Dynabook UPA3538WL Wireless WiFi Link 4965AGN User Manual Scan
Toshiba Corporation Wireless WiFi Link 4965AGN Scan
Dynabook >
Contents
- 1. User manual
- 2. Manual Addendam
- 3. User Manual
User manual
Tasman , Portégé® M400 Series User’s Guide - If you need assistance:‘ :~ Toshiba’s Support Web site pcsupport.toshiba.com Toshiba Global Support Centre Calling within the United States (800) 457-7777 Calling from outside the United States (949) 859-4273 For more information, see “If Something Goes Wrong" on page 207 in this guide. PMA00005801 0 01/06 _ Handling the cord on this product will expose you to lead, a chemical known to the State 0! California to cause birth defects or other reproductive harml Wash hands alter handling. Model: Portégé ® M400 Series Recordable and/or ReWritable Drive(s) and Associated Software Warranty The computer system you purchased may include Recordable and/or ReWritable optical media drive(s) and associated sofiware, among the most ndvanoed data storage technologies available. As with any new technology, you must read and follow all set-up and usage instructions in the applicable user guides and/or manuals enclosed or provided electronically, If you fail to do so. this product may not function properly and you may lose data or sufl'er other damage TOSHIBA AMERICA INFORMATION SYSTEMS, INC. (“TOSHIBA"), ITS AFFILIATES AND SUPPLIERS DO NOT WARRANT THAT OPERATION OF THE PRODUCT WILL BE U'NI'NTERRUPTED OR ERROR FREE, YOU AGREE THAT TOSHIBA, ITS AI-TILIATES AND SUPPLIERS SHALL HAVE NO RESPONSIBILITY FOR DAMAGE TO OR LOSS OF ANY BUSINESS, PROFITS, PROGRAMS, DATA. NETWORK SYSTEMS OR REMOVABLE STORAGE MEDIA ARISING OUT OF OR RESULTING FROM THE USE OF THE PRODUCT, EVEN IF ADVISED OF THE POSSIBILITY THEREOF. Protection of Stored Data Foryuur impormu am please make periodic back~up copies ofall the data stored on the hard disk or other storage devices is apiecauu'on apinst possible failum alteration, or km ofthe data IF YOUR DATA ls ALTERED OR mST DUE TO ANY TROUBLE, FAILURE OR MALFUNCTION OF THE HARD DISKDRIVE OR OTHER STORAGE DEVICES AND THE DATA CANNOT BE RECOVERED, TOSHIBA SHALL NOT BE LIABLE FOR ANY DAMAGE OR LOSS or DATA, OR ANY OTHER DAMAGE RESULTING THEREFROM. WHEN COPYING OR TRANSFERRING YOUR DATA, PLEASE BE SURE To CONFIRM WHETHER THE DATA HAS BEEN SUCCESSFmY COPIED OR TRANSFERRED. TOSHIBA DISCLAIMS ANY UADanY FOR THE EAlLURE T0 COPY 0R TRANst THE DATA CORRECI'LY Critical Applications The wmpsm you have pinchased is not designed for any “critical applications.“ “Critical applications“ means life support systems, medical applications, connections In implanted medical devices, mmiercial transportation nuclear facilities or systems or any other applications where product filure could lead to injurytopersens or less oflife or catastrophic property damage. ACCORDINGLY, TOSHIBA. ITS AFFILIATES AND SUPPLIERS DISCLAIM ANYAND ALL LIABILITY ARISING OUT OF THE USE OF THE COMPUTER PRODUCTS m ANY CRrI'ICAL APPLICATIONS. IF YOU USE THE COMPUTER PRODUCTS IN A CRITICAL APPLICATION, YOU, AND NOT TOSHIBA, ASSUME FULL RESPONSIBILITY FOR SUCH USE. FCC Notice “Declaration of Conformity lnlormalion” This equiprneml-rasbeentefled and foundlo comply wilh titelimitsforaClass B digital device, pursuant to Part 15 offlre FCC rules. These limits are desigred to provide reasonable pmtecrion against harmful interference in a residential installation, This equipmmt generates, uses and can radiate radio frequency energy and, mm installed andused in accordance with the instructions, it may cause harmful interference to radio oorrrrnnnications. However, there is no guarantee that inwrfereme will notoccur in a particular installation. Ifthis equipment does cause harmful interference to radio «television reoeptiornwhichcan be determinedbyurmingtlreequipmmtofiandm,theuserisencoruragodtotryto correctflre interference by one or more ofrhe following measures: «6 Reorient or relocate the receiving antenna. Increase the separation between the equipment and receiver, \“ Connect the equipment to an outlet on a circuit dilfercnt from that to which the receiver is connected at Consult the dealer oran experienced radio/‘l'V technician for help. ———————_——-— "01-5 Only Peripherals complying with the FCC Class B limits maybe attached to this equipment. Opemtion with noncompliant peripherals or peripherals not recommended by Toshiba ls likely to result in interference to radio and TV reception. Shielded cables must be used between the external devices and the oomputer‘s parallel port, monitor port USB port, PS/Z port“, i.L|NK° port and mlcropnone jack. Changes or modifications rnarleto this equipment not expressly approved by Toshiba or parties authorized by Toshiba could void the user's authorlly to operate the equipment. Thisdevioeocmplies withPart 150m FCC Rules. Opemfiunissubjeottothe followingnvoconditions: -:~ This device may not cause hnnnful hrisrfarencn (0 This device must accept any interference received, including interfelvme that may cause mtdesired operation Contact either: 4‘ Toshiba’s Suppon Web site at. pcsupporttoslubam ~Z~ Or call the Toshiba Global Suppon Centre: Within the United States at (800) 457-7777 Outside the United States at (949) 859-4273 Industry Canada Requirement This class]; digital apparatus complies with Canadian lciasoos, Cetappareilmmtéfiqucdelzclame Butconfotmed lanotmeN'MiB-OOS du Canada FCC requirements The following information is pursuant to FCC CFR47, Pan 68 and refeis to internal modems. This equipment complies with Part 68 ofthe FCC rules. On the bottom of this equipment is a label that contains, among other informatim, the FCC registmtion number and ringer equivalence mlmha (REN) for this equipment. lrreqrrasm the information must be pmvided to the telephone company. The modemcimnects tothe telephonic line by meanscfa standaldjack calledthle USOC [U] [C A plug andjack mad to connect this equipment to the premises wiring and telephone network must comply with the applicable FCC pan 68 rules and requixemenls adopted by the ACTA. It is assigned in be connected to a compatible modular jack that is also compliant. TheRENisusedwdetennineulenumberofdevimulatntaybeconnectedwa telephone line Excessive RENs on atelephone line may lesult in the devices not ringinginmponse toanincomingcall. In mostbutnotall Mthesum of KENS should notexceed five (50). To be certain of the number of devices that maybecmnmdmnlhlansdemnnmedbymemeENgwnwflieloa-l telephone company. For products approved anerJuly 23, 2001, the REN forthis product ispflnoft‘heproduct idmtifier thathas the format US:AMEQWUOOO(. The digits repmemed by the “it an theREN without a decirnnlpoint(e.g,03 isnRENofOJ) ForeodierprothxdstheRENis separately shown onthe label. Omnection to party line service is subject to state tatifl's. Contact the state public . utility coal‘lmissiorn public service commission or corporation commission for information. Telephone Company Procedures The goal ofthe telephone company is topmvide you with the best service itcan Inordettodothis, itmayoocasionallybcnmsaryforfliuntomakechangesin their equipmmt, operations or procedures. If these changes might afl‘ect your sorvioo or the operation ofyour equipment the telephone company will give you notice, in writing. to allow you to make any changesnwessary tomaintain lmintmupwd service. It Problems Arise . If this equipment causes harm to the telephone network, the telephone company will notify you in advance that temporary discontinuance of service may be required. But ifadvanoed notice is not practical, the telephone company will notify the custom as soon “possible. Also, you will be advised oryour right to file a complaint with the FCC ifyou believe it is necessary It'trouble is experienced with this equipment, for repair or limited warmnty information, please contact Toshiba Corporation Toshiba America Information Systems. Inc. or an authorized representative of Toshiba, or the Toshiba Support Centre within the Uniwd Stats at (800) 457~7777 or Outside the Unimd States at (949) 8594271 If the equipment is causing him to the telephone network, the telephone company may request that you disconnect the equipment until the problem is resolved Disconnection Ifyou should everdecide topelmanently disconnect your modem from its present line, pluse call thetelephone companyandletthemlmowofthis chmge. Fax Brandan The Telephone lesumer Protection Act of [991 makes it unlawful for any person to use a computer or otherelectronic device, including Fax whines. lo sendanymagelmlesssuchmessageclearlywrmins inamarginatthetopor bottom ofeach transmitted page or on the firstpoge ofthe transmissierl'l1 the date and time it is sent and an identification ofthe business or other entity, orother individual smding the message and the telephone munborof the sending machine orsuch business, other entity, mindividual. (The telephone number provided maynotbe a900numberoranyothernumber forwhich charges exceed local or long-distance transmission charges) lnordermprogramthis information intoyourfaxtmnsmissiormefertothefix sofiware instructions imkilled on this computer. Alarm Equipment lfywr hornehas specially wired alarm equipment connected to the telephone line, engine the insbllafion of this equipmentdoes not disable your alarm equipment If you have questions about what will disable alarm equipment, consult your telephone company or a qualified installer Instructions for it: 08-03 Certified Equipment NOTICE: The lndustry Canada label identifies certified equipment. This certification means that the equipment meets certain telecommunications network protective, operational and safety requiremenm as prescribed in the appropriate Terminal Equipment Technical Requirements document(s). The Department does not guarantee the equipment will operate to the user’s satisfaction. Before installing this equipment, users should ensure that it is permissible to be wmecied lo the facilities ofthe local teleomnrnnnications company. The equipment muslalso be installedusing an acceptable method ofconnection. The cusmmershould bea'ware that compliance with the above conditions may not prevent degradation of service in some situations. Repairs to certified equipment should be coordinated by a representative designated by the supplier. Any repairs or alterations made by the userto this equipment, or equipth malftlnclitms, may give the telecommunications company cause to reqlmtthe user to disconnect the equipment . Users should ensure for their own protection that the electrical gound connections oflhc power utility, telephone lines and intemal metallic water pipe system, ifpreoem, are oonnecmd together. Thisprecaution may be particularly important in rural areas. Caution: Users should not attempt to make such connections themselves, but should contact the appropriate electric inspection authority, or electrician, as appropriate. The user manual of analog equipment must contain the equipment’s Ringer Equivalence Number (REN) and an explanation notice similar to the following: mmgernquiwlmntnnbetmem ofthis devioecanbe foundonthe label aflixed tn your computer. Nance: The Ringer Equivalence Number (KEN) assigned to each lamina] devieeprqvidemhidiearim ornierrnxirninnnumherer terminals allowed to be connected m atelephme interface. The terminaticn on an innereee may consist ofany denihinaneh efdevieee subjecttmlyne v the requirement that the sum emie Ringer Equiwlence Numbers ornn the devices deer not exceed 5. The standard connecting arrangement (telephone jock type) for this equipment is jack type(s): usoc R11 to. Wireless Interoperability The TOSHIBA Wireless LAN Mirli l>cr Cardprodnotx are designed robe interoperable with aluywireless LANpmdnct that is based on Direct Sequence Spread Spectrum (DSSS) radio bechmlogy, and is compliant to: <- The “31313 802.11 StandardonWrreless LANs(Re'vision A/B/G).asdefined andapprevedhyuie Institute ofElectJ-ical andEledrrenics Engineers. The Wireless Fidelity (Wi—Fi) certification as defined by the Wl-Fi Alliance The “Wr-Fi CEITIFIED“ logo is a certification mark ofthe Wr-Fi Alliance. cAun§n B/uetoqer and Wireless LAN dwices operate within the same radio frequency range and may interfere with one another. If you use Blueraotlt and Wireless LAN devices simultaneously, you may ocmsionally experience a less man optimal network perlormance or even lose your network connection, If you should experience any such problem. immediately turn off your Blueroorh or ereIess LAN device. Please contact Toshiba PC product support on Web site htth/wwwloshiba- aurope.coreromputers/tnl/bluelooth,him in Europe or pcsupporltoshibacom in the United States for more inlom-ratlon. Summon Radio Frequency Interference Requirements This device is restricted in indoor use due to its operation in the 5.15 GHz to 5.25 GHz frequency range. FCC requires lhis product to be used Indoors for frequency range 5.15 GHz to 5.25 GHz to reduce the potential tor harmlul interlerenoe to cochannel Mobile Satellite systems. High power radars are allocated as primary users of the 5.25 GHz to 5.35 GHz and 5.65 GHz to 5.85 GHz bands, These radar stations can cause interference with and/or damage this device. —-—-——— Wireless LAN and Your Health Wireless LAN products, like ruin radio devius, emit radio fieqmcy electromagnetic energy. The level of energy emimd by Wireless LAN devices however is far much less than the electromagnetic energy emimd by wireless devices like for example mobile phones. Because WuelessLAN products operate withinthe guidelines found in radio fiequency safety standards and recommemlatiom, TOSHIBA believes Wireless LAN is safe foruse by consumers. Those standards and rewrmnendatims reflect the consensus oflhe scientific community and result from delibenfiors ofpmels mdoonmflneesofscienfimvdmoonfimmflyreviewandhnerpmflmmmsive research limmre. ‘ Insomesimationsorenvimnments, flwmofWrmtessLANmayberesn—icted by the proprietor ofthe building or responsible represenmlives ofthc organization These situations may for example inchrde: ‘ '2' Using the Wireless lAN equipment on board airplanes, or ‘3' In any other environment where the risk of interfel’enoe to other devices or services is perceived or identified as harmful. If you are uncertain ofthe policy‘that applies on the use ofwireless devices in a specific organization or environment (e.g. airports). you are amour-aged in ask for momma“ to use the Wirehss [AN device prior a. timing on the equipment. [m] Exposure to Radio Frequency Radiation The radiated output power oi the TOSHIBA Wireless LAN Mini PCI Card is tar below the FCC radio trequency exoosuie limits. Nevertheless, the TOSHIBA Wireless LAN Minl PCI Card shall be used in such a manner that the potential lor human contact during normal operation is minimized. In normal operating configuration, the LCD in the upright position, the distanoe between the antenna and the user should not be less than 20 cm. The antenna(sl used tor this lmnsmitler must not he co-Iomted or opemting in conjunction with any other antenna or transmitter. Antenna(s) used in 5.15 GHz to 5.25 GHz frequency band must be integral antenna which provlde no access to the end user. Rater to the Regulatory Statements as identified in the documentation that comes with those products for additional inlormation. ———-———-———— Regulatory Information The TOSHIBA Wireless LAN Mini PCI Card must be imhlled and uwd in strict mordance with the manufacturer's instructions as described in the wer- CD documentation that comes with the product. This device complies with the following radio frequency and safety mndards. Canada - Industry Canada (Hi) This device complies with RSS 210 oflndustry Canada m The Installer ol this radio equipment must ensure that the antenna is located or pointed such that it does not emit RF lield in excess or Health Canada limits lor the general population; consult Salety Code 6, obtainable from Health Canada's Web site www.hc-sc.gc.ca/rph, The RF device shall not be co-located with any other transmitter that has not been tested with this device. Operation is subjeotw the following two conditions: (1) this device may not cause interference, and (2) this device must accept any inference, including imerference that may cause undesired operation of this device, L’utilisaticvn de cc dispositifest auwrifie seulement aux conditions suit/antes: (l) il ne doit pas produim do brouillage et (2) l’utilisatflrr du dispositifdoit étre pret a ampwr tout brmxillage radioélectrique few, méme si cc brouillage mt Sllwcpfible dc oomptcrmefln Ie fonctionncment du dispositii'. The term “1C" before the equipment certification number only signifies that the Indlstry Canada technical specifications were met To prevent! radio interference in the licensed service, this device is invaded to be operated indoors and away fiom windows toprovide maximum shielding. Equipment (or its transmit antenna) that is installed outdoors is subject to licensing Pour enrpeclrer queoet appareil came rm brouillage au service firisant l'ohjet d‘une licence, il doitm utilize a I'interieur et devmit elm place loin des (omen afin de Foumierun ecram dc blindagc maximal. Si le rnztriel (ou son antcnne d’emission) est inshlle a l'c'xlerie'ur, il doit faine I'objet d'une licence. m This device is restrlcled to Indoor use due to its operation in the 5.15 GHz to 5.25 GHz frequency ranges Industry Canada requires this product to be used indoors tor frequency range 5.15 GHz to 5.25 GHz to reduce the potential tor harmlul lnlerlerence lo mhannel Mobile Satellite systems. High power radars are allocated as orinlary users or the 5.25 GHZ to 5.35 GHZ and 5.65 GHz to 5.85 GHz bands. These radar stations can cause inlerlerenoe with and/or darmgo this device. 10 EU Deciaration oi Conformity TOSHJBA declares, that the product: PLU lO’ conforms to the following Standards: Supplementary mic product complia with the Informau'ml: mini-hem offlle law Voltage Directive 72/23/EEC, the me Directive 89/336/ EECami/onheM’lTEDlrecfive 1999/ 05/550 ThispmductiscarryingflleCE—MarkinmdanoewidldwwlnwdEumpepn Directim Responsible for CEMarIdng is TOSHIBA Europe, Harnrnfelddamm 8, 41460 Nellss, Gummy. VCCI Class B Information COfilli M'fllfil‘laISISiflmifl-fl (vcc l ) 0)!‘ [iii < 7 5 X Bilfifil‘ifilf'r. willt. wsnavmll'ra i'. a fab?! LTL‘fiTMi Ewilb‘ >r'\°-7-Izt:'~>’a>!flfllzifillbf fifiéhbki QEI‘QEEIQECT: tn‘fi'dfif. Bflmfl.i:fi£911 LL‘I! ") “DE L'C'Fz L‘. Modem Warning Notice ' Conformity Statement The equipment has been approvedm [Commission Decision ‘m—zr'] for pran- European single terminal oomoodoh to the Public Switched Telephone Network (PSTN). However, due to ditferences bétween the individual PSTNs provided in different countries/regions the apprulml fleas not. of itself, give an unconditional mime: ofsucoessful operation on every PSTN network lamination point. in the event ofpmblems, you should contact your equipment supplier in the first instance. NOTE The above Caution iniolmaiion applies to products that operate with all 302113 device. Taiwan 11 Article 14 Unless wed, for any model modified low pcwer mh'o fiequency electric machinery any company, under or user shall nor change the frequency ' increase firepower orchangeihe fem-rec and functions ofihe original design. Article 17 Any use oflow power radio frequency electric machinery shall not infect aviation safety and inwrfere with legal oommmlicatims, In the evmt inierfermee is caused, the use of such electric machinery shall be immediately disconlinued. Operation ofsuch products can be resumed only when they are modified and can no [anger cause interference The legal communications meniicmed in the above item refer 00 radio communicatim cperaied in mordanoewiih relwommunieation laws and regulations. 141W power mdio frequency electric machinery shall resist against inmference from legal communications arfi'om industrial, scientific and medical radio emission elem'ic machinery. Using this Equipment in‘Japan Inlapan, the frequency bandwidth of2,400 MHz Io 2,483.5 MHz for seed-id genemion low-power dais wnnnrmiealim systems such as this equipment Overlape matofrnobile ohje'midenlificudm sysme (premises radio simian and specified low-power radio simian). 1. Sticker Please puithe following sticker on devices incm'pcming this product. me lreqneney bendwldm ni ms equprmnl may mule win-i me um- rings at mum-l mes. wmlme deweea. med-cal dances ”helm/Zn mes incised innn mime ind m-lunssd speclled lemme indie uni-em our mobile dbl-q neuhlirAI-dn swam iRFlD) used in lzeluy mm Ines iOIM Rldlo same) I eslnie using INS equipmeni ensure mm ll den wi lnlvlue win my an me am Islod above 2 ii ihls sawmill causes RF nieilsisme in olher indie nun-in DIDWily shelve me Imquelmy being used dimes ms Ivcwwi oi use or Iltn Ml ihe muc- 01 wuss-an: cl leacl TOSHIBA Dried PC ll you have prwlsmr win "influence caused by nus dream In Other Rmio Sinllem The indication shown beluw appears onihis equipnenl 12 (4) 1 2,4: This equipment uses n frequency of2.4 GHz, 2 DS: This equipment uses DS-SS modulation. OF: This equipment uses 0mm modulation, 3 The inlerference range of this equipment is less than 40m 4 - - - This equipment uses a frequency bandwidth from 2,400 MHz to 2,4815 MHz. It is possible to avoid the band of mobile object idmdfieadon systems, 3. TOSHIBA Direct PC Monday—Pride)", 10:00— 17:00 ‘ Toll Free Tel: 0120-13-1100 Direct Dial: 03—3457-5916 Fox: 03-5444-9450 i Device Authorization This device obtains the Technical Regulalion Confmmity Certification and the Technical Conditions Compliance Approval, and it belongs to the device clay of radio equipment of low-power data communication system radio station stipulated in the Radio Law and the Telecommunications Btsinms law of Japan. rheNume onhe mile equipment: referlothe equipment label providedundw computer JAPAN APPROVALS INSTITUTE FOR TELECOMMU'N'ICATIONS EQUIPMENT Approval Number. DOI-l 1231? TELECOM ENGINEERING CENTER Approval Number. 03NY.A0018, 03GZDA0017 The following restrictions apply: ~:~ Do not disassemble or mom the device. 0 Do rim install the embedded wileless module inw other device, ~:~ sin GHz to 5.23 GHz for indooruse only. A. OD Radio Approvals for Wireless Devices "01-5 The following iniormalion is dependent on what type of wireless device is in v your computer. Approved Counlrieslflegions for use for the Alheros ARSBMB-43I44 and ARSBMBs Mini PCl Wireless Network Adapters This equipmmt is appravedto the redio standard eyriis comin'ias/regions‘inflie followingtable. Do nol use this equipment temp! in the countries/regions in meiollwving table. NOTE This dwiee works on passive scan only. A peer-lopeer mode is not available in 802.113 and Turbo Mode. 802.11b(2AGHz) Aisimlia Austria Belgium Canada Denmark Finland France Germany Greece Ireland Italy Liechtenstein blxembo‘ug Netherlands New Zealand Norway Portugal Sweden Switzerland UK USA Europe - Restrictions for use of 2.4 GHz Frequencies in European Communilv Counlrles Beige Fofprivele usage oulside buildingsacmsspublic midsweriessriisn Belgique: 300mnospecialregislmtim wiui lBPT/Bll’l'isreqnired.chismeimw IBPT/BIPT is required for priveie usage outside buildings across public grounds over more em 300m. For regisnefiorr and license elem mum lBPT/BIP'R 14 Voor privé-gebruik haliten gebouw over publieke goud over afsmnd kleiner dan 300m gem mgimfie bij Bll’T/[BPT nodig; voor gebruik wcralsrand gmterdan 300m is we] ngistratic bij BlP'l'llBPT nodig, Voor legistmtie of licentie kunt u oomxc! opnemen met BM Dans le ens d'une utilisau'on privée, a l‘extérieur d‘un batiment, au- dtssm d‘un cspace public, mm cnrcgistrcment n’tstnéoasaircpmlr une dismnce demoinsde 300m, Puurune dislanoe supérianv 3 300mm enregimememauprés de l‘l'BP’l' at requise, Pourlcs emegistmmcms ct Iioznws, veuillez commier l‘lBPT, Deulschland: License required for crutdoor installations Check with reseller for procedure to follaw, Arirneldung im Olndoor-Baeich mtwendig abet nicht gmchmigungspflichtigBim mit Handler die Vorgehcnsweise abslirnmm Rmrricwd frequmcy bend: only channels 1 lo 7 (2400 MHz and 2454 MHz rcspectivcly) may be and outdoors in Frame, Please contact ART, (hapJ/Wwwm—leleoomfi) for applicable procedures to follaw. Band; dc fréquenoemtreinle: Is 15 canaux l- 7 (2400 at 2454MHz mpectivement) doiwent étmu ' sés endmils exléricuren France. Vous pouvez comm I’Auloi'ité de Régulaticn (he Télécormmmiations (hIth/wwwan-wleomnfi) pour lapmcédm é suivre. Iralr’z License required for indoor use. Use with outdoor installations not alluwed, 13‘an la ouncessione ministeriale anche per l’uso imam, Frame: Verificare can i rivcnditori la pmcedura da seguirer Nederland: License required for outdoor installations, Check with reseller for procedure to follow. Licentie verplicht voor gelmiik met buirenanrzrmes, Neam comm op met verkoper voorjuiste procedure. 802.lla(5 GHz) Ammlia Austria Belgium Canada Denmark Finland France Germany Greece Ireland Italy Liechwnstzin Luxembourg Netherlands New Zealand Norway Portugal Sweden Swimland UK USA 15 ThrboModeGGl-lz)’ Canada USA Europe - Restrictions for use of 5 GHz Frequencies In European Community Countries European Community 5150~SZSOMHz 52505350er 54705725;er Cgumria Clururehulé,40,44, Clmmelx:52.56,60, Ct-mrzls: 100,104, IOS’IIZ, 48 a “6,120.124, ”3.132. “6,140 IndoorOnly Indoor Only Indoor/armor Arno-in 0 x x Belgium, France, 0 o x Switzerland/Lichtenstein Denrrrarlgl-‘inland, o o 0 Germany Greece, ‘ Ireland, Italy, Luxembourg, Netherlands, Norway, Pompl,$weden.UK ‘ Iceland, Spain 0 o o O: allowed ><: forbidden 4. To remain in oonformanoe with European spectrum wage laws for Wireless LAN operation, the above 2.4 GHz and 5 GHz channel limitations apply. The user should use the wireless LAN utility to check the current channel of operation, lfopmrtion is occurring outside ofthe allowable frequencies as listed above. the usermust case operating therreless LAN atthat location and consult the local technical support Mmmible for the wireless network. ' The5 GHzTurbomode feetllreisnot allowedforopemtzion inany European Community country. This device must notbe operated in ad~hoc mode using Channels in the 5 Gszands intim European Community. Ad—hoc mode provides a direct conununioation between two client devim without aWueIess LAN Am Point. This device muslbe usedwith Access Points that have employed and activated a radar detection feature required for Elu'opean Commimity operation in the 5 GHz hands, This dovioewill opmte unduthe control of the Access Point in order to avoid operating on a channel oompied by any radar system in the area. The presence ofnearby radar operation may “sill! 16 in (cmpcrary infim‘uptiw ofopcmfion ofthis device ThcAccms Point’s mdardcwction feature will aulm-mfically mun openfion on achannel flee ofradar. You may mu with the local lechnical 5mm suffresponsible for the wireless mm to ensure the Access Point dcvice(s) am My configured for European Comnnmity operation. Approved Countries/Regions for use for the Alheros Assumx Mini PCI Wiraless Network Adapter This equipmemis appmvedto the radio slmdnrdlyy file commits/regions in the following table, DD not use this equipment except in the countvies/vegions in the Inllnwing table. NOTE This device works on passive scan only, A peemtrpeer mode is not available in 302.11a and Turbo Made. xoz.ub(2.4 GHz) Australia Austria Belgium Canada Denmark Finland France Gmny Greece Ireland Italy Liechtenstein Luxembourg Nelhcrlands New Maud Norway Portugal Sweden Swhzerland UK USA 802.1 la (5 GHZ) Ausnalia Austria Belgium Canada Denmark Finland Fume Germany Greece Inland Italy Liechmmein Luxembourg Netherlands New Zealand Norway Portugal Sweden Switzerland UK USA Turbo Mode (5 GHz) Canada USA Approved Countries/Regions for use lur the Intel® PRO! Wireless LAN 2100 38 Mini PCI Adapter niseqnipmeniiseppmvedmuiemdio smudardbytheoountries/rcgims in the following table. [Em Do not use lhis equipment except in the countries/legions in iheiullwving table. Argentina Australia Austria Belgium Bmzil Qanada Chile Denmark Finland Fiance Gummy Gleeoe Iceland Ireland Italy Japan Liechwnswin Lmtembcurg Mexioo Nefiwflmds New Zealand Non-my Peru PWFJ Singapole Spain Sweden Switzerland UK Uruguay USA Venezuela Approved Countries/Regions for use for the Toshiba Mini PCl Wireless LAN Card This equipment is approved to the indie standard by the counu'ies/regions in the following table. Do not use this equipment except in the countries/legions in the following tablel Australia Austria Belgium Canada Denmark Finland ance Sammy Greece Hong Kong Iceland inland Italy Japan Liechtenstein 21 Any use of low power radio frequency electric machinery shall not affect aviation safety and interfere Willi legal communications. lnflie even interference is caused, the use ofsuch electricmachinery shall be inmledialely discontinued. Operation of such procmm can be resumed only Whfil they are modified and can no Imgcr cause inteifcrenoe. The legal communications mentioned in the above item refer to radio communications operand in accordance with fielewmmimicalim laws and regulations Luwpowrradio frequency electric machinery shall resist agninst interference fiom legal mummicafim M fimn industrial. scientific and medical radio emission electric machinery. Using this Equipment in Japan in Japan. the freqimicybandwidlh 00,400 MHz in 2,483.5 MHz for second generativn low-power data mnrrrnisaiim systems such as fliis equipment overlaps um ofmobile abject idmtificatim sysums (premises radio station and specified low-power radio station). 1. Sticker r Please put die following sticker on devices incorporating this prpdum, TM lie-mm hamdm a IN! ear-pm MAY warms Wllhlfl Ihe M unu- Is mam-i devices. sclwnilc Gel/loss, medical dew/es. mlcmwava m. Inseam led-1 mile": and non-licensee swim my unis slam": in moblle shied Munmcalw synm (mm ma n hclw 910de hirer (Oihs mm slur-ms! i aroma mg m: WWI. ensure minim mi mini-u win worm. aquvmsm lime same 2 II on equipmem Games RF iii-«mm m m: via-e suns-rs. narrow change he Imumy using rrssri. air-gum beanie-r 00 use, ovum all me snubs or emissions cl leaclYOSNIEA Dml PC lyw NV. pmblsms wim interim» caused by «air Wadi/u lo om lam-u SIM-ens 2. Indication The indication shown below appears on his equipment. (1) (2) (3) (4) 1 2.4: This equipment uses a frequency of 2.4 GHz.
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.4 Linearized : No Create Date : 2007:01:16 16:58:35Z Subject : Modify Date : 2007:01:16 17:17:23-08:00 Page Count : 18 Creation Date : 2007:01:16 16:58:35Z Author : z21644as Producer : Acrobat PDFWriter 3.02 for Windows NT Keywords : Mod Date : 2007:01:16 17:17:23-08:00 Metadata Date : 2007:01:16 17:17:23-08:00 Title : Scan Creator : z21644as Description :EXIF Metadata provided by EXIF.tools