR5GCTEJVCRVJGUGCTEJ°GNFCPFGPVGTQPGQTOQTGYQTFUVJGP tap Search. Chapter 23 App Store 179 APPLE CONFIDENTIAL â First Draft (1.10.11) Info Screen Tap any app in a list to see more information, such as the appâs price, screenshots, and ratings. If you already installed the app, âInstalledâ appears instead of the price on the Info screen. View screenshots: Scroll to near the bottom of the Info page. Flick left or right to view additional screenshot pages. Double-tap to zoom in. Get ratings and read reviews: Tap Ratings near the bottom of the Info screen. Email a link to the appâs Info page in iTunes: Tap âTell a Friendâ near the bottom of the Info screen. Report a problem: Tap âReport a Problemâ near the bottom of the Info screen. Select a problem from the list or type optional comments, then tap Report. Send the app to someone as a gift: Tap âGift This Appâ near the bottom of the Info screen, then follow the onscreen instructions. 180 Chapter 23 App Store APPLE CONFIDENTIAL â First Draft (1.10.11) Downloading Apps 9JGP[QW°PFCPCRR[QWYCPVKPVJG#RR5VQTG[QWECPRWTEJCUGCPFFQYPNQCFKV to iPhone. If the app is free, you can download it without charge. Once you download an app, itâs immediately installed on iPhone. Purchase and download an app: 1 Tap the price (or tap Free), then tap Buy Now. 2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1- If you donât have an Apple ID, tap Create New Apple ID to set one up. Downloads for purchase are charged to your Apple ID. For additional downloads made YKVJKPVJGPGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP Some apps allow you to make purchases within the app. You can restrict in-app purchases in Settings. See âRestrictionsâ on page 202. 5QOGCRRUWUGRWUJPQVK°ECVKQPUVQCNGTV[QWQHPGYKPHQTOCVKQPGXGPYJGPVJG CRRKUP¨VTWPPKPI0QVK°ECVKQPUXCT[FGRGPFKPIQPVJGCRRDWVOC[KPENWFGVGZV or sound alerts, and a numbered badge on the app icon on the Home screen. See â0QVK°ECVKQPUâ on page 195. ;QWECPTGFGGOK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ make purchases. When youâre signed in, your remaining store credit appears with your Apple ID information at the bottom of most App Store screens. Enter a redemption code: Tap Redeem near the bottom of the Featured screen, then follow the onscreen instructions. See the status of downloading apps: After you begin downloading an app, its icon appears on the Home screen and shows a progress indicator. If a download is interrupted, iPhone starts the download again the next time it has an Internet connection. Or, if you open iTunes on your computer, iTunes completes the download to your iTunes library (if your computer is connected to the Internet and signed in using the same Apple ID). Deleting Apps You can delete apps you install from the App Store. If you delete an app, data associated with the app is no longer available to iPhone, unless you reinstall the app and restore its data from a backup. Chapter 23 App Store 181 APPLE CONFIDENTIAL â First Draft (1.10.11) You can reinstall an app and restore its data as long as you backed up iPhone with iTunes on your computer. (If you try to delete an app that hasnât been backed up to your computer, an alert appears.) To retrieve the app data, you must restore iPhone from a backup containing the data. See âRestoring from a Backupâ on page 257. Delete an App Store app: 1 Touch and hold any app icon on the Home screen, until the icons start to jiggle. 2 Tap in the corner of the app you want to delete. 3 Tap Delete, then press the Home button. If you donât see on the app icon, either the app wasnât purchased from the App Store or deleting apps has been restricted. See âRestrictionsâ on page 202. When you delete an app, its data is no longer accessible through the iPhone user interface, but it isnât erased from iPhone. For information about erasing all content and settings, see âErase All Content and Settingsâ on page 207. You can redownload any app that youâve purchased from the App Store, free of charge. Replace a deleted app:  On iPhone: Purchase the app again (you wonât be charged).  In iTunes: Connect iPhone to your computer, select iPhone in the Devices list, click Apps and select the checkbox next to the app, then click Apply. Writing Reviews You can write and submit your own app reviews directly on iPhone. Write a review: 1 Tap Ratings near the bottom of the Info screen. 2 On the Reviews screen, tap âWrite a Review.â 3 Select the number of stars (1â5) for your rating of the app, and enter your nickname, a title for the review, and optional review comments. If youâve written reviews before, VJGPKEMPCOG°GNFKUCNTGCF[°NNGFKP1VJGTYKUG[QW¨TGCUMGFVQETGCVGCTGXKGYGT nickname. 4 Tap Send. You must be signed in to your Apple account and have downloaded the item in order to submit reviews. 182 Chapter 23 App Store APPLE CONFIDENTIAL â First Draft (1.10.11) Updating Apps Whenever you access the App Store, it checks for updates to apps youâve installed. The App Store also automatically checks for updates every week. The App Store icon shows the total number of app updates available. If an update is available and you access the App Store, the Updates screen appears immediately. App updates are downloaded and automatically installed when you choose to update them. App upgrades are new releases that can be purchased or downloaded through the App Store on iPhone or the iTunes Store on your computer. Update an app: 1 At the bottom of the screen, tap Updates. 2 Tap an app to see more information about the update. 3 Tap Update. Update all apps: At the bottom of the screen, tap Updates, then tap Update All. +H[QWVT[VQWRFCVGCPCRRRWTEJCUGFHTQOCFKĂGTGPV#RRNGCEEQWPV[QW¨TGCUMGFHQT that account ID and password in order to download the update. Syncing Purchased Apps When you connect iPhone to your computer, iTunes syncs apps you download or purchase on iPhone to your iTunes library. This lets you access the downloads on your computer and provides a backup if you delete apps from iPhone. Downloaded apps are backed up the next time you sync with iTunes. Afterwards, only app data is backed up when you sync with iTunes. Apps are synced to the Apps list in your iTunes library. iTunes creates the list if it doesnât exist. Chapter 23 App Store 183 APPLE CONFIDENTIAL â First Draft (1.10.11) Game Center 24 About Game Center You can discover new games and share your game experiences with friends around the world in Game Center (iPhone 3GS or later). Invite your friends to play, or use CWVQOCVEJVQ°PFQVJGTYQTVJ[QRRQPGPVU%JGEMNGCFGTDQCTFUVQUGGYJQVJGDGUV RNC[GTUCTG'CTPDQPWURQKPVUD[CEJKGXKPIURGEK°ECEEQORNKUJOGPVUKPCICOG Note: Game Center may not be available in all countries or regions, and the available games may vary by country or region. To use Game Center, you need an Internet connection and an Apple ID. If you already have an iTunes Store, MobileMe, or other Apple account, you can use that Apple ID with Game Center. If you donât already have an Apple account, you can create a new one in Game Center, as described below. Setting Up Game Center 9JGP[QW°TUVQRGP)COG%GPVGT[QW¨TGCUMGFKH[QWYCPVVQCNNQYRWUJPQVK°ECVKQPU ;QWOC[°TUVDGCUMGFKH[QWYCPVVQVWTPQP0QVK°ECVKQPU 0QVK°ECVKQPUOC[KPENWFG alerts, sounds, and icon badges that let you know about Game Center events even when youâre not using Game Center. For example, you might receive an alert that a friend has invited you to play a game. #NNQYPQVK°ECVKQPU6CR1- +H[QWVCR&QP¨V#NNQY[QWYQP¨VTGEGKXGPQVK°ECVKQPUHQT)COG%GPVGT;QWECP VWTPPQVK°ECVKQPUQPCVCNCVGTVKOGKH[QWYCPVCPF[QWECPURGEKH[YJCVMKPFUQH PQVK°ECVKQPU[QWYCPVVQIGV 6WTPPQVK°ECVKQPUQPQTQĂ+P5GVVKPIUEJQQUG0QVK°ECVKQPU6WTPKPIQĂ0QVK°ECVKQPU FKUCDNGUCNNPQVK°ECVKQPUHQTCNNCRRU 184 APPLE CONFIDENTIAL â First Draft (1.10.11) 5RGEKH[YJKEJPQVK°ECVKQPU[QWYCPVHQT)COG%GPVGTIn Settings, choose 0QVK°ECVKQPU )COG%GPVGTVJGPEQP°IWTGVJG5QWPFU#NGTVUCPF$CFIGUUGVVKPIU+H )COG%GPVGTFQGUP¨VCRRGCTVWTPQP0QVK°ECVKQPU Set up Game Center information for your Apple ID: 1 Enter your Apple ID and password, then tap Sign In. You may be asked to provide additional information. If you donât have an Apple ID, you can create one by tapping Create New Account. 2 Tap Agree to accept the Game Center Terms & Conditions. 3 Enter a nicknameâthe name others will see and know you by. 4 %QP°IWTG[QWT)COG%GPVGTUGVVKPIU  To allow other users to invite you to play a game, leave Allow Game Invites turned QP1VJGTYKUGVCRVQVWTPKVQĂ Â 6QCNNQYQVJGTWUGTUVQ°PF[QWD[[QWTGOCKNCFFTGUUNGCXG(KPF/G$['OCKN VWTPGFQP1VJGTYKUGVCRVQVWTPKVQĂ Â 8GTKH[[QWTCEEQWPVGOCKN;QWECPGPVGTCFKĂGTGPVCFFTGUUKH[QWFQP¨VYCPVVQ WUGVJGQPGHTQOVJG#RRNGCEEQWPV[QWWUGFVQUKIPKP6QEQP°TOVJKUCFFTGUUCU yours, youâll need to respond to the email that is sent to that address.  To add more email addresses that people can use to contact you in Game Center, tap Add Another Email. 5 6CR0GZVYJGP[QWTCEEQWPVKUEQP°IWTGF Change Game Center settings for your Apple ID: 1 Tap Me at the bottom of the screen, then tap your account banner. 2 Tap View Account. 3 Make your changes, then tap Done. 5KIPKPWUKPICFKĂGTGPV#RRNG+& 1 Tap Me, then tap the account banner at the bottom of the screen. 2 Tap Sign Out. 3 Enter the new Apple ID and password, then tap Sign In. Games Purchasing and Downloading Games Games for Game Center are available from the App Store. If you havenât entered credit card information for your Apple ID, youâre prompted to enter that information before you can purchase and download games. Purchase and download games: Tap Games, then tap Find Game Center Games. Chapter 24 Game Center 185 APPLE CONFIDENTIAL â First Draft (1.10.11) The Game Center section of App Store displays games that work with Game Center. You can browse this section, and purchase and download games from it, as you would for other apps in the App Store. See Chapter 23, âApp Store,â on page 178. If you want to purchase a game that a friend has, tap the game on your friendâs info screen to go directly to that game in the App Store. Playing Games The Games screen displays the games you download from the iTunes Store. For each of the games, your number of achievements and your ranking among all the gameâs players are displayed. Get information about a game: Tap Games, then tap a game. If available, you can FKURNC[VJGICOG¨UNGCFGTDQCTFUUGG[QWTCEJKGXGOGPVUHQTVJGICOGCPF°PFQWV whoâs recently played the game. Play a game: Tap Games, choose a game, then tap Play. Depending on the game, the home screen may provide instructions or other information, and let you view leaderboards and achievements, set game options, and start a single or multiplayer game. To play against others, you can either invite a friend QTWUGCWVQOCVEJVQJCXG)COG%GPVGT°PFQVJGTRNC[GTUHQT[QW(QTKPHQTOCVKQP about making friends in Game Center, see âFriendsâ on page 189. For multiplayer games, you can also send a game invitation from the Friends screen. Invite a friend to a multiplayer game from the Friends screen: 1 Tap Friends at the bottom of the screen. 2 Choose a friend. 3 Choose a game and tap Play. If the game allows or requires additional players, you can choose players to invite, then tap Next. 186 Chapter 24 Game Center APPLE CONFIDENTIAL â First Draft (1.10.11) 4 Enter and send your invitation, then wait for the others to accept. 5 Start the game. If a friend isnât available or doesnât respond to your invitation, you can tap Auto-Match VQJCXG)COG%GPVGT°PFCPQVJGTRNC[GTHQT[QWQTVCR+PXKVG(TKGPFVQVT[KPXKVKPI some other friend. Other players may invite you to play the game. Respond to an invitation to play a game: Tap Accept or Decline in the alert that appears. You can disable multiplayer games in Restrictions. See âRestrictionsâ on page 202. ;QWECPRTGXGPVQVJGTRNC[GTUHTQOKPXKVKPI[QWVQRNC[ICOGUD[VWTPKPIQĂ#NNQY Game Invites in Game Center settings. See âYour Status and Account Informationâ on page 191. Return to Game Center: Press the Home button, then tap Game Center on the Home screen. On iPhone 3GS or later, you can also press the Home button twice quickly and choose Game Center from your recent apps. Leaderboards Some games provide one or more leaderboards to show the ranking of the gameâs players, with their scores, times, or other measures of the playersâ success. See a gameâs leaderboard: Tap Games, then choose the game and tap Leaderboard. You may also be able to view leaderboards from within a game. If a game has variations (such as Easy, Normal, and Hard), the Categories screen lets you choose the leaderboard for the game in general, or for one of the variations. Chapter 24 Game Center 187 APPLE CONFIDENTIAL â First Draft (1.10.11) The leaderboard shows the ranking of your friends, and of all players. You may be able VQXKGYNGCFGTDQCTFUVCVUHQTCURGEK°EVKOGRGTKQFUWEJCUVQFC[VJKUYGGMQTCNNVKOG Rotate iPhone to see a leaderboard in landscape orientation. Start playing a game from the leaderboard: Tap Play in the upper-right corner. Achievements 5QOGICOGUTGYCTF[QWYKVJDQPWURQKPVUHQTURGEK°ECEJKGXGOGPVU See the possible achievements for a game: Tap Games, choose a game, then tap Achievements. For each achievement, Game Center shows how many bonus points are awarded, and whether youâve completed the achievement. The total points awarded for your CEJKGXGOGPVUCRRGCTCVVJGVQR;QWECPIGVDQPWURQKPVUHQTCURGEK°ECEJKGXGOGPV only once. You may also be able to view achievements from within a game. Recently Played Some games let you see which of your friends have recently played the game. 188 Chapter 24 Game Center APPLE CONFIDENTIAL â First Draft (1.10.11) See whoâs recently played a game: Tap Games, tap a game, then tap Recently Played. Get information about a player: Tap a playerâs name in the list. Friends Game Center puts you in contact with players around the world. You add friends to Game Center by making a request, or by accepting a request from another player. Add a friend to Game Center: 1 Tap Friends or Requests. 2 Tap +, then enter a friendâs email address or Game Center nickname. Matching addresses and names from your contacts appear as you type. Tap a contact to include that person in your request. Tap to browse your contacts. To add several friends at once, enter additional contacts. 3 Enter a message for your request, then tap Send. In order to become a friend, a person must accept your request. Other players might send you a request. If you receive an alert, you can accept the request from there, or close it and respond to the request later from the Request screen. A badge on the Requests button indicates the number of outstanding friend requests. Respond to a friend request: Tap Requests, tap the name of the person making the request, then tap Accept, Ignore, or Report a Problem. Chapter 24 Game Center 189 APPLE CONFIDENTIAL â First Draft (1.10.11) When a player accepts another playerâs request, they each become the otherâs friend. Friendsâ names appear on the Friends screen. Get information about a friend: Tap the friendâs name. Search for a friend: Tap the status bar to scroll to the top of the screen, then tap the UGCTEJ°GNFCPFUVCTVV[RKPI(TKGPFUYJQOCVEJ[QWTUGCTEJCRRGCTCU[QWV[RG A friendâs info page shows how many friends (including you) the person has, the PWODGTQHFKĂGTGPVICOGU[QWTHTKGPFJCURNC[GFCPFJQYOCP[CEJKGXGOGPVU[QWT friend has completed. The info screen may also show:  The games youâve played together  The games you have in common  Other games your friend has You can tap a game in any of the lists to see your position and your friendâs position on the overall leaderboard, and your respective accomplishments for the game. 190 Chapter 24 Game Center APPLE CONFIDENTIAL â First Draft (1.10.11) Invite a friend to play a game: Tap Friends, tap the friendâs name, tap a game, then tap Play. See âPlaying Gamesâ on page 186. Remove a friend: Tap Friends, tap a name, then tap Unfriend and tap Remove. +HCRNC[GTKUQĂGPUKXGQTGZJKDKVUKPCRRTQRTKCVGDGJCXKQT[QWECPTGRQTVVJGRTQDNGO Report a problem with a friend: Tap Friends, tap the friendâs name, then tap âReport a Problem.â Describe the problem, then tap Report to send the report. +H[QWVWTPQĂ/WNVKRNC[GT)COGUKP5GVVKPIU[QWECP¨VUGPFQTTGEGKXGKPXKVCVKQPUVQ play games. See âRestrictionsâ on page 202. Your Status and Account Information The Me screen summarizes information about your friends, your games, and your achievements. 6JGVGZV°GNFKPVJGEGPVGTQHVJGUETGGPNGVU[QWGPVGT[QWTEWTTGPVUVCVWUOGUUCIG Your status appears along with your nickname in other playersâ Friends screens. Change your status: 6CRVJGUVCVWU°GNFCPFWUGVJGMG[DQCTFVQGPVGTQTWRFCVG[QWT status. View your account information: Tap the account banner, then tap View Account. You can change or update the following settings:  Nickname  Allow game invites  Find Me By Email  Your mail address for Game Center  Additional email addresses 9JGP[QW°PKUJVCR&QPG Chapter 24 Game Center 191 APPLE CONFIDENTIAL â First Draft (1.10.11) ;QWECPCNUQUKIPQWVCPFUKIPKPVQCFKĂGTGPVCEEQWPVQTETGCVGCPGYCEEQWPV Sign out: Tap the account banner, then tap Sign Out. To sign in to another account, enter your username and password, then tap Sign In. To create a new account, tap Create New Account and follow the onscreen instructions. 192 Chapter 24 Game Center APPLE CONFIDENTIAL â First Draft (1.10.11) Settings 25 5GVVKPIUCNNQYU[QWVQEWUVQOK\GK2JQPGCRRUUGVVJGFCVGCPFVKOGEQP°IWTG[QWT network connection, and enter other preferences for iPhone. Airplane Mode Airplane mode disables the wireless features of iPhone to reduce potential interference with aircraft operation and other electrical equipment. Turn on airplane mode: Tap Settings and turn airplane mode on. When airplane mode is on, appears in the status bar at the top of the screen. No phone, radio, Wi-Fi, or Bluetooth signals are emitted from iPhone and GPS reception is VWTPGFQĂFKUCDNKPIOCP[QHK2JQPG¨UHGCVWTGU;QWYQP¨VDGCDNGVQ  Make or receive phone calls  Make or receive FaceTime video calls  Get visual voicemail  Send or receive email  Browse the Internet  Sync your contacts, calendars, or bookmarks (MobileMe only) with MobileMe or Microsoft Exchange  Send or receive text or MMS messages  Stream YouTube videos  Get stock quotes  Get map locations  Get weather reports  Use the iTunes Store or the App Store  Use Game Center 193 APPLE CONFIDENTIAL â First Draft (1.10.11) If allowed by the aircraft operator and applicable laws and regulations, you can continue to use iPhone to:  Listen to music and watch videos  Listen to visual voicemail previously received  Check your calendar  Take or view photos or video (iPhone 4 or later)  Hear alarms  Use the stopwatch or timer  Use the calculator  Take notes  Record voice memos  Use Compass  Read text messages and email messages stored on iPhone If Wi-Fi is available and allowed by the aircraft operator and applicable laws and regulations, you can turn Wi-Fi back on and:  Make or receive FaceTime video calls  Send and receive email  Browse the Internet  Sync your contacts, calendars, and bookmarks (MobileMe only) with MobileMe and Microsoft Exchange  Stream YouTube videos  Get stock quotes  Get map locations  Get weather reports  Use the iTunes Store or the App Store  Use Game Center You may also be allowed to turn on Bluetooth and use Bluetooth devices with iPhone. Wi-Fi Wi-Fi settings determine whether iPhone uses local Wi-Fi networks to connect to the +PVGTPGV+HPQ9K(KPGVYQTMUCTGCXCKNCDNGQT[QW¨XGVWTPGF9K(KQĂVJGPK2JQPG connects to the Internet via your cellular data network, when available. 6WTP9K(KQPQTQĂ%JQQUG9K(KCPFVWTP9K(KQPQTQĂ Join a Wi-Fi network: Choose Wi-Fi, wait a moment as iPhone detects networks in range, then select a network. If necessary, enter a password and tap Join (networks that require a password appear with a lock icon). 194 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) Once you join a Wi-Fi network manually, iPhone automatically joins it whenever the network is in range. If more than one previously used network is in range, iPhone joins the one last used. When iPhone is joined to a Wi-Fi network, the Wi-Fi icon in the status bar at the top of the screen shows signal strength. The more bars you see, the stronger the signal. Set iPhone to ask if you want to join a new network: Choose Wi-Fi and turn âAsk to ,QKP0GVYQTMUÂŚQPQTQĂ When youâre trying to access the Internet, by using Safari or Mail for example, and you arenât in range of a Wi-Fi network youâve previously used, this option tells iPhone to look for another network. iPhone displays a list of all available Wi-Fi networks that you can choose from. (Networks that require a password appear with a lock icon.) If âAsk VQ,QKP0GVYQTMUÂŚKUVWTPGFQĂ[QWOWUVOCPWCNN[LQKPCPGVYQTMVQEQPPGEVVQVJG Internet when a previously used network or a cellular data network isnât available. Forget a network, so iPhone doesnât join it: Choose Wi-Fi and tap network youâve joined before. Then tap âForget this Network.â next to a Join a closed Wi-Fi network: To join a Wi-Fi network that isnât shown in the list of scanned networks, choose Wi-Fi > Other, then enter the network name. If the network requires a password, tap Security, tap the type of security the network uses, and enter the password. You must already know the network name, password, and security type to connect to a closed network. Some Wi-Fi networks may require you to enter or adjust additional settings, such as a client ID or static IP address. Ask the network administrator which settings to use. Adjust settings for connecting to a Wi-Fi network: Choose Wi-Fi, then tap a network. next to VPN 6JKUUGVVKPICRRGCTUYJGP[QWJCXG820EQP°IWTGFQPK2JQPGCNNQYKPI[QWVQVWTP 820QPQTQĂ5GGÂĽNetworkâ on page 198. Personal Hotspot On a CDMA model, Personal Hotspot settings are available at the top level of Settings, and at General > Network settings. See âNetworkâ on page 198. 0QVK°ECVKQPU This setting appears when you open an application (such as Game Center) that uses VJG#RRNG2WUJ0QVK°ECVKQPUGTXKEG Chapter 25 Settings 195 APPLE CONFIDENTIAL â First Draft (1.10.11) 2WUJPQVK°ECVKQPUCNGTV[QWVQPGYKPHQTOCVKQPGXGPYJGPVJGCRRKUP¨VTWPPKPI 0QVK°ECVKQPUXCT[D[CRRDWVOC[KPENWFGVGZVQTUQWPFCNGTVUCPFCPWODGTGFDCFIG on the app icon on the Home screen. ;QWECPVWTPPQVK°ECVKQPUQĂKH[QWFQP¨VYCPVVQDGPQVK°GFQTKH[QWYCPVVQ conserve battery life. 6WTPCNNPQVK°ECVKQPUQPQTQĂ6CR0QVK°ECVKQPUVJGPVWTPPQVK°ECVKQPUQPQTQĂ 6WTPUQWPFUCNGTVUQTDCFIGUQPQTQĂHQTCPCRR6CR0QVK°ECVKQPUEJQQUGCPCRR HTQOVJGNKUVVJGPEJQQUGVJGV[RGUQHPQVK°ECVKQP[QWYCPVVQVWTPQPQTQĂ Carrier This setting appears when youâre outside of your carrierâs network and other local carrier data networks are available to use for your phone calls, visual voicemail, and cellular network Internet connections. You can make calls only on carriers that have roaming agreements with your carrier. Additional fees may apply. Roaming charges may be billed to you by the carrier of the selected network, through your carrier. For information about out-of-network coverage and how to enable roaming, contact your carrier or go to your carrierâs website. Select a carrier: Choose Carrier and select the network you want to use. Once you select a network, iPhone uses only that network. If the network is unavailable, âNo serviceâ appears on the iPhone screen and you canât make or receive calls or visual voicemail, or connect to the Internet via cellular data network. Set Network Settings to Automatic to have iPhone select a network for you. Sounds and the Ring/Silent Switch Switch between ring and silent mode: Flip the Ring/Silent switch on the side of iPhone. 9JGPUGVVQUKNGPVK2JQPGFQGUP¨VRNC[CP[TKPICNGTVQTGĂGEVUUQWPFU+VFQGU however, play alarms set using Clock. Note: +PUQOGEQWPVTKGUQTTGIKQPUVJGUQWPFGĂGEVUHQT%COGTCCPF8QKEG/GOQUCTG played even if the Ring/Silent switch is set to silent. Set whether iPhone vibrates when you get a call: Choose Sounds. To set whether iPhone vibrates in silent mode, turn Vibrate under Silent QPQTQĂ6QUGVYJGVJGT iPhone vibrates in ring mode, turn Vibrate under Ring QPQTQĂ 196 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) Adjust the ringer and alerts volume: Choose Sounds and drag the slider. Or, if âChange with Buttonsâ is turned on, use the volume buttons on the side of iPhone. The volume buttons donât change the ringer and alerts volume if a song or video is playing or if youâre on a call. Allow the volume buttons to change the ringer or alerts volume: Choose Sounds and turn on âChange with Buttons.â Set the ringtone: Choose Sounds > Ringtone. 5GVVJGCNGTVCPFGĂGEVUUQWPFU%JQQUG5QWPFUCPFVWTPKVGOUQPQTQĂWPFGT4KPI 9JGPVJG4KPI5KNGPVUYKVEJKUUGVVQTKPIK2JQPGRNC[UUQWPFUHQTCNGTVUCPFGĂGEVU that are turned on. You can set iPhone to play a sound whenever you:  Get a call  Get a text message  Get a voicemail message  Get an email message  Send an email message  Have an appointment that youâve set to alert you  Lock iPhone  Type using the keyboard Brightness 5ETGGPDTKIJVPGUUCĂGEVUDCVVGT[NKHG&KOVJGUETGGPVQGZVGPFVJGVKOGDGHQTG[QW need to recharge iPhone, or use Auto-Brightness. Adjust the screen brightness: Choose Brightness and drag the slider. Set whether iPhone adjusts screen brightness automatically: Choose Brightness CPFVWTP#WVQ$TKIJVPGUUQPQTQĂ+H#WVQ$TKIJVPGUUKUQPK2JQPGCFLWUVUVJGUETGGP brightness for current light conditions using the built-in ambient light sensor. Wallpaper Wallpaper settings let you set an image or photo as wallpaper for the Lock screen. On iPhone 3GS or later, you can also set wallpaper for your Home screen. See âAdding Wallpaperâ on page 36. General General settings include network, sharing, security, and other iOS settings. You can also °PFKPHQTOCVKQPCDQWV[QWTK2JQPGCPFTGUGVXCTKQWUK2JQPGUGVVKPIU Chapter 25 Settings 197 APPLE CONFIDENTIAL â First Draft (1.10.11) About Choose General > About to get information about iPhone, including:  Name of your phone network  Number of songs, videos, photos, and apps  Total storage capacity  Space available  Software version  Carrier  Model and serial numbers  Wi-Fi and Bluetooth addresses  GSM Models: IMEI (International Mobile Equipment Identity) and ICCID (Integrated %KTEWKV%CTF+FGPVK°GTQT5OCTV%CTF  CDMA Model:/'+& /QDKNG'SWKROGPV+FGPVK°GT  /QFGO°TOYCTGXGTUKQPQHVJGEGNNWNCTVTCPUOKVVGT  Legal information  Regulatory information Usage Show battery percentage (iPhone 3GS or later): Choose General > Usage and turn Battery Percentage on. See your usage statistics: Choose General > Usage. There, you can see:  UsageâAmount of time iPhone has been awake and in use since the last full charge. iPhone is awake whenever youâre using itâincluding making or receiving phone calls, using email, sending or receiving text messages, listening to music, browsing the web, or using any other iPhone features. iPhone is also awake while performing background tasks, such as fetching email messages.  StandbyâAmount of time iPhone has been powered on since its last full charge, including the time iPhone has been asleep.  Current period call time and lifetime call time.  Amount of data sent and received over the cellular data network. Reset your usage statistics: Choose General > Usage, then tap Reset Statistics to clear the data and cumulative time statistics. The statistics for the amount of time iPhone has been unlocked and in standby mode arenât reset. Network 7UG0GVYQTMUGVVKPIUVQEQP°IWTGC820 XKTVWCNRTKXCVGPGVYQTM EQPPGEVKQPCEEGUU 9K(KUGVVKPIUQTVWTP&CVC4QCOKPIQPQTQĂ 198 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) 6WTP)QPQTQĂ(GSM models only.) Choose General > Network, then tap to turn 3G QPQTQĂ Using 3G loads Internet data faster in some cases, but may decrease battery RGTHQTOCPEG+H[QW¨TGOCMKPICNQVQHRJQPGECNNU[QWOC[YCPVVQVWTP)QĂVQ extend battery performance. 6WTP%GNNWNCT&CVCQPQTQĂChoose General > Network, then turn Cellular Data on or QĂ +H%GNNWNCT&CVCKUVWTPGFQĂ[QWYQP¨VDGCDNGVQCEEGUUVJG+PVGTPGVWPNGUU[QWLQKPC Wi-Fi network. By default, Cellular Data is turned on. 6WTP&CVC4QCOKPIQPQTQĂChoose General > Network, then turn Data Roaming on QTQĂ Data Roaming turns on Internet and visual voicemail access over a cellular data network when youâre in an area not covered by your carrierâs network. For example, YJGP[QW¨TGVTCXGNKPI[QWECPVWTPQĂ&CVC4QCOKPIVQCXQKFRQVGPVKCNTQCOKPI EJCTIGU$[FGHCWNV&CVC4QCOKPIKUVWTPGFQĂ 6WTP+PVGTPGV6GVJGTKPIQPQTQĂ(GSM models only.) Choose General > Network > +PVGTPGV6GVJGTKPIVJGPVWTP+PVGTPGV6GVJGTKPIQPQTQĂ See âSharing an Internet Connectionâ on page 24. 6WTP2GTUQPCN*QVURQVQPQTQĂ(CDMA model only.) Choose General > Network > 2GTUQPCN*QVURQVVJGPVWTP2GTUQPCN*QVURQVQPQTQĂ See âSharing an Internet Connectionâ on page 24. #FFCPGY820EQP°IWTCVKQPChoose General > Network > VPN > Add VPN %QP°IWTCVKQP VPNs used within organizations allow you to communicate private information UGEWTGN[QXGTCPQPRTKXCVGPGVYQTM;QWOC[PGGFVQEQP°IWTG820HQTGZCORNGVQ access your work email on iPhone. iPhone can connect to VPNs that use the L2TP, PPTP, or Cisco IPSec protocols. VPN works over both Wi-Fi and cellular data network connections. Ask your network administrator which settings to use. In most cases, if youâve set up VPN on your computer, you can use the same VPN settings for iPhone. Once you enter VPN settings, a VPN switch appears in the Settings menu that you can WUGVQVWTP820QPQTQĂ 820OC[CNUQDGCWVQOCVKECNN[UGVWRD[CEQP°IWTCVKQPRTQ°NG5GGÂĽConnecting to the Internetâ on page 22. %JCPIGC820EQP°IWTCVKQPChoose General > Network > VPN and tap the EQP°IWTCVKQP[QWYCPVVQWRFCVG 6WTP820QPQTQĂ%JQQUG820VJGPVCRVQVWTP820QPQTQĂ Chapter 25 Settings 199 APPLE CONFIDENTIAL â First Draft (1.10.11) &GNGVGC820EQP°IWTCVKQPChoose General > Network > VPN, tap the blue CTTQYPGZVVQVJGEQP°IWTCVKQPPCOGVJGPVCR&GNGVG820CVVJGDQVVQOQHVJG EQP°IWTCVKQPUETGGP Bluetooth iPhone can connect wirelessly to Bluetooth devices such as headsets, headphones, and car kits for music listening and hands-free talking. See âUsing a Bluetooth Device for Callsâ on page 71. ;QWECPCNUQEQPPGEVVJG#RRNG9KTGNGUU-G[DQCTFXKC$NWGVQQVJ5GGÂĽUsing an Apple 9KTGNGUU-G[DQCTFâ on page 44. 6WTP$NWGVQQVJQPQTQĂ%JQQUG)GPGTCN $NWGVQQVJCPFVWTP$NWGVQQVJQPQTQĂ Location Services Location services lets apps such as Maps, Camera, Compass, and third-party locationbased apps gather and use data indicating your location. The location data collected D[#RRNGKUPQVEQNNGEVGFKPCHQTOVJCVRGTUQPCNN[KFGPVK°GU[QW;QWTCRRTQZKOCVG location is determined using available information from cellular network data, local Wi-Fi networks (if you have Wi-Fi turned on), and GPS (may not be available in all locations). When an app is using location services, appears in the status bar. Every app that uses location services appears in the Location Services settings screen, UJQYKPIYJGVJGTNQECVKQPUGTXKEGUKUVWTPGFQPQTQĂHQTVJCVCRR appears for each app that has requested your location within the last 24 hours. You can turn location UGTXKEGUQĂHQTUQOGQTHQTCNNCRRUKH[QWFQP¨VYCPVVQWUGVJKUHGCVWTG+H[QWVWTP NQECVKQPUGTXKEGUQĂ[QW¨TGRTQORVGFVQVWTPKVQPCICKPVJGPGZVVKOGCPCRRVTKGUVQ use this feature. 6WTPNQECVKQPUGTXKEGUQPQTQĂHQTCNNCRRUChoose General > Location Services and VWTPNQECVKQPUGTXKEGUQPQTQĂ 6WTPNQECVKQPUGTXKEGUQPQTQĂHQTUQOGCRRU6WTPNQECVKQPUGTXKEGUQPQTQĂHQTVJG individual apps. If you have third-party apps on iPhone that use location services, review the third partyâs terms and privacy policy to understand how that app uses your location data. 6QEQPUGTXGDCVVGT[NKHGVWTPNQECVKQPUGTXKEGUQĂYJGP[QW¨TGPQVWUKPIKV Home Button Home Button settings (iPhone 3G only) let you specify what happens when you double-click the Home button. The âSpotlight Searchâ settings, described below, are also available under Home Button on iPhone 3G. 200 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) Set the action performed when you double-click the Home button: Choose General > Home Button and set the action. You can set double-clicking the Home button to go to:  Home screen  Search screen  Phone Favorites  Camera app  iPod app Set whether double-clicking the Home button shows iPod controls when playing music: Choose General > Home Button, then tap the switch to turn iPod controls on QTQĂ6JKUHGCVWTGQXGTTKFGUVJGCEVKQPHQTFQWDNGENKEMKPIVJG*QOGDWVVQPCPFYQTMU GXGPKHVJGFKURNC[KUVWTPGFQĂQTK2JQPGKUNQEMGF Spotlight Search The Spotlight Search setting lets you specify the content areas searched by Search, and rearrange the order of the results. Set which content areas are searched by Search: 1 Choose General > Spotlight Search (on iPhone 3G, choose General > Home > Spotlight Search). 2 Tap an item to select or deselect it. All search categories are selected by default. Set the order of search result categories: 1 Choose General > Spotlight Search (on iPhone 3G, choose General > Home > Spotlight Search). 2 Touch next to an item, then drag up or down. Auto-Lock .QEMKPIK2JQPGVWTPUQĂVJGFKURNC[VQUCXG[QWTDCVVGT[CPFVQRTGXGPVWPKPVGPFGF operation of iPhone. You can still receive calls and text messages, and you can adjust the volume and use the mic button on the iPhone earphones when listening to music or on a call. Set the amount of time before iPhone locks: Choose General > Auto-Lock, then choose a time. Passcode Lock By default, iPhone doesnât require you to enter a passcode to unlock it. On iPhone 3GS or later, setting a passcode enables data protection. See âSecurity Featuresâ on page 53. Chapter 25 Settings 201 APPLE CONFIDENTIAL â First Draft (1.10.11) Important: On iPhone 3GS, you must also restore iOS software to enable data protection. See âRestoring iPhoneâ on page 256. Set a passcode: Choose General > Passcode Lock and enter a 4-digit passcode, then enter the passcode again to verify it. iPhone then requires you to enter the passcode to unlock it or to display the passcode lock settings. 6WTPRCUUEQFGNQEMQĂChoose General > Passcode Lock, enter your passcode, and VCR6WTP2CUUEQFG1ĂVJGPGPVGT[QWTRCUUEQFGCICKP Change the passcode: Choose General > Passcode Lock, enter your passcode, and tap Change Passcode. Enter your passcode again, then enter and reenter your new passcode. If you forget your passcode, you must restore the iPhone software. See âUpdating and Restoring iPhone Softwareâ on page 256. Set how long before your passcode is required: Choose General > Passcode Lock and enter your passcode. Tap Require Passcode, then select how long iPhone can be locked before you need to enter a passcode to unlock it. 6WTP5KORNG2CUUEQFGQPQTQĂChoose General > Passcode Lock, then turn Simple 2CUUEQFGQPQTQĂ #UKORNGRCUUEQFGKUCHQWTFKIKVPWODGT6QKPETGCUGUGEWTKV[VWTPQĂ5KORNG2CUUEQFG and use a longer passcode with a combination of numbers, letters, punctuation, and special characters. 6WTP8QKEG&KCNQPQTQĂ K2JQPG)5QTNCVGT Choose General > Passcode Lock, then VWTP8QKEG&KCNQPQTQĂ Erase data after ten failed passcode attempts: Choose General > Passcode Lock, enter your passcode, and tap Erase Data to turn it on. After ten failed passcode attempts, your settings are reset to their defaults and all your information and media are erased:  On iPhone 3GS or later: by removing the encryption key to the data (which is encrypted using 256-bit AES encryption)  On iPhone 3G: by overwriting the data Important: You canât use iPhone while data is being overwritten. This can take up to two hours or more, depending on the model and storage capacity of your iPhone. (On iPhone 3GS or later, the encryption key is removed immediately.) Restrictions You can set restrictions for the use of some apps and for iPod content on iPhone. For GZCORNGRCTGPVUECPTGUVTKEVGZRNKEKVOWUKEHTQODGKPIUGGPQPRNC[NKUVUQTVWTPQĂ YouTube access entirely. Turn on restrictions: 1 Choose General > Restrictions, then tap Enable Restrictions. 202 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) 2 Enter a four-digit passcode. 3 Reenter the passcode. 6WTPQĂTGUVTKEVKQPUChoose General > Restrictions, then enter the passcode. Tap Disable Restrictions, then reenter the passcode. Important: If you forget your passcode, you must restore the iPhone software from iTunes. See âUpdating and Restoring iPhone Softwareâ on page 256. Set app restrictions: Set the restrictions you want by tapping individual controls on or QĂ$[FGHCWNVCNNEQPVTQNUCTGQP PQVTGUVTKEVGF 6CRCPKVGOVQVWTPKVQĂCPFTGUVTKEV its use. Safari Safari is disabled and its icon is removed from the Home screen. You cannot use Safari to browse the web or access web clips. Other third-party apps may allow web browsing even if Safari is disabled. YouTube is disabled and its icon is removed from the Home screen. YouTube Camera is disabled and its icon is removed from the Home screen. You cannot take photos. Camera You cannot make or receive FaceTime video calls (iPhone 4 only). FaceTime The iTunes Store is disabled and its icon is removed from the Home screen. You cannot preview, purchase, or download content. iTunes The App Store is disabled and its icon is removed from the Home screen. You cannot install apps on iPhone. Installing Apps You cannot delete apps from iPhone. customizing the Home screen. doesnât appear on app icons when youâre Deleting Apps The current Location Services settings and the Find My iPhone setting (in MobileMe accounts in âMail, Contacts, Calendarsâ) are locked and cannot be changed. Location The current Mail, Contacts, Calendar settings are locked and you cannot add, modify, or delete accounts. Accounts Chapter 25 Settings 203 APPLE CONFIDENTIAL â First Draft (1.10.11) Restrict purchases within apps: 6WTPQĂ+P#RR2WTEJCUGU9JGPGPCDNGFVJKUHGCVWTG allows you to purchase additional content or functionality within apps downloaded from the App Store. Set content restrictions: Tap Ratings For, then select a country from the list. You can then set restrictions using that countryâs ratings system for the following categories of content:  Music & Podcasts  Movies  TV Shows  Apps In the United States for example, to allow only movies rated PG or below, tap Movies, then select PG from the list. Content that you restrict wonât appear on iPhone. Note: Not all countries or regions have rating systems. Restrict multiplayer games: 6WTPQĂ/WNVKRNC[GT)COGU 9JGP/WNVKRNC[GT)COGUKUVWTPGFQĂ[QWECP¨VTGSWGUVCOCVEJUGPFQTTGEGKXG invitations to play games, or add friends in Game Center. Restrict adding friends: 6WTPQĂ#FFKPI(TKGPFU 9JGP#FFKPI(TKGPFUKUQĂ[QWECP¨VOCMGQTTGEGKXGHTKGPFTGSWGUVUKP)COG%GPVGT If Multiplayer Games is turned on, you can continue to play with existing friends. Date and Time These settings apply to the time shown in the status bar at the top of the screen, and in world clocks and calendars. Set whether iPhone shows 24-hour time or 12-hour time: Choose General > Date 6KOGVJGPVWTP*QWT6KOGQPQTQĂ *QWT6KOGOC[PQVDGCXCKNCDNGKPCNN countries or regions.) Set whether iPhone updates the date and time automatically: Choose General > &CVG6KOGVJGPVWTP5GV#WVQOCVKECNN[QPQTQĂ If iPhone is set to update the time automatically, it gets the correct time over the cellular network and updates it for the time zone youâre in. Some carriers donât support network time in all locations. If youâre traveling, iPhone may not be able to automatically set the local time. Set the date and time manually: Choose General > Date & Time, then turn Set #WVQOCVKECNN[QĂ6CR6KOG International > Language, choose the language you want to use, then tap Done. Set the Voice Control language for iPhone: Choose General > International > Voice Control, then choose the language you want to use (iPhone 3GS or later). Add international keyboards: 1 %JQQUG)GPGTCN +PVGTPCVKQPCN -G[DQCTFU The number of active keyboards appears next to the right arrow. 2 6CRÂĽ#FF0GY-G[DQCTFÂÂŚVJGPEJQQUGCMG[DQCTF You can add as many keyboards as you want. To learn about using international keyboards, see â+PVGTPCVKQPCN-G[DQCTFUâ on page 40. Edit your keyboard list: %JQQUG)GPGTCN +PVGTPCVKQPCN -G[DQCTFUVJGPVCR'FKV and do one of the following:  To delete a keyboard, tap  To reorder the list, drag , then tap Delete. next to a keyboard to a new place in the list. Change a keyboard layout: +P5GVVKPIUEJQQUG)GPGTCN +PVGTPCVKQPCN -G[DQCTFU and select a keyboard. You can make separate selections for both the on-screen software and external hardware keyboards for each language. The software keyboard layout determines the layout of the keyboard that appears on the iPhone screen. The hardware keyboard layout determines the virtual layout of an #RRNG9KTGNGUU-G[DQCTFEQPPGEVGFVQK2JQPG 206 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) Set the date, time, and telephone number formats: Choose General > International > Region Format, and choose your region. The Region Format also determines the language used for the days and months that appear in native iPhone apps. Set the calendar format: Choose General > International > Calendar, and choose the format. Accessibility To turn on accessibility features (iPhone 3GS or later), choose Accessibility and choose the features you want. See Chapter 29, âAccessibility,â on page 235. 2TQ°NGU 6JKUUGVVKPICRRGCTUKH[QWKPUVCNNQPGQTOQTGRTQ°NGUQPK2JQPG6CR2TQ°NGUVQUGG KPHQTOCVKQPCDQWVVJGRTQ°NGU[QW¨XGKPUVCNNGF Resetting iPhone Reset all settings: Choose General > Reset and tap Reset All Settings. All your preferences and settings are reset. Information (such as contacts and ECNGPFCTU CPFOGFKC UWEJCUUQPIUCPFXKFGQU CTGP¨VCĂGEVGF Erase all content and settings: Connect iPhone to your computer or a power adapter. Choose General > Reset and tap âErase All Content and Settings.â This resets all settings to their defaults and erases all your information and media:  On iPhone 3GS or later: by removing the encryption key to the data (which is encrypted using 256-bit AES encryption)  On iPhone 3G: by overwriting the data Important: You canât use iPhone while data is being overwritten. This can take up to two hours or more, depending on the model and storage capacity of your iPhone. (On iPhone 3GS or later, the encryption key is removed immediately.) Reset network settings: Choose General > Reset and tap Reset Network Settings. When you reset network settings, your list of previously used networks and VPN UGVVKPIUPQVKPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGCTGTGOQXGF9K(KKUVWTPGFQĂCPF then back on, disconnecting you from any network youâre on. The Wi-Fi and âAsk to Join Networksâ settings are left turned on. 6QTGOQXG820UGVVKPIUKPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGEJQQUG5GVVKPIU )GPGTCN 2TQ°NGVJGPUGNGEVVJGRTQ°NGCPFVCR4GOQXG Reset the keyboard dictionary: %JQQUG)GPGTCN 4GUGVCPFVCR4GUGV-G[DQCTF Dictionary. You add words to the keyboard dictionary by rejecting words iPhone suggests as you type. Tap a word to reject the correction and add the word to the keyboard dictionary. Resetting the keyboard dictionary erases all words youâve added. Chapter 25 Settings 207 APPLE CONFIDENTIAL â First Draft (1.10.11) Reset the Home screen layout: Choose General > Reset and tap Reset Home Screen Layout. Reset location warnings: Choose General > Reset and tap Reset Location Warnings. Location warnings are requests made by apps (such as Camera, Compass, and Maps) VQWUGNQECVKQPUGTXKEGUK2JQPGRTGUGPVUCNQECVKQPYCTPKPIHQTCPCRRVJG°TUVVKOG the app makes a request to use location services. If you tap Cancel in response to the request, the request isnât presented again. To reset the location warnings so that you get a request for each app again, tap Reset Location Warnings. Mail, Contacts, Calendars 7UG/CKN%QPVCEVU%CNGPFCTUUGVVKPIUVQUGVWRCEEQWPVUCPFVWTPQPURGEK°ECEEQWPV services (such as mail, contacts, calendars, bookmarks, and notes) for iPhone:  Microsoft Exchange (mail, contacts, and calendars)  MobileMe (mail, contacts, calendars, bookmarks, notes, and Find My iPhone)  Google (mail, calendars, and notes)  Yahoo! (mail, calendars, and notes)  AOL (mail and notes)  Other POP and IMAP mail systems  LDAP or CardDAV accounts for Contacts  CalDAV or iCalendar (.ics) accounts for Calendars Accounts 6JG#EEQWPVUUGEVKQPNGVU[QWUGVWRCEEQWPVUQPK2JQPG6JGURGEK°EUGVVKPIUVJCV appear depend on the type of account youâre setting up. Your service provider or system administrator should be able to provide the information you need to enter. For more information, see:  âAdding Mail, Contacts, and Calendar Accountsâ on page 25  âAdding Contactsâ on page 219  âSubscribing to Calendarsâ on page 120 Change an accountâs settings: Choose âMail, Contacts, Calendars,â choose an account, then make the changes you want. Changes you make to an accountâs settings on iPhone are not synced to your EQORWVGTUQ[QWECPEQP°IWTG[QWTCEEQWPVUVQYQTMYKVJK2JQPGYKVJQWVCĂGEVKPI the account settings on your computer. Stop using an account service: Choose âMail, Contacts, Calendars,â choose an account, VJGPVWTPCPCEEQWPVUGTXKEG UWEJCU/CKN%CNGPFCTUQT0QVGU QĂ 208 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) +HCPCEEQWPVUGTXKEGKUQĂK2JQPGFQGUP¨VFKURNC[QTU[PEKPHQTOCVKQPYKVJVJCV account service until you turn it back on. Adjust advanced settings: Choose âMail, Contacts, Calendars,â choose an account, then do one of the following:  To set whether drafts, sent messages, and deleted messages are stored on iPhone or remotely on your email server (IMAP accounts only), tap Advanced and choose Drafts Mailbox, Sent Mailbox, or Deleted Mailbox. If you store messages on iPhone, you can see them even when iPhone isnât connected to the Internet.  To set how long before messages are removed permanently from Mail on iPhone, tap Advanced and tap Remove, then choose a time: Never, or after one day, one week, or one month.  To adjust email server settings, tap Host Name, User Name, or Password under Incoming Mail Server or Outgoing Mail Server. Ask your network administrator or Internet service provider for the correct settings.  To adjust SSL and password settings, tap Advanced. Ask your network administrator or Internet service provider for the correct settings. Delete an account from iPhone: Choose âMail, Contacts, Calendars,â choose an account, then scroll down and tap Delete Account. Deleting an account means you can no longer access the account with your iPhone. All email and the contacts, calendar, and bookmark information synced with the account are removed from iPhone. However, deleting an account doesnât remove the account or its associated information from your computer. Fetch New Data 6JKUUGVVKPINGVU[QWVWTP2WUJQPQTQĂHQT/QDKNG/G/KETQUQHV'ZEJCPIG;CJQQ and any other push accounts on iPhone. Push accounts deliver new information to iPhone whenever new information appears on the server (some delays may occur). ;QWOKIJVYCPVVQVWTP2WUJQĂVQUWURGPFFGNKXGT[QHGOCKNCPFQVJGTKPHQTOCVKQPQT to conserve battery life. 9JGP2WUJKUQĂCPFYKVJCEEQWPVUVJCVFQP¨VUWRRQTVRWUJFCVCECPUVKNNDG fetchedâthat is, iPhone can check with the server and see if new information is available. Use the Fetch New Data setting to determine how often data is requested. For optimal battery life, donât fetch too often. Turn Push on: Choose âMail, Contacts, Calendarsâ > Fetch New Data, then tap to turn Push on. Set the interval to fetch data: Choose âMail, Contacts, Calendarsâ > Fetch New Data, then choose how often you want to fetch data for all accounts. To conserve battery life, fetch less frequently. Chapter 25 Settings 209 APPLE CONFIDENTIAL â First Draft (1.10.11) Setting Push to OFF (or setting Fetch to Manually on the Fetch New Data screen) overrides individual account settings. Mail Mail settings, except where noted, apply to all accounts youâve set up on iPhone. 6QVWTPCNGTVUUQWPFUHQTPGYQTUGPVOCKNQPQTQĂWUGVJG5QWPFUUGVVKPIU Set the number of messages shown on iPhone: Choose âMail, Contacts, Calendarsâ > Show, then choose a setting. Choose to see the most recent 25, 50, 75, 100, or 200 messages. To download additional messages when youâre in Mail, scroll to the bottom of your inbox and tap Load More Messages. Note: For Microsoft Exchange accounts, choose âMail, Contacts, Calendarsâ and choose the Exchange account. Tap âMail days to syncâ and choose the number of days of mail you want to sync with the server. Set how many lines of each message are shown in the message list: Choose âMail, Contacts, Calendarsâ > Preview, then choose a setting. ;QWECPEJQQUGVQUGGWRVQ°XGNKPGUQHGCEJOGUUCIG6JCVYC[[QWECPUECPCNKUVQH messages in a mailbox and get an idea of what each message is about. Set a minimum font size for messages: Choose âMail, Contacts, Calendarsâ > Minimum Font Size, then choose Small, Medium, Large, Extra Large, or Giant. Set whether iPhone shows To and Cc labels in message lists: Choose âMail, Contacts, %CNGPFCTUÂŚVJGPVWTP5JQY6Q%E.CDGNQPQTQĂ next to each message in a list indicates whether If Show To/Cc Label is on, or the message was sent directly to you or you received a copy. 5GVYJGVJGTK2JQPGEQP°TOUVJCV[QWYCPVVQFGNGVGCOGUUCIGChoose âMail, %QPVCEVU%CNGPFCTUÂŚCPFKPVJG/CKNUGVVKPIUVWTP#UM$GHQTG&GNGVKPIQPQTQĂ Set whether iPhone automatically loads remote images: Choose âMail, Contacts, %CNGPFCTUÂŚVJGPVWTP.QCF4GOQVG+OCIGUQPQTQĂ Set whether mail messages are organized by thread: Choose âMail, Contacts, %CNGPFCTUÂŚVJGPVWTP1TICPK\G$[6JTGCFQPQTQĂ Set whether iPhone sends you a copy of every message you send: Choose âMail, %QPVCEVU%CNGPFCTUÂŚVJGPVWTP#NYC[U$EE/[UGNHQPQTQĂ Add a signature to your messages: Choose âMail, Contacts, Calendarsâ > Signature, then type a signature. You can set iPhone to add a signatureâyour favorite quote, or your name, title, and phone number, for exampleâto the bottom of every message you send. Set the default email account: Choose âMail, Contacts, Calendarsâ > Default Account, then choose an account. 210 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) This setting determines which of your accounts an email message is sent from when you create a message from another iPhone appâfor example, when you send a photo from Photos or tap the email address of a business in Maps. To send the message from CFKĂGTGPVCEEQWPVVCRVJG(TQO°GNFKPVJGOGUUCIGCPFEJQQUGCPQVJGTCEEQWPV Contacts Set how contacts are sorted: Choose âMail Contacts, Calendars,â then under Contacts tap Sort Order and do one of the following:  6QUQTVD[°TUVPCOG°TUVtap First, Last.  6QUQTVD[NCUVPCOG°TUVtap Last, First. Set how contacts are displayed: Choose âMail Contacts, Calendars,â then under Contacts tap Display Order and do one of the following:  6QUJQY°TUVPCOG°TUVtap First, Last.  6QUJQYNCUVPCOG°TUVtap Last, First. Import contacts from a SIM card (GSM models only): Choose âMail, Contacts, Calendars,â then tap Import SIM Contacts. The contact information on the SIM card is imported to iPhone. If you have Contacts enabled for MobileMe, Microsoft Exchange, or a CardDAV account, youâre asked to choose which account you want to add the SIM contacts to. Calendars Set alerts to sound when you receive a meeting invitation: Choose âMail, Contacts, Calendars,â and under Calendar, tap âNew Invitation Alertsâ to turn it on. Set how far back in the past to show your calendar events on iPhone: Choose âMail, Contacts, Calendarsâ > Sync, then choose a period of time. Turn on Calendar time zone support: Choose âMail, Contacts, Calendarsâ > Time Zone Support, then turn Time Zone Support on. Select a time zone for calendars by tapping Time Zone and entering the name of a major city. When Time Zone Support is on, Calendar displays event dates and times in the time \QPGQHVJGEKV[[QWUGNGEVGF9JGP6KOG Call Forwarding and turn Call Forwarding on. 2 On the âForward toâ screen, enter the phone number you want calls forwarded to. FaceTime calls are not forwarded. For more information about call forwarding, including how to forward calls on a CDMA model, see âCall Forwardingâ on page 74. Call Waiting Activate or deactivate call waiting: (GSM models only.) Choose Phone > Call Waiting, VJGPVWTP%CNN9CKVKPIQPQTQĂ+H[QWVWTPECNNYCKVKPIQĂCPFUQOGQPGECNNU[QW when youâre already on the phone, the call goes to voicemail. For more information about call waiting, including how to activate or deactivate call waiting on a CDMA model, see âCall Waitingâ on page 75. Show My Caller ID Show or hide your caller ID: (GSM models only.) Choose Phone > Show My Caller ID, VJGPVWTP5JQY/[%CNNGT+&QPQTQĂ For more information about caller ID, including how to show or hide your caller ID on a CDMA model, see âCaller IDâ on page 75. 212 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) Using iPhone with a Teletype (TTY) Machine In some countries or regions, Teletype (TTY) machines are used by deaf or hearingimpaired people to communicate by typing and reading text. You can use iPhone with a TTY machine if you have the iPhone TTY Adapter cable, available for purchase separately in many countries. Go to www.apple.com/store (may not be available in all countries or regions) or check with your local Apple retailer. Connect iPhone to a TTY machine: Choose Phone, then turn TTY on. Then connect iPhone to your TTY machine using the iPhone TTY Adapter. For information about using a TTY machine, see the documentation that came with the machine. For information about other accessibility features of iPhone, see Chapter 29, âAccessibility,â on page 235. Calling from Abroad 5GVK2JQPGVQCFFVJGEQTTGEVRTG°ZYJGPFKCNKPIHTQOCPQVJGTEQWPVT[In Settings, tap Phone, then turn International Assist on. This lets you make calls to your home country using the numbers in your contacts and favorites lists, without having to add a RTG°ZQT[QWTEQWPVT[EQFG+PVGTPCVKQPCN#UUKUVYQTMUHQT75VGNGRJQPGPWODGTUQPN[ For more information, see âUsing iPhone Abroadâ on page 77. Changing Your Voicemail Password A voicemail password helps prevent others from access your voicemail. You need to enter the password only when youâre calling in to get your messages from another phone. You wonât need to enter the password when using voicemail on iPhone. Change your voicemail password: Choose Phone > Change Voicemail Password. Locking Your SIM Card You can lock your SIM card (GSM models only), so it canât be used without a Personal +FGPVK°ECVKQP0WODGT 2+0 ;QWOWUVGPVGTVJG2+0GCEJVKOG[QWVWTPK2JQPGQĂCPF turn it back on again. Some carriers require a SIM PIN in order to use iPhone. Important: If you enter the PIN incorrectly three times, you may need to enter a 2GTUQPCN7PNQEMKPI-G[ 27- VQGPCDNG[QWT5+/ECTFCICKP4GHGTVQVJG5+/ECTF documentation or contact your carrier. Some cellular networks may not accept an emergency call from iPhone if the SIM card is locked. 6WTPVJG5+/2+0QPQTQĂ 1 %JQQUG2JQPG 5+/2+0VJGPVWTP5+/2+0QPQTQĂ 2 'PVGT[QWT2+0VQEQP°TO7UGVJG2+0CUUKIPGFD[[QWTECTTKGTQT[QWTECTTKGT¨UFGHCWNV PIN. Change the PIN for your SIM card: 1 Choose Phone > SIM PIN. Chapter 25 Settings 213 APPLE CONFIDENTIAL â First Draft (1.10.11) 2 Turn SIM PIN on, then tap Change PIN. 3 Enter your current PIN, then enter your new PIN. 4 'PVGT[QWTPGY2+0CICKPVQEQP°TOVJGPVCR&QPG Accessing Your Carrierâs Services Depending on your carrier, you may be able to access some of your carrierâs services directly from iPhone. For example, you may be able to check your bill balance, call directory assistance, or view how many minutes you have left. Access your carrierâs services: Choose Phone. Then scroll down and tap the button for your carrierâs services. When you request information such as your bill balance, your carrier may provide the KPHQTOCVKQPKPCVGZVOGUUCIG%QPVCEV[QWTECTTKGTVQ°PFQWVKHVJGTGCTGCP[EJCTIGU for these services. Safari Safari settings let you select your Internet search engine, set security options, and for developers, turn on debugging. General Select a search engine: Choose Safari > Search Engine and select the search engine you want to use. ;QWECPUGV5CHCTKVQCWVQOCVKECNN[°NNQWVYGDHQTOUWUKPIEQPVCEVKPHQTOCVKQPPCOGU and passwords you previously entered, or both. Enable AutoFill: Choose Safari > AutoFill, then do one of the following:  To use information from contacts, turn Use Contact Info on, then choose My Info and select the contact you want to use. 5CHCTKWUGUKPHQTOCVKQPHTQO%QPVCEVUVQ°NNKPEQPVCEV°GNFUQPYGDHQTOU  To use information from names and passwords, turn Names & Passwords on. When this feature is on, Safari remembers names and passwords of websites you XKUKVCPFCWVQOCVKECNN[°NNUKPVJGKPHQTOCVKQPYJGP[QWTGXKUKVVJGYGDUKVG  To remove all AutoFill information, tap Clear All. Security By default, Safari is set to show features of the web, such as some movies, animation, and web apps. You may wish to change security settings to help protect iPhone from possible security risks on the Internet. Change security settings: Choose Safari, then do one of the following:  To be warned when visiting potentially fraudulent websites, turn Fraud Warning on. 214 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) Fraud warning protects you from potentially fraudulent Internet sites. When you visit a suspicious site, Safari warns you about its suspect nature and doesnât load the page.  To enable or disable JavaScript, VWTP,CXC5ETKRVQPQTQĂ JavaScript lets web programmers control elements of the pageâfor example, a page that uses JavaScript might display the current date and time or cause a linked page to appear in a pop-up.  To block or allow pop-ups, VWTP$NQEM2QRWRUQPQTQĂ$NQEMKPIRQRWRUUVQRUQPN[ pop-ups that appear when you close a page or open a page by typing its address. It doesnât block pop-ups that open when you tap a link.  To set whether Safari accepts cookies, tap Accept Cookies and choose Never, âFrom visited,â or Always. A cookie is a piece of information that a website puts on iPhone so the website can remember you when you visit again. That way, webpages can be customized for you based on information you may have provided. Some pages wonât work correctly unless iPhone is set to accept cookies.  To clear a database, tap Databases, then tap Edit. Tap next to a database, then tap Delete. Some web apps use databases to store app information on iPhone.  To clear the history of webpages youâve visited, tap Clear History.  To clear all cookies from Safari, tap Clear Cookies.  To clear the browser cache, tap Clear Cache. The browser cache stores the content of pages so the pages open faster the next time you visit them. If a page you open doesnât show new content, clearing the cache may help. Developer The debug console can help you resolve webpage errors. If itâs turned on, the console appears when a webpage error occurs. 6WTPVJGFGDWIEQPUQNGQPQTQĂChoose Safari > Developer, and turn Debug %QPUQNGQPQTQĂ Messages Use Messages settings to adjust settings for SMS and MMS messages. Note: The MMS Messaging and Show Subject Field settings donât appear if MMS isnât supported by your carrier. Choose whether or not to see a preview of messages on the Home screen: Choose /GUUCIGUCPFVWTP5JQY2TGXKGYQPQTQĂ Chapter 25 Settings 215 APPLE CONFIDENTIAL â First Draft (1.10.11) Choose whether or not to repeat message alerts: Choose Messages and turn Repeat #NGTVQPQTQĂ+H[QWKIPQTGCOGUUCIGCNGTV[QW¨NNDGCNGTVGFVYQOQTGVKOGU 6WTP//5OGUUCIKPIQPQTQĂChoose Messages and turn MMS Messaging on or QĂ+H//5OGUUCIKPIKUQĂ[QWYQP¨VDGCDNGVQTGEGKXG//5°NGCVVCEJOGPVUUWEJCU images or audio. Group messaging (may not be available in all countries and regions) maintains the thread of the group when sending texts to multiple recipients. 6WTP)TQWR/GUUCIKPIQPQTQĂChoose Messages and turn Group Messaging on or QĂ Show a subject line for messages you send or receive: Choose Messages and turn Show Subject Field on. Show a character count for messages you send or receive: Choose Messages and turn Character Count on. The character count includes all charactersâincluding spaces, punctuation, and returnsâand appears as you type when your message exceeds two lines. iPod Use iPod Settings to adjust settings for music and video playback on your iPod. Music Music settings apply to songs, podcasts, and audiobooks. 6WTP5JCMGVQ5JWĂGQPQTQĂ%JQQUGK2QFVJGPVWTP5JCMGVQ5JWĂGQPQTQĂ 9JGP5JCMGVQ5JWĂGKUQP[QWECPUJCMGK2JQPGVQUJWĂGCPFKOOGFKCVGN[EJCPIG the currently playing song. Set iTunes to play songs at the same sound level: In iTunes, choose iTunes > Preferences if youâre using a Mac, or Edit > Preferences if youâre using a PC. Then click Playback and select Sound Check. Set iPhone to use the iTunes volume settings (Sound Check): Choose iPod and turn Sound Check on. Use the equalizer to customize the sound on iPhone: Choose iPod > EQ and choose a setting. Set a volume limit for music and videos: Choose iPod > Volume Limit and drag the slider to adjust the maximum volume. Tap Lock Volume Limit to assign a code to prevent the setting from being changed. Setting a volume limit only limits the volume for music (including podcasts and audiobooks) and videos (including rented movies and TV shows), and only when headphones, earphones, or speakers are connected to the headset jack on iPhone. 216 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) WARNING: For important information about avoiding hearing loss, see the Important Product Information Guide at www.apple.com/support/manuals/iphone. Show song lyrics and podcast information: Choose iPod and turn Lyrics & Podcast Info on. Video Video settings apply to video content, including rented movies and TV shows. You can set where to resume playing videos that you previously started, turn closed captioning QPQTQĂCPFUGVWRK2JQPGVQRNC[XKFGQUQP[QWT68 Set where to resume playing videos: Choose iPod > Start Playing, then select whether you want videos that you previously started watching to resume playing from VJGDGIKPPKPIQTYJGTG[QWNGHVQĂ 6WTPENQUGFECRVKQPKPIQPQTQĂ%JQQUGK2QFCPFVWTP%NQUGF%CRVKQPKPIQPQTQĂ Note: Not all video content is encoded for closed captioning. TV Out Use these settings to control how iPhone plays videos on your TV. 6WTPYKFGUETGGPQPQTQĂ%JQQUGK2QFCPFVWTP9KFGUETGGPQPQTQĂ Set TV signal to NTSC or PAL: Choose iPod > TV Signal and select NTSC or PAL. NTSC and PAL are TV broadcast standards. iPhone displays NTSC 480p/PAL 576p when attached to a TV using a Component AV Cable, or NTSC 480i/PAL 576i using a Composite AV Cable. Your TV might use NTSC or PAL, depending on where you bought it. If youâre not sure which to use, check the documentation that came with your TV. For more information about using iPhone to play videos on your TV, see âWatching Videos on a TVâ on page 107. Photos Slideshow Use the Slideshow settings to specify how slideshows display your photos. Set the length of time each slide is shown: Choose Photos > Play Each Slide For and select the length of time. 5GVCVTCPUKVKQPGĂGEV%JQQUG2JQVQU 6TCPUKVKQPCPFUGNGEVCVTCPUKVKQPGĂGEV Set whether to repeat slideshows: %JQQUG2JQVQUCPFVWTP4GRGCVQPQTQĂ Set photos to appear randomly or in order: %JQQUG2JQVQUCPFVWTP5JWĂGQPQTQĂ Chapter 25 Settings 217 APPLE CONFIDENTIAL â First Draft (1.10.11) HDR The HDR setting (iPhone 4 only) lets you choose whether to save the normal-exposure photo in addition to the HDR version of a photo when HDR is turned on. See âTaking Photos and Recording Videosâ on page 130. Choose whether to save both the normal-exposure version and the HDR version of photos: +P5GVVKPIUEJQQUG2JQVQUVJGPVWTP-GGR0QTOCN2JQVQQPQTQĂ+HVJG UGVVKPIKUQĂQPN[VJG*&4XGTUKQPQHCRJQVQKUUCXGF If you save both versions, when the controls are visible. appears in the upper-left corner of the HDR photo Notes Use Notes settings to change the font used to display your notes, and to set the default account for notes you add on iPhone. Change the font: Choose Notes, then select the font you want to use. Set the default account for new notes: Choose Notes and tap Default Account. Then select an account, or tap On My iPhone if you donât want notes you add on iPhone to be synced with an account. Store Use Store settings to change or create an Apple ID. By default, the Apple ID youâre signed in to when you sync iPhone with your computer appears in Store settings. You can change Apple IDs on iPhone to purchase music or apps using another Apple ID. If you donât have an Apple ID, you can create one in Store settings. Sign in: Choose Store and tap Sign In, then enter your Apple ID and password. View your account information: Choose Store and tap View Apple ID, then type your password and follow the onscreen instructions. 5KIPKPWUKPICFKĂGTGPV#RRNG+&Choose Store and tap Sign Out, then tap Sign In and enter the Apple ID and password. Create a new Apple ID: Choose Store and tap Create New Apple ID, then follow the onscreen instructions. Nike + iPod Use Nike + iPod settings to activate and adjust settings for the Nike + iPod app (iPhone 3GS or later). See Chapter 27, âNike + iPod,â on page 225. 218 Chapter 25 Settings APPLE CONFIDENTIAL â First Draft (1.10.11) Contacts 26 About Contacts Contacts makes it easy to call, email, or text your friends and associates. You can add contacts directly on iPhone, or sync contacts from applications on your computer. If you have a MobileMe or Microsoft Exchange account with Contacts enabled, or a supported CardDAV account, you can sync your contacts over the air without connecting iPhone to your computer. You can open Contacts from the Home screen, or from the Phone app. Adding Contacts You can add contacts to iPhone in the following ways:  In iTunes, sync contacts from Google or Yahoo!, or sync with applications on your computer (see âiPhone Settings Panes in iTunesâ on page 58)  Set up a MobileMe or Microsoft Exchange account on iPhone, with Contacts enabled (see âSetting Up MobileMe Accountsâ on page 25 or âSetting Up Microsoft Exchange Accountsâ on page 26)  +PUVCNNCRTQ°NGVJCVUGVUWRCP'ZEJCPIGCEEQWPVYKVJ%QPVCEVUGPCDNGF IQVQ www.apple.com/iphone/business)  Set up an LDAP or CardDAV account on iPhone  Enter contacts directly on iPhone  Import contacts from a SIM card The number of contacts you can add is limited only by the amount of memory on iPhone. Set up an LDAP or CardDAV account: 1 In Settings, tap âMail Contacts, Calendars,â then tap Add Account. 219 APPLE CONFIDENTIAL â First Draft (1.10.11) 2 Tap Other, then tap Add LDAP Account or Add CardDAV Account. 3 Enter your account information and tap Next to verify the account. 4 Tap Save. When you set up an LDAP account, you can view and search for contacts on your company or organizationâs LDAP server. The server appears as a new group in Contacts. Since LDAP contacts arenât downloaded to iPhone, you must have an Internet EQPPGEVKQPVQXKGYVJGO%JGEMYKVJ[QWTU[UVGOCFOKPKUVTCVQTHQTURGEK°ECEEQWPV settings and other requirements (such as VPN). When you set up a CardDAV account, your account contacts are synced with iPhone over the air. If itâs supported, you can also search for contacts on your company or organizationâs CardDAV server. Import contacts from another phoneâs SIM card: In Settings, tap âMail, Contacts, Calendars,â then tap Import SIM Contacts. The contact information on the SIM card is imported to iPhone. If you have Contacts enabled for both MobileMe and Microsoft Exchange, youâre asked to choose which account you want to add the SIM contacts to. Important: iPhone doesnât store contacts on its SIM card. Searching Contacts ;QWECPUGCTEJ°TUVNCUVCPFEQORCP[PCOGUKP[QWTEQPVCEVUQPK2JQPG+H[QWJCXG a Microsoft Exchange account set up on iPhone, you may also be able to search your enterprise Global Address List (GAL) for contacts in your organization. If you have an LDAP account set up on iPhone, you can search contacts on your organizationâs LDAP server. If you have a CardDAV account, you can search contacts synced to iPhone, or searchable contacts on a supported CardDAV server. ;QWECPUGCTEJVJG°TUVNCUVCPFEQORCP[PCOG°GNFU#U[QWV[RGKPVJGUGCTEJ°GNF contacts with matching information appear immediately. Search contacts: +P%QPVCEVUVCRVJGUGCTEJ°GNFCVVJGVQRQHCP[NKUVQHEQPVCEVUCPF enter your search. (To scroll quickly to the top of the list, tap the status bar.) Search a GAL: Tap Groups, tap Directories at the bottom of the list, then enter your search. You canât edit GAL contacts or save them to iPhone. Search an LDAP server: Tap Groups, tap the LDAP server name, then enter your search. You canât edit LDAP contacts or save them to iPhone. Search a CardDAV server: Tap Groups, tap the searchable CardDAV group at the bottom of the list, then enter your search. 220 Chapter 26 Contacts APPLE CONFIDENTIAL â First Draft (1.10.11) You canât edit searchable CardDAV contacts from the server, but you can edit synced CardDAV contacts on iPhone. Contacts are included in searches from the Home screen. See âSearchingâ on page 47. Managing Contacts on iPhone Add a contact on iPhone: Tap Contacts and tap . Delete a contact In Contacts, choose a contact, than tap Edit. Scroll down and tap Delete Contact. Add a contact from the numeric keypad 6CR-G[RCFGPVGTCPWODGTVJGPVCR Tap Create New Contact and enter the callerâs information, or tap âAdd to Existing Contactâ and choose a contact. Enter a pause in a number Tap , then tap Pause. One or more pauses may be required by a phone system before dialing an extension, for example. Pauses appear as commas when the number is saved. Enter a hard pause in a number (CDMA model only.) Tap , then tap Wait. A hard pause appears as a semicolon when the number is saved. When dialing, iPhone pauses when it reaches the semicolon, waiting until you tap the Dial button to continue. Add a recent callerâs phone number to your contacts Tap Recents and tap next to the number. Then tap Create New Contact, or tap âAdd to Existing Contactâ and choose a contact. Edit contact information: Choose a contact, then tap Edit.  Add information:(KNNKPCDNCPM°GNF  Add an address: Tap Add New Address.  #FFC°GNFVJCV¨UPQVUJQYKPI Tap Add Field.  Change the ringtone for the contact:6CRVJGTKPIVQPG°GNFVJGPEJQQUGCTKPIVQPG 6QWUGVJGFGHCWNVTKPIVQPGURGEK°GFKPVJG5QWPFUUGVVKPIUEJQQUG&GHCWNV  Delete an item: Tap , then tap Delete. ;QWECPEJCPIG°GNFNCDGNUD[VCRRKPIVJGNCDGNCPFEJQQUKPICFKĂGTGPVQPG6Q create a custom label, scroll to the bottom of the list and tap Add Custom Label. If you sync contacts from your computer and also over the air, you can link contacts to ETGCVGCUKPINGWPK°GFEQPVCEV Link a contact: In edit mode, tap Link Contact, then choose a contact. See â7PK°GF%QPVCEVUâ on page 223. Chapter 26 Contacts 221 APPLE CONFIDENTIAL â First Draft (1.10.11) Assign a photo to a contact: 1 Tap Contacts, then choose a contact. 2 Tap Edit and tap Add Photo, or tap the existing photo. 3 Tap Take Photo and take a photo with the camera. Or tap Choose Existing Photo and choose a photo. 4 Drag and scale the photo as desired. 5 Tap Use Photo (new photo) or Choose (existing photo). Using Contact Information You can use the information on a contactâs Info screen to:  Call the contact  Create an email message in Mail, addressed to the contact  Open the contactâs home page in Safari  Find the location of the contactâs address in Maps, and get directions  Send a text message to the contact  Share the contact information with others  Add a phone number for the contact to your favorites list  Make a FaceTime video call Use a contactâs info screen: Tap Contacts and choose a contact. Then tap an item. *HSS :LUKHULTHPS =PZP[[OL^LIZP[L :LLHTHWHUK NL[KPYLJ[PVUZ 4HRLH -HJL;PTL ]PKLVJHSS :LUKH[L_[TLZZHNL (KKHWOVUL U\TILY[V`V\Y MH]VYP[LZSPZ[ A star next to a phone number means the number is in your favorites list. appears on the FaceTime button if youâve ever had a FaceTime call with the contact. See your own phone number: Tap Contacts and scroll to the top of the list. (Not available in all countries or regions.) 222 Chapter 26 Contacts APPLE CONFIDENTIAL â First Draft (1.10.11) 7PK°GF%QPVCEVU When you sync contacts with multiple accounts, you might have entries for the same person in more than one account. To help keep redundant contacts from appearing KPVJG#NN%QPVCEVUNKUVQPK2JQPGEQPVCEVUHTQOFKĂGTGPVCEEQWPVUVJCVJCXGVJGUCOG °TUVCPFNCUVPCOGUCTGNKPMGFCPFFKURNC[GFCUCUKPINGWPK°GFEQPVCEV (unless they JCXGFKĂGTGPVOKFFNGPCOGU 9JGP[QWXKGYCWPK°GFEQPVCEVVJGVKVNG7PK°GF+PHQ CRRGCTUCVVJGVQRQHVJGUETGGP7PK°GFEQPVCEVUCRRGCTQPN[KPVJG#NN%QPVCEVUNKUV 6JGUQWTEGCEEQWPVUQHCWPK°GFEQPVCEVCRRGCTCVVJGDQVVQOQHVJGUETGGPWPFGT Linked Cards. View contact information from a source account: Tap one of the source accounts. Unlink a contact: Tap Edit, tap Link a contact: Tap Edit, then tap Chapter 26 Contacts , then tap Unlink. and choose a contact. 223 APPLE CONFIDENTIAL â First Draft (1.10.11) +H[QWNKPMEQPVCEVUYKVJFKĂGTGPV°TUVQTNCUVPCOGUVJGPCOGUQPVJGKPFKXKFWCN EQPVCEVUYQP¨VEJCPIGDWVQPN[QPGPCOGCRRGCTUQPVJGWPK°GFECTF6QEJQQUG YJKEJPCOGCRRGCTUYJGPXKGYKPIVJGWPK°GFECTFVCRVJGNKPMGFECTFYKVJVJG PCOG[QWRTGHGTVJGPVCR7UG6JKU0COG(QT7PK°GF%CTF .KPMGFEQPVCEVUCTGP¨VOGTIGF7PNGUU[QWGFKVCWPK°GFEQPVCEVVJGEQPVCEVKP the source account remains separate and unchanged. If you change information KPCWPK°GFEQPVCEVVJGEJCPIGUCTGEQRKGFVQGCEJUQWTEGCEEQWPVKPYJKEJVJCV KPHQTOCVKQPCNTGCF[GZKUVU+H[QWCFFKPHQTOCVKQPVQCWPK°GFEQPVCEVVJCVKPHQTOCVKQP is added to the contact in each source account. Linked contact information also appears at the bottom of an individual contactâs Info UETGGPYJGPKV¨UXKGYGFKPCURGEK°EUQWTEGCEEQWPV VJCVKUPQVKPVJG#NN%QPVCEVU NKUV YJKEJNGVU[QWUGGVJG7PK°GF+PHQUETGGPCPFVJGNKPMGFEQPVCEVHTQOGCEJQHVJG other source accounts. 224 Chapter 26 Contacts APPLE CONFIDENTIAL â First Draft (1.10.11) Nike + iPod 27 Activating Nike + iPod When turned on in Settings, the Nike + iPod app appears on the Home screen (iPhone 3GS or later). With a Nike + iPod Sensor (sold separately), the Nike + iPod app provides audible feedback on your speed, distance, time elapsed, and calories burned during a run or walk. You can send your workout information to nikeplus.com, where you can track your progress, set goals, and participate in challenges. 6WTP0KMG K2QFQPQTQĂIn Settings, choose Nike + iPod and turn Nike + iPod on or QĂ9JGP0KMG K2QFKUVWTPGFQPKVUCRRKEQPCRRGCTUQPVJG*QOGUETGGP See the Nike + iPod documentation for information about setting up and using Nike + iPod. 225 APPLE CONFIDENTIAL â First Draft (1.10.11) Linking a Sensor 6JG°TUVVKOG[QWUVCTVCYQTMQWV[QW¨TGRTQORVGFVQCEVKXCVG[QWTUGPUQTYJKEJ automatically links the sensor with iPhone. You can also use Nike + iPod settings to link a sensor with iPhone. 0KMG K2QFECPNKPMVQQPN[QPGUGPUQTCVCVKOG6QWUGCFKĂGTGPVUGPUQTWUG0KMG iPod settings to link the new sensor. Link a sensor to iPhone: 1 Put the Nike + iPod sensor in your shoe. 2 In Settings on iPhone, choose Nike + iPod > Sensor. 3 Tap Link New, then walk around as instructed. 4 Tap Done when the sensor is linked. Working Out with Nike + iPod After activating Nike + iPod and inserting the Nike + iPod Sensor in your Nike+ ready shoe, you can use Nike + iPod for your workouts. Work out using Nike + iPod: 1 In Nike + iPod on iPhone, tap Workouts, then choose a type of workout. 2 Depending on the workout, you may need to set a time, distance, or calorie goal. 3 Choose a playlist or other audio selection, then start your workout. 4 9JGP[QW°PKUJ[QWTYQTMQWVVCR'PF9QTMQWV To turn on spoken feedback or set other options, see âNike + iPod Settingsâ on page 227. Sending Workouts to Nikeplus.com 6JG°TUVVKOG[QWEQPPGEVK2JQPGVQK6WPGUCHVGTCYQTMQWV[QW¨TGCUMGFKH[QWYCPV to automatically send your workouts to Nike+ when you sync iPhone. Click Send to send your current workout to nikeplus.com and set iTunes to automatically send future workouts when you sync iPhone with iTunes. If you click Donât Send, you can set iTunes to do this later. Set iTunes to automatically send workouts to nikeplus.com when you sync iPhone with iTunes: 1 Connect iPhone to your computer. Make sure your computer is connected to the Internet. 2 In iTunes, click Nike + iPod at the top of the screen, then select âAutomatically send workout data to nikeplus.com.â 226 Chapter 27 Nike + iPod APPLE CONFIDENTIAL â First Draft (1.10.11) 3 Click âVisit nikeplus.comâ or click Visit in the dialog that appears. 4 Click Save Your Runs and log in, or register if you havenât already done so. Send workout data wirelessly to nikeplus.com from iPhone: 1 In Nike + iPod on iPhone, tap History. Make sure iPhone is connected to the Internet. 2 Tap âSend to Nike+.â 3 Enter your email address and nikeplus.com account password, then tap âLogin to Nike +.â If you donât already have a nikeplus.com account, tap Join Nike+ to set one up. To see your workouts on nikeplus.com, log in to your account and follow the onscreen instructions. Calibrating Nike + iPod You calibrate Nike + iPod using a workout you just completed. You can only calibrate workouts of a quarter mile or more. Calibrate iPhone: 1 Run or walk a known distance, then tap End Workout. 2 Tap Calibrate, then enter the distance and tap Done. Reset Nike + iPod to the default calibration: In Settings, choose Nike + iPod, then tap Reset Calibration. Nike + iPod Settings In Settings, choose Nike + iPod to activate and adjust settings for the Nike + iPod app. Choose a PowerSong: Choose PowerSong and select a song from your music library. 6WTPURQMGPHGGFDCEMQPQTQĂChoose Spoken Feedback and select a male or HGOCNGXQKEGVQCEEQORCP[[QWTYQTMQWVQT1ĂVQVWTPQĂURQMGPHGGFDCEM Set a distance preference: %JQQUG&KUVCPEGVJGPUGNGEV/KNGUQT-KNQOGVGTUVQ measure your workout distance. Set your weight: %JQQUG9GKIJVVJGPÂąKEMVQGPVGT[QWTYGKIJV Set the screen orientation: Choose Lock Screen, then select a screen orientation preference. Set up the Nike + iPod Sensor: Choose Sensor, then follow the onscreen instructions to set up your sensor (sold separately). You can use a Nike+ compatible remote (sold separately) to control Nike + iPod YKTGNGUUN[$GHQTGWUKPICTGOQVGHQTVJG°TUVVKOG[QWOWUVUGVKVWRQPK2JQPG Chapter 27 Nike + iPod 227 APPLE CONFIDENTIAL â First Draft (1.10.11) Set up the Nike + iPod remote: Choose Remote, then follow the onscreen instructions to set up your remote (third-party product sold separately). Reset Nike + iPod to the default calibration: Tap Reset Calibration. 228 Chapter 27 Nike + iPod APPLE CONFIDENTIAL â First Draft (1.10.11) iBooks 28 About iBooks iBooks is a great way to read and buy books. Download the free iBooks app from the App Store, and then get everything from classics to best sellers from the built-in iBookstore. Once you download a book, itâs displayed on your bookshelf. Add ePub books and PDFs to your bookshelf using iTunes. Then tap a book or PDF to start reading. iBooks remembers your location, so you can easily return to where you NGHVQĂ#YKFGTCPIGQHFKURNC[QRVKQPUOCMGUVJGDQQMUGCU[VQTGCF Note: The iBooks app and the iBookstore may not be available in all languages or locations. (]HPSHISLVU[OLP)VVRZ[VYL;P[SLH]HPSHIPSP[`PZ Z\IQLJ[[VJOHUNL To download the iBooks app and use the iBookstore, you need an Internet connection and an Apple account. If you donât have an Apple account, or if you want to make purchases from another Apple account, go to Settings > Store. See âStoreâ on page 218. 229 APPLE CONFIDENTIAL â First Draft (1.10.11) Syncing Books and PDFs Use iTunes to sync your books and PDFs between iPhone and your computer. When iPhone is connected to your computer, the Books pane lets you select which items to sync. You can sync books that you download or purchase from the iBookstore. You can also add DRM-free ePub books and PDFs to your iTunes library. There are several websites VJCVQĂGTDQQMUKPG2WDCPF2&(HQTOCV Sync an ePub book or PDF to iPhone: Download the book or PDF using your EQORWVGT6JGPKPK6WPGUEJQQUG(KNG #FFVQ.KDTCT[CPFUGNGEVVJG°NG%QPPGEV iPhone to your computer, select the book or PDF in the Books pane in iTunes, and then sync iPhone. If a PDF doesnât appear in the Books pane, you need to change its type in iTunes. 5GCTEJ[QWTK6WPGUNKDTCT[VQ°PFVJG2&(UGNGEVKVVJGPEJQQUG(KNG )GV+PHQ+PVJG 1RVKQPUUGEVKQPQHVJG°NGKPHQTOCVKQPYKPFQYEJQQUG$QQMHTQOVJG/GFKC-KPF RQRWROGPWVJGPENKEM1- Using the iBookstore In the iBooks app, tap Store to open the iBookstore. From there, you can browse HGCVWTGFDQQMUQTDGUVUGNNGTUCPFDTQYUGHQTDQQMUD[CWVJQTQTVQRKE9JGP[QW°PF a book you like, you can purchase and download it. Note: Some features of the iBookstore may not be available in all locations. Get more information: In the iBookstore, you can read a summary of the book, read or write a review, and download a sample of the book before buying it. Purchase a book: Find a book you want, tap the price, then tap Buy Now. Sign in to [QWT#RRNGCEEQWPVVJGPVCR1-5QOGDQQMUOC[DGHTGGHQTFQYPNQCFKPI The purchase is charged to your Apple account. If you make additional purchases YKVJKPVJGPGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP If youâve already purchased a book and want to download it again, tap Purchases in VJGK$QQMUVQTGCPF°PFVJGDQQMKPVJGNKUV6JGPVCR4GFQYPNQCF Books that you purchase are synced to your iTunes library the next time you sync iPhone with your computer. This provides a backup in case you delete the book from iPhone. 230 Chapter 28 iBooks APPLE CONFIDENTIAL â First Draft (1.10.11) Reading Books Reading a book is easy. Go to the bookshelf and tap the book you want to read. If you donât see the book youâre looking for, tap the name of the current collection at the top of the screen to go to other collections. Turn pages: 6CRPGCTVJGTKIJVQTNGHVOCTIKPQHCRCIGQTÂąKEMNGHVQTTKIJV6QEJCPIG the direction the page turns when you tap the left margin, go to Settings > iBooks. )QVQCURGEK°ERCIGTap near the center of the current page to show the controls. Drag the page navigation control at the bottom of the screen to the desired page, then let go. Go to the table of contents: Tap near the center of the current page to show the controls, then tap . Tap an entry to jump to that location, or tap Resume to return to the current page. Add or remove a bookmark: Tap the ribbon button to set a bookmark. You can have multiple bookmarks. To remove a bookmark, tap it. You donât need to set a bookmark YJGP[QWENQUGCDQQMDGECWUGK$QQMUTGOGODGTUYJGTG[QWNGHVQĂCPFTGVWTPU there when you open the book again. Add, remove, or edit a highlight: Touch and hold any word until itâs selected. Use the grab points to adjust the selection, then tap Highlight. To remove a highlight, tap the highlighted text, then tap Remove Highlight. To change the color of a highlight, tap the highlighted text, then tap Colors and select a color from the menu. Add, remove, or edit a note: Touch and hold any word until itâs selected. Use the grab points to adjust the selection, then tap Note. Type some text, then tap Done. To view a note, tap the indicator in the margin near the highlighted text. To remove a note, tap the highlighted text, then tap Delete Note. To change the color of a note, tap the highlighted text, then tap Colors and select a color from the menu. See all your bookmarks, highlights and notes: To see the bookmarks, highlights, and notes youâve added, tap , then tap Bookmarks. To view a note, tap its indicator. Chapter 28 iBooks 231 APPLE CONFIDENTIAL â First Draft (1.10.11) Enlarge an image: Double-tap the image. To read a book while lying down, use the portrait orientation lock to prevent iPhone from rotating the screen when you rotate iPhone. See âViewing in Portrait or Landscape Orientationâ on page 32. Reading PDFs You can use iBooks to read PDFs. Go to the bookshelf and tap Collections, select a collection, then tap the PDF you want to read. Turn pages: Flick left or right. Enlarge a page: Pinch to zoom in on the page, then scroll to see the portion you want. )QVQCURGEK°ERCIGTap near the center of the current page to show the controls. Then, in the page navigation controls at the bottom of the page, drag until the desired page number appears, or tap a thumbnail to jump to that page. Add or remove a bookmark: Tap the ribbon button to set a bookmark. You can have multiple bookmarks. To remove a bookmark, tap it. You donât need to set a bookmark when you close a PDF, because iBooks remembers YJGTG[QWNGHVQĂCPFTGVWTPUVJGTGYJGP[QWQRGPKVCICKP Go to the table of contents: Tap near the center of the current page to show the controls, then tap . Tap an entry to jump to that location, or tap Resume to return to VJGEWTTGPVRCIG+HVJGCWVJQTJCUP¨VFG°PGFCVCDNGQHEQPVGPVU[QWECPVCRCRCIG icon instead to go to that page. Changing a Bookâs Appearance To change the appearance of a book, access the controls by tapping near the center of a page. Change the font or type size: Tap , then in the list that appears, tap or to reduce or enlarge the type size. To change the font, tap Fonts, then select one from the list. Changing the font and size also changes text formatting. Change the brightness: Tap iBooks. , then adjust the brightness. This setting applies only in Change the page and type color: Tap , then turn the Sepia option on to change the color of the page and type. This setting applies to all books. ;QWECPEJCPIGVJGYC[VJCVK$QQMULWUVK°GUVJGVGZVQHRCTCITCRJUKP5GVVKPIU iBooks. 232 Chapter 28 iBooks APPLE CONFIDENTIAL â First Draft (1.10.11) Searching Books and PDFs You can search for the title or author of a book to quickly locate it on the bookshelf. ;QWECPCNUQUGCTEJVJGEQPVGPVUQHCDQQMVQ°PFCNNVJGTGHGTGPEGUVQCYQTFQT RJTCUG[QW¨TGKPVGTGUVGFKP;QWECPCNUQUGPFCUGCTEJVQ9KMKRGFKCQT)QQINGVQ°PF other related resources. Search for a book: Go to the bookshelf. If necessary, change to the collection that you want to search. Tap the status bar to scroll to the top of the screen, then tap the magnifying glass. Enter a word thatâs in the title of a book, or the authorâs name, then tap Search. Matching books appear on the bookshelf. Search in a book: Open a book and tap near the center of the page to show the controls. Tap the magnifying glass, then enter a search phrase and tap Search. Tap a search result to go to that page in the book. To send your search to Google or Wikipedia, tap Search Google or Search Wikipedia. Safari opens and displays the result. To quickly search for a word in a book, touch and hold the word, then tap Search. .QQMKPIWRVJG&G°PKVKQPQHC9QTF ;QWECPNQQMWRVJGFG°PKVKQPQHCYQTFWUKPIVJGFKEVKQPCT[ Look up a word: Select a word in a book, then tap Dictionary in the menu that appears. Dictionaries may not be available for all languages. Having a Book Read to You If you have a visual impairment, you can use VoiceOver to read a book aloud. See âVoiceOverâ on page 236. Some books may not be compatible with VoiceOver. Printing or Emailing a PDF You can use iBooks to send a copy of a PDF via email, or to print all or a portion of the PDF to a supported printer. Email a PDF: Open the PDF, then tap and choose Email Document. A new message CRRGCTUYKVJVJG2&(CVVCEJGF9JGP[QW°PKUJCFFTGUUKPICPFYTKVKPI[QWTOGUUCIG tap Send. Print a PDF: Open the PDF, then tap and choose Print. Select a printer and the page range and number of copies, then tap Print. For more information, see âPrintingâ on page 45. You can only email or print PDFs. These options arenât available for ePub books. Chapter 28 iBooks 233 APPLE CONFIDENTIAL â First Draft (1.10.11) Organizing the Bookshelf Use the bookshelf to browse your books and PDFs. You can also organize items into collections. Sort the bookshelf: Go to the bookshelf and tap the status bar to scroll to the top of the screen, then tap and select a sort method from the choices at the bottom of the screen. Rearrange items on the bookshelf: Touch and hold a book or PDF, then drag it to a new location on the bookshelf. Delete an item from the bookshelf: Go to the bookshelf and tap Edit. Tap each book or PDF that you want to delete so that a checkmark appears, then tap Delete. When [QW°PKUJFGNGVKPIVCR&QPG+H[QWFGNGVGCDQQM[QWRWTEJCUGF[QWECPFQYPNQCF it again from Purchases in the iBookstore. If youâve synced your device with your computer, the book also remains in your iTunes Library. Create, rename, or delete a collection: Tap the name of the current collection youâre viewing, such as Books or PDFs, to display the collections list. Tap New to add a new collection. To delete a collection, tap Edit, then tap and tap Delete. You canât edit or remove the built-in Books and PDFs collections. To edit the name of a collection, tap its PCOG9JGP[QW°PKUJVCR&QPG Move a book or PDF to a collection: Go to the bookshelf and tap Edit. Tap each book or PDF that you want to move so that a checkmark appears, then tap Move and select a collection. Items can be in only one collection at a time. When you add a book or 2&(VQ[QWTDQQMUJGNHHQTVJG°TUVVKOGKV¨URWVKPVQVJG$QQMUQT2&(EQNNGEVKQP(TQO VJGTG[QWECPOQXGKVVQCFKĂGTGPVEQNNGEVKQP;QWOKIJVYCPVVQETGCVGEQNNGEVKQPUHQT work and school, for example, or for reference and leisure reading. View a collection: Tap the name of the current collection at the top of the screen, then pick a new one from the list that appears. Bookmark and Note Syncing iBooks saves your bookmarks, notes, and current page information in your Apple account, so theyâre always up to date and you can read a book seamlessly across multiple devices. For PDFs, the bookmarks and current page information are synced. 6WTPDQQMOCTMU[PEKPIQPQTQĂGo to Settings > iBooks, then turn Sync Bookmarks QPQTQĂ You must have an Internet connection to sync your settings. iBooks syncs information for all of your books when you open or quit the app. Information for individual books is also synced when you open or close the book. 234 Chapter 28 iBooks APPLE CONFIDENTIAL â First Draft (1.10.11) Accessibility 29 Universal Access Features In addition to the many features that make iPhone easy to use for everyone, accessibility features (iPhone 3GS or later) are designed to make it easier for users with visual, auditory, or other physical disabilities to use iPhone. These accessibility features include:  VoiceOver  Zoom  Large Text  White on Black  Mono Audio  Speak Auto-text  Support for braille displays With the exception of VoiceOver, these accessibility features work with all iPhone apps, including third-party apps you download from the App Store. VoiceOver works with all apps that come preinstalled on iPhone, and with many third-party apps. For more information about iPhone accessibility features, go to www.apple.com/ accessibility. 'CEJCEEGUUKDKNKV[HGCVWTGECPDGVWTPGFQPQTQĂKP#EEGUUKDKNKV[UGVVKPIUQPK2JQPG ;QWECPCNUQVWTPCEEGUUKDKNKV[HGCVWTGUQPQTQĂKPK6WPGUYJGPK2JQPGKUEQPPGEVGFVQ your computer. 6WTPCEEGUUKDKNKV[HGCVWTGUQPQTQĂKPK6WPGU 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the Devices list. 3 +PVJG5WOOCT[RCPGENKEM%QP°IWTG7PKXGTUCN#EEGUUKPVJG1RVKQPUUGEVKQP 235 APPLE CONFIDENTIAL â First Draft (1.10.11) 4 5GNGEVVJGCEEGUUKDKNKV[HGCVWTGUVJCV[QWYCPVVQWUGCPFENKEM1- .CTIG6GZVECPQPN[DGVWTPGFQPQTQĂWUKPIK2JQPGUGVVKPIU5GGÂĽLarge Textâ on page 250. ;QWECPVWTPENQUGFECRVKQPKPIQPQTQĂKPK2QFUGVVKPIU5GGÂĽVideosâ on page 104. VoiceOver VoiceOver describes aloud what appears onscreen, so that you can use iPhone without UGGKPIKV8QKEG1XGTURGCMUKPVJGNCPIWCIGURGEK°GFKP+PVGTPCVKQPCNUGVVKPIUYJKEJ OC[DGKPÂąWGPEGFD[VJG4GIKQP.QECNGUGVVKPI Note: VoiceOver is available in many languages, but not all. VoiceOver tells you about each element on the screen as itâs selected. When an GNGOGPVKUUGNGEVGFKV¨UGPENQUGFD[CDNCEMTGEVCPING HQTVJGDGPG°VQHVJQUGYJQECP see the screen) and VoiceOver speaks the name or describes the item. The enclosing rectangle is referred to as the VoiceOver cursor. If text is selected, VoiceOver reads the text. If a control (such as a button or switch) is selected and Speak Hints is turned on, VoiceOver may tell you the action of the item or provide instructions for youâfor example, âdouble-tap to open.â When you go to a new screen, VoiceOver plays a sound and then selects and speaks VJG°TUVGNGOGPVQHVJGUETGGP V[RKECNN[VJGKVGOKPVJGWRRGTNGHVEQTPGT 8QKEG1XGT also lets you know when the screen changes to landscape or portrait, and when it is locked or unlocked. Setting Up VoiceOver Important: VoiceOver changes the gestures used to control iPhone. Once VoiceOver is turned on, you have to use VoiceOver gestures to operate iPhoneâeven to turn 8QKEG1XGTQĂCICKPVQTGUWOGUVCPFCTFQRGTCVKQP 236 Chapter 29 Accessibility APPLE CONFIDENTIAL â First Draft (1.10.11) 6WTP8QKEG1XGTQPQTQĂIn Settings, choose General > Accessibility > VoiceOver and VCRVJG8QKEG1XGT1P1ĂUYKVEJ ;QWECPCNUQUGV6TKRNGENKEM*QOGVQVWTP8QKEG1XGTQPQTQĂ5GGÂĽTriple-Click Homeâ on page 251. Note: You cannot use VoiceOver and Zoom at the same time. 6WTPURQMGPJKPVUQPQTQĂIn Settings, choose General > Accessibility > VoiceOver, CPFVCRVJG5RGCM*KPVU1P1ĂUYKVEJ9JGP5RGCM*KPVUKUVWTPGFQP8QKEG1XGTOC[ tell you the action of the item or provide instructions for youâfor example, âdoubletap to open.â Speak Hints is turned on by default. Set the VoiceOver speaking rate: In Settings, choose General > Accessibility > VoiceOver, and adjust the Speaking Rate slider. Add speaking rate to the rotor: In Settings, choose General > Accessibility and tap to turn on âInclude in Rotor.â You can choose the kind of feedback you get when you type. You can set VoiceOver to speak characters, words, both, or nothing. If you choose to hear both characters and words, VoiceOver speaks each character as you type it, then speaks the whole word YJGP[QW°PKUJKVD[GPVGTKPICURCEGQTRWPEVWCVKQP Choose typing feedback: In Settings, choose General > Accessibility > VoiceOver > Typing Feedback. You can choose Characters, Words, Characters and Words, or Nothing HQTUQHVYCTGMG[DQCTFUCPFHQTCP#RRNG9KTGNGUU-G[DQCTF UGGÂĽUsing an Apple 9KTGNGUU-G[DQCTFâ on page 44). Use phonetics In Settings, choose General > Accessibility > VoiceOver, then tap the Use Phonetics switch to turn it on. Use this feature when you type or read characterby-character, to help make clear which characters were spoken. When Use Phonetics is turned on, 8QKEGQXGT°TUVURGCMUVJGEJCTCEVGTVJGPURGCMUC word beginning with the character. For example, if you type the character âf,â VoiceOver speaks âf,â and then a moment later, âfoxtrot.â Use pitch change In Settings, choose General > Accessibility > VoiceOver, then tap the Use Pitch Change switch to turn it on. VoiceOver uses a higher pitch when entering a letter, and a lower pitch when deleting a letter. VoiceOver also uses a higher pitch when URGCMKPIVJG°TUVKVGOQHCITQWR UWEJCUCNKUV or table) and a lower pitch when speaking the last item of a group. $[FGHCWNV8QKEG1XGTWUGUVJGNCPIWCIGVJCV¨UUGVHQTK2JQPG;QWECPUGVCFKĂGTGPV language for VoiceOver. Chapter 29 Accessibility 237 APPLE CONFIDENTIAL â First Draft (1.10.11) Set the language for iPhone: In Settings, choose General > International > Language, VJGPUGNGEVCNCPIWCIGCPFVCR1-5QOGNCPIWCIGUOC[DGKPÂąWGPEGFD[VJG4GIKQP Local setting. In Settings, choose General > International > Region Format and select the format. Set the language for VoiceOver: In Settings, choose General > International > Voice Control, then choose the language. If you change the language for iPhone, you may need to reset the language for VoiceOver. Set the rotor options for web browsing: In Settings, choose General > Accessibility > VoiceOver > Web Rotor. Tap to select or deselect options. To change the position of an item in the list, touch next to the item, then drag up or down. Select the languages available in the Language rotor: In Settings, choose General > Accessibility > VoiceOver > Language Rotor and tap to select the language or languages you want to appear in the Language rotor. To change the position of a language in the list, touch next to the language and drag up or down. The Language rotor is always available when youâve selected more than one language. VoiceOver Gestures 9JGP8QKEG1XGTKUVWTPGFQPVJGUVCPFCTFVQWEJUETGGPIGUVWTGUJCXGFKĂGTGPVGĂGEVU These and some additional gestures let you move around the screen and control individual elements when theyâre selected. VoiceOver gestures include two- and VJTGG°PIGTUIGUVWTGUVQVCRQTÂąKEM(QTDGUVTGUWNVUYJGPWUKPIVYQCPFVJTGG°PIGT IGUVWTGUTGNCZCPFNGV[QWT°PIGTUVQWEJVJGUETGGPYKVJUQOGURCEGDGVYGGPVJGO You can use standard gestures when VoiceOver is turned on, by double-tapping and JQNFKPI[QWT°PIGTQPVJGUETGGP#UGTKGUQHVQPGUKPFKECVGUVJCVPQTOCNIGUVWTGU CTGKPHQTEG6JG[TGOCKPKPGĂGEVWPVKN[QWNKHV[QWT°PIGT6JGP8QKEG1XGTIGUVWTGU resume. ;QWECPWUGFKĂGTGPVVGEJPKSWGUVQGPVGT8QKEG1XGTIGUVWTGU(QTGZCORNG[QWECP GPVGTCVYQ°PIGTVCRWUKPIVYQ°PIGTUHTQOQPGJCPFQTQPG°PIGTHTQOGCEJJCPF ;QWECPCNUQWUG[QWTVJWODU/CP[°PFVJGÂĽURNKVVCRÂŚIGUVWTGGURGEKCNN[GĂGEVKXG instead of selecting an item and double-tapping, you can touch and hold an item with QPG°PIGTVJGPVCRVJGUETGGPYKVJCPQVJGT°PIGT6T[FKĂGTGPVVGEJPKSWGUVQFKUEQXGT which works best for you. If your gestures donât work, try quicker movements, especially for double-tapping and ÂąKEMKPIIGUVWTGU6QÂąKEMVT[SWKEMN[DTWUJKPIVJGUETGGPYKVJ[QWT°PIGTQT°PIGTU When VoiceOver is turned on, the VoiceOver Practice button appears, which gives you a chance to practice VoiceOver gestures before proceeding. Practice gestures: In Settings, choose General > Accessibility > VoiceOver, then tap 8QKEG1XGT2TCEVKEG9JGP[QW°PKUJRTCEVKEKPIVCR&QPG 238 Chapter 29 Accessibility APPLE CONFIDENTIAL â First Draft (1.10.11) If you donât see the VoiceOver Practice button, make sure VoiceOver is turned on. Hereâs a summary of key VoiceOver gestures: Navigating and Reading  Tap: Speak item.  Flick right or left: Select the next or previous item.  Flick up or down: Depends on the Rotor Control setting. See âRotor Controlâ on page 240.  6YQ°PIGTVCR Stop speaking the current item.  6YQ°PIGTÂąKEMWR Read all from the top of the screen.  6YQ°PIGTÂąKEMFQYP Read all from the current position.  6YQ°PIGTÂĽUETWDÂŚ/QXGVYQ°PIGTUDCEMCPFHQTVJVJTGGVKOGUSWKEMN[ OCMKPIC âzâ) to dismiss an alert or go back to the previous screen.  6JTGG°PIGTÂąKEMWRQTFQYP Scroll one page at a time.  6JTGG°PIGTÂąKEMTKIJVQTNGHV Go to the next or previous page (such as the Home screen, Stocks, or Safari).  6JTGG°PIGTVCR Speak the scroll status (which page or rows are visible).  (QWT°PIGTÂąKEMWR5GNGEVVJG°TUVGNGOGPVQPVJGUETGGP  (QWT°PIGTÂąKEMFQYP Select the last element on the screen. Activating  Double-tap: Activate the selected item.  Triple-tap: Double-tap an item.  Split-tap: An alternative to selecting an item and double-tapping is to touch an item YKVJQPG°PIGTVJGPVCRVJGUETGGPYKVJCPQVJGTVQCEVKXCVGCPKVGO  6QWEJCPKVGOYKVJQPG°PIGTVCRVJGUETGGPYKVJCPQVJGT°PIGT ÂĽURNKVVCRRKPIÂŚ Activate the item.  Double-tap and hold (1 second) + standard gesture: Use a standard gesture. The double-tap and hold gesture tells iPhone to interpret the subsequent gesture as UVCPFCTF(QTGZCORNG[QWECPFQWDNGVCRCPFJQNFVJGPYKVJQWVNKHVKPI[QWT°PIGT FTCI[QWT°PIGTVQUNKFGCUYKVEJ  6YQ°PIGTFQWDNGVCR Answer or end a call. Play or pause in iPod, YouTube, Voice Memos, or Photos. Take a photo (Camera). Start or pause recording in Camera or Voice Memos. Start or stop the stopwatch.  6JTGG°PIGTFQWDNGVCR Mute or unmute VoiceOver.  6JTGG°PIGTVTKRNGVCR6WTPVJGUETGGPEWTVCKPQPQTQĂ Chapter 29 Accessibility 239 APPLE CONFIDENTIAL â First Draft (1.10.11) Rotor Control The rotor control is a virtual dial that you can use to change the results of up and FQYPÂąKEMIGUVWTGUYJGP8QKEG1XGTKUVWTPGFQP Operate the rotor: 4QVCVGVYQ°PIGTUQPVJGK2JQPGUETGGPVQÂĽVWTPÂŚVJGFKCNVQ choose between options. The current setting appears on the screen and is spoken aloud. 6JGGĂGEVQHVJGTQVQTFGRGPFUQPYJCV[QW¨TGFQKPI(QTGZCORNGKH[QW¨TGTGCFKPI text in an email you received, you can use the rotor to switch between hearing text URQMGPYQTFD[YQTFQTEJCTCEVGTD[EJCTCEVGTYJGP[QWÂąKEMWRQTFQYP+H[QW¨TG browsing a webpage, you can use the rotor setting to hear all the text (either word-byword or character-by-character), or to jump from one element to another of a certain type, such as headers or links. The following lists show the available rotor options, depending on the context of what youâre doing. Reading text Select and hear text by:  Character  Word  Line Browsing a webpage Select and hear text by:  Character  Word  Line  Heading  Link  Visited link  Non-visited link  In-page link  Form control  Table 240 Chapter 29 Accessibility APPLE CONFIDENTIAL â First Draft (1.10.11)  Row (when navigating a table)  List  Landmark  Image  Static text Zoom in or out Entering text Move insertion point and hear text by:  Character  Word  Line Select edit function Select language Using a control (such as the spinner for setting the time in Clock) Select and hear values by:  Character  Word  Line Adjust the value of the control object Speaking (available only with the Apple Wireless Keyboard) Adjust VoiceOver speaking by:  Volume  Rate  Typing echo  Use pitch change  Use Phonetics See â%QPVTQNNKPI8QKEG1XGT7UKPICP#RRNG9KTGNGUU-G[DQCTFâ on page 246. You can select which rotor options appear for web browsing, and arrange their order. See âSetting Up VoiceOverâ on page 236. Chapter 29 Accessibility 241 APPLE CONFIDENTIAL â First Draft (1.10.11) Using VoiceOver Select items on the screen: &TCI[QWT°PIGTQXGTVJGUETGGP8QKEG1XGTKFGPVK°GU each element as you touch it. You can move systematically from one element to the PGZVD[ÂąKEMKPINGHVQTTKIJVYKVJCUKPING°PIGT'NGOGPVUCTGUGNGEVGFHTQONGHVVQ TKIJVVQRVQDQVVQO(NKEMTKIJVVQIQVQVJGPGZVGNGOGPVQTÂąKEMNGHVVQIQVQVJG previous element. 7UGHQWT°PIGTIGUVWTGUVQUGNGEVVJG°TUVQTNCUVGNGOGPVQPCUETGGP  5GNGEVVJG°TUVGNGOGPVQPCUETGGP(NKEMWRYKVJHQWT°PIGTU  Select the last element on a screen: (NKEMFQYPYKVJHQWT°PIGTU âTapâ a selected item when VoiceOver is turned on: Double-tap anywhere on the screen. âDouble-tapâ a selected item when VoiceOver is turned on: Triple-tap anywhere on the screen. Speak the text of an element, character-by-character or word-by-word: With VJGGNGOGPVUGNGEVGFÂąKEMWRQTFQYPYKVJQPG°PIGT(NKEMFQYPVQTGCFVJGPGZV EJCTCEVGTQTÂąKEMWRVQTGCFVJGRTGXKQWUEJCTCEVGT7UGRJQPGVKEUVQJCXG8QKEG1XGT also speak a word beginning with the character being spoken. See âSetting Up VoiceOverâ on page 236. Twist the rotor control to have VoiceOver read word-by-word. Adjust a slider: 9KVJCUKPING°PIGTÂąKEMWRVQKPETGCUGVJGUGVVKPIQTFQYPVQ decrease the setting. VoiceOver announces the setting as you adjust it. 242 Chapter 29 Accessibility APPLE CONFIDENTIAL â First Draft (1.10.11) Scroll a list or area of the screen (NKEMWRQTFQYPYKVJVJTGG°PIGTU(NKEMFQYP to page down through the list or screen, or ÂąKEMWRVQRCIGWR9JGPRCIKPIVJTQWIJCNKUV VoiceOver speaks the range of items displayed (for example, âshowing rows 5 through 10â). You can also scroll continuously through a list, instead of paging through it. Double-tap and hold. When you hear a series of tones, you can OQXG[QWT°PIGTWRQTFQYPVQUETQNNVJGNKUV Continuous scrolling stops when you lift your °PIGT Use a list index Some lists have an alphabetical index along the right side. The index cannot be selected by ÂąKEMKPIDGVYGGPGNGOGPVU[QWOWUVVQWEJVJG index directly to select it. With the index selected, ÂąKEMWRQTFQYPVQOQXGCNQPIVJGKPFGZ;QW ECPCNUQFQWDNGVCRVJGPUNKFG[QWT°PIGTWRQT down. Reorder a list Some lists, such as Favorites in Phone, and Web Rotor and Language Rotor in Accessibility settings can be reordered. Select on the right side of an item, double-tap and hold until you hear a sound, then drag up or down. VoiceOver speaks the item youâve moved above or below, depending on the direction youâre dragging. Unlock iPhone: Select the Unlock switch, then double-tap the screen. Rearrange the Home screen: On the Home screen, select the icon you want to move. Double-tap and hold the icon, then drag it. VoiceOver speaks the row and column position as you drag the icon. Release the icon when itâs in the location you want. You can drag additional icons. Drag an item to the left or right edge of the screen to move KVVQCFKĂGTGPVRCIGQHVJG*QOGUETGGP9JGP[QW°PKUJRTGUUVJG*QOG button. Mute VoiceOver &QWDNGVCRYKVJVJTGG°PIGTU&QWDNGVCRCICKP YKVJVJTGG°PIGTUVQVWTPURGCMKPIDCEMQP6Q VWTPQĂQPN[8QKEG1XGTUQWPFUUGVVJG4KPI Silent switch to Silent. If you have an external keyboard connected, you can also press the Control key on the keyboard to mute or unmute VoiceOver. Stop speaking an item 6CRQPEGYKVJVYQ°PIGTU6CRCICKPYKVJ VYQ°PIGTUVQTGUWOGURGCMKPI5RGCMKPI automatically resumes when you select another item. 6WTPVJGUETGGPEWTVCKPQPQTQĂ 6TKRNGVCRYKVJVJTGG°PIGTU9JGPUETGGPEWTVCKP is on, the screen contents are active even though VJGFKURNC[KUVWTPGFQĂ Chapter 29 Accessibility 243 APPLE CONFIDENTIAL â First Draft (1.10.11) Speak the entire screen from the top (NKEMWRYKVJVYQ°PIGTU Speak from the current item to the bottom of the screen (NKEMFQYPYKVJVYQ°PIGTU You can hear iPhone status information by touching the top of the screen. This information can include the time, battery life, Wi-Fi signal strength, and more. Making Phone Calls with VoiceOver &QWDNGVCRVJGUETGGPYKVJVYQ°PIGTUVQCPUYGTQTGPFCECNN9JGPCRJQPGECNN is established with VoiceOver on, the screen displays the numeric keypad by default, instead of showing call options. This makes it easier to use the keypad to respond to a menu of options when you reach an automated system. Display call options: 5GNGEVVJG*KFG-G[RCFDWVVQPKPVJGNQYGTTKIJVEQTPGTCPF double-tap. Display the numeric keypad again: 5GNGEVVJG-G[RCFDWVVQPPGCTVJGEGPVGTQHVJG screen and double-tap. Entering and Editing Text 9JGP[QWGPVGTCPGFKVCDNGVGZV°GNF[QWECPWUGVJGQPUETGGPMG[DQCTFQTCP external keyboard connected to iPhone to enter text. There are two ways to enter text in VoiceOverâstandard typing and âtouchâ typing. With standard typing, you select a key, then double-tap the screen to enter the character. With touch typing, you touch to select a key and the character is entered CWVQOCVKECNN[YJGP[QWNKHV[QWT°PIGT6QWEJV[RKPIECPDGSWKEMGTDWVOC[TGSWKTG more practice than standard typing. VoiceOver also lets you use the editing features of iPhone to cut, copy, or paste in a VGZV°GNF Enter text: 1 5GNGEVCVGZV°GNFVQDTKPIWRVJGQPUETGGPMG[DQCTF You may need to double-tap to bring up the keyboard, if it doesnât appear CWVQOCVKECNN[8QKEG1XGTYKNNVGNN[QWKHVJGVGZV°GNFÂĽKUGFKVKPIÂŚQTKH[QWPGGFVQ âdouble-tap to edit.â +HVJG°GNFCNTGCF[EQPVCKPUVGZVVJGKPUGTVKQPRQKPVKURNCEGFGKVJGTCVVJGDGIKPPKPI or at the end of the text. Double-tap to move the insertion point to the opposite end. VoiceOver tells you the position of the insertion point. 2 Use the keyboard to type characters: 244 Chapter 29 Accessibility APPLE CONFIDENTIAL â First Draft (1.10.11)  Standard typing: 5GNGEVCMG[QPVJGMG[DQCTFD[ÂąKEMKPINGHVQTTKIJVVJGPFQWDNG VCRVQGPVGTVJGEJCTCEVGT1TOQXG[QW°PIGTCTQWPFVJGMG[DQCTFVQUGNGEVCMG[ CPFYJKNGEQPVKPWKPIVQVQWEJVJGMG[YKVJQPG°PIGTVCRVJGUETGGPYKVJCPQVJGT °PIGTVQGPVGTVJGEJCTCEVGT8QKEG1XGTURGCMUVJGMG[YJGPKV¨UUGNGEVGFCPFCICKP when the character is entered.  Touch typing: 6QWEJCMG[QPVJGMG[DQCTFVQUGNGEVKVVJGPNKHV[QWT°PIGTVQGPVGT VJGEJCTCEVGT+H[QWVQWEJVJGYTQPIMG[OQXG[QWT°PIGTQPVJGMG[DQCTFWPVKN you select the key you want. VoiceOver speaks the character for each key as you VQWEJKVDWVFQGUP¨VGPVGTCEJCTCEVGTWPVKN[QWNKHV[QWT°PIGT Note: Touch typing works only for the keys that actually enter text. Use standard typing for other keys such as Shift, Delete, and Return. VoiceOver tells you when it thinks youâve misspelled a word. Choose standard or touch typing: With VoiceOver turned on and a key selected on VJGMG[DQCTFWUGVJGTQVQTVQUGNGEV6[RKPI/QFGVJGPÂąKEMWRQTFQYP Move the insertion point: Use the rotor to choose whether you want to move the insertion point by character, by word, or by line. By default, VoiceOver moves the insertion point character-by-character. Flick up or down to move the insertion point forward or backward in the text. VoiceOver makes a sound when the insertion point moves, and speaks the character that the insertion point moves across. When moving the insertion point by word, VoiceOver speaks each word as you move across it. When moving forward, the insertion point is placed at the end of the traversed word, before the space or punctuation that follows it. When moving backward, the insertion point is placed the end of the word preceding the traversed word, before the space or punctuation that follows it. To move the insertion point past the punctuation at the end of a word or sentence, use the rotor to switch back to character mode. When moving the insertion point by line, VoiceOver speaks each line as you move across it. When moving forward, the insertion point is placed at the beginning of the next line (except when you reach the last line of a paragraph, when the insertion point is moved to the end of the line just spoken). When moving backward, the insertion point is placed at the beginning of the line thatâs spoken. Delete a character: Select the , then double-tap or split-tap. You must do this even when touch typing. To delete multiple characters, touch and hold the Delete key, VJGPVCRVJGUETGGPYKVJCPQVJGT°PIGTQPEGHQTGCEJEJCTCEVGT[QWTYCPVVQFGNGVG VoiceOver speaks the character as itâs deleted. If you have Use Pitch Change turned on, VoiceOver speaks deleted characters in a lower pitch. Select text: 5GVVJGTQVQTVQ'FKVÂąKEMWRQTFQYPVQEJQQUG5GNGEVQT5GNGEV#NNVJGP double tap. If you chose Select, the word closest to the insertion point is selected when you double-tap. If you chose Select All, the entire text is selected. Chapter 29 Accessibility 245 APPLE CONFIDENTIAL â First Draft (1.10.11) Pinch apart or together to increase or decrease the selection. Cut, copy, or paste: /CMGUWTGVJGTQVQTKUUGVVQGFKV9KVJVGZVUGNGEVGFÂąKEMWRQT down to choose Cut, Copy, or Paste, then double-tap. Undo: 5JCMGK2JQPGÂąKEMNGHVQTTKIJVVQEJQQUGVJGCEVKQPVQWPFQVJGPFQWDNGVCR Enter an accented character: In standard typing mode, select the plain character, then double-tap and hold until you hear a sound indicating alternate characters have CRRGCTGF&TCINGHVQTTKIJVVQUGNGEVCPFJGCTVJGEJQKEGU4GNGCUG[QWT°PIGTVQGPVGT the current selection. Change the language youâre typing in: 5GVVJGTQVQTVQ.CPIWCIGVJGPÂąKEMWR QTFQYP%JQQUGÂĽFGHCWNVNCPIWCIGÂŚVQWUGVJGNCPIWCIGURGEK°GFKP+PVGTPCVKQPCN settings. Note: The Language rotor appears only if you select more than one language in the VoiceOver Language Rotor setting. See âSetting Up VoiceOverâ on page 236. Controlling VoiceOver Using an Apple Wireless Keyboard ;QWECPEQPVTQN8QKEG1XGTWUKPICP#RRNG9KTGNGUU-G[DQCTFRCKTGFYKVJK2JQPG5GG â7UKPICP#RRNG9KTGNGUU-G[DQCTFâ on page 44. The VoiceOver keyboard commands let you navigate the screen, select items, read screen contents, adjust the rotor, and perform other VoiceOver actions. All the keyboard commands (except one) include Control-Option, abbreviated in the table below as âVO.â VoiceOver Help speaks keys or keyboard commands as you type them. You can use VoiceOver Help to learn the keyboard layout and the actions associated with key combinations. VoiceOver Keyboard Commands VO = Control-Option 246 Read all, starting from the current position VOâA Read from the top VOâB Move to the status bar VOâM Press the Home button VOâH Select the next or previous item VOâRight Arrow or VOâLeft Arrow Tap an item VOâSpace bar &QWDNGVCRYKVJVYQ°PIGTU VOââ-â Choose the next or previous rotor item VOâUp Arrow or VOâDown Arrow Chapter 29 Accessibility APPLE CONFIDENTIAL â First Draft (1.10.11) Choose the next or previous speech rotor item VOâCommandâLeft Arrow or VOâCommandâ Right Arrow Adjust speech rotor item VOâCommandâUp Arrow or VOâCommandâ Down Arrow Mute or unmute VoiceOver VOâS 6WTPVJGUETGGPEWTVCKPQPQTQĂ VOâShift-S Turn on VoiceOver help 81ÂŁ- 4GVWTPVQVJGRTGXKQWUUETGGPQTVWTPQĂ VoiceOver help Escape Quick Nav 6WTPQP3WKEM0CXVQEQPVTQN8QKEG1XGTWUKPIVJGCTTQYMG[U3WKEM0CXKUQĂD[ default. 6WTP3WKEM0CXQPQTQĂ Left ArrowâRight Arrow Select the next or previous item Right Arrow or Left Arrow 5GNGEVVJGPGZVQTRTGXKQWUKVGOURGEK°GFD[ the rotor setting Up Arrow or Down Arrow 5GNGEVVJG°TUVQTNCUVKVGO ControlâUp Arrow or ControlâDown Arrow "Tapâ an item Up ArrowâDown Arrow Scroll up, down, left, or right OptionâUp Arrow, OptionâDown Arrow, Optionâ Left Arrow, or OptionâRight Arrow Change the rotor Up ArrowâLeft Arrow or Up ArrowâRight Arrow Using Maps With VoiceOver, you can zoom in or out, select pins, and get information about locations. Zoom in or out: 7UGVJGTQVQTVQEJQQUG\QQOOQFGVJGPÂąKEMWRQTFQYPVQ\QQO in or out. Select a pin: 6QWEJCRKPQTÂąKEMNGHVQTTKIJVVQOQXGHTQOQPGKVGOVQCPQVJGT Get information about a location: With a pin selected, double-tap to display the KPHQTOCVKQPÂąCI(NKEMNGHVQTTKIJVVQUGNGEVVJGÂąCIVJGPFQWDNGVCRVQFKURNC[VJG information page. Editing Videos and Voice Memos You can use VoiceOver gestures to trim Camera videos and Voice Memo recordings. Chapter 29 Accessibility 247 APPLE CONFIDENTIAL â First Draft (1.10.11) Trim a voice memo: On the Voice Memos screen, select the button to the right of the memo you want to trim, then double-tap. Then select Trim Memo and double-tap. 5GNGEVVJGDGIKPPKPIQTGPFQHVJGVTKOVQQN(NKEMWRVQFTCIVQVJGTKIJVQTÂąKEMFQYP to drag to the left. VoiceOver announces the amount of time the current position will trim from the recording. To execute the trim, select Trim Voice Memo and double-tap. Trim a video: While viewing a video, double-tap the screen to display the video EQPVTQNU5GNGEVVJGDGIKPPKPIQTGPFQHVJGVTKOVQQN6JGPÂąKEMWRVQFTCIVQVJGTKIJV QTÂąKEMFQYPVQFTCIVQVJGNGHV8QKEG1XGTCPPQWPEGUVJGCOQWPVQHVKOGVJGEWTTGPV position will trim from the recording. To execute the trim, select Trim and double-tap. Using a Braille Display with VoiceOver Setting Up a Braille Display You can use a refreshable Bluetooth braille display to read VoiceOver output in braille. In addition, braille displays with input keys and other controls can be used to control iPhone when VoiceOver is turned on. iPhone works with many wireless braille displays. For a list of supported displays, go to www.apple.com/accessibility. Set up a braille display: 1 Turn on the braille display. 2 On iPhone, turn on Bluetooth. In Settings, choose General > Bluetooth, then tap the Bluetooth switch. 3 In Settings, choose General > Accessibility > VoiceOver > Braille, then choose the braille display. 6WTPEQPVTCEVGFDTCKNNGQPQTQĂIn Settings, choose General > Accessibility > VoiceOver > Braille, then tap the Contracted Braille switch. Choosing a Language The braille display uses the language thatâs set for Voice Control. By default, this is the language set for iPhone in Settings > International > Language. You can use VJG8QKEG1XGTNCPIWCIGUGVVKPIVQUGVCFKĂGTGPVNCPIWCIGHQT8QKEG1XGTCPFDTCKNNG displays. Set the language for VoiceOver: In Settings, choose General > International > Voice Control, then choose the language. If you change the language for iPhone, you may need to reset the language for VoiceOver and your braille display. Controlling VoiceOver with Your Braille Display You can set the leftmost or rightmost cell of your braille display to provide system status and other information:  Announcement History contains an unread message  The current Announcement History message has not been read 248 Chapter 29 Accessibility APPLE CONFIDENTIAL â First Draft (1.10.11)  VoiceOver speech is muted  The iPhone battery is low (less than 20% charge)  iPhone is in landscape orientation  6JGUETGGPFKURNC[KUVWTPGFQĂ Â The current line contains additional text to the left  The current line contains additional text to the right Set the leftmost or rightmost cell to display status information: In Settings, choose General > Accessibility > VoiceOver > Braille > Status Cell, then tap Left or Right. See an expanded description of the status cell: On your braille display, press the status cellâs router button. Zoom /CP[K2JQPGCRRUNGV[QW\QQOKPQTQWVQPURGEK°EGNGOGPVU(QTGZCORNG[QWECP double-tap or use the pinch gesture to expand webpage columns in Safari. Zoom is also a special accessibility feature that lets you magnify the entire screen of any app youâre using, to help you see whatâs on the display. 6WTP Accessibility > Zoom and tap the Accessibility, tap Large Text, then tap the text size you want. White on Black Use White on Black to invert the colors on the iPhone screen, which may make it easier to read the screen. When White on Black is turned on, the screen looks like a photographic negative. Invert the screenâs colors: In Settings, choose General > Accessibility and tap the âWhite on Blackâ switch. Mono Audio Mono Audio combines the sound of the left and right channels into a mono signal played on both sides. This enables users with hearing impairment in one ear to hear the entire sound signal with the other ear. 6WTP/QPQ#WFKQQPQTQĂIn Settings, choose General > Accessibility and tap the Mono Audio switch. Speak Auto-text Speak Auto-text speaks the text corrections and suggestions iPhone makes when youâre typing. 250 Chapter 29 Accessibility APPLE CONFIDENTIAL â First Draft (1.10.11) 6WTP5RGCM#WVQVGZVQPQTQĂIn Settings, choose General > Accessibility and tap the Speak Auto-text switch. Speak Auto-text also works with VoiceOver or Zoom. Triple-Click Home Triple-click Home provides an easy way to turn some of the Accessibility features on QTQĂYJGP[QWRTGUUVJG*QOG button quickly three times. You can set Triple-click *QOGVQVWTP8QKEG1XGTQPQTQĂVWTP9JKVGQP$NCEMQPQTQĂQTRTGUGPVVJGQRVKQPU to:  6WTP8QKEG1XGTQPQTQĂ Â 6WTP Accessibility > Triple-click Home and choose the function you want. Closed Captioning and Other Helpful Features Many iPhone features help make iPhone accessible to all users, including those with visual or auditory impairments. Closed Captioning You can turn on closed captioning for videos in iPod settings. See âVideoâ on page 217. Note: Not all video content is encoded for closed captioning. Voice Control Voice Control (iPhone 3GS or later) lets you make phone calls and control iPod music playback by using voice commands. See âVoice Dialingâ on page 65, and âUsing Voice Control with iPodâ on page 100. Large Phone Keypad Make phone calls simply by tapping entries in your contacts and favorites lists. When you need to dial a number, iPhoneâs large numeric keypad makes it easy. See âPhone Callsâ on page 64. Widescreen Keyboards Several apps let you rotate iPhone when youâre typing, so you can use a larger keyboard:  Mail Chapter 29 Accessibility 251 APPLE CONFIDENTIAL â First Draft (1.10.11)  Safari  Messages  Notes  Contacts Visual Voicemail The play and pause controls in visual voicemail let you control the playback of messages. Drag the playhead on the scrubber bar to repeat a portion of the message thatâs hard to understand. See âChecking Voicemailâ on page 72. Assignable Ringtones You can assign distinctive ringtones to individuals in your contacts list for audible caller ID. You can purchase ringtones from the iTunes Store on iPhone. See âPurchasing Ringtonesâ on page 172. Instant Messaging (IM) Chat The App Store features many Internet Messaging (IM) apps, such as AIM, BeejiveIM, ICQ, and Yahoo! Messenger, that are optimized for iPhone. Minimum Font Size for Mail Messages To increase readability, set a minimum font size for Mail message text to Large, Extra Large, or Giant. See âMailâ on page 210. TTY Support (Available in Some Areas) Use iPhone in TTY mode with the iPhone TTY Adapter (available separately) to use a Teletype (TTY) machine. See âUsing iPhone with a Teletype (TTY) Machineâ on page 213. Universal Access in Mac OS X Take advantage of the Universal Access features in Mac OS X when you use iTunes to sync information and content from your iTunes library to iPhone. In the Finder, choose Help > Mac Help, then search for âuniversal access.â For more information about iPhone and Mac OS X accessibility features, go to www. apple.com/accessibility. 252 Chapter 29 Accessibility APPLE CONFIDENTIAL â First Draft (1.10.11) Hearing Aid Compatibility The FCC has adopted hearing aid compatibility rules for digital wireless phones. These rules require certain phones to be tested and rated under the American National Standard Institute (ANSI) C63.19 hearing aid compatibility standards. The ANSI standard for hearing aid compatibility contains two types of ratings: an âMâ rating for reduced radio frequency interference to enable acoustic coupling with hearing aids that do not operate in telecoil mode, and a âTâ rating for inductive coupling with hearing aids operating in telecoil mode. These ratings are given on a scale from one to four, where four is the most compatible. A phone is considered hearing aid compatible under FCC rules if it is rated M3 or M4 for acoustic coupling and T3 or T4 for inductive coupling. Please check www.apple.com/iphone/specs.html for current iPhone hearing aid compatibility ratings. Hearing aid compatibility ratings are not a guarantee that a particular hearing aid will work with a particular phone. And some hearing aids may work well with phones that do not meet particular ratings. The best way to ensure interoperability between a hearing aid and a phone is to use them together before making a purchase. This phone has been tested and rated for use with hearing aids for some of the wireless technologies that it uses. However, there may be some newer wireless technologies used in this phone that have not been tested yet for use with hearing CKFU+VKUKORQTVCPVVQVT[VJGFKĂGTGPVHGCVWTGUQHVJKURJQPGVJQTQWIJN[CPFKP FKĂGTGPVNQECVKQPUWUKPI[QWTJGCTKPICKFQTEQEJNGCTKORNCPVVQFGVGTOKPGKH[QWJGCT any interfering noise. Consult your service provider or the manufacturer of this phone for information on hearing aid compatibility. If you have questions about return or exchange policies, consult your service provider or phone retailer. Chapter 29 Accessibility 253 Support and Other Information Apple iPhone Support Site Comprehensive support information is available online at www.apple.com/support/ iphone. You can also use Express Lane for personalized support (not available in all countries or regions). Go to expresslane.apple.com. Restarting and Resetting iPhone If something isnât working right, try restarting iPhone, force quitting an app, or resetting iPhone. Restart iPhone: 2TGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPWPVKNVJGTGFUNKFGT CRRGCTU5NKFG[QWT°PIGTCETQUUVJGUNKFGTVQVWTPQĂK2JQPG6QVWTPK2JQPGDCEMQP RTGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPWPVKNVJG#RRNGNQIQCRRGCTU +H[QWECP¨VVWTPQĂK2JQPGQTKHVJGRTQDNGOEQPVKPWGU[QWOC[PGGFVQTGUGVK2JQPG #TGUGVUJQWNFDGFQPGQPN[KHVWTPKPIK2JQPGQĂCPFQPFQGUP¨VTGUQNXGVJGRTQDNGO Force quit an app: 2TGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPHQTCHGYUGEQPFU until a red slider appears, then press and hold the Home button until the app quits. On iPhone 3GS or later, you can also remove an app from the recents list to force it to quit. See âOpening and Switching Appsâ on page 29. Reset iPhone: 2TGUUCPFJQNFVJG1P1Ă5NGGR9CMGDWVVQPCPFVJG*QOGDWVVQPCV the same time for at least ten seconds, until the Apple logo appears. Backing Up iPhone iTunes creates backups of settings, downloaded apps and data, and other information on iPhone. You can use a backup to restore these items to your iPhone after a software restore or to transfer the information to another iPhone. See âUpdating and Restoring iPhone Softwareâ on page 256. 254 Appendix APPLE CONFIDENTIAL â First Draft (1.10.11) APPLE CONFIDENTIAL â First Draft (1.10.11) Backing up iPhone or restoring from a backup isnât the same as syncing content and other items (such as music, podcasts, ringtones, photos, videos, and apps that you download via iTunes) with your iTunes library. Backups include settings, downloaded apps and data, and other information on iPhone. After you restore iPhone, you need to sync again to get your music, videos, photos, apps, and other content back on iPhone. See âRestoring from a Backupâ on page 257. Apps downloaded from the App Store are backed up the next time you sync with iTunes. Afterwards, only app data is backed up when you sync with iTunes. Creating a Backup iTunes creates a backup of iPhone when you:  Sync with iTunes By default, iTunes syncs iPhone each time you connect iPhone to your computer. See âSyncing with iTunesâ on page 56. iTunes wonât automatically back up an iPhone VJCVKUP¨VEQP°IWTGFVQU[PEYKVJVJCVEQORWVGT;QWECPCNUQU[PEOCPWCNN[D[ clicking Sync in iTunes. Note that iTunes creates a backup only once each time K2JQPGKUEQPPGEVGFVQ[QWTEQORWVGTDGHQTGVJG°TUVU[PEVJCVQEEWTU+H[QWU[PE again, iTunes doesnât create another backup.  Update iPhone K6WPGUDCEMUWRK2JQPGDGHQTGWRFCVKPIK2JQPGGXGPKHKVKUP¨VEQP°IWTGFVQU[PE with iTunes on that computer.  Restore iPhone (if you choose to back up) iTunes asks if you want to back up iPhone before restoring it. For more information about backups, including the settings and information stored in a backup, go to support.apple.com/kb/HT1766. Removing a Backup You can remove a backup of iPhone from the list of backups in iTunes. You may want to do this, for example, if a backup was created on someone elseâs computer. Remove a backup: 1 In iTunes, open iTunes Preferences.  Mac: Choose iTunes > Preferences.  Windows: Choose Edit > Preferences. 2 Click Devices (iPhone doesnât need to be connected). 3 Select the backup you want to remove, then click Delete Backup. 4 %QP°TO[QWYKUJVQTGOQXGVJGUGNGEVGFDCEMWRD[ENKEMKPI&GNGVG$CEMWR 5 %NKEM1-VQENQUGVJGK6WPGU2TGHGTGPEGU9KPFQY Appendix A Support and Other Information 255 APPLE CONFIDENTIAL â First Draft (1.10.11) Updating and Restoring iPhone Software You can use iTunes to update or restore iPhone software.  If you update, the iPhone software is updated. Your downloaded apps, settings, and FCVCCTGP¨VCĂGEVGF Note: In some cases, an update may also involve restoring iPhone.  If you restore, the latest version of iPhone software is reinstalled, settings are restored to their default, and all data stored on iPhone is deleted, including downloaded apps, songs, videos, contacts, photos, calendar information, and any other data. If youâve backed up iPhone with iTunes on your computer, you can restore data from the backup at the end of the restore process. Deleted data is no longer accessible via the iPhone user interface, but it isnât erased from iPhone. For information about erasing all content and settings, see âResetting iPhoneâ on page 207. If you use a Bluetooth headset or car kit with iPhone and you restore settings, you must pair the Bluetooth device with iPhone again to use it. For more information about updating and restoring iPhone software, go to support. apple.com/kb/HT1414. Updating iPhone Make sure you have an Internet connection and have installed the latest version of iTunes from www.apple.com/itunes. Update iPhone: 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the Devices list, then click Summary at the top of the screen. 3 Click âCheck for Update.â iTunes tells you if thereâs a newer version of the iPhone software available. 4 Click Update to install the latest version of the software. Restoring iPhone Make sure you have an Internet connection and have installed the latest version of iTunes from www.apple.com/itunes. Restore iPhone: 1 Connect iPhone to your computer. 2 In iTunes, select iPhone in the Devices list, then click Summary at the top of the screen. 3 Click âCheck for Update.â iTunes tells you if thereâs a newer version of the iPhone software available. 256 Appendix A Support and Other Information APPLE CONFIDENTIAL â First Draft (1.10.11) 4 Click Restore. Follow the onscreen instructions to complete the restore process. When restoring, it is recommended that you back up iPhone when prompted. When the iPhone software has been restored, you can either set it up as a new iPhone, or restore your music, videos, app data, and other content from a backup. After you restore from a backup, previous data is no longer accessible through the iPhone user interface, but it isnât erased from iPhone. For information about erasing all content and settings, see âResetting iPhoneâ on page 207. Restoring from a Backup You can restore the settings, app data, and other information from a backup, or use this feature to transfer these items to another iPhone. Make sure you have an Internet connection and have installed the latest version of iTunes from www.apple.com/itunes. Important: Restoring from a backup is not the same as restoring iPhone from the Summary pane in iTunes. See âRestoring iPhoneâ on page 256. Restoring from a backup does not fully restore iPhone software. Also, restoring iPhone from a backup restores all data in the backup, including data for apps. If you choose an old backup, restoring from it could replace the app data with data that is not current. If you restore iPhone from a backup of some other iPhone or iPod touch, some passwords and settings may not be restored. (Additional, but still not all, passwords and settings may be restored if the backup is encrypted.) For more information about the settings and information stored in a backup, go to support.apple.com/kb/HT1766. Restore iPhone from a backup: 1 Connect iPhone to the computer you normally sync with. 2 In iTunes, Control-click iPhone in the Devices list and choose âRestore from Backupâ from the menu that appears. 3 Choose the backup that you want to restore from the pop-up menu, then click Restore. If your backup is encrypted, enter your password. Safety, Software, and Service Information This table describes where to get more iPhone-related safety, software, and service information. Appendix A Support and Other Information 257 APPLE CONFIDENTIAL â First Draft (1.10.11) To learn about Do this Using iPhone safely See the Important Product Information Guide at www.apple.com/support/manuals/iphone for the latest safety and regulatory information. iPhone service and support, tips, forums, and Apple software downloads Go to www.apple.com/support/iphone. Service and support from your carrier Contact your carrier or go to your carrierâs website. The latest information about iPhone Go to www.apple.com/iphone. Using iTunes Open iTunes and choose Help > iTunes Help. For an online iTunes tutorial (may not be available in all countries and regions), go to www.apple.com/ support/itunes. Creating an Apple ID Go to appleid.apple.com. MobileMe Go to www.me.com. Using iPhoto on Mac OS X Open iPhoto and choose Help > iPhoto Help. Using Address Book on Mac OS X Open Address Book and choose Help > Address Book Help. Using iCal on Mac OS X Open iCal and choose Help > iCal Help. Microsoft Outlook, Windows Address Book, or Adobe Photoshop Elements See the documentation that came with those apps. Finding your iPhone serial number, International Mobile Equipment Identity (IMEI), QT/QDKNG'SWKROGPV+FGPVK°GT /'+& ;QWECP°PF[QWTK2JQPGUGTKCNPWODGTCPF+/'+ (GSM models) or MEID (CDMA model) on the iPhone packaging. Or, on iPhone, choose Settings > General > About. In iTunes on your computer, hold down the Control key and choose Help > About iTunes (Windows) or iTunes > About iTunes (Mac), then release the Control key. (Press the Space bar to pause the scrolling.) Obtaining warranty service First follow the advice in this guide and online resources. Then go to www.apple.com/support or see the Important Product Information Guide at www.apple.com/support/manuals/iphone. Battery replacement service Go to www.apple.com/support/iphone/service/ battery. Using iPhone in an Enterprise Environment Go to www.apple.com/iphone/business to learn more about enterprise features of iPhone, including:  Microsoft Exchange  +PUVCNNKPIEQP°IWTCVKQPRTQ°NGU 258 Appendix A Support and Other Information APPLE CONFIDENTIAL â First Draft (1.10.11)  CalDAV  CardDAV  IMAP  LDAP  VPN Using iPhone with Other Carriers Some carriers let you unlock iPhone for use with their network. To determine if your ECTTKGTQĂGTUVJKUQRVKQPIQVQsupport.apple.com/kb/HT1937. Contact your carrier for authorization and setup information. Youâll need to connect iPhone to iTunes to complete the process. Additional fees may apply. For troubleshooting information, go to support.apple.com/kb/TS3198. Disposal and Recycling Information Apple Used Mobile Phone Recycling Program (available in some areas): For free recycling of your old mobile phone, a prepaid shipping label, and instructions, see: www.apple.com/recycling iPhone Disposal and Recycling: You must dispose of iPhone properly according to local laws and regulations. Because iPhone contains electronic components and a battery, iPhone must be disposed of separately from household waste. When iPhone reaches its end of life, contact local authorities to learn about disposal and recycling QRVKQPUQTUKORN[FTQRKVQĂCV[QWTNQECN#RRNGTGVCKNUVQTGQTTGVWTPKVVQ#RRNG6JG battery will be removed and recycled in an environmentally friendly manner. For more information, see: www.apple.com/recycling European UnionâElectronics and Battery Disposal Information: This symbol means that according to local laws and regulations your product and its battery should be recycled separately from household waste. When this product reaches its end of life, take it to a collection point designated by local authorities for the recycling of electronic equipment. The improper disposal of waste electronic GSWKROGPVHTQOVJGEQPUWOGTOC[DGUWDLGEVVQ°PGU6JGUGRCTCVGEQNNGEVKQPCPF recycling of your product and its battery at the time of disposal will help conserve natural resources and ensure that it is recycled in a manner that protects human health and the environment. Appendix A Support and Other Information 259 APPLE CONFIDENTIAL â First Draft (1.10.11) For collection and recycling services for iPhone, go to: www.apple.com/recycling/ nationalservices/europe.html Battery Replacement for iPhone: The rechargeable battery in iPhone should be replaced only by an authorized service provider. For battery replacement services go to: www.apple.com/support/iphone/service/battery Deutschland: Dieses Gerät enthält Batterien. Bitte nicht in den HausmĂźll werfen. Entsorgen Sie dieses Gerätes am Ende seines Lebenszyklus entsprechend der maĂgeblichen gesetzlichen Regelungen. Nederlands: Gebruikte batterijen kunnen worden ingeleverd bij de chemokar of in een speciale batterijcontainer voor klein chemisch afval (kca) worden gedeponeerd. TĂźrkiye: '''[{PGVOGNKI KPG 'NGMVTKMNKXG'NGMVTQPKM'U [CNCTFC$C\Ă 
Source Exif Data:File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.4 Linearized : Yes XMP Toolkit : Adobe XMP Core 4.2.1-c043 52.372728, 2009/01/18-15:08:04 Format : application/pdf Creator : Apple Inc. Create Date : 2011:01:11 04:36:29Z Creator Tool : Adobe InDesign Server CS3 (5.0.5) Modify Date : 2011:01:15 15:21:56-08:00 Metadata Date : 2011:01:15 15:21:56-08:00 Producer : Mac OS X 10.6.6 Quartz PDFContext Document ID : uuid:f42f8937-0e6f-497e-99eb-fc816c1aefa2 Instance ID : uuid:d91d1a6c-690d-4188-b0d6-fc16bff163fe Page Count : 272 Author : Apple Inc.EXIF Metadata provided by EXIF.tools