Fuji Film 01000006 Flat Panel Detector User Manual 897N120339A Z72N3191A 141015
Fuji Film Corporation Flat Panel Detector 897N120339A Z72N3191A 141015
Contents
- 1. (Short-Term Confidential) User Manual 1
- 2. (Short-Term Confidential) User Manual 2
(Short-Term Confidential) User Manual 1
For Safe Operation DIGITAL RADIOGRAPHY System &RQÂżJXUDWLRQ (Product Overview) (DR-ID 1200) Operation Manual Basic Operation 2nd Edition : October 2014 7URXEOHVKRRWLQJ Daily Inspection and Maintenance Appendix Maintenance and Inspection This Operation Manual describes details on how to operate the FDR D-EVO II and cautions to be observed when operating it. Please read the Operation Manual thoroughly before actually operating the FDR D-EVO II along with âDR-ID 300CL Operation Manualâ and other manuals for the related products. After reading this manual, store it nearby the FDR D-EVO II so that you can see it whenever necessary. 897N120339A ii FDR D-EVO II Operation Manual 897N120339A Introduction This Operation Manual includes descriptions of matters necessary when using the FDR D-EVO II , such as the equipment overview, operation procedures and precautions to observe, as well as daily inspections and maintenance. Accompanying documents were originally drafted in the English language. Installation may only be conducted by authorized service personal. Indications for use (for U.S.) The Wired/Wireless FDR D-EVO IIĂDWSDQHOVHQVRUV\VWHPLVLQWHQGHGWRFDSWXUHIRUGLVSOD\ radiographic images of human anatomy. It is intended for use in general projection radiographic DSSOLFDWLRQVLQFOXGLQJSHGLDWULFDQGQHRQDWDOH[DPVZKHUHYHUFRQYHQWLRQDOÂżOPVFUHHQRU&5 systems may be used. The FDR D-EVO IILVQRWLQWHQGHGIRUPDPPRJUDSK\ĂXRURVFRS\ tomography, and angiography applications. Intended use (for European Union and other countries.) The FDR D-EVO IIĂDWSDQHOGHWHFWRUV\VWHPLVLQWHQGHGWRFDSWXUHIRUGLVSOD\UDGLRJUDSKLFLPDJHV of human anatomy. It is intended for use in general projection radiographic applications wherever FRQYHQWLRQDOÂżOPVFUHHQRU&5V\VWHPVPD\EHXVHG Note : The above statements were determined by applicable medical device regulations which vary throughout the world. These statements are subject to revision when additional clearance or approval is obtained. CAUTIONS 1. No part or all of this manual may be reproduced in any form without prior permission. 7KHLQIRUPDWLRQFRQWDLQHGLQWKLVPDQXDOPD\EHVXEMHFWWRFKDQJHZLWKRXWSULRUQRWLFH )8-,),/0&RUSRUDWLRQVKDOOQRWEHOLDEOHIRUPDOIXQFWLRQVDQGGDPDJHVUHVXOWLQJIURP LQVWDOODWLRQUHORFDWLRQUHPRGHOLQJPDLQWHQDQFHDQGUHSDLUSHUIRUPHGE\RWKHUWKDQGHDOHUV VSHFLÂżHGE\)8-,),/0&RUSRUDWLRQ )8-,),/0&RUSRUDWLRQVKDOOQRWEHOLDEOHIRUPDOIXQFWLRQVDQGGDPDJHVRI)8-,),/0 Corporation products due to products of other manufacturers not supplied by FUJIFILM Corporation. )8-,),/0&RUSRUDWLRQVKDOOQRWEHOLDEOHIRUPDOIXQFWLRQVDQGGDPDJHVUHVXOWLQJIURP UHPRGHOLQJPDLQWHQDQFHDQGUHSDLUXVLQJUHSDLUSDUWVRWKHUWKDQWKRVHVSHFLÂżHGE\ FUJIFILM Corporation. )8-,),/0&RUSRUDWLRQVKDOOQRWEHOLDEOHIRUPDOIXQFWLRQVDQGGDPDJHVUHVXOWLQJIURP QHJOLJHQFHRISUHFDXWLRQVDQGRSHUDWLQJPHWKRGVFRQWDLQHGLQWKLVPDQXDO )8-,),/0&RUSRUDWLRQVKDOOQRWEHOLDEOHIRUPDOIXQFWLRQVDQGGDPDJHVUHVXOWLQJIURPXVH XQGHUHQYLURQPHQWFRQGLWLRQVRXWVLGHWKHUDQJHRIXVLQJFRQGLWLRQVIRUWKLVSURGXFWVXFKDV power supply, installation environment, etc. contained in this manual. )8-,),/0&RUSRUDWLRQVKDOOQRWEHOLDEOHIRUPDOIXQFWLRQVDQGGDPDJHVUHVXOWLQJIURP QDWXUDOGLVDVWHUVVXFKDVÂżUHVHDUWKTXDNHVĂRRGVOLJKWQLQJHWF 7KLVV\VWHPLVFODVVLÂżHGDVDPHGLFDOGHYLFHXQGHU(&'LUHFWLYH((& Caution : Rx Only in the United States (Federal law restricts this device to sale by or on the order of a physician.) FDR D-EVO II Operation Manual 897N120339A iii Open-Source Software Contained in This Product This product contains third partyâs software that is made available as open source software or free software. 7KLVVRIWZDUHLVSURYLGHGÂłDVLV´ZLWKQRZDUUDQW\RIDQ\NLQGDVWRLWVPHUFKDQWDELOLW\RUÂżWQHVVIRU any particular purpose. For the information on open source software contained in this product, please see the attached DVD. Source codes for certain type of open source software used in this product are available at delivery cost. If you would like to receive such source codes, please contact FUJIFILM dealer or the service representatives at the agency from which you purchased this product. (Please be noted that any inquiries concerning the contents of source codes should be directed to original licensors of open source software.) Note :)8-,),/0KDVVXFFHVVIXOO\SHUIRUPHGYHULÂżFDWLRQDQGYDOLGDWLRQWHVWLQJRQDOOWKLUGSDUW\ VRIWZDUHDQGKDVFRQÂżUPHGLWVVXLWDELOLW\WREHXVHGLQWKLVV\VWHP 7UDGHPDUNV All company names and product names described in this manual are the trademarks or registered trademarks of FUJIFILM Corporation or their respective holders. Windows is the registered trademark of US Microsoft Corporation in the U.S.A. and other countries. SDHC Logo is a trademark of SD-3C, LLC. Copyright Š 2014 FUJIFILM Corporation. All rights reserved. iv FDR D-EVO II Operation Manual 897N120339A FDR D-EVO II System Operation Manuals DIGITAL RADIOGRAPHY FDR D-EVO II (DR-ID 1200) Operation Manual DR-ID 1200PU Operation Manual DR-ID 1200DU Operation Manual DR-ID 300CL Operation Manual The DR-ID 1200MC runs on a commercially available personal computer. However, operations are not required to use the FDR D-EVO II. For operations of a commercially available personal computer, see the operation manual provided by the manufacturer. Manage and store all the Operation Manuals of the devices constituting the system together as a set. FDR D-EVO II Operation Manual 897N120339A (When the optional access point is used) DIGITAL RADIOGRAPHY DR-ID 1200 PANEL UNIT DR-ID 1200PU DOCKING UNIT DR-ID 1200DU Flat panel sensor Flat panel sensor Power supply unit DR-ID 1200MP Docking stand DR-ID 1200DS Image processing unit DR-ID 300CL*1, *3 Access point Battery charger Hub Image processing unit of other digital radiography system DR-ID 300CL (When an access point installed in the hospital is used) DIGITAL RADIOGRAPHY DR-ID 1200 PANEL UNIT DR-ID 1200PU Flat panel sensor Power supply unit DR-ID 1200MP DOCKING UNIT DR-ID 1200DU Flat panel sensor Docking stand DR-ID 1200DS Image processing unit DR-ID 300CL*3 Battery charger Control cabinet DR-ID 1200MC*2 Access point Hub vi FDR D-EVO II Operation Manual 897N120339A Image processing unit of other digital radiography system DR-ID 300CL 7KHUHDUHIRXUW\SHVRIĂDWSDQHOVHQVRUV'5,'6('5,'6('5,'6(DQG DR-ID 1212SE (wireless/wired communication mode). Although the contents of this manual are GHVFULEHGE\WDNLQJWKHH[DPSOHRI'5,'6(WKHVDPHFDQDOVREHDSSOLHGWRRWKHUĂDWSDQHO VHQVRUV:LWKUHJDUGWRWKHGHVFULSWLRQVSHFLÂżFWRDFHUWDLQW\SHRIĂDWSDQHOVHQVRUWKHSURGXFW name is given in the description. The panel unit (DR-ID 1200PU) and the docking unit (DR-ID 1200DU) can be used simultaneously. Up to two power supply units (DR-ID 1200MP) and up to three docking stands (DR-ID 1200DS) can be used. To use the digital radiography (DR-ID 1200), either one power supply unit or docking stand is necessary. *1 The software for the control cabinet is installed on the image processing unit (DR-ID 300CL). 'HSHQGLQJRQWKHFRQÂżJXUDWLRQWKHFRQWUROFDELQHW '5,'0& PD\QRWEHLQFOXGHGLQWKH system. If not included, the software for the control cabinet can be installed on the image processing unit (DR-ID 300CL). ) RUGHWDLOVSHFLÂżFDWLRQRILPDJHSURFHVVLQJXQLWSOHDVHUHIHUWRÂł'5,'&/2SHUDWLRQ Manualâ. *3 When the image processing unit (DR-ID 300CL) is used in patient environment, run the notebook computer on battery power. FDR D-EVO II Operation Manual 897N120339A vii viii FDR D-EVO II Operation Manual 897N120339A Contents at a Glance Chapter Chapter Chapter Chapter Chapter Appendix For Safe Operation This chapter presents Warnings and Cautions we wish you to observe for safe operation of the FDR D-EVO II. 6\VWHP&RQÂżJXUDWLRQ 3URGXFW2YHUYLHZ This chapter gives the various unit names and describes their functions and features of the FDR D-EVO II. Basic Operation This chapter describes start-up, shut-down and other basic operations of the FDR D-EVO II. Troubleshooting This chapter describes how to troubleshoot in the event of an error on the FDR D-EVO II, and provides explanations about a list of error messages each of which appears when an error occurs. Daily Inspection and Maintenance This chapter describes daily care and maintenance we wish you to perform so that you can use the FDR D-EVO II optimally. $SSHQGL[$ 6SHFLÂżFDWLRQV Appendix Z Precautions for Exposure Appendix O Use of Optional Items Maintenance and Inspection Radio frequency (RF) compliance information FDR D-EVO II Operation Manual 897N120339A ix How to Read This Manual %DVLFSDJHOD\RXW 3OHDVHKDYHDJRRGJUDVSRIWKHEDVLFSDJHFRQÂżJXUDWLRQRIWKLV2SHUDWLRQ0DQXDODVLOOXVWUDWHG EHORZIRU\RXWRXVHLWPRUHHIÂżFLHQWO\ Section title Lead Shows the title of an operation procedure described in the section. Describes information we wish you to know in advance of your operating the system or information that may help you to operate it. 3.2 Starting Up and Shutting Down the System This section explains how to start up and shut down the system. Operations are required on the power VXSSO\XQLWGRFNLQJVWDQGĂDWSDQHOVHQVRUDQGLPDJHSURFHVVLQJXQLW The image processing unit in this section is only an example. For details on the image processing unit being used, see the Operation Manual provided with the personal computer. Index 3.2.1 Starting Up the System Operation procedure Describes an operation procedure according to sequential numbers. (When the DR-ID 1200PU is used) Make sure that the power cable is connected to the image processing unit. 1 Basic Operation 2 :KHQWKHĂDWSDQHOVHQVRULVXVHGLQZLUHOHVVFRPPXQLFDWLRQPRGHLQVWDOOWKHIXOO\FKDUJHG EDWWHU\SDFNWRWKHĂDWSDQHOVHQVRU :KHQLWLVXVHGLQZLUHGFRPPXQLFDWLRQPRGHFRQQHFWWKHĂDWSDQHOVHQVRUDQGWKHSRZHU VXSSO\XQLWXVLQJWKH6(FDEOH 3UHVVWKH21VLGHRIWKHPDLQVZLWFKRIWKHSRZHUVXSSO\XQLW Make sure that the power status LED is lit in blue. 3 A caption that facilitates you to open a desired [Chapter] quickly. :KHQWKHRSWLRQDODFFHVVSRLQWLVXVHGFRQQHFWWKHDFFHVVSRLQWWRWKHLPDJHSURFHVVLQJXQLW CAUTIONS 8VHWKHRSWLRQDODFFHVVSRLQWE\FRQQHFWLQJLWWRWKHSUHVHWLPDJHSURFHVVLQJXQLWDQGWRWKH86% FRQQHFWRU'RQRWXVHWKHRSWLRQDODFFHVVSRLQWE\FRQQHFWLQJLWWRRWKHULPDJHSURFHVVLQJXQLWDQG RU86%FRQQHFWRU 4 3UHVVWKH21VLGHRIWKHPDLQVZLWFKRIWKHSRZHUVXSSO\XQLW 7KHLQLWLDOL]DWLRQSURFHVVVWDUWV ⢠All cables should be connected properly. ⢠No media should be inserted into the disk drive of image processing unit. If the control cabinet is included in the system, the control cabinet starts up automatically. CAUTIONS ,IWKHSRZHUVWDWXV/('RIWKHFRQWUROFDELQHWGRHVQRWFRPHRQDIWHUWXUQLQJRQWKHLPDJH SURFHVVLQJXQLWWXUQRQWKHFRQWUROFDELQHW FDR D-EVO II Operation Manual 897N120339A 3-9 3DJHQXPEHU Displayed in conjunction with the chapter number. FDR D-EVO II Operation Manual 897N120339A 0DUNV Information items to be observed when you are operating this system and the supplementary remarks are described in this manual with the respective marks. For the safe system operation, be sure to observe Warning/Caution. WARNING Indicates hazardous situations that may lead to serious injuries or even death if the precaution is not or cannot be followed. CAUTIONS Indicates hazardous situations that may lead to mild or moderate injury or physical damages if the caution is not or cannot be followed. Indicates procedures requiring special attention, instructions that must be followed, supplementary explanations, etc. HINT Shows an item helpful for further effective system operation. Shows a more detailed operation method or an item that describes additional information. Expressions Messages appear on the display panel and the buttons are shown as below. Ć %XWWRQV H[DPSOH ------------------------------ Select The button to operate is shown. FDR D-EVO II Operation Manual 897N120339A xi Contents Introduction ...........................................................................................................................iii FDR D-EVO II System Operation Manuals .......................................................................... v Contents at a Glance ............................................................................................................ix How to Read This Manual .................................................................................................... x Chapter 1 For Safe Operation 1.1 Precautions Before Operating This Equipment ....................................................... 1-1 1.2 Precautions to be Observed When Using the Electric Medical Equipment ............. 1-2 1.3 Safety ...................................................................................................................... 1-3 1.4 Electromagnetic Compatibility (EMC).................................................................... 1-12 1.4.1 1.5 Precautions in Using the FDR D-EVO II .............................................................. 1-17 1.5.1 1.5.2 1.5.3 1.5.4 1.5.5 1.5.6 1.5.7 1.5.8 1.6 Handling.................................................................................................................1-17 Before Exposure ....................................................................................................1-18 During Exposure ....................................................................................................1-19 During Cleaning .....................................................................................................1-20 Storage ..................................................................................................................1-20 Precautions Related to the Load Applied to the Flat Panel Sensor .......................1-21 Radio Waves .........................................................................................................1-22 Battery Pack Status Indicator ................................................................................1-23 Locations of Labels and Signs .............................................................................. 1-24 1.6.1 1.6.2 1.6.3 1.6.4 1.6.4 1.6.5 1.7 DR-ID 1200 ...................................................................................................................1-12 Locations of Labels ................................................................................................1-24 DR-ID 1200 ............................................................................................................1-26 DR-ID 1200PU .......................................................................................................1-27 DR-ID 1200DU.......................................................................................................1-27 Safety and Other Symbols .....................................................................................1-28 Symboles de sĂŠcuritĂŠ et autres .............................................................................1-29 Installation Conditions ........................................................................................... 1-30 1.7.2 1.7.3 'HÂżQLWLRQRI3DWLHQW(QYLURQPHQW ..........................................................................1-30 Installation Precautions..........................................................................................1-31 Precautions for Installing the Access Point (Optional) ...........................................1-31 Chapter 2 6\VWHP&RQÂżJXUDWLRQ 3URGXFW2YHUYLHZ 2.1 FDR D-EVO II .................................................................................................................................................. 2-1 2.1.2 2.2 Unit Names and the Functions ................................................................................ 2-4 2.2.1 xii 6\VWHP&RQÂżJXUDWLRQ ..............................................................................................2-1 Features of the FDR D-EVO II .................................................................................................... 2-3 DR-ID 1200 ..............................................................................................................2-4 ,PDJH3URFHVVLQJ8QLW'LVSOD\&RQÂżJXUDWLRQ ......................................................... 2-9 2.4 Routine Operation Diagram................................................................................... 2-13 :LUHOHVV6SHFLÂżFDWLRQV ......................................................................................... 2-14 FDR D-EVO II Operation Manual 897N120339A Chapter 3 Basic Operation 3.1 Preparing the Flat Panel Sensor ............................................................................. 3-1 3.1.1 3.1.2 3.1.3 3.1.4 Type of Flat Panel Sensor .......................................................................................3-1 Number of the Connectable Flat Panel Sensors .....................................................3-1 Connecting/Disconnecting the Flat Panel Sensor Connector ..................................3-1 Inserting/Removing the Flat Panel Sensor into/ from the Radiographic Examination Stand ..............................................................3-2 3.1.5 Changing the Direction of the Flat Panel Sensor Connector ...................................3-4 3.1.6 Charging the Battery Pack for the Flat Panel Sensor ..............................................3-5 3.1.7 Charging the Image Processing Unit ..............................................................................3-6 3.1.8 Installing/Removing the Battery Pack for the Flat Panel Sensor .............................3-6 3.1.10 Attaching the Flat Panel Sensor to the Docking Stand ............................................3-8 3.2 Starting Up and Shutting Down the System ...............................................................................3-9 3.2.1 3.2.2 3.3 Routine Operations ....................................................................................................3-13 Step 1 Step 2 Step 3 3.4 Starting Up the System ............................................................................................3-9 Shutting Down the System .................................................................................... 3-11 Entering the Patient Information .............................................................................3-14 Selecting the Anatomical Region and Exposure/Study Menu.................................3-15 X-ray Exposure .......................................................................................................3-17 [1] Positioning the patient ......................................................................................3-17 [2] X-ray exposure/Image displaying .....................................................................3-18 [3] Sleep mode.......................................................................................................3-19 [4] Extended Image Readout .................................................................................3-19 How to Use Memory Exposure Mode........................................................................3-20 3.4.1 3.4.2 3.4.3 3.4.4 How to Start up and Use Memory Exposure Mode ...............................................3-20 How to Load Images ..............................................................................................3-21 List of Error Codes .................................................................................................3-22 How to Terminate Memory Exposure Mode...........................................................3-22 &KDSWHU7URXEOHVKRRWLQJ 4.1 When a Message Appears on the Image Processing Unit .................................................... 4-1 [1] If a warning dialog box appears ......................................................................................4-1 [2] If the message dialogue box MD11001 appears ..............................................................4-1 [3] If an exposed image cannot be acquired .........................................................................4-2 [4] If the dialog box containing the error message numbered 13048 appears ......................4-3 [5] If âUnusable due to error.â appears on the image processing unit................................................4-3 [6] If any other message dialogue box appears ....................................................................4-4 4.2 How to Cope with an Error... ................................................................................... 4-5 [1] When the image processing unit hangs up⌠..................................................................4-5 [2] When the image processing unit is turned off due to an electrical outage .......................4-5 [3] If a hard disk of the image processing unit is damaged ...................................................4-6 [4] If a white image is displayed after an exposure ...............................................................4-6 [5] Precautions for operation when the device status is âInitializingâ or âChanging FPDâ in the image processing unitâs âOutput Device Status windowâ ............4-6 >@,IWKHĂDWSDQHOVHQVRUFDQQRWEHXVHGLQZLUHOHVVFRPPXQLFDWLRQPRGH ......................4-6 [7] If an error occurs on an output destination device ...........................................................4-7 Chapter 5 Daily Inspection and Maintenance 5.1 Daily User Inspection and Maintenance .................................................................... 5-1 5.1.1 5.1.2 Daily Inspection (DR-ID 1200) .................................................................................5-1 Periodical Inspection................................................................................................5-2 FDR D-EVO II Operation Manual 897N120339A xiii $SSHQGL[$6SHFLÂżFDWLRQV $ 6SHFLÂżFDWLRQV ..........................................................................................................A-1 A.1.1 A.1.2 A.1.3 A.1.4 A.1.5 A.2 External View and Weight .......................................................................................A-5 A.2.1 A.3 Processing Capacity (DR-ID 1200)......................................................................... A-1 Image Output (DR-ID 1200).................................................................................... A-1 Reduced Equivalent................................................................................................ A-2 Power Supply Conditions........................................................................................ A-3 Environmental Conditions ....................................................................................... A-3 DR-ID 1200 ............................................................................................................. A-5 Characteristics.........................................................................................................A-9 Appendix Z Precautions for Exposure Z.1 Precautions for Exposure in AUTO MODE ...........................................................................Z-1 Z.1.1 Z.1.2 Z.1.3 Z.1.4 Radiation Field .........................................................................................................Z-1 Depiction of the Cervical Region .............................................................................Z-2 Depiction of the HIP JOINT AXL â 2 Menu ..............................................................Z-2 EDR Image Data Analysis .......................................................................................Z-3 Z.2 Precautions for Exposure in SEMI-AUTO MODE ...................................................Z-4 Z.3 Precautions for Exposure in SEMI-X MODE ...........................................................Z-5 Z.4 Precautions for Exposure in FIX MODE ......................................................................Z-6 Z.5 Precautions for the Automatic X-ray Detection Function.............................................Z-7 Z.5.1 Z.5.2 Z.6 Z.7 Precautions for Making an Exposure .......................................................................Z-7 Precautions Related to the X-ray Exposure Time ....................................................Z-8 Precautions for Use in Wireless Communication Mode ..............................................Z-9 Other Precautions .................................................................................................Z-10 Z.7.1 Z.7.2 Z.7.3 Z.7.4 Z.7.5 Z.7.6 Z.7.7 Z.7.8 Z.7.9 Z.7.10 Z.7.10 Precautions for Exposure of a Subject in Relatively Large Contrast .....................Z-10 Precautions for Flat Panel Sensor .........................................................................Z-10 Precautions for Assuring the Radiation Field .........................................................Z-10 Images Output When the X-ray Shot Switch is Operated Incorrectly ....................Z-10 Precautions for Urgent Use ...................................................................................Z-11 Precautions Related to Continuous Operation ......................................................Z-11 Precautions Related to Grid...................................................................................Z-11 Precautions during Calibration...............................................................................Z-11 Precautions for Exposing the Flat Panel Sensor to X-ray......................................Z-11 Precautions for Extended Image Readout .............................................................Z-11 Precautions for Using the Access Point ................................................................Z-12 Appendix O Use of Optional Items O.1 Optional Items ....................................................................................................... O-1 O.2 Using the SE Storage Case ................................................................................... O-2 O.3 Using the Retaining Bracket for MP ....................................................................... O-3 O.4 DS Anchor Fixing Bracket ...................................................................................... O-4 O.5 Wall Fixing Bracket ................................................................................................. O-5 O.6 Access Point........................................................................................................... O-6 Maintenance and Inspection 5DGLRIUHTXHQF\ 5) FRPSOLDQFHLQIRUPDWLRQ Compliance with 1999/5/EC ................................................................................................. 3 xiv FDR D-EVO II Operation Manual 897N120339A Chapter 1 For Safe Operation 3UHFDXWLRQV%HIRUH2SHUDWLQJ7KLV (TXLSPHQW For Safe Operation Before using this equipment, please read âPrecautions Before Operating This Equipmentâ carefully so that you can operate it correctly. Whenever you operate this equipment, be sure to observe those precautions. Failure to do so may cause you to subject to injuries or property damage to occur. The institution where the equipment is installed is responsible for its use and maintenance. In addition, this equipment should not be used by persons other than doctors or suitably trained staff. 7KLVV\VWHPLVFODVVLÂżHGDVDPHGLFDOGHYLFHXQGHU(&'LUHFWLYH((& This equipment has been designed on the assumption that the patient would not come into direct contact with it or for operation by appropriately trained operator. Process waste correctly, as stipulated by local law or any regulations that apply. Part of the components contains harmful substances which may pollute the ambient environment if disposed carelessly. For details on product disposal, contact our RIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYH FDR D-EVO II Operation Manual 897N120339A 1-1 1.2 Precautions to be Observed When 8VLQJWKH(OHFWULF0HGLFDO(TXLSPHQW We ask that you observe these usage precautions and use the equipment correctly. 1. This equipment should be used only by people who have the proper skills. 2. Observe the following precautions when installing the equipment. 2-1. Install the equipment where water will not splash it. 2-2. Install the equipment where it will not be adversely affected by air pressure, temperature, humidity, ventilation, sunlight, dust or the presence of salt, sulfur or like substances in the atmosphere. 2-3. Make sure the equipment will remain in stable condition on a level surface and not be subjected to vibration or shock. 2-4. Do not install the equipment in places where chemicals are stored or gases emitted. 2-5. Make sure that the power frequency, voltage and power consumption are appropriate. 2-6. Connect the ground wire correctly. 3. Observe the following precautions before beginning to use the device. &RQÂżUPWKDWWKHJURXQGZLUHKDVEHHQFRPSOHWHO\FRQQHFWHG 3-2. Make sure that all cords have been connected properly and safely. 3-3. Be aware that correct diagnosis can be hindered and danger can result from using different pieces of equipment together. 3-4. Make sure that the battery and power supply are installed properly. 4. Observe the following precautions when using the equipment. 4-1. Make sure not to exceed the time and dose required for diagnosis. 4-2. Always monitor the patient and the equipment for abnormalities. 4-3. Take an appropriate action, such as stopping the equipment after ensuring the patientâs safety, if any abnormalities are found in his/her health or in the equipment. 5. Observe the following precautions after using the equipment. 5-1. Using the established procedure, then turn the power off. 5-2. When unplugging cords, do not pull on the body of the cord itself or apply unnecessary force. 5-3. Observe the following precautions when storing the equipment. I Store the equipment where water will not splash it. II Store the equipment where it will not be adversely affected by air pressure, temperature, humidity, ventilation, sunlight, dust or the presence of salt, sulfur or like substances in the atmosphere. III Make sure the equipment will remain in stable condition on a level surface and not be subjected to vibration or shock. IV Do not store the equipment in places where chemicals are stored or gases emitted. 5-4. After using the accessories, recollect them and put them back in order. 5-5. Make sure to clean the equipment for the next use. ,IWKHUHLVWURXEOHZLWKWKHHTXLSPHQWGRQRWDWWHPSWWRÂż[LWUDQGRPO\,QVWHDGGRZKDWLV indicated and entrust repairs to a professional. 7. Do not remodel the equipment. 8. Maintenance and Inspection 8-1. Make inspect the equipment and parts periodically. 8-2. If the equipment has not been used for a long time, make sure that it operates normally and safely prior to using it again. 9. Other Items 9-1. When subjecting patients (particularly infants and pregnant women) to radiation, make sure not to exceed the necessary time and dose. Also, ensure that radiation is contained within WKHH[SRVXUHSODQHRIWKHĂDWSDQHOVHQVRU 9-2. Follow the Operation Manual and operate the equipment correctly. For Safe Operation 1-2 FDR D-EVO II Operation Manual 897N120339A 1.3 Safety Before using the FDR D-EVO II, read this section thoroughly to ensure that you use the product properly. (OHFWULF6KRFN:DUQLQJVDQG&DXWLRQV WARNING For Safe Operation The power supply to the FDR D-EVO II is AC100 to 240V. 7RDYRLGHOHFWULFVKRFNVXVHUVVKRXOGDOZD\VWDNHWKHIROORZLQJSUHFDXWLRQV Ć 'RQRWRSHQDQ\FRYHUVZKHQLWLVQRWQHFHVVDU\ Ć ,QVWDOOWKHHTXLSPHQWLQDORFDWLRQZKHUHLWZLOOQRWEHH[SRVHGWRZDWHU Ć 0DNHVXUHWKDWWKHJURXQGZLUHRIWKHHTXLSPHQWLVFRQQHFWHGFRPSOHWHO\ Ć &KHFNWKDWDOORIWKHFDEOHVDUHFRPSOHWHO\DQGVHFXUHO\FRQQHFWHG Ć .HHSWKHFRQWUROFDELQHWRXWRIUHDFKRISDWLHQWV WARNING 'RQRWWRXFKWKHSDWLHQWÂśVERG\ZKLOHWRXFKLQJWKHFRQWUROFDELQHWDQGWKHLPDJHSURFHVVLQJ XQLW2WKHUZLVHWKHSDWLHQWPD\UHFHLYHDQHOHFWULFVKRFN WARNING 'RQRWXVHDPXOWLSOHWDSFRQQHFWRURUH[WHQVLRQFDEOHIRUSRZHULQJWKHGHYLFHVFRQVWLWXWLQJ WKHV\VWHP2WKHUZLVHÂżUHRUHOHFWULFVKRFNPD\RFFXUGXHWRWKHHOHFWULFDOORDGH[FHHGLQJWKH allowable limit. WARNING 2EVHUYHWKHIROORZLQJSUHFDXWLRQVZKHQXVLQJWKHFDEOHV Ć 'RQRWWRXFKWKHSOXJDQGFRQQHFWRUZLWKZHWKDQGV2WKHUZLVHHOHFWULFVKRFNPD\UHVXOW FDXVLQJGHDWKRUVHYHUHLQMXU\ Ć +ROGWKHSOXJRUFRQQHFWRUZKHQUHPRYLQJWKHFDEOH 3XOOLQJWKHFDEOHRUFDUU\LQJE\KROGLQJLWPD\GDPDJHWKHFDEOHFDXVLQJÂżUHRUHOHFWULFVKRFN Ć 'RQRWGDPDJHRUUHPRGHOWKHFDEOH 'RQRWSODFHDKHDY\REMHFWRQWKHFDEOHRUOD\LWXQGHUWKHĂDWSDQHOVHQVRU'RQRWVWHSRQ SXOOIRUFLEO\EHQGRUEXQGOHWKHFDEOH2WKHUZLVHÂżUHRUHOHFWULFVKRFNPD\UHVXOW WARNING 'RQRWWXUQRQWKHV\VWHPZLWKGHZFRQGHQVDWLRQRQWKHĂDWSDQHOVHQVRU2WKHUZLVHÂżUHRU HOHFWULFVKRFNPD\UHVXOW WARNING 'RQRWXVHWKHHTXLSPHQWLQDORFDWLRQZKHUHPHWDOSDUWLFOHVFRXOGFRPHLQWRWKHHTXLSPHQW 7KLVPD\FDXVHDQHOHFWULFVKRFN WARNING 'RQRWGLVDVVHPEOHRUUHPRGHOWKHHTXLSPHQW2WKHUZLVHÂżUHRUHOHFWULFVKRFNPD\UHVXOW .HHSDZD\IURPWKHSDUWVLQVLGHWKHSURGXFWZKLFKPD\FDXVHHOHFWULFVKRFN,I\RXWRXFK them accidentally, death or severe injury may result. FDR D-EVO II Operation Manual 897N120339A 1-3 WARNING 'RQRWKLWRUGURSWKHHTXLSPHQWRUVXEMHFWLWWRVHYHUHVKRFN2WKHUZLVHWKHHTXLSPHQWPD\ EHGDPDJHG,IWKHGDPDJHGHTXLSPHQWLVXVHGÂżUHRUHOHFWULFVKRFNPD\UHVXOW ,QDGGLWLRQGRQRWDSSO\VWURQJSUHVVXUHRQWRWKHĂDWSDQHOVHQVRU ,IDSSOLHGWKHĂDWSDQHOVHQVRUGHIRUPVDQGWKHZDWHUSURRIIXQFWLRQPD\EHFRPSURPLVHG WARNING/AVERTISSEMENT For Safe Operation 'RQRWXVHWKHĂDWSDQHOVHQVRUZLWKRXWWKHEDWWHU\SDFNV,IWKHEDWWHU\SDFNVDUHQRW DWWDFKHGDQHOHFWULFVKRFNPD\UHVXOW Nâutilisez pas le dĂŠtecteur Ă panneau plat sans les batteries. Si les batteries ne sont pas FRQQHFWpHVXQFKRFpOHFWULTXHULVTXHGHVHSURGXLUH WARNING 0DNHVXUHWRXVHWKHRSWLRQDOSDUWVDQGDFFHVVRULHVUHFRPPHQGHGE\XV)DLOXUHWRXVHWKH RSWLRQDOSDUWVDQGDFFHVVRULHVUHFRPPHQGHGE\XVPD\UHVXOWLQGDPDJHWRWKHHTXLSPHQW DQGRUHOHFWULFVKRFNDQGLQMXU\ CAUTIONS $VWKHFDEOHVRIWKHHTXLSPHQWDUHORQJEHFDUHIXOQRWWRHQWDQJOHWKHFDEOHVGXULQJXVH Also, be careful not to trip over the cables. Falls could result in injury. CAUTIONS )ROORZWKHVSHFLÂżHGSURFHGXUHZKHQWXUQLQJRIIWKHHTXLSPHQW2WKHUZLVHWKHĂDWSDQHO VHQVRUFRXOGEHGDPDJHGE\WKHUPDOVKRFN CAUTIONS 'RQRWVWRUHPDJQHWLFPHGLDQHDUWKH'5V\VWHPDQGFRQWUROFDELQHW2WKHUZLVHPDJQHWLVP JHQHUDWHGE\WKHHTXLSPHQWPD\FDXVHWKHGDWDWREHORVW CAUTIONS .HHSWKHHTXLSPHQWDZD\IURPSDWLHQWÂśVERG\ĂXLGVFKHPLFDOVZDWHUHWF 2WKHUZLVHLWPD\EHFRPHGDPDJHGFDXVLQJÂżUHRUHOHFWULFVKRFN ,IQHFHVVDU\SURWHFWWKHĂDWSDQHOVHQVRUE\FRYHULQJLWZLWKDGLVSRVDEOHEDJ ([SORVLRQ:DUQLQJV WARNING %HFDXVHWKLVHTXLSPHQWLVQRWH[SORVLRQSURRIGRQRWXVHFRPEXVWLEOHDQGH[SORVLYHJDVHV QHDUWKHHTXLSPHQW WARNING )ODPPDEOHJDVVHVPD\VWD\LQWKHURRPDIWHUGLVLQIHFWLRQ,I\RXWXUQWKHV\VWHPRQMXVWDIWHU GLVLQIHFWLRQHQVXUHWKDWWKHURRPLVZHOOYHQWLODWHGEHIRUHSRZHULQJRQWKHV\VWHP 1-4 FDR D-EVO II Operation Manual 897N120339A :DUQLQJVIRU$EQRUPDOLWLHV WARNING ,IDQ\RIWKHIROORZLQJRFFXUVLPPHGLDWHO\WXUQRIIWKHSRZHURIHDFKXQLWXQSOXJWKHSRZHU FDEOHIURPWKHRXWOHWDQGWKHQFRQWDFWRXURIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYH Ć :KHQVPRNHVWUDQJHRGRURUDEQRUPDOVRXQGLVSUHVHQW Ć :KHQDIRUHLJQREMHFW VXFKDVDPHWDOREMHFW RUOLTXLGHQWHUVWKHSURGXFW Ć :KHQWKHHTXLSPHQWLVGURSSHGRUKLWDQGLVGDPDJHG For Safe Operation Avertissements relatifs aux anomalies AVERTISSEMENT 6LOÂśXQHGHVFRQGLWLRQVUpSHUWRULpHVFLDSUqVVHSURGXLWPHWWH]LPPpGLDWHPHQWFKDTXHXQLWp hors tension, dĂŠbranchez le cordon dâalimentation de la prise secteur, puis contactez notre UHYHQGHXUDJUppRXQRWUHUHSUpVHQWDQW)8-,),/0 Ć (QFDVGHSUpVHQFHGHIXPpHGÂśXQHRGHXUpWUDQJHRXGÂśXQEUXLWDQRUPDO Ć (QFDVGHSpQpWUDWLRQGÂśXQFRUSVpWUDQJHU FRPPHXQREMHWPpWDOOLTXH RXGÂśXQOLTXLGHGDQV le produit. Ć (QFDVGÂśHQGRPPDJHPHQWGHOÂśpTXLSHPHQWVXLWHjXQHFKXWHRXjXQLPSDFW Installation Precautions CAUTIONS 'RQRWLQVWDOOWKHV\VWHPLQDORFDWLRQZLWKWKHIROORZLQJFRQGLWLRQV Ć :KHUHWKHWHPSHUDWXUHFKDQJHVVKDUSO\ Ć &ORVHWRKHDWVRXUFHVVXFKDVDKHDWHU Ć :KHUHWKHV\VWHPPD\EHH[SRVHGWRZDWHUGXHWRZDWHUOHDNDJHRULQJUHVV Ć :KHUHFRUURVLYHJDVPD\EHJHQHUDWHG Ć :KHUHWKHUHLVH[FHVVLYHGXVW Ć :KHUHWKHV\VWHPLVVXEMHFWWRIUHTXHQWRUH[FHVVLYHYLEUDWLRQVKRFN Ć :KHUHWKHV\VWHPLVH[SRVHGWRGLUHFWVXQOLJKW Ć :KHUHWKHUHLVQRYHQWLODWRU CAUTIONS 8VHWKHHTXLSPHQWRQDĂDWSODFH,IWKHHTXLSPHQWIDOOVLWPD\FDXVHGDPDJHWRWKHHTXLSPHQW or personal injury. CAUTIONS :KHQ\RXPRYHWKHHTXLSPHQWSODFHLWLQWKHFDVVHWWHVWRUDJHER[RIDPRELOH;UD\XQLWRUKROG LWE\KDQGWRSUHYHQWLWIURPIDOOLQJ,IWKHFDUWLVXVHGWRPRYHWKHHTXLSPHQWSODFHLWKRUL]RQWDOO\ CAUTIONS )RUYHWHULQDU\RUPRELOHDSSOLFDWLRQVSOHDVHFRQWDFWRXURIÂżFLDOGHDOHURU)8-,),/0 Representative. CAUTIONS :KHQWKHGHYLFHVDUHXVHGRXWGRRUVLQZLUHOHVVFRPPXQLFDWLRQPRGHFRQWDFWRXURIÂżFLDO dealer or FUJIFILM Representative. FDR D-EVO II Operation Manual 897N120339A 1-5 CAUTIONS/ATTENTION Do not place any object in a place where removal of the power cable is prevented. 1HSODFH]DXFXQREMHWjXQHPSODFHPHQWJrQDQWOHGpEUDQFKHPHQWGXFkEOHGÂśDOLPHQWDWLRQ CAUTIONS 7RHQVXUHRSWLPDOLPDJHTXDOLW\LWLVUHFRPPHQGHGWKDW\RXGRQRWXVHWKHĂDWSDQHOVHQVRU QHDUGHYLFHV PRWRUWUDQVIRUPHUVZLWFKLQJVXSSO\HWF WKDWJHQHUDWHHOHFWURPDJQHWLFQRLVH For Safe Operation CAUTIONS 7RHQVXUHRSWLPDOLPDJHTXDOLW\LWLVUHFRPPHQGHGWKDW\RXGRQRWSODFHWKHFDEOHV SRZHU FDEOHFRPPXQLFDWLRQFDEOHHWF RIWKHHTXLSPHQWQHDUGHYLFHV PRWRUWUDQVIRUPHUVZLWFKLQJ VXSSO\HWF WKDWJHQHUDWHHOHFWURPDJQHWLFQRLVHDQGWKHLUFDEOHV CAUTIONS Do not install the power supply unit in a place where it may be contacted inadvertently. In DGGLWLRQWDNHFDUHQRWWRPDNHFRQWDFWZLWKWKHSRZHUVXSSO\XQLWH[FHSWZKHQRSHUDWLQJWKH main switch. If the fan inside the power supply unit malfunctions, the power supply unit may EHFRPHKRWFDXVLQJLQMXU\ Connection Instructions WARNING 0DNHVXUHWKDWWKHGHYLFHVWREHFRQQHFWHGWRWKHHTXLSPHQWDUHDXWKRUL]HGIRUFRQQHFWLRQ WARNING &RQQHFWWKHSDQHOXQLW'5,'38DQGWKHGRFNLQJXQLW'5,''8RQO\WRWKHDFFHVV SRLQWLPDJHSURFHVVLQJXQLWRUWKHFRQWUROFDELQHW 3UHFDXWLRQVRQ([WHUQDO1HWZRUN&RQQHFWLRQ CAUTIONS :KHQDVHWWLQJRIWKHQHWZRUNWRZKLFKWKHHTXLSPHQWLVFRQQHFWHGKDVEHHQFKDQJHG FKHFNWKDWWKHFKDQJHGRHVQRWDIIHFWWKHV\VWHPRSHUDWLRQDQGWDNHPHDVXUHVLIQHFHVVDU\ 7KHVHWWLQJFKDQJHPD\LQFOXGHWKHIROORZLQJ Ć & KDQJHRIFRQQHFWLRQGHVWLQDWLRQ Ć $ GGLWLRQRIGHYLFHV Ć 5 HPRYDORIGHYLFHV Ć 8 SGDWHRIGHYLFHV Ć 8 SJUDGHRIGHYLFHV 1-6 FDR D-EVO II Operation Manual 897N120339A :DUQLQJVDQG&DXWLRQVRQ1HWZRUN WARNING 0DNHVXUHWRXVHWKHRSWLRQDOSDUWVDFFHVVRULHVDQGQHWZRUNVUHFRPPHQGHGE\XV)DLOXUHWR XVHWKHRSWLRQDOSDUWVDFFHVVRULHVDQGQHWZRUNVUHFRPPHQGHGE\XVPD\UHVXOWLQGDPDJHWR WKHHTXLSPHQWDQGRUHOHFWULFVKRFNDQGLQMXU\ CAUTIONS For Safe Operation &RQQHFWWRWKH(WKHUQHW1HWZRUNRI%$6(7;RU%$6(7SUHVFULEHGLQWKH,(((VWDQGDUG 'RQRWFRQQHFWWHOHSKRQHOLQHVWR/$1FRQQHFWRU2QO\873W\SHVWUDLJKW/$1FDEOHVRISDLU &DWHJRU\FDEOH &$7( RUKLJKHUDUHDSSURSULDWHIRUFRQQHFWLRQWRWKLVFRQQHFWRU CAUTIONS $IWHUFRQQHFWLQJWKLVV\VWHPWRWKHQHWZRUNZLWKRWKHUV\VWHPVFRQÂżUPWKDWWKHRWKHUV\VWHPV DUHQRWDIIHFWHG,IWKH\DUHDIIHFWHGWDNHFRXQWHUPHDVXUHVVXFKDVQHWZRUNVHSDUDWLRQ System Isolation Instructions WARNING To ensure complete system isolation, never install any unauthorized accessories or other such items. :KHQLWLVQHFHVVDU\WRLQVWDOODXWKRUL]HGDFFHVVRULHVRURSWLRQDOLWHPVFRQWDFWRXURIÂżFLDO dealer or FUJIFILM Representative. WARNING .HHSHTXLSPHQWRWKHUWKDQWKRVHXVHGIRUSDWLHQWVRXWRIWKHLUUHDFKWRHQVXUHDSSURSULDWH system isolation. WARNING ,QQRUPDOXVHKDYHDSDWLHQWWDNHDSURSHUSRVLWLRQLQJIRUH[SRVXUH7KHRSHUDWRUVKRXOG operate the system in a place where safety from radiation is ensured. The operator should DOVRPDNHVXUHEHIRUHH[SRVXUHWKDWQRRQHEXWWKHSDWLHQWLVLQWKHH[SRVXUHDUHDDQGWKH RSHUDWLQJDUHDRIWKHV\VWHP Software Precautions CAUTIONS Do not install additional software to the system. Do not uninstall any of the software preinstalled in the system. The system is preinstalled with the appropriate software. If other software is installed or if the H[LVWLQJVRIWZDUHLVXQLQVWDOOHGYDULRXVRSHUDWLRQDOHUURUVPD\UHVXOW FDR D-EVO II Operation Manual 897N120339A 1-7 Disinfection Instructions WARNING &RQÂżUPWKDWWKHUHVSLUDWRU\GHQVLW\RIGLVLQIHFWDQWLQFOXGLQJVROYHQWLVXQGHUOHJDOUHJXODWLRQ &HUWDLQGLVLQIHFWDQWVPD\GDPDJHKHDOWK:KHQXVLQJDGLVLQIHFWDQWIROORZLQVWUXFWLRQV supplied by the manufacturers. WARNING For Safe Operation 'RQRWXVHWKHIROORZLQJGLVLQIHFWDQWVRUVWHULOL]HUVDWWKHWLPHRIGLVLQIHFWLRQ4XDOLW\ SHUIRUPDQFHDQGVDIHW\RIWKHHTXLSPHQWFDQQRWEHDVVXUHG Ć &KORULFGLVLQIHFWDQWZKLFKLVVWURQJO\FRUURVLYHWRPHWDOVDQGUXEEHUSDUWV Ć 'LVLQIHFWDQWZKRVHXVHVRQPHWDOVSODVWLFVDQGFRDWLQJDUHIRUELGGHQDFFRUGLQJWRWKH instructions supplied with the disinfectant. Ć )RUPDOLQJDVDQGGLVLQIHFWDQWVSUD\VWKDWPD\JHWLQVLGHWKHHTXLSPHQW Ć 8OWUDYLROHWVWHULOL]HUV Disinfectant ethanol is recommended for disinfection. Carefully read the instructions and cautions supplied with the disinfectant before use. For details on the disinfectant, contact a FUJIFILM dealer or the service representatives at the DJHQF\IURPZKLFK\RXSXUFKDVHGWKHGLVLQIHFWDQW CAUTIONS ,IĂDWSDQHOVHQVRULVQRWGLVLQIHFWHGLWPD\OHDGVHFRQGDU\LQIHFWLRQ Be sure to disinfect with ethanol after use. CAUTIONS &OHDQWKHVHQVRUXQLWRIWKHĂDWSDQHOVHQVRUZLWKHWKDQROIRUGLVLQIHFWLRQHWFIRUHDFKSDWLHQW to prevent infection. 3UHFDXWLRQVIRU&KDUJLQJWKH%DWWHU\3DFN CAUTIONS 2EVHUYHWKHIROORZLQJSUHFDXWLRQVZKHQFKDUJLQJWKHEDWWHU\SDFN RSWLRQDO XVLQJWKHEDWWHU\ FKDUJHU RSWLRQDO Ć ' RQRWXVHWKHEDWWHU\SDFN < RUEDWWHU\FKDUJHULQFRPELQDWLRQZLWKDQ\EDWWHU\ SDFNRUEDWWHU\FKDUJHU LQFOXGLQJWKHSRZHUFDEOH RWKHUWKDQWKRVHUHFRPPHQGHGE\ FUJIFILM Corporation. Ć 'RQRWGLVDVVHPEOHRUFRQYHUWWKHEDWWHU\SDFNRUEDWWHU\FKDUJHU Ć ,IWKHEDWWHU\SDFNRUEDWWHU\FKDUJHUEHFRPHVIDXOW\FRQVXOWRXURIÂżFLDOGHDOHURU)8-,),/0 Representative. Ć 'RQRWFRYHUWKHKROHVLQWKHEDWWHU\FKDUJHUZLWKIRUHLJQPDWWHU Ć $YRLGWKHDFFXPXODWLRQRIGXVWRQWKHEDWWHU\FKDUJHU Ć ,QVHUWWKHEDWWHU\SDFNLQWRWKHEDWWHU\FKDUJHUVHFXUHO\ Ć ,IWKHLQVHUWLRQGLUHFWLRQRUSRVLWLRQRIWKHEDWWHU\SDFNLVLQFRUUHFWWKHEDWWHU\SDFNLVQRW FKDUJHGSURSHUO\ Ć : KHQLQVHUWLQJWKHEDWWHU\SDFNSUHYHQWIRUHLJQPDWWHUIURPJHWWLQJLQWRWKHEDWWHU\FKDUJHU Ć : KLOHFKDUJLQJWKHEDWWHU\SDFNGRQRWDOORZWKHEDWWHU\SDFNRUEDWWHU\FKDUJHUJHWZHWRU dusty. Ć ' RQRWVWHSRQWKH$&DGDSWHURIWKHEDWWHU\FKDUJHU$OVREHFDUHIXOQRWWRWULSRYHUWKH power cable. Ć ' RQRWVXEMHFWWKHEDWWHU\SDFNDQGEDWWHU\FKDUJHUWRVHYHUHVKRFN E\GURSSLQJWKHPHWF Ć 'RQRWSODFHWKHEDWWHU\FKDUJHUZLWKLQWKHUHDFKRISDWLHQWV 1-8 FDR D-EVO II Operation Manual 897N120339A Ć ' RQRWFKDUJHWKHEDWWHU\SDFNQHDUÂżUHRUXQGHUVWURQJVXQVKLQH,IWKHEXLOWLQSURWHFWLRQ PHFKDQLVPVDUHDFWLYDWHGE\DKLJKWHPSHUDWXUHWKHEDWWHU\SDFNFDQQRWEHFKDUJHG$OVR LIWKHEXLOWLQSURWHFWLRQPHFKDQLVPVDUHGDPDJHGWKHEDWWHU\SDFNPD\EHFKDUJHGZLWK H[WUHPHO\KLJKFXUUHQWDQGYROWDJHDQGDEQRUPDOFKHPLFDOUHDFWLRQVPD\RFFXULQVLGHWKH EDWWHU\SDFNFDXVLQJLWWRRYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć 7 RFKDUJHWKHEDWWHU\SDFNEHVXUHWRXVHWKHGHVLJQDWHGEDWWHU\FKDUJHUDQGWRREVHUYH WKHFKDUJLQJFRQGLWLRQVVSHFLÂżHGE\)8-,),/0&RUSRUDWLRQ,IWKHEDWWHU\SDFNLVFKDUJHGLQ RWKHUFRQGLWLRQV WHPSHUDWXUHRUYROWDJHFXUUHQWKLJKHUWKDQVSHFLÂżHGUHPRGHOHGEDWWHU\ FKDUJHUHWF WKHEDWWHU\SDFNPD\EHRYHUFKDUJHGRUFKDUJHGZLWKH[WUHPHO\KLJKFXUUHQW DQGDEQRUPDOFKHPLFDOUHDFWLRQVPD\RFFXULQVLGHWKHEDWWHU\SDFNFDXVLQJLWWRRYHUKHDW HPLWVPRNHH[SORGHRULJQLWH Ć ,PPHGLDWHO\VWRSFKDUJLQJWKHEDWWHU\SDFNLIFKDUJLQJLVQRWFRPSOHWHGZLWKLQWKHVSHFLÂżHG WLPH2WKHUZLVHWKHEDWWHU\SDFNPD\RYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć ' RQRWXVHWKHĂDWSDQHOVHQVRUQHDUWKHSRZHUFDEOH Ć 'RQRWXVHDIDXOW\RUEURNHQEDWWHU\FKDUJHURU$&DGDSWHU Ć 1 RWHWKDWWKHĂDWSDQHOVHQVRUFDQQRWEHFKDUJHGE\XVLQJWKH6(FRPPXQLFDWLRQFDEOHWKDW FRQQHFWVWKHĂDWSDQHOVHQVRUDQGWKHDFFHVVSRLQW RSWLRQDO For Safe Operation %DWWHU\3DFN,QVWUXFWLRQV WARNING Ć %DWWHU\SDFNUHTXLUHVUHJXODUFKHFNXSDQGUHSODFHPHQW%DWWHU\FDSDFLW\EHJLQVWRZDQH after a period of time. Ć ,IWKLVHTXLSPHQWLVQRWLQXVHIRUZKLOHVWRUHLWZLWKWKHEDWWHU\SDFNUHPRYHG 1RWUHPRYLQJWKHEDWWHU\SDFNPD\FDXVHPDOIXQFWLRQ CAUTIONS 2EVHUYHWKHIROORZLQJSUHFDXWLRQVZKHQXVLQJWKHEDWWHU\SDFN RSWLRQDO Ć 7 KHEDWWHU\SDFN 1 LVXVHGZLWKWKHĂDWSDQHOVHQVRU'RQRWXVHWKHPLQRWKHU combinations. Ć & KDUJHWKHEDWWHU\SDFNRQO\ZLWKWKHGHVLJQDWHGEDWWHU\FKDUJHU,IWKHEDWWHU\SDFNLV FKDUJHGXQGHUWKHFKDUJLQJFRQGLWLRQV YROWDJHFXUUHQWDQGFKDUJLQJPHWKRG GLIIHUHQW IURPWKRVHVSHFLÂżHGE\)8-,),/0&RUSRUDWLRQWKHEDWWHU\SDFNPD\HPLWVPRNHLJQLWH H[SORGHRUOHDNĂXLG Ć 6 WRUHWKHEDWWHU\SDFNLQDFRRODQGGDUNSODFH5HFKDUJHWKHVWRUHGEDWWHU\SDFNHYHU\VL[ months or every year. Otherwise a decrease in battery capacity or other problems may result. Ć ' RQRWOHDYHWKHUHPRYHGEDWWHU\SDFNLQWKHFDURURWKHUSODFHVH[SRVHGWRKLJK WHPSHUDWXUH,IWKHEDWWHU\SDFNLVXVHGRUVWRUHGLQDSODFHZKHUHLWLVH[SRVHGWRKLJK WHPSHUDWXUHWKHEDWWHU\SDFNPD\HPLWVPRNHLJQLWHH[SORGHRUOHDNĂXLG Ć 8 VHRUVWRUHWKHEDWWHU\SDFNRQO\LQWKHHQYLURQPHQWDOFRQGLWLRQVVSHFLÂżHGE\)8-,),/0 &RUSRUDWLRQ,IWKHEDWWHU\SDFNLVXVHGRUVWRUHGLQDSODFHZKHUHLWLVH[SRVHGWRKLJK WHPSHUDWXUHWKHEDWWHU\SDFNPD\HPLWVPRNHLJQLWHH[SORGHRUOHDNĂXLG Ć :KHQGLVSRVLQJRIWKHEDWWHU\SDFNFRQVXOWRXURIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYH Ć ' RQRWGLVDVVHPEOHRUUHPRGHOWKHEDWWHU\SDFN7KHEDWWHU\SDFNLVHTXLSSHGZLWKEXLOWLQ VDIHW\DQGSURWHFWLRQPHFKDQLVPV,IWKH\DUHGDPDJHGWKHEDWWHU\SDFNPD\RYHUKHDWHPLW VPRNHH[SORGHRULJQLWH Ć %HFDUHIXOQRWWRGURSWKHEDWWHU\SDFN7KHSDWLHQWPD\EHLQMXUHG Ć 'RQRWWRXFKWKHWHUPLQDORIWKHEDWWHU\SDFNGLUHFWO\7KHUHLVDULVNRIHOHFWULFVKRFN Ć ' RQRWFRQQHFWWKHSRVLWLYH DQGQHJDWLYH WHUPLQDOVZLWKDZLUHRUDQ\PHWDOREMHFW 'RQRWFDUU\RUVWRUHWKHEDWWHU\SDFNWRJHWKHUZLWKPHWDOREMHFWVVXFKDVQHFNODFHVRU KDLUSLQV2WKHUZLVHWKHEDWWHU\SDFNPD\VKRUWFLUFXLWDQGRYHUFXUUHQWPD\ĂRZFDXVLQJ WKHEDWWHU\SDFNWRRYHUKHDWHPLWVPRNHH[SORGHRULJQLWH0HWDOREMHFWVVXFKDVQHFNODFHV or hairpins may also become hot. Ć ' RQRWWKURZWKHEDWWHU\SDFNLQWRÂżUHRUH[SRVHLWWRH[FHVVLYHKHDW2WKHUZLVHLWVLQVXODWRU PD\PHOWLWVJDVUHOHDVHYHQWRUVDIHW\PHFKDQLVPVPD\EHGDPDJHGDQGRULWVHOHFWURO\WH PD\FDWFKÂżUHFDXVLQJWKHEDWWHU\SDFNWRRYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć ' RQRWXVHRUOHDYHWKHEDWWHU\SDFNLQDSODFHZKHUHLWLVH[SRVHGWRKLJKWHPSHUDWXUH Â& RUKLJKHU VXFKDVÂżUHRUDKHDWHU,IWKHUHVLQVHSDUDWRULVGDPDJHGGXHWRKHDWWKHEDWWHU\ SDFNPD\VKRUWFLUFXLWFDXVLQJLWWRRYHUKHDWHPLWVPRNHH[SORGHRULJQLWH FDR D-EVO II Operation Manual 897N120339A 1-9 Ć ' RQRWLPPHUVHWKHEDWWHU\SDFNLQZDWHURUVHDZDWHUDQGGRQRWDOORZLWWREHFRPHZHW ,IWKHEXLOWLQSURWHFWLRQPHFKDQLVPVDUHGDPDJHGWKHEDWWHU\SDFNPD\RYHUKHDWHPLW VPRNHH[SORGHRULJQLWH Ć ' RQRWSLHUFHWKHEDWWHU\SDFNZLWKDQDLOKLWLWZLWKDKDPPHURUVWHSRQLW2WKHUZLVHWKH EDWWHU\SDFNPD\EHGDPDJHGRUGHIRUPHGDQGVKRUWFLUFXLWFDXVLQJLWWRRYHUKHDWHPLW VPRNHH[SORGHRULJQLWH Ć ' RQRWVXEMHFWWKHEDWWHU\SDFNWRVWURQJLPSDFWRUWKURZLW,IWKHEXLOWLQSURWHFWLRQ PHFKDQLVPVDUHGDPDJHGWKHEDWWHU\SDFNPD\EHFKDUJHGZLWKH[WUHPHO\KLJKFXUUHQWDQG YROWDJHDQGDEQRUPDOFKHPLFDOUHDFWLRQVPD\RFFXULQVLGHWKHEDWWHU\SDFNFDXVLQJLWWR RYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć ' RQRWXVHDQDSSDUHQWO\GDPDJHGRUGHIRUPHGEDWWHU\SDFN2WKHUZLVHWKHEDWWHU\SDFN PD\RYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć ' RQRWVROGHUWKHEDWWHU\SDFNGLUHFWO\2WKHUZLVHLWVLQVXODWRUPD\PHOWRULWVJDVUHOHDVH YHQWRUVDIHW\PHFKDQLVPVPD\EHGDPDJHGFDXVLQJWKHEDWWHU\SDFNWRRYHUKHDWHPLW VPRNHH[SORGHRULJQLWH Ć ' RQRWUHYHUVHWKHSRVLWLYH DQGQHJDWLYH WHUPLQDOV2WKHUZLVHWKHEDWWHU\SDFNPD\ EHUHYHUVHFKDUJHGGXULQJFKDUJLQJ$VDUHVXOWDEQRUPDOFKHPLFDOUHDFWLRQVPD\RFFXU LQVLGHWKHEDWWHU\SDFNRUH[WUHPHO\KLJKFXUUHQWPD\ĂRZGXULQJGLVFKDUJLQJFDXVLQJLWWR RYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć 7 KHEDWWHU\SDFNKDVDSUHGHWHUPLQHGSRODULW\,I\RXFDQQRWFRQQHFWWKHEDWWHU\SDFNWRWKH EDWWHU\FKDUJHURURWKHUHTXLSPHQWGRQRWFRQQHFWWKHEDWWHU\SDFNIRUFHIXOO\0DNHVXUH WKDWWKHWHUPLQDOVDUHFRUUHFWO\RULHQWHG,IWKHEDWWHU\SDFNLVFRQQHFWHGLQUHYHUVHLWZLOO EHUHYHUVHFKDUJHGDQGDEQRUPDOFKHPLFDOUHDFWLRQVPD\RFFXULQVLGHWKHEDWWHU\SDFN FDXVLQJLWWRRYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć ' RQRWFRQQHFWWKHEDWWHU\SDFNWRDQHOHFWULFDORXWOHWRUFLJDUHWWHOLJKWHUVRFNHWLQDFDU 2YHUFXUUHQWPD\ĂRZWRWKHEDWWHU\SDFNGXHWRKLJKYROWDJHDSSOLHGFDXVLQJWKHEDWWHU\ SDFNWRRYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć ' RQRWXVHWKHEDWWHU\SDFNIRUHTXLSPHQWRWKHUWKDQWKRVHVSHFLÂżHG2WKHUZLVHWKH JXDUDQWHHGSHUIRUPDQFHZLOOEHUHGXFHGDQGRUWKHVHUYLFHOLIHZLOOEHVKRUWHQHG'HSHQGLQJ RQWKHHTXLSPHQWWRZKLFKWKHEDWWHU\SDFNLVFRQQHFWHGH[WUHPHO\KLJKFXUUHQWPD\ĂRZ FDXVLQJWKHEDWWHU\SDFNWREHGDPDJHGRYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć ,IWKHHOHFWURO\WHOHDNHGIURPWKHEDWWHU\SDFNHQWHUVWKHH\HVGRQRWUXEWKHP:DVKWKH eyes immediately with clean water such as tap water, and consult a doctor. Otherwise, eye injury may result. Ć ' RQRWXVHWKHEDWWHU\SDFNLQFRPELQDWLRQZLWKDSULPDU\EDWWHU\VXFKDVDGU\EDWWHU\RU RWKHUEDWWHU\RIDGLIIHUHQWFDSDFLW\W\SHDQGRUEUDQG2WKHUZLVHWKHEDWWHU\SDFNPD\ EHRYHUFKDUJHGGXULQJFKDUJLQJDQGDEQRUPDOFKHPLFDOUHDFWLRQVPD\RFFXULQVLGHWKH EDWWHU\SDFNFDXVLQJLWWRRYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć ' RQRWSXWWKHEDWWHU\SDFNLQDPLFURZDYHRYHQRUKLJKSUHVVXUHFRQWDLQHU2WKHUZLVHWKH EDWWHU\SDFNPD\EHUDSLGO\KHDWHGRUGDPDJHGFDXVLQJLWWRRYHUKHDWHPLWVPRNHH[SORGH RULJQLWH Ć ,IWKHEDWWHU\SDFNOHDNVRUHPLWVDQXQXVXDORGRUUHPRYHLWIURPÂżUHLPPHGLDWHO\ 2WKHUZLVHWKHOHDNHGHOHFWURO\WHPD\FDWFKÂżUHFDXVLQJWKHEDWWHU\SDFNWRRYHUKHDWHPLW VPRNHH[SORGHRULJQLWH Ć ,I\RXQRWLFHDQXQXVXDORGRUKHDWGLVFRORUDWLRQGHIRUPDWLRQRUDQ\RWKHUDEQRUPDOLW\GXULQJ XVHFKDUJLQJRUVWRUDJHUHPRYHWKHEDWWHU\SDFNIURPWKHHTXLSPHQWRUEDWWHU\FKDUJHUDQG VWRSXVLQJLW2WKHUZLVHWKHEDWWHU\SDFNPD\RYHUKHDWHPLWVPRNHH[SORGHRULJQLWH Ć ' RQRWXVHWKHEDWWHU\SDFNH[SRVHGWRDVWURQJPDJQHWLFÂżHOGRIDQ05,V\VWHPHWF Ć 'RQRWXVHWKHEDWWHU\SDFNLPPHUVHGLQOLTXLG For Safe Operation :DUQLQJVIRU3HGLDWULF8VH WARNING Ć ,IWKHH[SRVXUHFRQGLWLRQVIRUDYHUDJHVL]HDGXOWVDUHDSSOLHGWRFKLOGUHQLWPD\FDXVH excessive radiation exposure. Ć 6WXGLHVVKRZWKDWFKLOGUHQDUHPRUHUDGLRVHQVLWLYHWKDQDGXOWV LHFKLOGUHQDUHDWKLJKHU ULVNRIGHYHORSLQJFDQFHUFRPSDUHGWRDGXOWVH[SRVHGWRWKHVDPHGRVHRILRQL]LQJ UDGLDWLRQ $FFRUGLQJO\LQSHGLDWULFXVHVSHFLDODWWHQWLRQQHHGVWREHSDLGWRDYRLG unnecessary exposure. Ć %DVHGRQWKHFOLQLFDODSSOLFDWLRQSDWKRORJLFDOFRQGLWLRQVRIWKHSDWLHQWSDWLHQWVL]HDQG DQDWRPLFDOLPDJLQJUHJLRQDGMXVWWKHH[SRVXUHFRQGLWLRQVWRXVHWKHPLQLPXPDPRXQWRI UDGLDWLRQQHFHVVDU\WRREWDLQDSSURSULDWHPHGLFDOLPDJHV Ć $QDGGLWLRQDOÂżOWHUFDQDOVREHXVHGIRUFKLOGUHQWRUHGXFHXQQHFHVVDU\H[SRVXUHIXUWKHU 1-10 FDR D-EVO II Operation Manual 897N120339A Ć ,IFKLOGUHQFDQQRWEHH[SRVHGDWDQDSSURSULDWHGRVHZLWKWKH$(&GRQRWXVHWKH$(& Ć $GMXVWWKHH[SRVXUHFRQGLWLRQVWRPLQLPL]HWKH;UD\H[SRVXUHWLPHWRDYRLGUHSHDWHG exposure due to body movement. 2WKHU:DUQLQJVDQG&DXWLRQV WARNING 1RPRGLÂżFDWLRQRIWKLVHTXLSPHQWLVDOORZHG For Safe Operation CAUTIONS Install the system in accordance with what is provided by IEC 60601-1-1:2000 and IEC 60601&KDSWHU&RQWDFWRXURIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYHIRULQVWDOODWLRQ H[FHSWWKHĂDWSDQHOVHQVRU RIWKHV\VWHP CAUTIONS 'RQRWKLWRUGURSWKHHTXLSPHQW2WKHUZLVHLQMXU\RUGDPDJHWRLPDJHVHWFPD\UHVXOW CAUTIONS Be sure to inspect the system periodically. 7RDVVXUHRSWLPXPSHUIRUPDQFHRIWKHHTXLSPHQWLWLVQHFHVVDU\WRV\VWHPDWLFDOO\SHUIRUP maintenance and inspection. For information on maintenance and inspection, contact our RIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYH CAUTIONS 'RQRWSHUIRUPPDLQWHQDQFHDQGLQVSHFWLRQZKLOHWKHHTXLSPHQWLVXVHGIRUDSDWLHQW CAUTIONS $OWKRXJKWKHĂDWSDQHOVHQVRUFRQIRUPVWR,3;QRZDUUDQW\LVJLYHQDVWRWKHSUHYHQWLRQRI ZDWHULQWUXVLRQLQWKHĂDWSDQHOVHQVRU,IWKHĂDWSDQHOVHQVRULVVSODVKHGZLWKZDWHUZLSHRII PRLVWXUHDQGHQVXUHWKDWWKHĂDWSDQHOVHQVRULVFRPSOHWHO\GU\EHIRUHXVH Contraindications and Prohibitions No contraindications present. &ODVVLÂżFDWLRQ Ć $ FFRUGLQJWRWKHW\SHRISURWHFWLRQDJDLQVWHOHFWULFDOVKRFN Class 1 equipment Ć $FFRUGLQJWRWKHGHJUHHRISURWHFWLRQDJDLQVWHOHFWULFDOVKRFN Type B applied part Ć $FFRUGLQJWRWKHGHJUHHRISURWHFWLRQDJDLQVWKDUPIXOLQJUHVVRIZDWHU ,3; 7KHĂDWSDQHOVHQVRUFRQIRUPVWR,3; Ć $ FFRUGLQJWRWKHGHJUHHRIVDIHW\RIDSSOLFDWLRQLQWKHSUHVHQFHRIDĂDPPDEOHDQHVWKHWLFV mixture with air or with oxygen or nitrous oxide. ( TXLSPHQWQRWVXLWDEOHIRUXVHLQWKHSUHVHQFHRIDĂDPPDEOHDQHVWKHWLFVPL[WXUHZLWKDLURUZLWK oxygen or nitrous oxide. Ć $FFRUGLQJWRWKHPRGHRIRSHUDWLRQ CONTINUOUS OPERATION FDR D-EVO II Operation Manual 897N120339A 1-11 (OHFWURPDJQHWLF&RPSDWLELOLW\ (0& Essential performance (1) DR-ID 1201SE/DR-ID 1202SE/DR-ID 1211SE/DR-ID 1212SE obtains images. (2) DR-ID 1200MC stores images. (3) DR-ID 1200MC corrects images. (4) Image transfer in order from DR-ID 1201SE/DR-ID 1202SE/DR-ID 1211SE/DR-ID 1212SE to the DR-ID 1200MC or the image processing unit. (5) Image processing unit stores and displays images after correction. ,WVKDOOIXOÂżOODQGPDLQWDLQWKHVDIHW\UHTXLUHPHQWRIWKHVWDQGDUGV For Safe Operation DR-ID 1200 is consists of following components and conforms to IEC 60601-1-2 as a result of each component conforms to following standards. 1.4.1 DR-ID 1200 DR-ID 1200 consists of DR-ID 1200MC, DR-ID 300CL , DR-ID 1200MP , DR-ID 1200DS and DR-ID 1201SE/ DR-ID 1202SE/DR-ID 1211SE/DR-ID 1212SE This equipment has been tested and found to comply with the limits for medical devices to the IEC 60601-1-2 (EN 60601-1-2), Medical Device Directive 93/42/EEC. These limits are designed to provide reasonable protection against harmful interference in a typical medical installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to other devices in the vicinity. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to other devices, which can be determined by tuning the equipment off and on, the user is encouraged to try to correct the interference by one or PRUHRIWKHIROORZLQJPHDVXUHV ⢠Reorient or relocate the receiving device. ⢠Increase the separation between the equipment. ⢠Connect the equipment into an outlet on a circuit different from that to which the other device(s) are connected. If the problem cannot be solved with the above measures, stop using this equipment and consult WKHPDQXIDFWXUHURXURIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYHIRUKHOS WARNING Ć 'RQRWSODFHGHYLFHVJHQHUDWLQJHOHFWURPDJQHWLFZDYHQHDUWKLVHTXLSPHQW Ć ,IDGHYLFH V RWKHUWKDQWKRVHVSHFLÂżHGLVFRQQHFWHGSUHGHWHUPLQHG(0&SHUIRUPDQFH FDQQRWEHJXDUDQWHHG 1-12 FDR D-EVO II Operation Manual 897N120339A Further Information for IEC 60601-1-2 (EN 60601-1-2) 1. Medical electrical equipment needs special precautions regarding EMC and needs to be installed and put into service according to the EMC information provided in the accompanying documents. 2. Portable and mobile RF communications equipment can affect medical electrical equipment. 3. Information regarding the cable affecting EMC is as follows. Name Connected Device Network Cable Between the DR-ID 1200PU and the DR-ID 1200MC 0D[LPXP/HQJWK 20m (65.6 ft) *HQHUDO6SHFLÂżFDWLRQ Cat5e or more, UTP type and straight cable For Safe Operation Between the DR-ID 1200DU and the DR-ID 1200MC Between the DR-ID 1200MC and the DR-ID 300CL Power Cable DR-ID 1200MC, DR-ID 300CL Use a hospital grade power cable. (for North America) A non-hospital grade power cable can be used. (for other countries) 4. 7KHXVHRIDFFHVVRULHVWUDQVGXFHUVDQGFDEOHVRWKHUWKDQWKRVHVSHFLÂżHGZLWKWKHH[FHSWLRQRI transducers and cables sold by FUJIFILM Corporation as replacement parts for internal components, may result in increased emissions or decreased immunity of the DR-ID 1200. 5. The DR-ID 1200 should not be used adjacent to or stacked with other equipment. If adjacent or stacked use is necessary, the DR-ID 1200 should be observed to verify normal RSHUDWLRQLQWKHFRQÂżJXUDWLRQLQZKLFKLWZLOOEHXVHG 6. Basic performance of the equipment and the system $IWHULPDJHGDWDDUHDFTXLUHGIURPWKHĂDWSDQHOVHQVRUGDWDFRUUHFWLRQLVSHUIRUPHGE\WKHFRQWUROFDELQHW (DR-ID 1200MC), and the image is saved in and displayed on the image processing unit. 7. Test items (Tables 1 to 4) Table 1 *XLGDQFHDQGPDQXIDFWXUHUÂśVGHFODUDWLRQHOHFWURPDJQHWLFHPLVVLRQV 7KH'5,'LVLQWHQGHGIRUXVHLQWKHHOHFWURPDJQHWLFHQYLURQPHQWVSHFLÂżHGEHORZ The customer or the user of the DR-ID 1200 should assure that it is used in such an environment. Emissions test RF emissions CISPR 11 RF emissions CISPR 11 Harmonic emissions IEC 61000-3-2 9ROWDJHĂXFWXDWLRQV ĂLFNHUHPLVVLRQV IEC 61000-3-3 Compliance Group 1 (OHFWURPDJQHWLFHQYLURQPHQWJXLGDQFH The DR-ID 1200 uses RF energy only for their internal function. Therefore, their RF emissions are very low and are not likely to cause any interference in nearby electronic equipment. Class B Complies '5,'&ODVV$ Complies The DR-ID 1200 is suitable for use in all establishments, including domestic establishments and those directly connected to the public low-voltage power supply network that supplies buildings used for domestic purposes. FDR D-EVO II Operation Manual 897N120339A 1-13 Table 2 *XLGDQFHDQGPDQXIDFWXUHUÂśVGHFODUDWLRQHOHFWURPDJQHWLFLPPXQLW\ 7KH'5,'LVLQWHQGHGIRUXVHLQWKHHOHFWURPDJQHWLFHQYLURQPHQWVSHFLÂżHGEHORZ The customer or the user of the DR-ID 1200 should assure that it is used in such an environment. Immunity test IEC 60601-1-2 test level Compliance level (OHFWURPDJQHWLFHQYLURQPHQW JXLGDQFH Electrostatic discharge (ESD) IEC 61000-4-2 Âą6kV contact Âą8kV air Âą6kV contact Âą8kV air Floors should be wood, concrete or FHUDPLFWLOH,IĂRRUVDUHFRYHUHGZLWK synthetic material, the relative humidity should be at least 30%. For Safe Operation Electrical fast transient/burst IEC 61000-4-4 Âą2kV for power supply lines Âą1kV for input/output lines Âą2kV for power supply lines Âą1kV for input/output lines Mains power quality should be that of a typical commercial or hospital environment. Surge IEC 61000-4-5 Âą1kV differential mode Âą2kV common mode Âą1kV differential mode Âą2kV common mode Mains power quality should be that of a typical commercial or hospital environment. Voltage dips, short interruptions and voltage variations on power supply input lines IEC 61000-4-11 <5% UT (>95% dip in UT) for 0.5 cycle 40% UT (60% dip in UT) for 5 cycles 70% UT (30% dip in UT) for 25 cycles <5% UT (>95% dip in UT) for 5 s <5% UT (>95% dip in UT) for 0.5 cycle 40% UT (60% dip in UT) for 5 cycles 70% UT (30% dip in UT) for 25 cycles <5% UT (>95% dip in UT) for 5 s Mains power quality should be that of a typical commercial or hospital environment. If the user of the DR-ID 1200 requires continued operation during power mains interruptions, it is recommended that the DR-ID 1200 be powered from an uninterruptible power supply or a battery. 3 A/m 3RZHUIUHTXHQF\PDJQHWLFÂżHOGVVKRXOG be at levels characteristic of a typical location in a typical commercial or hospital environment. Power frequency (50/60Hz) magnetic ÂżHOG IEC 61000-4-8 3 A/m 127(UT is the a.c. mains voltage prior to application of the test level. 1-14 FDR D-EVO II Operation Manual 897N120339A Table 3 *XLGDQFHDQGPDQXIDFWXUHUÂśVGHFODUDWLRQHOHFWURPDJQHWLFLPPXQLW\ 7KH'5,'LVLQWHQGHGIRUXVHLQWKHHOHFWURPDJQHWLFHQYLURQPHQWVSHFLÂżHGEHORZ The customer or the user of the DR-ID 1200 should assure that it is used in such an environment. Immunity test IEC 60601-1-2 test level Compliance level 3 Vrms 150 kHz to 80 MHz 3 Vrms Radiated RF IEC 61000-4-3 3 V/m 80 MHz to 2.5 GHz 3 V/m Portable and mobile RF communications equipment should be used no closer to any part of the DR-ID 1200, including cables, than the recommended separation distance calculated from the equation applicable to the frequency of the transmitter. For Safe Operation Conducted RF IEC 61000-4-6 (OHFWURPDJQHWLFHQYLURQPHQWJXLGDQFH Recommended separation distance d = 1.2 d = 1.2 80 MHz to 800 MHz d = 2.3 800 MHz to 2.5 GHz where P is the maximum output power rating of the transmitter in watts (W) according to the transmitter manufacturer and d is the recommended separation distance in metres (m). )LHOGVWUHQJWKVIURPÂż[HG5)WUDQVPLWWHUVDV determined by an electromagnetic site survey,a should be less than the compliance level in each frequency range.b Interference may occur in the vicinity of equipment PDUNHGZLWKWKHIROORZLQJV\PERO 127($W0+]DQG0+]WKHKLJKHUIUHTXHQF\UDQJHDSSOLHV 127(7KHVHJXLGHOLQHVPD\QRWDSSO\LQDOOVLWXDWLRQV(OHFWURPDJQHWLFSURSDJDWLRQLVDIIHFWHGE\DEVRUSWLRQDQG UHĂHFWLRQIURPVWUXFWXUHVREMHFWVDQGSHRSOH D )LHOGVWUHQJWKIURPÂż[HGWUDQVPLWWHUVVXFKDVEDVHVWDWLRQVIRUUDGLR FHOOXODUFRUGOHVV WHOHSKRQHVDQGODQG mobile radios, amateur radio, AM and FM radio broadcast and TV broadcast cannot be predicted theoretically with DFFXUDF\7RDVVHVVWKHHOHFWURPDJQHWLFHQYLURQPHQWGXHWRÂż[HG5)WUDQVPLWWHUVDQHOHFWURPDJQHWLFVLWHVXUYH\ VKRXOGEHFRQVLGHUHG,IWKHPHDVXUHGÂżHOGVWUHQJWKLQWKHORFDWLRQLQZKLFKWKH'5,'LVXVHGH[FHHGVWKH applicable RF compliance, the DR-ID 1200 should be observed to verify normal operation. If abnormal performance is observed, additional measures may be necessary, such as reorienting or relocating the DR-ID 1200. E 2YHUWKHIUHTXHQF\UDQJHN+]WR0+]ÂżHOGVWUHQJWKVKRXOGEHOHVVWKDQ9P FDR D-EVO II Operation Manual 897N120339A 1-15 Table 4 Recommended separation distances between 3RUWDEOHDQGPRELOH5)FRPPXQLFDWLRQVHTXLSPHQWDQGWKH'5,' The DR-ID 1200 is intended for use in the electromagnetic environment in which radiated RF disturbances are controlled. The customer or the user of the DR-ID 1200 can help prevent electromagnetic interference by maintaining a minimum distance between portable and mobile RF communications equipment (transmitters) and the DR-ID 1200 as recommended below, according to the maximum output power of the communications equipment. For Safe Operation Rated maximum output power of transmitter 0.01 0.1 10 100 6HSDUDWLRQGLVWDQFHDFFRUGLQJWRIUHTXHQF\RIWUDQVPLWWHU 150 kHz to 80 MHz d = 1.2 0.12 0.38 1.2 3.8 12 80 MHz to 800 MHz d = 1.2 0.12 0.38 1.2 3.8 12 800 MHz to 2.5 GHz d = 2.3 0.23 0.73 2.3 7.3 23 For transmitters rated at a maximum output power not listed above, the recommended separation distance d in metres (m) can be estimated using the equation applicable to the frequency of the transmitter, where P is the maximum output power rating of the transmitter in watts (W) according to the transmitter manufacturer. 127( $W0+]DQG0+]WKHVHSDUDWLRQGLVWDQFHIRUWKHKLJKHUIUHTXHQF\UDQJHDSSOLHV 127( 7KHVHJXLGHOLQHVPD\QRWDSSO\LQDOOVLWXDWLRQV (OHFWURPDJQHWLFSURSDJDWLRQLVDIIHFWHGE\DEVRUSWLRQDQGUHĂHFWLRQIURPVWUXFWXUHVREMHFWVDQGSHRSOH 1-16 FDR D-EVO II Operation Manual 897N120339A 1.5 3UHFDXWLRQVLQ8VLQJWKH)'5'(92 II This section describes the precautions in using the FDR D-EVO II. +DQGOLQJ For Safe Operation +DQGOHWKHĂDWSDQHOVHQVRUFDUHIXOO\VLQFHWKH\DUH manufactured with precision. ,IWKHĂDWSDQHOVHQVRURUWKH6(FRPPXQLFDWLRQFDEOHLVKLWRU dropped or is subjected to severe shock, it may be malfunction. Be aware of dropping the devices could result in injury or device breakage also may cause injury. ,IWKHIURQWDQGUHDURIWKHĂDWSDQHOVHQVRUDUHVXEMHFWWR impact by a projection, it may be damaged. 'RQRWDSSO\VWURQJSUHVVXUHRQWRWKHĂDWSDQHOVHQVRU ,IDSSOLHGWKHĂDWSDQHOVHQVRUGHIRUPVDQGWKHZDWHUSURRI function may be compromised. Do not pull the SE communication cable. $OVRGRQRWSXOOWKHĂDWSDQHOVHQVRUZLWKVRPHWKLQJFDXJKWE\ the cable. Make sure that the cable is not trapped under the wheels of a stretcher or wheelchair. In addition, be careful not to catch the cable when using or storing it. 2WKHUZLVHWKHFDEOHZLOOEHGDPDJHGFDXVLQJÂżUHHOHFWULF shock or communication failure. 'RQRWKROGWKHĂDWSDQHOVHQVRULQRQHKDQGZKHQFDUU\LQJLW Hold it in both the hands or under the arm. :KHQFDUU\LQJRUVWRULQJWKHĂDWSDQHOVHQVRUUHPRYHWKH battery pack from it. If a seal that covers a screw peels from the side surface of the ĂDWSDQHOVHQVRUFRQWDFWD)8-,),/0GHDOHU,IWKHVHDOLVQRW attached, artifacts caused by discharge of static electricity may appear. To ensure optimal image quality, it is recommended that you do QRWXVHWKHĂDWSDQHOVHQVRUQHDUGHYLFHV PRWRUWUDQVIRUPHU switching supply, etc.) that generate electromagnetic noise. To ensure optimal image quality, it is recommended that you do not place the cables (power cable, communication cable, etc.) of the equipment near devices (motor, transformer, switching supply, etc.) that generate electromagnetic noise and their cables. 0DNHVXUHWKDWQROLTXLGHQWHUVWKHĂDWSDQHOVHQVRUIURP around the battery section. In addition, when attaching the battery pack, make sure that the waterproof packing attached WRWKHFRQQHFWRUWHUPLQDORIWKHĂDWSDQHOVHQVRULVDOLJQHG SURSHUO\2WKHUZLVHWKHĂDWSDQHOVHQVRUPD\EHGDPDJHG FDR D-EVO II Operation Manual 897N120339A 1-17 Do not use a multiple tap connector or extension cable for powering the devices constituting the system. 8SWRÂżYHĂDWSDQHOVHQVRUVFDQEHFRQQHFWHG,I\RXLQWHQG WRXVHVL[RUPRUHĂDWSDQHOVHQVRUVRQO\WKHÂżUVWÂżYHWKDW were connected to the image processing unit can be used. )RUWKLVUHDVRQZKHQVL[RUPRUHĂDWSDQHOVHQVRUVDUH registered, be careful not to use a wrong one, as you may FRQIXVHZKLFKĂDWSDQHOVHQVRULVFRQQHFWHG %HIRUHPDNLQJDQH[SRVXUHPDNHVXUHWKDWWKHĂDWSDQHO VHQVRULGHQWLÂżFDWLRQODPSRQWKHĂDWSDQHOVHQVRUWREH used and the panel icon selected on the screen of the image processing unit are the same color. For Safe Operation :KHQDĂDWSDQHOVHQVRULVFRPPXQLFDWLQJZLWKDSRZHU supply unit, docking stand or access point in a room, if the ĂDWSDQHOVHQVRULVPRYHGWRDQRWKHUURRPZKHUHWKHUHLV another power supply unit, docking stand or access point, FRPPXQLFDWLRQEHWZHHQWKHĂDWSDQHOVHQVRUDQGWKH GHYLFHLQWKHÂżUVWURRPPD\VWLOOEHHVWDEOLVKHG7RHVWDEOLVK FRPPXQLFDWLRQEHWZHHQWKHĂDWSDQHOVHQVRUDQGDGHYLFH LQWKHVHFRQGURRPFRQQHFWWKHĂDWSDQHOVHQVRUWRWKH device with the cable or insert it into the docking stand. The ĂDWSDQHOVHQVRULVUHFRJQL]HGDQGZLUHOHVVFRPPXQLFDWLRQ becomes available. 'RQRWSODFHWKHFDEOHWHUPLQDORQWKHĂRRUDVGRLQJVRPD\ cause infection. Also, clean the cable and the terminal periodically. 'RQRWLQVHUWWKHĂDWSDQHOVHQVRULQWRD&5UHDGHUXQLW 1.5.2 Before Exposure The use of an air-conditioner may dramatically changes the temperature of the room where the system is installed. This may cause dew condensation on the system, resulting in quality problems. When an air-conditioner is used, change the temperature gradually to avoid temperature variation in order not to cause dew condensation. ,IDQH[SRVXUHLVPDGHZLWKWKHIURQWDQGUHDURIWKHĂDWSDQHO sensor facing the other way round, not only the re-exposure is required but electric parts of inside the equipment may be damaged. Exposure plane of the flat panel sensor 1-18 FDR D-EVO II Operation Manual 897N120339A 'XULQJ([SRVXUH Before making an exposure, make sure that exposure conditions most appropriate for this system are set. Do not apply an excessive force to the exposure plane. 7KHVHQVRULQVLGHWKHĂDWSDQHOVHQVRUPD\EHGDPDJHG and it may not be possible to make an exposure properly. For Safe Operation(QWLUHVXUIDFHORDG'5,'6('5,'6('5,'6( DQG'5,'6( 310kg (683.6 lb) /RFDOORDG'5,'6('5,'6('5,'6(DQG '5,'6( 160kg (352.8 lb) / ø40mm (1.6 in.) %DVHGRQ)8-,),/0PHDVXUHPHQWVSHFLÂżFDWLRQV 8VHWKHĂDWSDQHOVHQVRURQDĂDWĂRRURUSODWIRUP When an excessive force is applied to the unit when it is tilted, the VHQVRULQVLGHWKHĂDWSDQHOVHQVRUPD\EHGDPDJHG Do not place a metal plate, etc., which blocks radio waves, before WKHDQWHQQD2WKHUZLVHGDWDPD\QRWEHVHQWFRUUHFWO\IURPWKHĂDW panel sensor. Antenna Antenna FDR D-EVO II Operation Manual 897N120339A 1-19 :KHQWKH6(FRPPXQLFDWLRQFDEOHLVFRQQHFWHGWRWKHĂDWSDQHOVHQVRUWRPDNHDQH[SRVXUH on a bed, follow the precautions below. Otherwise a load may be applied locally to the SE FRPPXQLFDWLRQFDEOHFRQQHFWRUVFDXVLQJGDPDJHWRWKHĂDWSDQHOVHQVRU For Safe Operation Make sure that the connector does not protrude from the edge of a bed Do not place the connector on a hard surface such as the edge of a bed Do not raise the flat panel sensor by holding only the connector 'XULQJ&OHDQLQJ To clean the outer surfaces, use a cleaning cloth tightly wrung out of commercially available ethanol (or diluted neutral detergent). CAUTIONS %HVXUHWRWXUQRIIWKHSRZHUEHIRUHFOHDQLQJHDFKSDUWRIWKHGHYLFH Ć Ć 'RQRWXVHDQH[FHVVLYHDPRXQWRIHWKDQRO RUQHXWUDOGHWHUJHQW DVGRLQJVRPD\DOORZWKH OLTXLGWRHQWHUIURPWKHJDSRQWKHRXWHUVXUIDFHVUHVXOWLQJLQWKHGDPDJHWRWKHĂDWSDQHO sensor, or cause the labels to come off. Ć 'RQRWXVHDVROYHQWVXFKDVWKLQQHURUEHQ]LQHDVLWFRUURGHVWKHRXWHUVXUIDFHV Ć )RURWKHUDYDLODEOHGLVLQIHFWDQWVFRQVXOWRXURIÂżFLDOGHDOHU 6WRUDJH :KHQWKHĂDWSDQHOVHQVRUDQGWKHLPDJHSURFHVVLQJXQLWDUHQRWLQXVHVWRUHWKHPLQDSODFH where they do not fall or drop. 1-20 FDR D-EVO II Operation Manual 897N120339A 1.5.6 Precautions Related to the Load Applied to the Flat Panel Sensor ,IH[FHVVLYHORDGLVDSSOLHGWRWKHĂDWSDQHOVHQVRUXVHLWRQDĂDWĂRRURUSODWIRUP When making an exposure for the patient in a wheelchair or adjustable bed or on a stretcher, the ĂDWSDQHOVHQVRUPD\EHGHIRUPHG VOLJKWO\ZDUSHG For Safe Operation Flat panel sensor Flat panel sensor ,QFDVHWKDWWKHĂDWSDQHOVHQVRULVGHIRUPHGPDNHVXUHWKDW;UD\LPDJHVDUHQRWDGYHUVHO\ DIIHFWHGEHIRUHFRQWLQXLQJWKHXVHRIWKHĂDWSDQHOVHQVRU The precautions below must also be observed when making an exposure. Â'RQRWKDYHWKHSDWLHQWVWDQGRQWKHĂDWSDQHOVHQVRU Â'RQRWSODFHWKHKDUGGHYLFHVVXFKDVVSLQHERDUGRQWKHĂDWSDQHOVHQVRU ([FHVVLYHORDGLVDSSOLHGORFDOO\DQGWKHĂDWSDQHOVHQVRUPD\EHGDPDJHG Spine board Flat panel sensor (YHQZKHQWKHĂDWSDQHOVHQVRULVXVHGRQDĂDWĂRRURUSODWIRUPLWPD\EHGDPDJHGLIWKHDSSOLHG load exceeds the limit. FDR D-EVO II Operation Manual 897N120339A 1-21 1.5.7 Radio Waves :LUHOHVVVSHFLÂżFDWLRQVIRUWKHĂDWSDQHOVHQVRUDQGDFFHVVSRLQWDUHDVIROORZV )ODWSDQHOVHQVRU $FFHVVSRLQW RSWLRQDO :LUHOHVVVSHFLILFDWLRQ ,(((Q ,(((Q 7UDQVPLWIUHTXHQF\ *+] *+] 0RGXODWLRQ OFDM OFDM )UHTXHQF\WROHUDQFH ÂSSP ÂSSP 'DWDWUDQVIHUUDWH 0ESV 0ESV 7UDQVIHUSRZHU G%PRUOHVV G%PRUOHVV For Safe Operation )RUZLUHOHVVVSHFLÂżFDWLRQVRIWKHLPDJHSURFHVVLQJXQLWVHHÂł'5,'&/2SHUDWLRQ0DQXDO´ CAUTIONS Ć Radio waves available outdoors vary, depending on the country where the system is used. (For U.S.) Radio waves in the 5.2GHz frequency band can be used indoors only. When radio waves in the 5.3GHz and 5.6GHz frequency bands are selected, the DFS function will operate. Ć When the FDR D-EVO II and any other wireless equipment are operating on the same frequency channel in a hospital, it may take time to show an image on the image processing unit monitor. CAUTIONS 7KHDYDLODEOHVFLHQWLÂżFHYLGHQFHGRHVQRWVKRZWKDWDQ\KHDOWKSUREOHPVDUHDVVRFLDWHGZLWK using low power wireless devices. There is no proof, however, that these low power wireless devices are absolutely safe. Low power Wireless devices emit low levels of radio frequency energy (RF) in the microwave range while being used. Whereas high levels of RF can produce health effects (by heating tissue), exposure of low-level RF that does not produce heating effects causes no known adverse health effects. Many studies of low-level RF exposures have not found any biological effects. Some studies have suggested that some biological effects might occur, EXWVXFKÂżQGLQJVKDYHQRWEHHQFRQÂżUPHGE\DGGLWLRQDOUHVHDUFK'5,'6('5,'6( '5,'6('5,'6(KDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWK)&&,&UDGLDWLRQH[SRVXUH OLPLWVVHWIRUWKIRUDQXQFRQWUROOHGHQYLURQPHQWDQGPHHWVWKH)&&UDGLRIUHTXHQF\ 5) ([SRVXUH *XLGHOLQHVDQG566RIWKH,&UDGLRIUHTXHQF\ 5) ([SRVXUHUXOHV /HVFRQQDLVVDQFHVVFLHQWLÂżTXHVGRQWQRXVGLVSRVRQVQÂśRQWPLVHQpYLGHQFHDXFXQSUREOqPHGH VDQWpDVVRFLpjOÂśXVDJHGHVDSSDUHLOVVDQVÂżOjIDLEOHSXLVVDQFH1RXVQHVRPPHVFHSHQGDQWSDV HQPHVXUHGHSURXYHUTXHFHVDSSDUHLOVVDQVÂżOjIDLEOHSXLVVDQFHVRQWHQWLqUHPHQWVDQVGDQJHU /HVDSSDUHLOVVDQVÂżOjIDLEOHSXLVVDQFHpPHWWHQWXQHpQHUJLHUDGLRpOHFWULTXH 5) WUqVIDLEOHGDQV OHVSHFWUHGHVPLFURRQGHVORUVTXÂśLOVVRQWXWLOLVpV$ORUVTXÂśXQHGRVHpOHYpHGH5)SHXWDYRLUGHV HIIHWVVXUODVDQWp HQFKDXIIDQWOHVWLVVXV OÂśH[SRVLWLRQjGHIDLEOHV5)TXLQHSURGXLVHQWSDVGH FKDOHXUQÂśDSDVGHPDXYDLVHIIHWVFRQQXVVXUODVDQWp'HQRPEUHXVHVpWXGHVRQWpWpPHQpHV VXUOHVH[SRVLWLRQVDX[5)IDLEOHVHWQÂśRQWGpFRXYHUWDXFXQHIIHWELRORJLTXH&HUWDLQHVpWXGHV RQWVXJJpUpTXÂśLOSRXYDLW\DYRLUFHUWDLQVHIIHWVELRORJLTXHVPDLVFHVUpVXOWDWVQÂśRQWSDVpWp FRQÂżUPpVSDUGHVUHFKHUFKHVVXSSOpPHQWDLUHV'5,'6('5,'6('5,'6('5,' 6(DpWpWHVWpHWMXJpFRQIRUPHDX[OLPLWHVGÂśH[SRVLWLRQDX[UD\RQQHPHQWVpQRQFpHVSRXU XQHQYLURQQHPHQWQRQFRQWU{OpHWUHVSHFWHOHVUqJOHVOHVUDGLRpOHFWULTXHV 5) GHOD)&&OLJQHV GLUHFWULFHVGÂśH[SRVLWLRQHWGÂśH[SRVLWLRQDX[IUpTXHQFHVUDGLRpOHFWULTXHV 5) &15GHOÂś,& 1-22 FDR D-EVO II Operation Manual 897N120339A %DWWHU\3DFN6WDWXV,QGLFDWRU 7KHVWDWXVDQGRSHUDEOHWLPHRIWKHEDWWHU\SDFNXVHGIRUWKHĂDWSDQHOVHQVRUDUHVKRZQE\WKH exposure unit battery indicator in the connected devices status at the lower right of the image processing unitâs display. The battery pack status indicator shows the remaining capacity of the battery pack. Each icon is described below. For details of the connected devices status, see the âConsole Advance (DR-ID 300CL) Reference Guideâ. For Safe Operation 5HDG\IRUH[SRVXUH 5HDG\IRUH[SRVXUH 5HDG\IRUH[SRVXUH (The remaining battery capacity is low. Charge the battery pack.) 1RWUHDG\IRUH[SRVXUH &KHFNWKHRSHUDEOHWLPHRQWKHLPDJHSURFHVVLQJXQLWÂśVGLVSOD\ZKHQWKHĂDWSDQHOVHQVRULVLQXVH Note that the displayed time differs, depending on the mode being used. FDR D-EVO II Operation Manual 897N120339A 1-23 1.6 Locations of Labels and Signs /RFDWLRQVRIODEHOVDQGVLJQVDIÂż[HGWRWKH)'5'(92IIDQGWKHUHOHYDQWVDIHW\VLJQVDUHVKRZQ EHORZ 1.6.1 Locations of Labels )ODWSDQHOVHQVRU '5,'6( )ODWSDQHOVHQVRU '5,'6( For Safe Operation Serial Number Label Serial Number Label DR-ID 1201SE Radio Law Certification Label DR-ID 1202SE Radio Law Certification Label Battery Cover Label Battery Cover Label DR-ID 1201SE Identification Label DR-ID 1202SE Identification Label ([SRVXUHSODQH! ([SRVXUHSODQH! )ODWSDQHOVHQVRU '5,'6( )ODWSDQHOVHQVRU '5,'6( Serial Number Label Serial Number Label DR-ID 1211SE Radio Law Certification Label DR-ID 1212SE Radio Law Certification Label Battery Cover Label Battery Cover Label DR-ID 1211SE Identification Label DR-ID 1212SE Identification Label ([SRVXUHSODQH! ([SRVXUHSODQH! Main switch/ power status LED &RQWUROFDELQHW '5,'0& ,IWKHFRQWUROFDELQHWLVQRWLQFOXGHGLQWKHV\VWHPWKH'5,'0&LGHQWLÂżFDWLRQODEHOLVSODFHGRQWKH&' FDVHRIWKHVRIWZDUHIRUWKHFRQWUROFDELQHW 1-24 FDR D-EVO II Operation Manual 897N120339A Do Not Step On This Surface label For the types of connectable FDEOHVFRQVXOWRXURIÂżFLDO dealer or FUJIFILM Representative DR-ID 1200MP Caution Label 1 DR-ID 1200PU System Label Pour en savoir plus sur les types de câbles connectables, contactez notre revendeur agrĂŠĂŠ ou notre reprĂŠsentant FUJIFILM. DR-ID 1200MP Caution Label 2 DR-ID 1200PU Rating Label For Safe Operation Power supply unit (DR-ID 1200MP) Do Not Step On This Surface label DR-ID 1200DU System Label DR-ID 1200DS Caution Label 1 DR-ID 1200DU Rating Label DR-ID 1200DS Caution Label 2 Docking stand (DR-ID 1200DS) For the types of connectable cables, FRQVXOWRXURIÂżFLDOGHDOHU or FUJIFILM Representative Pour en savoir plus sur les types de câbles connectables, contactez notre revendeur agrĂŠĂŠ ou notre reprĂŠsentant FUJIFILM. Battery Charger Rating Label Battery pack Rating Label AC Adapter Rating Label Battery Charger (optional) Access Point Product Label Battery pack (optional) Access Point Radio Law Certification Label Access point (optional) For details on the locations of labels for the image processing unit, see the âConsole Advance (DR-ID 300CL) Operation Manualâ. FDR D-EVO II Operation Manual 897N120339A 1-25 1.6.2 DR-ID 1200 For Safe Operation DR-ID 1201SE Identification Label DR-ID 1202SE Identification Label DR-ID 1211SE Identification Label DR-ID 1212SE Identification Label Battery Cover Label Do Not Step On This Surface label DR-ID 1201SE/DR-ID 1202SE/ DR-ID 1211SE/DR-ID 1212SE Radio Law Certification Label SN Serial Number Label DR-ID 1200MC Identification Label 1-26 FDR D-EVO II Operation Manual 897N120339A DR-ID 1200MC Identification Label (for the system without the DR-ID 1200MC) 1 Battery Charger Rating Label Access Point Product Label (for Europe) Access Point Product Label (for North America) For Safe Operation Battery Pack Rating Label AC Adapter (Battery Charger) Rating Label Access Point Radio Law Certification Label For details on the labels of the image processing unit, see the âConsole Advance (DR-ID 300CL) Operation Manualâ. 1.6.3 DR-ID 1200PU DR-ID 1200MP Caution Label 1 DR-ID 1200PU System Label DR-ID 1200PU Rating Label DR-ID 1200MP Caution Label 2 1.6.4 DR-ID 1200DU DR-ID 1200DS Caution Label 1 DR-ID 1200DU System Label DR-ID 1200DU Rating Label DR-ID 1200DS Caution Label 2 FDR D-EVO II Operation Manual 897N120339A 1-27 1.6.4 Safety and Other Symbols The following safety symbols are used in the labels or on its body. Symbol Description This symbol indicates compliance of the equipment with Directive 93/42/EEC. This symbol indicates compliance of the equipment with Directive 93/42/EEC. 7KLVV\PEROLQGLFDWHVWKDWWKHHTXLSPHQWLVFODVVLÂżHGDV&ODVVHTXLSPHQWLQWKH5 77( Directive. For Safe Operation Caution (See â1.6.1 Locations of Labelsâ (page 1-24).) OFF (To indicate disconnection from the mains, at least for mains switches or their positions, and all those cases where safety is involved.) ON (To indicate connection to the mains, at least for mains switches or their positions, and all those cases where safety is involved.) Protective earth (ground) Alternating current This symbol indicates that the equipment is a Type B Applied Part. Ready (To indicate the machine is ready for operation.) Electric energy General mandatory action sign This symbol indicates that this product is not to be disposed of with your household waste, according to the WEEE Directive (2002/96/EC) and your national law. This product should be handed over to a designated collection point. Improper handling of this type of waste could have a possible negative impact on the environment and human health due to potentially hazardous substances that are generally associated with EEE. At the same time, your cooperation in the correct disposal of this product will contribute to the effective usage of natural resources. )RUPRUHLQIRUPDWLRQDERXWZDVWHSOHDVHFRQWDFWRXURIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYH Year of manufacture Environmentally Friendly Use Period (EFUP) Caution for local load (See â1.5.3 During Exposureâ (page 1-19).) / 'RQRWGURSWKHĂDWSDQHOVHQVRUWRWKHXVHUSDWLHQW Entire surface load This symbol includes RF transmitters or indicates equipment that intentionally applies RF electromagnetic energy for diagnosis or treatment. Refer to Instruction Manual/Booklet No stepping on surface 1-28 FDR D-EVO II Operation Manual 897N120339A 1.6.5 Symboles de sĂŠcuritĂŠ et autres Les symboles de sĂŠcuritĂŠ suivants sont utilisĂŠs sur les ĂŠtiquettes ou sur le corps de lâĂŠquipement. Symbole Description Ce symbole indique la conformitĂŠ de lâĂŠquipement Ă la directive 93/42/CEE. Ce symbole indique la conformitĂŠ de lâĂŠquipement Ă la directive 93/42/CEE. &HV\PEROHLQGLTXHTXHOÂśpTXLSHPHQWDSSDUWLHQWjODFDWpJRULHGHODFODVVLÂżFDWLRQGHOD GLUHFWLYH5 77( For Safe Operation Attention (Voir ÂŤ 1.6.1 Emplacement des ĂŠtiquettes Âť (page 1-24).) HORS TENSION (Pour indiquer une dĂŠconnexion de lâalimentation secteur, au moins au niveau des interrupteurs secteurs ou leur position, et tous les cas dans lesquels la sĂŠcuritĂŠ est en jeu.) SOUS TENSION (Pour indiquer une connexion Ă lâalimentation secteur, au moins au niveau des interrupteurs secteurs ou leur position, et tous les cas dans lesquels la sĂŠcuritĂŠ est en jeu.) Protection via mise Ă la terre (masse) Courant alternatif Ce symbole indique que lâĂŠquipement est une pièce appliquĂŠe de type B. PrĂŞt (Pour indiquer que la machine est prĂŞte Ă ĂŞtre utilisĂŠe.) Ănergie ĂŠlectrique Symbole gĂŠnĂŠral dâaction obligatoire Ce symbole indique que ce produit ne doit pas ĂŞtre mis au rebut avec les dĂŠchets mĂŠnagers, conformĂŠment Ă la directive DEEE (2002/96/CE) et Ă la lĂŠgislation nationale en vigueur. Ce produit doit ĂŞtre remis Ă un centre de collecte appropriĂŠ. Une manipulation incorrecte de ce type de dĂŠchet peut avoir un impact nĂŠgatif sur lâenvironnement et sur la santĂŠ humaine, en raison des substances potentiellement dangereuses gĂŠnĂŠralement associĂŠes aux EEE. Votre coopĂŠration pour la mise au rebut correcte de ce produit contribuera en outre Ă une utilisation HIÂżFDFHGHVUHVVRXUFHVQDWXUHOOHV Pour en savoir plus sur les dĂŠchets, contactez notre revendeur agrĂŠĂŠ ou notre reprĂŠsentant FUJIFILM. AnnĂŠe de fabrication Attention relative Ă une charge placĂŠe de façon localisĂŠe / Ne faites pas tomber le dĂŠtecteur Ă panneau plat sur lâutilisateur/le patient Charge sur lâintĂŠgralitĂŠ de la surface Ce symbole inclut les ĂŠmetteurs RF ou indique un ĂŠquipement ĂŠmettant intentionnellement de OÂśpQHUJLHpOHFWURPDJQpWLTXH5)jGHVÂżQVGHGLDJQRVWLFRXGHWUDLWHPHQW Consultez le mode dâemploi Ne montez pas sur la surface FDR D-EVO II Operation Manual 897N120339A 1-29 1.7 Installation Conditions 'HÂżQLWLRQRI3DWLHQW(QYLURQPHQW )RUWKHSURGXFWVWKDWFDQEHLQVWDOOHGLQSDWLHQWHQYLURQPHQWVHHÂł6\VWHP&RQÂżJXUDWLRQ´ (page 2-1). CAUTIONS For Safe Operation ,QWKH;UD\URRPGRQRWLQVWDOOWKHSRZHUVXSSO\XQLWFRQWUROFDELQHWGRFNLQJVWDQGDFFHVV SRLQWLPDJHSURFHVVLQJXQLWDQGEDWWHU\FKDUJHU RSWLRQDO LQDUHDVZKHUHWKHXVHUFRXOG easily trip over them. Falls could result in injury. (8 .5m .2 ft) Ĺś %HGLQDSDWLHQWURRPRUEHGW\SHUDGLRJUDSKLFH[DPLQDWLRQVWDQG 2.5m (8.2 ft) 2.5m (8.2 ft) 2.5m (8.2 ft) Ĺś 8SULJKWW\SHUDGLRJUDSKLFH[DPLQDWLRQVWDQG (8 .5m .2 ft) 2.5m (8.2 ft) 2.5m (8.2 ft) 1-30 FDR D-EVO II Operation Manual 897N120339A 2.5m (8.2 ft) 1.7.2 Installation Precautions Ĺś 8VLQJLQDQRSHQVSDFH ,QVWDOOWKHĂDWSDQHOVHQVRUWKHDFFHVVSRLQWDQGWKHLPDJHSURFHVVLQJXQLWDWDGLVWDQFHRIOHVV than 10m (32.8 ft) from each other. If any distance is over 10m (32.8 ft), a wireless communication error may occur. Ĺś 8VLQJLQDQ;UD\URRP The access point should be installed in the X-ray room. For Safe Operation If the access point is not installed properly, wireless communication may become unstable. If this happens, the messages below may appear. These messages are only examples. Example 1 Panel communication error Example 2 Connection to X-ray unit has been disconnected. 3UHFDXWLRQVIRU,QVWDOOLQJWKH$FFHVV3RLQW 2SWLRQDO Install the optional access point in a place where the operation is not hindered. When the access point is installed onto a personal computer, be sure that the label attached on the access point does not face the front side. In addition, install the access point in an appropriate place to prevent it from colliding with a moving mobile X-ray unit. If any impact is applied to the optional access point, it may be damaged. FDR D-EVO II Operation Manual 897N120339A 1-31 1 For Safe Operation 1-32 FDR D-EVO II Operation Manual 897N120339A Chapter 2 \VWHP&RQILJXUDWLRQ (Product Overview) 2.1 FDR D-EVO II 6\VWHP&RQÂżJXUDWLRQ (When the optional access point is used) DIGITAL RADIOGRAPHY DR-ID 1200 6\VWHP&RQILJXUDWLRQ 3URGXFW2YHUYLHZ PANEL UNIT DR-ID 1200PU DOCKING UNIT DR-ID 1200DU Flat panel sensor Flat panel sensor Power supply unit DR-ID 1200MP Docking stand DR-ID 1200DS Image processing unit DR-ID 300CL*1, *3 Access point Battery charger Hub Image processing unit of other digital radiography system DR-ID 300CL (When an access point installed in the hospital is used) DIGITAL RADIOGRAPHY DR-ID 1200 PANEL UNIT DR-ID 1200PU Flat panel sensor Power supply unit DR-ID 1200MP DOCKING UNIT DR-ID 1200DU Flat panel sensor Docking stand DR-ID 1200DS Image processing unit DR-ID 300CL*3 Battery charger Control cabinet DR-ID 1200MC*2 Access point Hub Image processing unit of other digital radiography system DR-ID 300CL FDR D-EVO II Operation Manual 897N120339A 2-1 ⢠The products in can be installed in patient environment. However, the image processing unit cannot be installed while it is being charged. ⢠The FDR D-EVO II consists of the panel unit DR-ID 1200PU or docking unit DR-ID 1200DU, the control cabinet DR-ID 1200MC and the image processing unit. Â7KHSDQHOXQLW'5,'38FRQVLVWVRIWKHĂDWSDQHOVHQVRU'5,'6('5,'6( DR-ID 1211SE and DR-ID 1212SE, and the power supply unit DR-ID 1200MP. ⢠The panel unit DR-ID 1200PU can be operated in conjunction with the X-ray equipment, and it can be used for exposures in wired mode. Â7KHGRFNLQJXQLW'5,''8FRQVLVWVRIWKHĂDWSDQHOVHQVRU'5,'6('5,'6( DR-ID 1211SE and DR-ID 1212SE, and the docking stand DR-ID 1200DS. ⢠With the docking unit DR-ID 1200DU, the exposure ready status can be displayed with the lamp RQWKHGRFNLQJVWDQG,QDGGLWLRQWKHĂDWSDQHOVHQVRUWREHXVHGIRUH[SRVXUHFDQEHLGHQWLÂżHG with the lamp indication on the docking stand. Â7KHLPDJHSURFHVVLQJXQLW'5,'&/LVFRQÂżJXUHGE\LQVWDOOLQJLPDJHSURFHVVLQJVRIWZDUHRQ a commercially available personal computer conforming to IEC 60950-1 or equivalent. Â8SWRÂżYHĂDWSDQHOVHQVRUVFDQEHFRQQHFWHG Â:KHQWKH'5,'38LVXVHGXSWRWZRĂDWSDQHOVHQVRUVFDQEHFRQQHFWHGWRRQHSRZHU VXSSO\XQLWLQZLUHGFRPPXQLFDWLRQPRGH8SWRWZRSRZHUVXSSO\XQLWFDQEHXVHG:KHQWKHĂDW panel sensors are used with three to four different techniques, two power supply units are required. Â:KHQWKH'5,''8LVXVHGRQO\RQHĂDWSDQHOVHQVRUVFDQEHFRQQHFWHGWRRQHGRFNLQJ stand in wired communication mode. Up to three docking stand can be used. ⢠When the DR-ID 1200DU and a mobile X-ray unit are used, power to the access point is supplied by connecting it to the image processing unit DR-ID 300CL. System Configuration (Product Overview) *1 The software for the control cabinet is installed on the image processing unit (DR-ID 300CL). 'HSHQGLQJRQWKHFRQÂżJXUDWLRQWKHFRQWUROFDELQHW '5,'0& PD\QRWEHLQFOXGHGLQ the system. If not included, the software for the control cabinet can be installed on the image processing unit (DR-ID 300CL). )RUGHWDLOVSHFLÂżFDWLRQRILPDJHSURFHVVLQJXQLWSOHDVHUHIHUWRÂł'5,'&/2SHUDWLRQ Manualâ. *3 When the image processing unit (DR-ID 300CL) is used in patient environment, run the notebook computer on battery power. 2-2 FDR D-EVO II Operation Manual 897N120339A 2.1.2 Features of the FDR D-EVO II This section describes the main features of the FDR D-EVO II. /LJKWZHLJKWWKLQDQGURXQGLVKGHVLJQRIWKHĂDWSDQHOVHQVRUIDFLOLWDWHVOLIWLQJDQG enhances operability, for example, when it is set under a patient lying on a bed. 2 By utilizing FUJIFILMâs proprietary ISS (Irradiation Side Sampling) method, vapor deposition technique of CsI scintillator, particle blend technique of GOS scintillator, and also noise reduction IC, images with high sensitivity and high sharpness are obtained even in low-density areas. 3 After an X-ray irradiation process is completed, the exposed image appears on the monitor of the image processing unit in about one second at the shortest. In addition, since images are compressed with our unique compression technology (CIP) during communication, H[SRVXUHVFDQEHPDGHHIÂżFLHQWO\DWVKRUWLQWHUYDOV 7KHĂDWSDQHOVHQVRUKDVVOHHSPRGHDQGH[WUDVOHHSPRGH7KLVSRZHUVDYLQJGHVLJQ almost eliminates the need of replacing the battery pack. In addition, since a removable battery pack is adopted, it can be replaced even if the battery runs down. 5 The docking stand and the optional battery charger assist smooth exposure operations. The system can be used even in an emergency since only 3 minutes of charge time are required to make about 30 exposures. 8SWRLPDJHVFDQEHVWRUHGWHPSRUDULO\LQWKHPHPRU\RIWKHĂDWSDQHOVHQVRU The memory exposure mode can be activated easily by operating the button on the back of WKHĂDWSDQHOVHQVRU(YHQLIWKHLPDJHSURFHVVLQJXQLWLVQRWDYDLODEOHH[SRVXUHVFDQEH PDGHRQO\E\XVLQJWKHĂDWSDQHOVHQVRU 7 Extended Image Readout enables a long exposure for up to ten seconds. 7KHĂDWSDQHOVHQVRUFDQEHXVHGFOHDQO\VLQFHDOOVXUIDFHVKDYHEHHQFRDWHGZLWKDQ antibacterial agent. 6LQFHWKHH[WHUQDOGLPHQVLRQVDQGWKLFNQHVVRIWKHĂDWSDQHOVHQVRUDUHWKHVDPHDVWKRVH RIH[LVWLQJFDVVHWWHIRUJHQHUDOH[SRVXUH FRPSOLDQWZLWK,62 WKHĂDWSDQHOVHQVRU can be loaded onto the exposure stand that has been used. In addition, since operation on EDWWHU\SRZHUDQGZLUHOHVVFRPPXQLFDWLRQDUHDYDLODEOHRQHĂDWSDQHOVHQVRUFDQEHXVHG for multiple devices such as upright type and supine-position type radiography devices. 7KHĂDWSDQHOVHQVRUKDVWKH;UD\DXWRPDWLFGHWHFWLRQIXQFWLRQ 6PDUW6ZLWFK :LWKWKLVIXQFWLRQWKHĂDWSDQHOVHQVRUGHWHFWVHYHQDVPDOODPRXQWRI;UD\SUHFLVHO\WR start an exposure without connecting it to the X-ray device. 11 By using a notebook computer as the image processing unit, and also by using the optional access point, the need of carrying cables is eliminated and the system can be used for rounds. In addition, exposures can also be made outdoors depending on the frequency band of radio wave. 8SWRĂDWSDQHOVHQVRUVFDQEHUHJLVWHUHG$PRQJWKHUHJLVWHUHGĂDWSDQHOVHQVRUVXS WRÂżYHĂDWSDQHOVHQVRUVFDQEHXVHG 2QHDFKVLGHRIWKHĂDWSDQHOVHQVRUWKHUHLVDQ/('VKRZLQJWKHFHQWHUSRVLWLRQ7KH FRORURIWKLV/('FDQEHVHOHFWHGIURPDPRQJÂżYHFRORUV RUDQJHSXUSOHOLPH\HOORZEOXH DQGSLQN :KHQPXOWLSOHĂDWSDQHOVHQVRUVDUHXVHGWKH\FDQEHLGHQWLÂżHGZLWKWKHFRORU of the LED. In addition, the battery pack level can always be checked with the indicator LED on the EDFNRIWKHĂDWSDQHOVHQVRU 6LQFHWKHĂDWSDQHOVHQVRUFDQEHVKDUHGZLWKPXOWLSOHV\VWHPVWKHQXPEHURIĂDWSDQHO sensors can be optimized. 897N120339A System Configuration (Product Overview) FDR D-EVO II Operation Manual 2-3 2.2 Unit Names and the Functions Unit names and the functions of the FDR D-EVO II are described below. 2.2.1 DR-ID 1200 Ĺś DR-ID 1200PU * Exposure plane is shown in this figure. Flat panel sensor identification lamp Applied part Sleep release/ memory exposure mode start button Battery pack level indicator System Configuration (Product Overview) Sleep lamp Memory exposure mode status Status lamp Memory exposure mode start button Flat panel sensor (DR-ID 1201SE, DR-ID 1202SE, DR-ID 1211SE and DR-ID 1212SE) Power status LED Main switch Power supply unit (DR-ID 1200MP) 2-4 FDR D-EVO II Operation Manual 897N120339A Name Description Flat panel sensor The DR-ID 1201SE and DR-ID 1202SE incorporate a GOS indirect panel. The DR-ID 1211SE and DR-ID 1212SE incorporate a CsI indirect panel. Flat panel sensor LGHQWLÂżFDWLRQODPS 7KHĂDWSDQHOVHQVRUFXUUHQWO\LQXVHLVLGHQWLÂżHGE\WKHFRORURIWKLVODPS The color of this lamp is selected from among lime yellow, blue, purple, orange and SLQNDWWKHWLPHRILQVWDOODWLRQ,IWKHFRORULVQRWVSHFLÂżHGWKLVODPSLVOLWLQZKLWH 7KLVODPSRQWKHĂDWSDQHOVHQVRUFXUUHQWO\LQXVHLVOLWLQWKHVDPHFRORUDVWKH panel icon selected on the display of the image processing unit. Sleep lamp This LED shows the sleep status. (Blue) Off Sleep off or Sleep state On Extra sleep state Sleep release/memory exposure mode start button Releases the extra sleep mode. Memory exposure mode start button When this button is held pressed for 2 seconds while pressing the sleep release/ memory exposure mode start button, the memory exposure mode starts up. The memory exposure mode can be started up when no exposure menu is registered and calibration is not being performed. Battery pack level indicator System Configuration (Product Overview) :KHQWKHĂDWSDQHOVHQVRULVQRWRSHUDWHGIRUPLQXWHVLWLVSODFHGLQWKHVOHHS mode. Extra sleep mode, which can further save power, can also be set. To specify or change the setting of sleep mode or extra sleep mode, contact a FUJIFILM dealer. Memory exposure mode status In the memory exposure mode, the number of exposed images or an error during the start-up of memory exposure mode is displayed. Name Status lamp Description Indicates the equipment status by LEDs. READY READY POWER ERROR LINK (Green) On Blinks for 1.0 second Off On (Blue) POWER (The power on/off state of the Off ĂDWSDQHOVHQVRULVGLVSOD\HG Blinks for 1.0 second ERROR (Orange) Off On LINK (White) Off Exposure possible During exposure sequence Not ready Power ON Power OFF Error occurred Normal Connected Communication not possible. * When the battery pack is not attached, all LEDs are off. Power supply unit (DR-ID 1200MP) $GHYLFHVXSSO\LQJSRZHUWRWKHĂDWSDQHOVHQVRUDQGFRQQHFWLQJEHWZHHQWKH ĂDWSDQHOVHQVRULPDJHSURFHVVLQJXQLWDQGFRQWUROFDELQHW Main switch 6XSSOLHVWKHSRZHUWRWKHĂDWSDQHOVHQVRUDQGWKHLQVLGHRIWKHSRZHUVXSSO\ unit. Power status LED Displays ON/OFF of the power supply unit. HINT )RUGHWDLOVRQWKHĂDWSDQHOVHQVRULGHQWLÂżFDWLRQODPSDQGEDWWHU\SDFNOHYHOLQGLFDWRUVHHÂł/DPS,QGLFDWLRQVRQ the Flat Panel Sensorâ. FDR D-EVO II Operation Manual 897N120339A 2-5 Ĺś DR-ID 1200DU Flat panel sensor identification lamp READY lamp Status lamps Mute switch Main switch Docking stand (DR-ID 1200DS) System Configuration (Product Overview) Name Description Docking stand (DR-ID 1200DS) 6XSSOLHVWKHSRZHUWRWKHĂDWSDQHOVHQVRUDQGFRQQHFWVWKHĂDWSDQHOVHQVRU and the image processing unit. Main switch 6XSSOLHVWKHSRZHUWRWKHGRFNLQJVWDQGDQGWKHĂDWSDQHOVHQVRU Status lamps POWER (Blue) (The power on/off state of the docking stand is displayed.). POWER LINK LINK Battery pack level indicator (White) Battery pack level indicator On Power ON Off Power OFF On Connected (This lamp is lit when communication with the control cabinet is established after LQVHUWLQJWKHĂDWSDQHOVHQVRU Indicates the charge level of the battery pack for WKHĂDWSDQHOVHQVRULQ\HOORZLVKJUHHQ Lights in orange when an error occurs. Mute switch This switch is used to mute the buzzer that sounds when an exposure is ready, DĂDWSDQHOVHQVRULVLQVHUWHGRUWKHEDWWHU\SDFNRIDĂDWSDQHOVHQVRULVIXOO\ charged. Flat panel sensor LGHQWLÂżFDWLRQODPS 7KLVODPSLVOLWLQWKHVDPHFRORUDVWKHĂDWSDQHOVHQVRULGHQWLÂżFDWLRQODPSRQ WKHĂDWSDQHOVHQVRUFXUUHQWO\LQXVH READY lamp (Green) 7KLVODPSLVOLWZKHQWKHĂDWSDQHOVHQVRUFXUUHQWO\LQXVHLVUHDG\IRUH[SRVXUH Â1RWHWKDWWKHĂDWSDQHOVHQVRULQVHUWHGLQWRWKHGRFNLQJVWDQGFDQRQO\EHFKDUJHGRUXVHGIRUFRPPXQLFDWLRQ It cannot be used for exposures. ⢠If the battery pack level indicator of the docking stand lights in orange, press the main switch to turn it off and press the switch again to turn the power back on. 2-6 FDR D-EVO II Operation Manual 897N120339A Ĺś DR-ID 1200MC Main switch/ power status LED Control cabinet (DR-ID 1200MC) Control cabinet (DR-ID 1200MC) System Configuration (Product Overview) Name Description $SHUVRQDOFRPSXWHUXVHGIRUFRQWUROOLQJWKHĂDWSDQHOVHQVRUDQG performing image processing. Main switch Supplies the power to the control cabinet. Power status LED Displays ON/OFF of the control cabinet. 'HSHQGLQJRQWKHFRQÂżJXUDWLRQWKHFRQWUROFDELQHW '5,'0& PD\QRWEHLQFOXGHGLQWKHV\VWHP,IQRW included, the software for the control cabinet can be installed on the image processing unit (DR-ID 300CL). )RUGHWDLOVSHFLÂżFDWLRQRILPDJHSURFHVVLQJXQLWSOHDVHUHIHUWRÂł'5,'&/2SHUDWLRQ0DQXDO´ Ĺś SE cable Name SE cable Description $FDEOHWKDWFRQQHFWVWKHĂDWSDQHOVHQVRUDQGWKHSRZHUVXSSO\XQLW 7KLVFDEOHLVXVHGIRUDGGLQJWKHVHFRQGDQGVXEVHTXHQWĂDWSDQHO VHQVRUVFKDQJLQJRYHUWKHFRQQHFWLRQEHWZHHQWKHĂDWSDQHOVHQVRUVDQG other usages. &DEOHOHQJWK$SSUR[P IW $SSUR[P IW FDR D-EVO II Operation Manual 897N120339A 2-7 Ĺś SE communication cable Name Description SE communication cable System Configuration (Product Overview) $FDEOHXVHGIRUFRQQHFWLQJWKHĂDWSDQHOVHQVRUDQGWKHRSWLRQDODFFHVVSRLQW This cable is used for wired communication if wireless communication is not available. ,QDGGLWLRQWKLVFDEOHLVXVHGIRUUHJLVWHULQJRUUHFRJQL]LQJWKHĂDWSDQHOVHQVRU &DEOHOHQJWK$SSUR[P IW Ĺś %DWWHU\FKDUJHU 2SWLRQDO Battery charger Name Description Battery charger &KDUJHVWKHEDWWHU\SDFNIRUWKHĂDWSDQHOVHQVRU7ZRSDFNVFDQEH charged at the same time. Charge status indicator LED Indicates charge status. Ĺś ,PDJHSURFHVVLQJXQLW For the unit names and functions of the image processing unit, see the âDR-ID 300CL Operation Manualâ. 2-8 FDR D-EVO II Operation Manual 897N120339A ,PDJH3URFHVVLQJ8QLW'LVSOD\ &RQILJXUDWLRQ When the self-initialization process ends, the Patient Information Input Screen will appear on the image processing unit display. For details, see âDR-ID 300CL Operation Manualâ. Ĺś Patient Information Input Screen Patient information input field Input patient information. Tool button Operates the Patient Information Database function to input patient information. 6\VWHP&RQILJXUDWLRQ 3URGXFW2YHUYLHZ Clears patient information (except for technologist). Screen keyboard Used to input characters in the patient information input field. Reserves a study. Terminates patient information input, and proceeds to exposure menu selection. Displays the âStudy List screenâ. Connected devices status Connected devices status display field. Displays the status of connected devices. For details, see the next page. Ĺś Study Screen Patient information display field Displays patient information. Exposure menu list This list shows exposure menus selected on the âExposure Menu Selection screenâ. Selected exposure menu number display field Exposure unit display field The Tube, Technique, and Imaging panels can be uniquely arranged and displayed. Technologist display field Image display field The read image appears. Displays the name of loggedin technologist (user). Shot Ready (exposure ready status indicator) Exposure (image reading) can be performed when the indicator is lit green. Exposure (image reading) cannot be performed when the indicator is not lit. FDR D-EVO II Operation Manual 897N120339A 2-9 Ĺś Connected Devices Status Details on each icon and its display area are described below. Other indicator icons display area Other indicator icons display area System Configuration (Product Overview) 7KHVWDWXVRIWKHĂDWSDQHOVHQVRUSRZHUVXSSO\XQLWGRFNLQJVWDQGDQGLPDJHSURFHVVLQJXQLW is shown with an icon. Up to six icons can be displayed. The status of each connected device is shown in three categories. Device information displayed in each category is as follows. Category Status of exposure unit Status of the image processing unit and personal computer Other (Status of output unit, hospital LAN, etc.) Device information (1) Exposure unit communication indicator (2) Exposure unit battery indicator (3) Console event indicator (4) Console battery indicator (5) Output status indicator (6) Hospital wireless communication indicator The information is displayed in each category as shown below. Device information of the category Category Locations of category information can be customized in the user utility. For details, see âDR-ID 300CL Reference Guideâ. 2-10 FDR D-EVO II Operation Manual 897N120339A (1) Exposure Unit Communication Indicator 7KHIROORZLQJLFRQVGLVSOD\FRPPXQLFDWLRQVWDWXVRIWKHĂDWSDQHOVHQVRUFRUUHVSRQGLQJWRWKH VHOHFWRUVHOHFWHGLQWKHH[SRVXUHXQLWGLVSOD\ÂżHOGRIWKHÂł6WXG\VFUHHQ´ ,IWKHĂDWSDQHOVHQVRULVFRQQHFWHGZLWKZLUHGFRPPXQLFDWLRQWKHIROORZLQJLFRQVDUHGLVSOD\HG &RQQHFWHG 8QNQRZQ ,IWKHĂDWSDQHOVHQVRULVFRQQHFWHGZLUHOHVVO\WKHIROORZLQJLFRQVDUHGLVSOD\HG &RQQHFWHG'LVSOD\VWKHVLJQDOVWUHQJWKLQIRXUOHYHOV 'LVFRQQHFWHG 6\VWHP&RQILJXUDWLRQ 3URGXFW2YHUYLHZ 8QNQRZQ CAUTIONS While LVGLVSOD\HGUDGLRJUDSK\LVQRWUHFRPPHQGHGVLQFHZLUHOHVVFRPPXQLFDWLRQLVXQVWDEOH (2) Exposure Unit Battery Indicator When the exposure unit is connected to the image processing unit, the battery status is indicated with the following icons. 5HDG\IRUH[SRVXUH EDWWHU\FKDUJHIXOO\FKDUJHG 5HDG\IRUH[SRVXUH H[SRVXUHWLPHDYDLODEOHOHVVWKDQRQHKRXU 5HDG\IRUH[SRVXUH EDWWHU\FKDUJHUHFKDUJHQHHGHG 5HDG\IRUH[SRVXUH FRQQHFWHGWRSRZHUVXSSO\ 1RWUHDG\IRUH[SRVXUH CAUTIONS :KHQDQH[SRVXUHLVUHDG\WREHPDGH WKH5($'<VWDWXVODPSRQWKHĂDWSDQHOVHQVRULVOLW JUHHQ WKHSRZHUFRQVXPSWLRQRIWKHĂDWSDQHOVHQVRULQFUHDVHV$OWKRXJKWKHLQGLFDWRULFRQRI WKHUHPDLQLQJEDWWHU\OHYHOFKDQJHVWRORZDQGWKHYDOXHRIWKHRSHUDEOHWLPHGLVSOD\GHFUHDVHV temporarily, these are not failures. (3) Console Event Indicator The following icons display the status of the image processing unit. 1RUPDO :DUQLQJOHYHOHYHQWRQJRLQJ (UURUOHYHOHYHQWRQJRLQJ FDR D-EVO II Operation Manual 897N120339A 2-11 (4) Console Battery Indicator The status of the PC battery and of PC connection to the AC adapter are shown by the icons below. 5HDG\IRUXVH 5HDG\IRUXVH 5HDG\IRUXVH EDWWHU\FKDUJHUHFKDUJHQHHGHG 5HDG\IRUXVH FKDUJLQJRUWKH$&DGDSWHUFRQQHFWHG 1RWUHDG\IRUXVH (5) Output Status Indicator The following icons display the output status. 6\VWHP&RQILJXUDWLRQ 3URGXFW2YHUYLHZ :DLWLQJIRULPDJHRXWSXW 3URFHVVLQJLPDJHRXWSXW 2XWSXWHUURU (6) Hospital Wireless Communication Indicator The status of wireless communication between the image processing unit and the hospital LAN is shown by the icons below. &RQQHFWHG5DGLRÂżHOGVWUHQJWKLVGLVSOD\HGLQIRXUOHYHOV 6ZLWFKLQJFRQQHFWLRQ 'LVFRQQHFWHG CAUTIONS While LV GLVSOD\HG LPDJH WUDQVIHU WR WKH KRVSLWDO /$1 EHFRPHV XQVWDEOH DOWKRXJK ZLUHOHVV communication is established. 2-12 FDR D-EVO II Operation Manual 897N120339A 5RXWLQH2SHUDWLRQ'LDJUDP 7KHV\VWHPFRQÂżJXUDWLRQDQGWKHURXWLQHRSHUDWLRQGLDJUDPIRUWKH)'5'(92II is as follows. FDR D-EVO2 (DR-ID 1200) DR-ID 1200PU/DR-ID 1200DU ⢠X-ray exposure ⢠Image reading Image Processing Unit Image data ⢠Patient information entry ⢠Exposure region / study menu selection DR-ID 1200PU/DR-ID 1200DU System Configuration (Product Overview) ⢠Image processing, etc. Image data Image data Imager ⢠Film output Image Management Workstation ⢠DICOM-conformed open network supported FDR D-EVO II Operation Manual 897N120339A 2-13 2.5 Wireless Specifications 7HFKQLFDO6SHFLÂżFDWLRQIEEE802.11n (protocol) , 2.4GHz, W52, W53, W56, W58 (frequency) ,QWHQGHGHQYLURQPHQW5RRPVL]HRIP[P[P IW[IW[IW KHLJKW RU less (general X-ray room) (The electric shield does not exist excluding the installation stand or bed.) ,QVWDOODWLRQ'RQRWSODFHGHYLFHVJHQHUDWLQJHOHFWURPDJQHWLFZDYH &705,GLDWKHUP\ RFID etc.) near this equipment. We recommend not to use any other wireless devices such as cellular/smart phones, portable phones, microwave ovens, WAPs, etc. within 2m (6.6 ft) of the wireless FDR D-EVO II system. When other wireless devices are used within 2m (6.6 ft), wireless data communication may be delayed. (Data will not be lost; if a timeout occurs a retry can be performed after the cause of interference has been removed) Do not cover the Flat Panel Sensor (DR-ID 1201SE/DR-ID 1202SE/DR-ID 1211SE/DR-ID 1212SE) with a shield such as a metallic plate as this will interfere with a wireless communication. ,QIRUPDWLRQEHLQJWUDQVPLWWHG6\VWHP&RQWURO6LJQDO ,PJBUHTB&0'HWF Image Data of the Flat Panel Sensor 1RWH3DWLHQW,QIRUPDWLRQLVQRWWUDQVPLWWHGE\ZLUHOHVV interface of Access point :LUHOHVVUDQJHPD[P IW IURPWKH$FFHVVSRLQWDVWHVWHG$FWXDOUDQJHPD\YDU\ 'DWDWUDQVIHUUDWH0ESV '5,'EHWZHHQWKH)ODW3DQHO6HQVRUDQG&RQVROH3& (This value is FUJIFILM measuring result of wireless module, and actual data rate may vary.) 7UDQVIHU3RZHUG%PRUOHVV 0RGXODWLRQ2)'0 3URYLGHGE\,(((Q System Configuration (Product Overview) :LUHOHVV'DWD6HFXULW\:LUHOHVV)'5'(92II system (DR-ID 1201SE/DR-ID 1202SE/ DR-ID 1211SE/DR-ID 1212SE) will be utilizing the IEEE 802.11n. The Wireless Access Point (WAP) has a feature that limits the maximum number of the Flat Panel Sensor per access point to ensure data integrity. Further the WAP has MAC Address Filtering (unique IP address) and Wireless LAN Segmentation to ensure handshaking with only the registered wireless FDR D-EVO II Flat Panel Sensors (DR-ID 1201SE/DR-ID 1202SE/DR-ID 1211SE/ DR-ID 1212SE). ,QDGGLWLRQWRWKH0$&DGGUHVVÂżOWHULQJWKHZLUHOHVV communication between DR-ID 1201SE/DR-ID 1202SE/DR-ID 1211SE/DR-ID 1212SE (Flat Panel Sensor) and access point is secured by WPA2-PSK encryption with AES (Advanced Encryption Standard). Data security feature will be enabled during installation E\D)8-,),/0ÂżHOGVHUYLFHHQJLQHHU1RSDWLHQWLQIRUPDWLRQ is transmitted between DR-ID 1201SE/DR-ID 1202SE/DR-ID 1211SE/DR-ID 1212SE (Flat Panel Sensor) and access point., between access point and the console. +DQGVKDNLQJ3DLULQJ7KH:LUHOHVV$FFHVV3RLQWDQG'5,'6('5,'6('5 ID 1211SE/DR-ID 1212SE (Flat Panel Sensor) will be paired during LQVWDOODWLRQE\D)8-,),/0ÂżHOGVHUYLFHHQJLQHHUWRHQVXUHRQHWRRQH ZLUHOHVVFRQQHFWLRQ)8-,),/0ÂżHOGVHUYLFHHQJLQHHUZLOOPHDVXUH the wireless transmission condition in the primary area, so the FDR D-EVO II system can be used stable. )UHTXHQF\7ROHUDQFHÂSSP 2-14 FDR D-EVO II Operation Manual 897N120339A Quality of Service (QoS) Item Form of electric wave Center frequency DR-ID 1201SE/DR-ID 1202SE/ Unit DR-ID 1211SE/DR-ID 1212SE Standard Remarks Spectrum diffusion HT20 5180 - 5825 2412 - 2472 MHz 36ch,40ch,44ch,48ch W52 HT40 5190 - 5795 2422 - 2462 MHz Channel interval IEEE802.11n 20(HT20) / 40(HT40) Transmission rate IEEE802.11n HT20ä MCS0-15 38ch,46ch W52 HT40ä MCS0-15 Output power Max Frequency Tolerance OFDM Power 17 dBm - 20 ~ +20 ppm Reception MCS0=-89 dBm sensitivity MCS1=-86 dBm PER : MCS2=-83 dBm MCS0=-86 dBm MCS1=-83 dBm MCS2=-80 dBm MCS0=-88 dBm MCS1=-85 dBm MCS2=-82 dBm MCS0=-85 dBm MCS1=-82 dBm MCS2=-79 dBm Packet Error IEEE 802.11n (5GHz) Rate <10% IEEE 802.11n (2.4GHz) System Configuration (Product Overview) Modulation MAX HT20 HT40 HT20 HT40 )RUGHWDLOVRQWKHZLUHOHVVVSHFLÂżFDWLRQRIWKHLPDJHSURFHVVLQJXQLWVHHWKHÂł&RQVROH$GYDQFH '5,'&/ Operation Manualâ. FDR D-EVO II Operation Manual 897N120339A 2-15 2 System Configuration (Product Overview) 2-16 FDR D-EVO II Operation Manual 897N120339A Chapter 3 Basic Operation 3UHSDULQJWKH)ODW3DQHO6HQVRU 7KLVVHFWLRQGHVFULEHVKRZWRSUHSDUHWKHĂDWSDQHOVHQVRU 3.1.1 Type of Flat Panel Sensor DR-ID 1201SE, DR-ID 1202SE, DR-ID 1211SE, DR-ID 1212SE 7KHEDWWHU\SDFN RSWLRQDO LVUHTXLUHGZKHQWKHĂDWSDQHOVHQVRULVXVHGLQZLUHOHVVFRPPXQLFDWLRQ mode. 3.1.2 Number of the Connectable Flat Panel Sensors Basic Operation 7RHQDEOHWKHĂDWSDQHOVHQVRULWV,'QHHGVWREHUHJLVWHUHGLQDGYDQFHE\RXURIÂżFLDOGHDOHURU FUJIFILM Representative. 8SWRDKXQGUHGĂDWSDQHOVHQVRUVFDQEHUHJLVWHUHG 8SWRÂżYHĂDWSDQHOVHQVRUVFDQEHFRQQHFWHG :KHQWKH'5,'38LVXVHGXSWRWZRĂDWSDQHOVHQVRUVFDQEHFRQQHFWHGWRRQHSRZHU supply unit in wired communication mode. Up to two power supply unit can be used. :KHQWKH'5,''8LVXVHGRQO\RQHĂDWSDQHOVHQVRUVFDQEHFRQQHFWHGWRRQHGRFNLQJ stand in wired communication mode. Up to three docking stand can be used. 'HSHQGLQJRQWKHFRQÂżJXUDWLRQWKHFRQWUROFDELQHW '5,'0& PD\QRWEHLQFOXGHGLQWKHV\VWHP,IQRW included, the software for the control cabinet can be installed on the image processing unit (DR-ID 300CL). )RUGHWDLOVSHFLÂżFDWLRQRILPDJHSURFHVVLQJXQLWSOHDVHUHIHUWRÂł'5,'&/2SHUDWLRQ0DQXDO´ &RQQHFWLQJ'LVFRQQHFWLQJWKH)ODW3DQHO6HQVRU Connector Disconnect the connector. Press the latches on both sides of the connector. Connect the connector. Press the connector into the insertion section. Make sure that the latches on both sides are properly engaged when connecting the connector. If the connector is inserted incompletely, the power may turn off. KHQPXOWLSOHĂDWSDQHOVHQVRUVDUHXVHGPDNHVXUHWKDWWKH5($'<ODPSDPRQJWKHVWDWXVODPSVRIWKHĂDW panel sensor to be used for an exposure is lit. FDR D-EVO II Operation Manual 897N120339A 3-1 &RQQHFW'LVFRQQHFWWKHFRQQHFWRUVWUDLJKWWRWKHĂDWSDQHOVHQVRU,IFRQQHFWHGGLVFRQQHFWHGDWDQDQJOHWKH connector may be damaged. ,QVHUWLQJ5HPRYLQJWKH)ODW3DQHO6HQVRULQWRIURPWKH 5DGLRJUDSKLF([DPLQDWLRQ6WDQG ROORZWKHSURFHGXUHEHORZWRLQVHUWUHPRYHWKHĂDWSDQHOVHQVRULQWRIURPWKHUDGLRJUDSKLF examination stand. Basic Operation For details, see the Operation Manual for the radiographic examination stand. CAUTIONS RUWKHSRVLWLRQLQJDWWKHWLPHRILQVHUWLQJUHPRYLQJWKHĂDWSDQHOVHQVRUVHHWKH2SHUDWLRQ 0DQXDOIRUWKHUDGLRJUDSKLFH[DPLQDWLRQVWDQG CAUTIONS 0DNHVXUHWKDWWKHĂDWSDQHOVHQVRULVLQVWDOOHGLQWKHUDGLRJUDSKLFH[DPLQDWLRQVWDQGVHFXUHO\ CAUTIONS HFDUHIXOQRWWRKDYH\RXUÂżQJHUVFDXJKWZKHQLQVHUWLQJUHPRYLQJWKHĂDWSDQHOVHQVRULQWR IURPWKHUDGLRJUDSKLFH[DPLQDWLRQVWDQG CAUTIONS :KHQSXOOLQJRXWSXVKLQJLQWKHWUD\RIWKHUDGLRJUDSKLFH[DPLQDWLRQVWDQGDIWHUVHWWLQJWKHĂDW SDQHOVHQVRURQLWEHFDUHIXOQRWWRGURSWKHĂDWSDQHOVHQVRURUGDPDJHWKHWUD\ CAUTIONS %HIRUHLQVHUWLQJUHPRYLQJWKHĂDWSDQHOVHQVRULQWRIURPWKHUDGLRJUDSKLFH[DPLQDWLRQVWDQG SXOORXWWKHWUD\FRPSOHWHO\2WKHUZLVHWKHĂDWSDQHOVHQVRUPD\EHGDPDJHG )RUWKHHIIHFWLYHDUHDRIWKHĂDWSDQHOVHQVRUVHHSDJH$ 3-2 FDR D-EVO II Operation Manual 897N120339A >@8SULJKWW\SH 3 6HWWKHĂDWSDQHOVHQVRUWRWKHXSSHUSDUWRI the tray. 4 3XVKWKHWUD\EDFNLQWRSODFHDIWHUVHWWLQJ WKHĂDWSDQHOVHQVRU CAUTIONS :KHQLQVHUWLQJWKHĂDWSDQHOVHQVRULQWR WKHUDGLRJUDSKLFH[DPLQDWLRQVWDQGGLUHFW WKHH[SRVXUHSODQHWRZDUGWKH;UD\WXEH Pull out the tray. Tray ,QVHUWWKHĂDWSDQHOVHQVRULQWRWKHFDVVHWWH UHFHLYHZLWKWKHJUHHQPDUNRIWKHĂDWSDQHO sensor up, and then move it downwards. Basic Operation Green mark 5 5HPRYHWKHĂDWSDQHOVHQVRUDIWHUXVH Pull out the tray, push the cassette receive GRZQZDUGVDQGWKHQUHPRYHWKHĂDWSDQHOVHQVRU Push the tray back into place. Cassette receive FDR D-EVO II Operation Manual 897N120339A 3-3 [2] Bed type Center mark CAUTIONS :KHQLQVHUWLQJWKHĂDWSDQHOVHQVRU WRWKHUDGLRJUDSKLFH[DPLQDWLRQVWDQG direct the exposure plane upwards. 1 3XOORXWWKHWUD\E\XVLQJWKHKDQGOH 3 3XVKWKHWUD\EDFNLQWRSODFHE\XVLQJWKH KDQGOHDIWHUVHWWLQJWKHĂDWSDQHOVHQVRU 4 5HPRYHWKHĂDWSDQHOVHQVRUDIWHUXVH Tray Basic Operation 2 3XOOWKHFDVVHWWHVWRSSHUDQGVHWWKHĂDW SDQHOVHQVRUVRWKDWLWVFHQWHUPDUNLV DOLJQHGZLWKWKHFHQWHURIWKHVWRSSHU Hold the handle and pull out the tray. Remove the ĂDWSDQHOVHQVRUZKLOHSXOOLQJWKHFDVVHWWHVWRSSHU and then push the tray back into place. Cassette stopper &KDQJLQJWKH'LUHFWLRQRIWKH)ODW3DQHO6HQVRU Connector 7KHGLUHFWLRQRIWKHFRQQHFWRURIWKHĂDWSDQHOVHQVRUFDQEHFKDQJHGGHSHQGLQJRQKRZLWLV inserted into the radiographic examination stand. 7RFKDQJHWKHGLUHFWLRQFRQWDFWRXURIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYH When shipped 3-4 FDR D-EVO II Operation Manual 897N120339A After changing the direction &KDUJLQJWKH%DWWHU\3DFNIRUWKH)ODW3DQHO6HQVRU Charge the battery pack (optional) using the battery charger (optional). CAUTIONS 'RQRWFKDUJHWKHEDWWHU\SDFNRWKHUWKDQWKRVHGHVLJQDWHGE\)8-,),/0&RUSRUDWLRQ,IWKH EDWWHU\SDFNLVFKDUJHGXQGHUWKHFKDUJLQJFRQGLWLRQV YROWDJHFXUUHQWDQGFKDUJLQJPHWKRG GLIIHUHQWIURPWKRVHVSHFLÂżHGE\)8-,),/0&RUSRUDWLRQWKHEDWWHU\SDFNPD\HPLWVPRNH LJQLWHH[SORGHRUOHDNĂXLG CAUTIONS :KHQVHWWLQJWKHEDWWHU\SDFNLQWRWKHEDWWHU\FKDUJHUPDNHVXUHWKDWWKHRULHQWDWLRQRIWKH EDWWHU\SDFNLVFRUUHFWDVVKRZQLQWKHÂżJXUHLQ6WHS 1 ,IWKHEDWWHU\SDFNLVIRUFLEO\VHWLQ WKHZURQJRULHQWDWLRQERWKWKHEDWWHU\SDFNDQGWKHEDWWHU\FKDUJHUPD\EHGDPDJHGDQGHPLW VPRNHLJQLWHOHDNĂXLGRUFDXVHHOHFWULFVKRFN Basic Operation :KHQWKHEDWWHU\SDFNLQVWDOOHGLQWKHĂDWSDQHOVHQVRULVIXOO\FKDUJHGLWLVSRVVLEOHWRSHUIRUPH[SRVXUHVIRUD maximum of approximately 500 images. However, the number varies depending on the usage conditions. 7KHFDSDFLW\RIWKHEDWWHU\SDFNLVGLVSOD\HGRQWKHEDWWHU\SDFNOHYHOLQGLFDWRURIWKHĂDWSDQHOVHQVRUDQGRQWKH screen of the image processing unit. :KHQWKHUHPDLQLQJFDSDFLW\RIWKHEDWWHU\SDFNRIWKHĂDWSDQHOVHQVRUEHFRPHVOHVVWKDQDSSUR[PLQXWHV a pop-up window appears on the image processing unit display, and exposure cannot be performed. If this happens, replace or charge the battery pack. :KHQWKHUHPDLQLQJFDSDFLW\RIWKHEDWWHU\SDFNLQVWDOOHGLQWKHĂDWSDQHOVHQVRUEHFRPHVORZWKHEDWWHU\SDFN OHYHOLQGLFDWRULVOLWLQRUDQJHDQGH[SRVXUHVFDQQRWEHSHUIRUPHG,IWKLVKDSSHQVFRQQHFWWKH6(FDEOHWRWKHĂDW panel sensor to charge the battery pack. 1 6HWWKHEDWWHU\SDFNLQWKHEDWWHU\FKDUJHU When the battery pack is set, a buzzer sound is generated and the charge status indicator LED lights. Two battery packs can be charged at the same time. 2 :KHQEDWWHU\FKDUJHLVFRPSOHWHGUHPRYH WKHEDWWHU\SDFN When battery charge is completed, the charge status indicator LED changes from blinking to lighting. FDR D-EVO II Operation Manual 897N120339A 3-5 3.1.7 &KDUJLQJWKH,PDJH3URFHVVLQJ8QLW For details, refer to the manual of the personal computer. ,QVWDOOLQJ5HPRYLQJWKH%DWWHU\3DFNIRUWKH)ODW3DQHO Sensor )ROORZWKHSURFHGXUHEHORZWRLQVWDOOUHPRYHWKHEDWWHU\SDFNIRUWKHĂDWSDQHOVHQVRU :KHQLQVWDOOLQJUHPRYLQJWKHEDWWHU\SDFNSODFHWKHĂDWSDQHOVHQVRURQDĂDWSODFH Do not remove the battery pack until a processed image appears in the window of the image processing unit after the exposure. Remove the battery cover. Basic Operation 3ODFHWKHĂDWSDQHOVHQVRUZLWKWKHEDFNVLGHIDFLQJ XSZDUGSUHVVWKH³ƴSRUWLRQRIWKHORFNOHYHUDQG then slide it in the direction of the arrow to remove the battery cover. Guide marks Battery pack ⢠To remove the battery pack, perform the same procedure as Step 1 (removing the battery cover). Battery pack 2 ,QVWDOOWKHEDWWHU\SDFN Slide the battery pack along the dent of the battery VHFWLRQRIWKHĂDWSDQHOVHQVRUWRZDUGWKHFRQQHFWRU terminal. Align the guide mark of the battery pack ZLWKWKDWRIWKHĂDWSDQHOVHQVRUDQGSXVKWKH battery pack in to install it. Make sure that battery pack is securely installed. Pushing the battery pack in with the guide marks misaligned may damage the connector terminal. When attaching the battery pack, make sure that the waterproof packing attached to the connector WHUPLQDORIWKHĂDWSDQHOVHQVRULVDOLJQHGSURSHUO\ :KHQWKHEDWWHU\SDFNLVLQVWDOOHGLQWKHĂDWSDQHO sensor, the power is automatically turned on. 3-6 FDR D-EVO II Operation Manual 897N120339A ⢠To install the battery cover, perform the same procedure as Step 2 (installing the battery pack). /DPS,QGLFDWLRQVRQWKH)ODW3DQHO6HQVRU 7KLVVHFWLRQH[SODLQVWKHLQGLFDWLRQVRIWKHĂDWSDQHOVHQVRULGHQWLÂżFDWLRQODPSDQGWKHEDWWHU\SDFN level indicator. For other lamp indications, see â2.2.1 DR-ID 1200â. Ĺś)ODWSDQHOVHQVRULGHQWLÂżFDWLRQODPS 7KHĂDWSDQHOVHQVRULVDFWLYH %OLQNLQJLQZKLWH While in sleep/extra sleep mode %OLQNLQJLQLGHQWLÂżFDWLRQFRORU While detecting an impact %OLQNLQJLQUHG Ĺś %DWWHU\SDFNOHYHOLQGLFDWRU LED0 LED3 LED2 LED1 (When the battery pack is being charged) /('/LWLQJUHHQ $YDLODEOHWLPHPLQXWHVRUPRUH /('%OLQNLQJLQJUHHQ/('/LWLQJUHHQ $YDLODEOHWLPHPLQXWHVRUPRUHEXWOHVVWKDQPLQXWHV /('%OLQNLQJLQJUHHQ/('/LWLQJUHHQ $YDLODEOHWLPH/HVVWKDQPLQXWHV /('%OLQNLQJLQJUHHQ Basic Operation Fully charged (When the battery pack is not charged) $YDLODEOHWLPHPLQXWHVRUPRUH /('/LWLQJUHHQ $YDLODEOHWLPHPLQXWHVRUPRUHEXWOHVVWKDQPLQXWHV /('/LWLQJUHHQ $YDLODEOHWLPH/HVVWKDQPLQXWHV /('/LWLQJUHHQ $YDLODEOHWLPHPLQXWHVRUOHVV /('/LWLQRUDQJH FDR D-EVO II Operation Manual 897N120339A 3-7 $WWDFKLQJWKH)ODW3DQHO6HQVRUWRWKH'RFNLQJ6WDQG CAUTIONS Ć + DQGOHWKHGRFNLQJVWDQGFDUHIXOO\'RQRWKLWRUGURSWKHGRFNLQJVWDQGRUVXEMHFWLWWR VHYHUHVKRFNWRDYRLGSRVVLEOHGDPDJH Ć ,IDQ\GDPDJHVXFKDVFUDFNLQJFKLSSLQJRUSHHOLQJLVIRXQGRQWKHGRFNLQJVWDQGXVHLW after repair. Otherwise, personal injury may result. Consult a FUJIFILM dealer for repair. Ć ,IH[FHVVLYHIRUFHLVDSSOLHGWRWKHGRFNLQJVWDQGLWPD\EHGDPDJHG,QDGGLWLRQGRQRW DSSO\H[FHVVLYHIRUFHWRWKHĂDWSDQHOVHQVRULQVHUWHGLQWKHGRFNLQJVWDQG Ć : KHQPRYLQJWKHGRFNLQJVWDQGWKDWKDVDOUHDG\EHHQLQVWDOOHGFRQVXOWRXURIÂżFLDOGHDOHU or local representative. Ć ' RQRWSXOOWKHFDEOHIRUFLEO\2WKHUZLVHWKHFDEOHPD\EHEURNHQRUWKHGRFNLQJVWDQGPD\ EHGDPDJHG 1 'LVFRQQHFWWKHFRQQHFWRUIURPWKHĂDW panel sensor and then attach the adapter for WKHGRFNLQJVWDQG HINT When removing the adapter for the docking stand IURPWKHĂDWSDQHOVHQVRUVOLGHWKHORFNNH\RQWKH adapter for the docking stand toward the right side. Basic Operation Lock Key 2 ,QVHUWWKHĂDWSDQHOVHQVRU Check the position of the adapter for the docking VWDQGDOLJQWKHĂDWSDQHOVHQVRUZLWKWKHGRFNLQJ VWDQGDQGVORZO\LQVHUWWKHĂDWSDQHOVHQVRUVWUDLJKW into the docking stand until it stops along the right and left guides of the docking stand. Adapter for the docking stand 3-8 FDR D-EVO II Operation Manual 897N120339A 3.2 6WDUWLQJ8SDQG6KXWWLQJ'RZQWKH6\VWHP This section explains how to start up and shut down the system. Operations are required on the power VXSSO\XQLWGRFNLQJVWDQGĂDWSDQHOVHQVRUDQGLPDJHSURFHVVLQJXQLW The image processing unit in this section is only an example. For details on the image processing unit being used, see the Operation Manual provided with the personal computer. 6WDUWLQJ8SWKH6\VWHP (When the DR-ID 1200PU is used) Make sure that the power cable is connected to the image processing unit. :KHQWKHĂDWSDQHOVHQVRULVXVHGLQZLUHOHVVFRPPXQLFDWLRQPRGHLQVWDOOWKHIXOO\FKDUJHG EDWWHU\SDFNWRWKHĂDWSDQHOVHQVRU :KHQLWLVXVHGLQZLUHGFRPPXQLFDWLRQPRGHFRQQHFWWKHĂDWSDQHOVHQVRUDQGWKHSRZHU VXSSO\XQLWXVLQJWKH6(FDEOH Press the ON side of the main switch of the power supply unit. Basic Operation 1 Make sure that the power status LED is lit in blue. 3 :KHQWKHRSWLRQDODFFHVVSRLQWLVXVHGFRQQHFWWKHDFFHVVSRLQWWRWKHLPDJHSURFHVVLQJXQLW CAUTIONS 8VHWKHRSWLRQDODFFHVVSRLQWE\FRQQHFWLQJLWWRWKHSUHVHWLPDJHSURFHVVLQJXQLWDQGWRWKH86% FRQQHFWRU'RQRWXVHWKHRSWLRQDODFFHVVSRLQWE\FRQQHFWLQJLWWRRWKHULPDJHSURFHVVLQJXQLWDQG or USB connector. Press the ON side of the main switch of the power supply unit. The initialization process starts. ⢠All cables should be connected properly. ⢠No media should be inserted into the disk drive of image processing unit. If the control cabinet is included in the system, the control cabinet starts up automatically. CAUTIONS ,IWKHSRZHUVWDWXV/('RIWKHFRQWUROFDELQHWGRHVQRWFRPHRQDIWHUWXUQLQJRQWKHLPDJH SURFHVVLQJXQLWWXUQRQWKHFRQWUROFDELQHW FDR D-EVO II Operation Manual 897N120339A 3-9 5 7KH3DWLHQW,QIRUPDWLRQ,QSXW6FUHHQEHORZDSSHDUVIROORZLQJWKHRSHQLQJVFUHHQRQWKHLPDJH SURFHVVLQJXQLWPRQLWRU Patient Information Input Screen CAUTIONS Basic Operation An error occurs if the system is started up immediately after shutdown. 7RUHVWDUWWKHV\VWHPLQFOXGLQJWKHFRQWUROFDELQHWPDNHVXUHWKDWWKHSRZHUVWDWXV/('RIWKH FRQWUROFDELQHWLVRIIDQGWKHQSUHVVWKHSRZHUVZLWFKIRUWKHLPDJHSURFHVVLQJXQLW CAUTIONS Ć ' RQRWFRQQHFWGLVFRQQHFWWKHĂDWSDQHOVHQVRUWRIURPWKHSRZHUVXSSO\XQLWRUWRIURPWKH GRFNLQJVWDQGZKLOHWKHPHVVDJHÂł&DOLEUDWLQJ´LVGLVSOD\HGLQWKHFRQQHFWHGGHYLFHVVWDWXV DIWHUWKHV\VWHPVWDUWXS2WKHUZLVHWKHV\VWHPGRHVQRWVWDUWXSQRUPDOO\UHVXOWLQJLQDQHUURU Ć may be displayed in the connected devices status while information on radio wave VWUHQJWKLVEHLQJDFTXLUHGIURPWKHĂDWSDQHOVHQVRU (When the DR-ID 1200DU is used) Make sure that the power cable is connected to the image processing unit. 1 7XUQRQWKHPDLQVZLWFKRQWKHGRFNLQJVWDQG Make sure that the POWER lamp among the status lamps is lit in blue. 2 ,QVWDOOWKHIXOO\FKDUJHGEDWWHU\SDFNWRWKHĂDWSDQHOVHQVRU 3 :KHQWKHRSWLRQDODFFHVVSRLQWLVXVHGFRQQHFWWKHDFFHVVSRLQWWRWKHLPDJHSURFHVVLQJXQLW CAUTIONS 8VHWKHRSWLRQDODFFHVVSRLQWE\FRQQHFWLQJLWWRWKHSUHVHWLPDJHSURFHVVLQJXQLWDQGWRWKH86% FRQQHFWRU'RQRWXVHWKHRSWLRQDODFFHVVSRLQWE\FRQQHFWLQJLWWRRWKHULPDJHSURFHVVLQJXQLWDQG or USB connector. 4 3-10 7XUQRQWKHLPDJHSURFHVVLQJXQLW FDR D-EVO II Operation Manual 897N120339A 5 7KH3DWLHQW,QIRUPDWLRQ,QSXW6FUHHQDSSHDUVRQWKHLPDJHSURFHVVLQJXQLWPRQLWRUDVVKRZQLQ Step 5 RQ3DJH CAUTIONS Ć 'RQRWFRQQHFWGLVFRQQHFWWKHĂDWSDQHOVHQVRUWRIURPWKHSRZHUVXSSO\XQLWRUWRIURPWKH GRFNLQJVWDQGZKLOHWKHPHVVDJHÂł&DOLEUDWLQJ´LVGLVSOD\HGLQWKHFRQQHFWHGGHYLFHVVWDWXV DIWHUWKHV\VWHPVWDUWXS2WKHUZLVHWKHV\VWHPGRHVQRWVWDUWXSQRUPDOO\UHVXOWLQJLQDQHUURU Ć may be displayed in the connected devices status while information on radio wave VWUHQJWKLVEHLQJDFTXLUHGIURPWKHĂDWSDQHOVHQVRU 6KXWWLQJ'RZQWKH6\VWHP (When the DR-ID 1200PU is used) 1 &RQÂżUPWKDWWKHHTXLSPHQWLVQRWUXQQLQJ7RXFKWKH EXWWRQDWWKHXSSHUULJKWRIWKHLPDJH SURFHVVLQJXQLWGLVSOD\DQGWKHQWKH button from the displayed menu. Touch the EXWWRQLQWKHGLVSOD\HGFRQÂżUPDWLRQZLQGRZ 7KHLPDJHSURFHVVLQJXQLWZLOOVKXWGRZQLQDIHZPLQXWHV,IWKHFRQWUROFDELQHWLVLQFOXGHGLQWKH system, the control cabinet will also turn off automatically. Basic Operation (1) (2) (3) Turn off the display as necessary. 3 0DNHVXUHWKDWFDOLEUDWLRQRIWKHĂDWSDQHOVHQVRULVFRPSOHWHG :KHQFRPSOHWHGWKH5($'<ODPSRIWKHĂDWSDQHOVHQVRUWXUQVRII :KHQWKHRSWLRQDODFFHVVSRLQWLVXVHGUHPRYHWKHDFFHVVSRLQWIURPWKHLPDJHSURFHVVLQJXQLW FDR D-EVO II Operation Manual 897N120339A 3-11 5 Press the OFF side of the main switch of the power supply unit. Make sure that the power status LED is off. 6 5HPRYHWKHEDWWHU\SDFNIURPWKHĂDWSDQHOVHQVRU6HWWKHVHEDWWHU\SDFNVLQWKHEDWWHU\ FKDUJHU Battery pack CAUTIONS Basic Operation If the control cabinet is included in the system, do not turn off the control cabinet with the main switch. Shutdown operation may not be performed normally. CAUTIONS :KHQWKHV\VWHPLVVKXWGRZQLPDJHTXDOLW\DGMXVWPHQWLVSHUIRUPHGIRUREWDLQLQJRSWLPDO GLDJQRVWLFLPDJHV 'RQRWGLVFRQQHFWWKH6(FDEOHRU6(FRPPXQLFDWLRQFDEOHXQWLOV\VWHPVKXWGRZQZKHQWKHĂDW panel sensor is used in wired communication mode. 5HPRYHWKHEDWWHU\SDFNDIWHUFRQÂżUPLQJV\VWHPVKXWGRZQZKHQWKHĂDWSDQHOVHQVRULVXVHG in wireless communication mode. (When the DR-ID 1200DU is used) Perform Steps 1 1 and 2 RQ3DJH 2 :KHQWKHRSWLRQDODFFHVVSRLQWLVXVHGUHPRYHWKHDFFHVVSRLQWIURPWKHLPDJHSURFHVVLQJ unit. 3 0DNHVXUHWKDWFDOLEUDWLRQRIWKHĂDWSDQHOVHQVRULVFRPSOHWHG :KHQFRPSOHWHGWKH5($'<ODPSRIWKHĂDWSDQHOVHQVRUWXUQVRII 4 7XUQRIIWKHPDLQVZLWFKRQWKHGRFNLQJVWDQG Make sure that the POWER lamp among the status lamps is off. 5 3-12 5HPRYHWKHEDWWHU\SDFNIURPWKHĂDWSDQHOVHQVRU6HWWKHVHEDWWHU\SDFNVLQWKHEDWWHU\ FKDUJHU FDR D-EVO II Operation Manual 897N120339A 3.3 Routine Operations FDR D-EVO II routine operations can be broadly divided into the following three steps. Step 1 Entering the Patient Information (See page 3-14.) Step 2 Selecting the Anatomical Region and Exposure/Study Menu (See page 3-15.) Step 3 X-ray Exposure (See page 3-17.) HINT Basic Operation Operations that are actually performed on the FDR D-EVO II are only those described in â Step 3 X-ray Exposureâ. Other operations are performed on the image processing unit. For details, see âDR-ID 300CL Operation Manualâ. FDR D-EVO II Operation Manual 897N120339A 3-13 Step 1 1 (QWHULQJWKH3DWLHQW,QIRUPDWLRQ 7KH3DWLHQW,QIRUPDWLRQ,QSXW6FUHHQEHORZLVGLVSOD\HGRQWKHLPDJHSURFHVVLQJXQLWGLVSOD\ immediately after startup. Enter patient information items appropriately, and then touch the button. Not all the items of patient information need to be input. Input any one of the items in order to proceed to the next operation. When the optional card reader is provided, patient information can be input by reading from a magnetic card. Observe the following when the message âCalibrating...â is displayed in the connected devices status. Â'RQRWVXEMHFWWKHĂDWSDQHOVHQVRUWRVKRFN ⢠Do not deliver radiation. Â'RQRWFRQQHFWGLVFRQQHFWWKHĂDWSDQHOVHQVRUWRIURPWKHSRZHUVXSSO\XQLWRUWRIURPWKHGRFNLQJVWDQG Basic Operation Patient information input field Input patient information. Tool button Operates the Patient Information Database function to input patient information. Clears patient information (except for technologist). Screen keyboard Used to input characters in the patient information input field. Reserves a study. Terminates patient information input, and proceeds to exposure menu selection. Displays the âStudy List screenâ. Connected devices status Connected devices status display field. Displays the status of connected devices. Patient information includes the following items. Patientâs Name / Sex / Birth Date / Outpatient/Inpatient / Patient ID / Accession No. / Requesting Department / Contrast Allergies / Patient comments / Study comments HINT You can change patient information input items and their display order in the User Utility settings. 3-14 FDR D-EVO II Operation Manual 897N120339A Step 2 6HOHFWLQJWKH$QDWRPLFDO5HJLRQDQG([SRVXUH6WXG\ Menu The Exposure Menu Selection Screen is displayed. 6HOHFWDQDQDWRPLFDOUHJLRQIURPWKHGLVSOD\JURXSOLVWDQGWKHQVHOHFWDQH[SRVXUHPHQXIURP WKHH[SRVXUHPHQXOLVWUHJLVWHUHGWRWKHGLVSOD\JURXSRQWKHORZHUVLGH 0RUHWKDQRQHPHQX can be selected.) 7KHVHOHFWHGH[SRVXUHPHQX V LVGLVSOD\HGLQWKHVHOHFWHGH[SRVXUHPHQXOLVWRQWKHULJKWVLGH of the screen. Display group list Selected exposure menu list Basic Operation Exposure menu list registered to the display group Touch DIWHUVHOHFWLQJH[SRVXUHPHQX V (1) (2) FDR D-EVO II Operation Manual 897N120339A 3-15 3 The Study Screen is then displayed. Basic Operation :KHQUHJLVWHULQJDQH[SRVXUHPHQX V PRYHWKHĂDWSDQHOVHQVRUDQGLPDJHSURFHVVLQJXQLWRUDFFHVVSRLQWFORVH to each other, so that they are within the range of wireless communication. If the units are out of the range of wireless communication, the message may appear when an exposure menu(s) LVUHJLVWHUHG,QWKLVFDVHPRYHWKHĂDWSDQHOVHQVRUDQGLPDJHSURFHVVLQJXQLWRUDFFHVVSRLQWFORVHWRHDFK other, so that they are within the range of wireless communication, and then follow the displayed message. For details, see â4.1 When a Message Appears on the Image Processing Unitâ. 3-16 FDR D-EVO II Operation Manual 897N120339A Step 3 ;UD\([SRVXUH When settings on the image processing unit have been completed, you can perform an exposure. CAUTIONS Ć 0DNHVXUHWRLGHQWLI\DSDWLHQWDJDLQVWWKHQDPHRUELUWKGDWHDQGWKHQKDYHKLP KHU WDNHD SURSHUSRVLWLRQLQJIRUH[SRVXUH Ć 0DNHVXUHWRFRQÂżUPWKHH[SRVXUHPHQXWREHXVHGDQGWKHQKDYHDSDWLHQWWDNHDSURSHU SRVLWLRQLQJIRUH[SRVXUH Ć :KHQPXOWLSOHSDQHOVDUHXVHGPDNHVXUHWKDWWKH5($'<ODPSDPRQJWKHVWDWXVODPSV RIWKHĂDWSDQHOVHQVRULVOLWLQRUGHUWRFRQÂżUPWKDWLWLVWKHFRUUHFWRQHIRUWKHVHOHFWHG WHFKQLTXH Ć $IWHUVWDUWLQJH[SRVLQJRSHUDWLRQGRQRWGLVFRQQHFWRUFRQQHFWWKHFRQQHFWRU,IWKH FRQQHFWRULVGLVFRQQHFWHGRUFRQQHFWHGUDGLRJUDSK\PD\EHFRPHLPSRVVLEOHRUQRUPDO LPDJHVFDQQRWEHREWDLQHG HINT 0RELOHH[SRVXUHVFDQEHPDGHE\FDUU\LQJWKHĂDWSDQHOVHQVRUQRWHERRNFRPSXWHU LPDJHSURFHVVLQJXQLW DQG the optional access point. Basic Operation >@3RVLWLRQLQJWKHSDWLHQW Position the patient. CAUTIONS [HUFLVHGXHFDUHVRWKDWDQLQWUDYHQRXVOLQHRUGUDLQWXEHSXWWRDSDWLHQWGRHVQRWKRRNLQWR WKHHTXLSPHQW For the exposure position of the upright-type/bed-type radiographic examination stand, see its Operation Manual. :KHQPDNLQJDQH[SRVXUHGLUHFWO\XVLQJWKHĂDWSDQHOVHQVRU set the exposure position by reference to the effective area. Effective area For details on the effective area, see page A-6. When the automatic X-ray detection function is used, see âZ.5 Precautions for the Automatic X-ray Detection Functionâ. FDR D-EVO II Operation Manual 897N120339A 3-17 >@;UD\H[SRVXUH,PDJHGLVSOD\LQJ 0DNHDQH[SRVXUHDIWHUFRQÂżUPLQJWKDW6KRW5HDG\ H[SRVXUHUHDG\VWDWXVLQGLFDWRU LVOLWJUHHQLQWKHFRQQHFWHG GHYLFHVVWDWXVRIWKHLPDJHSURFHVVLQJXQLW:KHQWKHDXWRPDWLF;UD\GHWHFWLRQIXQFWLRQLVXVHGLIWKHĂDWSDQHO sensor is subjected to X-ray radiation without ShotReady lit in green, no image will be acquired although X-ray radiation is applied. $IWHU WKH H[SRVXUH GR QRW PRYH WKH LPDJH SURFHVVLQJ XQLW DQG WKH ĂDW SDQHO VHQVRU XQWLO D SURFHVVHG LPDJH appears in the window of the image processing unit. Basic Operation Touch the button at the lower right to complete the study. To prepare for exposures of the next patient, repeat Step 1 through Step 3 . (1) The registration of the next new patient should be processed after more than 2 seconds. 3-18 FDR D-EVO II Operation Manual 897N120339A [3] Sleep mode When sleep mode is enabled, if no operation is performed for about two minutes without an exposure menu UHJLVWHUHGWKHĂDWSDQHOVHQVRUZLOOHQWHUVOHHSPRGHDQGWKHSRZHUVWDWHLVFKDQJHGWRWKHSRZHUVDYLQJVWDWH Once an exposure menu is registered, sleep mode is canceled automatically. In addition, when the SE cable is FRQQHFWHGWRWKHĂDWSDQHOVHQVRURUZKHQWKHĂDWSDQHOVHQVRULVLQVHUWHGLQWRWKHGRFNLQJVWDQGVOHHSPRGHLV canceled automatically. ([WUDVOHHSPRGHZKLFKFDQIXUWKHUVDYHSRZHUFDQDOVREHVHW,IDVSHFLÂżHGWLPHKDVHODSVHGDIWHUDOOĂDWSDQHO sensors enter sleep mode, they enter extra sleep mode. When the sleep release/memory exposure mode start button is pressed, extra sleep mode is canceled. In sleep mode or extra sleep mode, the operating time of the battery pack becomes longer since the power is saved. ,IWKHĂDWSDQHOVHQVRULVEHLQJFDOLEUDWHGRULILWGHWHFWVDQLPSDFWLWPD\WDNHORQJHUWLPHWRHQWHUVOHHSPRGH or sleep mode may be canceled temporarily. When the setting of sleep mode or extra sleep mode needs to be FKDQJHGFRQVXOWRXURIÂżFLDOGHDOHURUORFDOUHSUHVHQWDWLYH >@([WHQGHG,PDJH5HDGRXW FDR D-EVO II Operation Manual 897N120339A Basic Operation When the Extended Image Readout mode is enabled, a long exposure for up to ten seconds is available. To set the ([WHQGHG,PDJH5HDGRXWPRGHFRQVXOWRXURIÂżFLDOGHDOHURUORFDOUHSUHVHQWDWLYH)RUGHWDLOVRQKRZWRXVHWKH Extended Image Readout mode, see the âConsole Advance (DR-ID 300CL) Reference Guideâ. 3-19 3.4 How to Use Memory Exposure Mode ,QWKHPHPRU\H[SRVXUHPRGHDPD[LPXPRIH[SRVXUHVFDQEHPDGHRQO\ZLWKWKHĂDWSDQHO sensor, without using the image processing unit. 3.4.1 How to Start up and Use Memory Exposure Mode HINT Press and hold the memory exposure mode VWDUWEXWWRQDQGWKHVOHHSUHOHDVHPHPRU\ exposure mode start button at the same time for 2 seconds. Memory exposure mode status Sleep release/ memory exposure mode start button When the memory exposure mode is started up, the ĂDWSDQHOVHQVRUHQWHUV;UD\GHWHFWLRQPRGH For details on X-ray detection mode, see âZ.5 Precautions for the Automatic X-ray Detection Functionâ. 2 Status lamp :KHQWKH5($'<ODPSDPRQJWKHVWDWXV ODPSVLVDXWRPDWLFDOO\OLWLQJUHHQPDNHDQ exposure. Basic Operation READY Memory exposure mode start button :KHQWKHQXPEHURILPDJHVVWRUHGRQWKHĂDWSDQHO sensor is displayed in the memory exposure mode status, the start-up process is completed. 3 0DNHVXUHWKDWWKHQXPEHURILPDJHV displayed in the memory exposure mode status has increased. HINT Before the start-up process is completed, calibration RIWKHĂDWSDQHOVHQVRUPD\EHSHUIRUPHG During calibration, â888â blinks in the memory exposure mode status. When the READY lamp among the status lamps is automatically lit in green, the next exposure can be made. HINT When calibration is completed, the number of LPDJHVVWRUHGRQWKHĂDWSDQHOVHQVRULVGLVSOD\HG The value displayed as the number of images is used for managing the images. For example, when â3â is displayed before an exposure and then â4â is displayed after the exposure, the number of the exposed image is â4â. CAUTIONS When the memory exposure mode is started XSZKLOHWKHĂDWSDQHOVHQVRULVLQXVH DPHVVDJHLVGLVSOD\HGRQWKHVFUHHQRI WKHLPDJHSURFHVVLQJXQLWLQGLFDWLQJWKDW communication is disconnected. Since this is QRWDQHUURUVHOHFWÂł2.´WRFRQWLQXHRSHUDWLRQ +RZHYHULIWKHIROORZLQJHUURUFRGHVDUH GLVSOD\HGWDNHDSSURSULDWHPHDVXUHV DFFRUGLQJWRWKHLQVWUXFWLRQVGLVSOD\HGRQWKH VFUHHQ;;; HUURUFRGHVEHJLQQLQJZLWK ³´ RU 3-20 FDR D-EVO II Operation Manual 897N120339A CAUTIONS Ć 1 RWHWKDWZKHQWKHĂDWSDQHOVHQVRULV used in the memory exposure mode, if a VWURQJLPSDFWLVDSSOLHGWRWKHĂDWSDQHO VHQVRUDZKLWHLPDJHPD\EHREWDLQHG LQFUHPHQWLQJWKHQXPEHURILPDJHV Ć 0 DQDJHWKHUHFRUGVRIH[SRVHGLPDJHVWR identify the correspondence between the LPDJHQXPEHUDQGWKHSDWLHQWQDPH +RZWR/RDG,PDJHV 1 &RQQHFWLQVHUWWKHĂDWSDQHOVHQVRUWRLQWR each device. :KHQFDOLEUDWLRQRIWKHĂDWSDQHOVHQVRULVLQ progress, an error may occur. If this happens, wait for a while and then try image loading again. (When the DR-ID 1200PU is used) &RQQHFWWKHĂDWSDQHOVHQVRUWRWKHSRZHUVXSSO\ unit using the SE cable. Flat panel sensor 3 'LVSOD\WKHÂł6WXG\VFUHHQ´RIWKHSDWLHQW FRUUHVSRQGLQJWRWKHORDGHGLPDJHVDQG VHOHFWWKHH[SRVXUHPHQXWREHOLQNHGZLWK WKHLPDJHV 4 6HOHFWWKHVHOHFWRURIWKHĂDWSDQHOVHQVRU LQZKLFKWKHLPDJHLVVWRUHGDQGWKHQVHOHFW >,PDJH%R[@ Power supply unit 5 2QWKHÂł,PDJH/LEUDU\VFUHHQ´VHOHFWWKH LPDJHRIZKLFKWKHQXPEHULVWREHOLQNHG with the exposure menu and then select [Import]. Basic Operation (When the DR-ID 1200DU is used) ,QVHUWWKHĂDWSDQHOVHQVRULQWRWKHGRFNLQJVWDQG )RUGHWDLOVRQKRZWRLQVHUWWKHĂDWSDQHOVHQVRU into the docking stand, see â3.1.10 Attaching the Flat Panel Sensor to the Docking Standâ on Page 3-8. 2 7RORDGLPDJHVVWRUHGRQWKHĂDWSDQHO VHQVRULQWRWKHLPDJHSURFHVVLQJXQLW GLVSOD\WKHÂł,PDJH5HDGHU6WDWXVZLQGRZ´ RQWKHLPDJHSURFHVVLQJXQLWVHOHFWWKHĂDW SDQHOVHQVRUDQGWKHQÂł*HW,PDJH )3'Ă &6/ ´ HINT When an image that has not been linked with an exposure menu is left, if images are acquired from WKHĂDWSDQHOVHQVRUWKHDFTXLVLWLRQGDWHDQGWLPH is added to the image No. of the image that was acquired previously. For details, see the âConsole Advance (DR-ID 300CL) Reference Guideâ. ,PDJHVVWRUHGLQWKHĂDWSDQHOVHQVRUDUHORDGHG onto the image processing unit. FDR D-EVO II Operation Manual 897N120339A 3-21 3.4.3 List of Error Codes If an error occurs while starting up or using the memory exposure mode, the corresponding error code is displayed in the memory exposure mode status. Terminate the memory exposure mode and then perform the countermeasure against each error. Error codes are listed in the table below. Error code Occurrence condition E01 Countermeasure Basic Operation &DOLEUDWLRQRIWKHĂDWSDQHOVHQVRULV in progress. Wait for a while and then start up the memory exposure mode again. An exposure menu is registered on the image processing unit. Terminate or suspend the study on the image processing unit. The SE cable or SE communication FDEOHLVFRQQHFWHGWRWKHĂDWSDQHO sensor. Disconnect the SE cable or SE communication FDEOHIURPWKHĂDWSDQHOVHQVRU 7KHĂDWSDQHOVHQVRULVLQVHUWHGLQWR the docking stand. 5HPRYHWKHĂDWSDQHOVHQVRUIURPWKHGRFNLQJ stand. E03 An X-ray is irradiated when exposure is not available. &RQQHFWWKHĂDWSDQHOVHQVRUWRWKHLPDJH processing unit or remove and attach the battery pack and then restart the memory exposure mode. E04 7KHĂDWSDQHOVHQVRUGHWHFWVDQ impact. &RQQHFWWKHĂDWSDQHOVHQVRUWRWKHLPDJH processing unit. E05 The remaining capacity of the battery pack is low. Replace the battery pack. E06, E07, E17, E18 7KHWHPSHUDWXUHRIWKHĂDWSDQHO sensor or battery back is abnormal. Check if the operating temperature is within WKHWHPSHUDWXUHUDQJHVSHFLÂżHGLQWKH environmental operating conditions. E08, E09, E11 to E14, E16, E19 $QDEQRUPDOLW\RFFXUUHGRQWKHĂDW panel sensor. &RQVXOWRXURIÂżFLDOGHDOHURUORFDO representative. E10 Calibration has failed. Restart the memory exposure mode. E15 Image storage has failed. &RQVXOWRXURIÂżFLDOGHDOHURUORFDO representative. ,IWKHVDPHHUURURFFXUVUHSHDWHGO\FRQVXOWRXURIÂżFLDOGHDOHURUORFDOUHSUHVHQWDWLYH 3.4.4 How to Terminate Memory Exposure Mode (DR-ID 1200PU) 5HPRYHWKHEDWWHU\SDFNIURPWKHĂDWSDQHOVHQVRU 2UFRQQHFWWKHĂDWSDQHOVHQVRUWRWKHSRZHUVXSSO\XQLWRUWRWKHRSWLRQDODFFHVVSRLQWE\XVLQJ the SE cable or SE communication cable. (DR-ID 1200DU) 5HPRYHWKHEDWWHU\SDFNIURPWKHĂDWSDQHOVHQVRU 2ULQVHUWWKHĂDWSDQHOVHQVRULQWRWKHGRFNLQJVWDQG HINT ,PDJHVH[SRVHGLQWKHPHPRU\H[SRVXUHPRGHDUHQRWORVWHYHQLIWKHEDWWHU\SDFNLVUHPRYHGIURPWKHĂDWSDQHO sensor. 3-22 FDR D-EVO II Operation Manual 897N120339A Chapter 4 7URXEOHVKRRWLQJ 4.1 :KHQD0HVVDJH$SSHDUVRQWKH,PDJH 3URFHVVLQJ8QLW This section describes the warning dialog box and error messages. ,IDQHUURUZKLFKFDQQRWEHKDQGOHGRUWKHVDPHHUURUUHFXUVIUHTXHQWO\FRQWDFWRXURIÂżFLDOGHDOHURU FUJIFILM Representative. ,IDQHUURURIXQNQRZQFDXVHRFFXUVGRQRWFRQWLQXHWKHRSHUDWLRQDQGFRQWDFWRXURIÂżFLDOGHDOHURU FUJIFILM Representative. >@,IDZDUQLQJGLDORJER[DSSHDUV If a communication error or an unexpected error has occurred, a warning dialog box pops up on the screen. In such a case, after checking error details and closing the box, take appropriate action immediately. Be sure not to continue the operation of the image processing unit without taking an appropriate action. If any operation is performed while a warning dialog box is displayed, another screen may be displayed, hiding the dialog box behind. In this case, press the [Enter] key to close the hidden box. When a warning dialog box that contains an error code beginning with â10â appears, follow the steps below. 5HDGDPHVVDJHLQWKHZDUQLQJGLDORJER[DQGWKHQFOLFN>2.@LQWKHGLDORJER[ 2 'HWDFKWKHEDWWHU\SDFNVIRUDOOĂDWSDQHOVHQVRUV 3 &RQÂżUPWKDWWKHĂDWSDQHOVHQVRUVDUHWXUQHGRII 4 5HDWWDFKWKHEDWWHU\SDFNVWRWKHĂDWSDQHOVHQVRUV7KHQWKHV\VWHPUHVWDUWV Troubleshooting 1 >@,IWKHPHVVDJHGLDORJXHER[0'DSSHDUV The following message dialogue box appears not only when the image processing unit starts up but DOVRZKHQDFRPPXQLFDWLRQHUURURFFXUVLQWKHĂDWSDQHOVHQVRURULPDJHSURFHVVLQJXQLW &KHFNLIWKHĂDWSDQHOVHQVRULVZLWKLQWKHUHDFKRIUDGLRZDYHV,IWKHXQLWLVRXWRIWKHUDQJHPRYH WKHLPDJHSURFHVVLQJXQLWDQGWKHĂDWSDQHOVHQVRUFORVHUWRHDFKRWKHU ,QDGGLWLRQFRQÂżUPWKDWWKHUHDUHQRREVWDFOHVZKLFKDUHLQWHUUXSWLQJWKHFRPPXQLFDWLRQ When the problem is not solved within a short time after the message box is displayed, perform the following procedure. FDR D-EVO II Operation Manual 897N120339A 4-1 KHQ DFTXLULQJ GDWD LV LQWHUUXSWHG WKH LPDJH GDWD LV PDLQWDLQHG LQ WKH ĂDW SDQHO VHQVRU LI UHFRQQHFWLRQ LV VXFFHVVIXOO\PDGHRUXQWLOSRZHUVXSSO\RIĂDWSDQHOVHQVRULVWXUQHGRIIVRLPDJHGDWDZLOOQRWEHORVW ,QWKHFDVHRIWKHPHPRU\H[SRVXUHPRGHLPDJHVVWRUHGLQWKHĂDWSDQHOVHQVRUDUHQRWORVWHYHQLIWKHĂDWSDQHO sensor is turned off. 1 6HOHFW>2.@RQWKHPHVVDJHER[ 2 &KHFNLIWKHHTXLSPHQWFRQQHFWHGZLWKWKHLPDJHSURFHVVLQJXQLWLVWXUQHGRQ If any equipment is turned off, turn it on and wait for a while. 3 ,IWKHSUREOHPLVQRWVROYHGVKXWGRZQWKHLPDJHSURFHVVLQJXQLW 4 0DNHVXUHWKDWWKHSRZHUVWDWXV/('RIWKHFRQWUROFDELQHWLVRIIDQGWKHQUHVWDUWWKHLPDJH SURFHVVLQJXQLW This step is not required if the control cabinet is not included in the system. If the power status LED of the control cabinet does not turn off even after approximately 10 minutes have passed following the shutdown of the image processing unit, press and hold the main switch of the control cabinet. 7URXEOHVKRRWLQJ KHQWKHLPDJHSURFHVVLQJXQLWLVUHVWDUWHGDQGWKHVDPHHUURUPHVVDJHER[LVGLVSOD\HGFRQWDFWRXURIÂżFLDO dealer or FUJIFILM Representative. >@,IDQH[SRVHGLPDJHFDQQRWEHDFTXLUHG 'RQRWUHPRYHWKHEDWWHU\SDFNIURPWKHĂDWSDQHOVHQVRUXQWLODQH[SRVHGLPDJHLVDFTXLUHG,IUHPRYHGWKH image data and the exposure menu data used for the exposure will be lost. If an exposed image cannot be acquired, the following error message may be displayed. 1 ,IZLUHOHVVFRPPXQLFDWLRQLVGLVFRQQHFWHGGXULQJLPDJHUHDGLQJWKHIROORZLQJPHVVDJHGLDORJ is displayed. 0RYH WKH ĂDW SDQHO VHQVRU FORVH WR WKH DFFHVV SRLQW FKHFN WKH GLVSOD\HG LFRQ ( ) to make sure that proper wireless communication is established, and then select âYesâ. If the status is QRWLPSURYHGFRQQHFWWKHĂDWSDQHOVHQVRUDQGWKHDFFHVVSRLQWXVLQJWKH6(FRPPXQLFDWLRQFDEOH and then select âYesâ. If you select âNoâ, the image data and the exposure menu data used for the exposure will be lost. 4-2 FDR D-EVO II Operation Manual 897N120339A 2 If an exposure is made under a condition where wireless communication is unstable, the IROORZLQJPHVVDJHGLDORJPD\EHGLVSOD\HG6HOHFWÂł2.´WRDFTXLUHWKHLPDJHDQGWKHQFKHFN WKHDFTXLUHGLPDJH >@,IWKHGLDORJER[FRQWDLQLQJWKHHUURUPHVVDJHQXPEHUHG 13048 appears 7KHGLDORJXHER[DSSHDUVZKHQDVHYHUHVKRFNLVDSSOLHGWRWKHĂDWSDQHOVHQVRU0DNHVXUHWKDW WKHH[WHULRURIWKHĂDWSDQHOVHQVRULVQRWGDPDJHGRUGHIRUPHGDQGWKDWQRDEQRUPDOLW\LVIRXQGLQ the exposed image. Troubleshooting [5] ,IÂł8QXVDEOHGXHWRHUURU´DSSHDUVRQWKHLPDJHSURFHVVLQJXQLW Connected devices status FDR D-EVO II Operation Manual 897N120339A 4-3 If âUnusable due to error.â is displayed on the image processing unit, remove the battery pack from WKHĂDWSDQHOVHQVRUDQGLQVWDOOLWDJDLQ Guide marks Battery pack >@,IDQ\RWKHUPHVVDJHGLDORJXHER[DSSHDUV If a message dialogue box other than those [1] â [5] appears on the image processing unit monitor, read the message carefully and take appropriate action. Troubleshooting 4-4 FDR D-EVO II Operation Manual 897N120339A 4.2 How to Cope with an Error... >@:KHQWKHLPDJHSURFHVVLQJXQLWKDQJVXSÂŤ If an inappropriate processing is performed while this equipment is operating, the screen may freeze and the system may hang up (processing disabled). In that case, shut down the equipment forcibly according to the following procedure, and then restart it. 1 3UHVVWKH>&WUO@>$OW@>'HO@NH\VVLPXOWDQHRXVO\ 2 Âł:LQGRZV6HFXULW\´LVGLVSOD\HG Select [Start Task Manager]. 3 Âł:LQGRZV7DVN0DQDJHU´LVGLVSOD\HG Select âProcessManagerMain.exeâ in the list in the âProcessesâ tab, and then click [End Process]. 4 7KHPHVVDJHER[LVGLVSOD\HG Click [End Process] to terminate the image processing unit. Depending on equipment status, an error message may not be displayed. Troubleshooting 5 7KHGHVNWRSVFUHHQRIWKHRSHUDWLQJV\VWHPLVGLVSOD\HG Close the âWindows Task Manager windowâ, and then select the [Start] button at the lower left of the screen. Select [Restart] from the displayed menu. CAUTIONS Ć 0DNHVXUHWRVKXWGRZQWKHV\VWHPIROORZLQJWKHDERYHSURFHGXUHVLQFDVHRIDKDQJXSRI WKHLPDJHSURFHVVLQJXQLW,IWKHSHUVRQDOFRPSXWHULVWXUQHGRIIZLWKRXWVKXWGRZQDQHUURU may occur on the computer. Ć 1RWHWKDWIRUFLEOHVKXWGRZQSURFHVVLQJRIWKHHTXLSPHQWLVDQHPHUJHQF\DFWLRQ'RQRWXVH this action under normal situations. If the control cabinet is included in the system, press and hold the main switch of the control cabinet to turn it off. 7 7XUQRIIWKHPDLQVZLWFKRQWKHSRZHUVXSSO\XQLWDQGRQWKHGRFNLQJVWDQG >@:KHQWKHLPDJHSURFHVVLQJXQLWLVWXUQHGRIIGXHWRDQ HOHFWULFDORXWDJH When the image processing unit is turned off due to an electrical outage, etc., take the following actions according the condition when the power comes back on. Ĺś ,IWKHSRZHUFRPHVEDFNRQVRRQDIWHUDQHOHFWULFDORXWDJH Wait until the image processing unit restarts. When the image processing unit has restarted, shut down the image processing unit by following the normal procedure. For details of system shutdown, see the âDR-ID 300CL Operation Manualâ. To restart the image processing unit, follow the procedure for the system startup. FDR D-EVO II Operation Manual 897N120339A 4-5 >@,IDKDUGGLVNRIWKHLPDJHSURFHVVLQJXQLWLVGDPDJHG If one of the hard disks is damaged, a window indicating so will appear. In such a case, press the )NH\DQGFRQWDFWRXURIÂżFLDOGHDOHU >@,IDZKLWHLPDJHLVGLVSOD\HGDIWHUDQH[SRVXUH If a white image is displayed, a LAN communication error may have occurred. &KHFNLIWKH/$1FRPPXQLFDWLRQFRQQHFWRUVDUHSURSHUO\FRQQHFWHGEHWZHHQWKHĂDWSDQHOVHQVRU and the power supply unit or and between the power supply unit and the control cabinet. Make an H[SRVXUHDJDLQDIWHUFRQÂżUPDWLRQ [5] Precautions for operation when the device status is Âł,QLWLDOL]LQJ´RUÂł&KDQJLQJ)3'´LQWKHLPDJHSURFHVVLQJ XQLWÂśVÂł2XWSXW'HYLFH6WDWXVZLQGRZ´ :KHQDĂDWSDQHOVHQVRULVDGGHGRUUHSODFHGRUZKHQWKHEDWWHU\RIDĂDWSDQHOVHQVRULVUHSODFHG Âł,QLWLDOL]LQJ´RUÂł&KDQJLQJ)3'´LVGLVSOD\HGIRUDOOWKHĂDWSDQHOVHQVRUVLQWKHGHYLFHVWDWXVÂżHOGRI the image processing unitâs âOutput Device Status windowâ. While either of the status messages is displayed, you cannot make an exposure. Wait until the message disappears. :KHQWKHĂDWSDQHOVHQVRULVWXUQHGRQE\FRQQHFWLQJWKHFDEOHIRUZLUHGFRPPXQLFDWLRQRUE\ attaching the battery pack immediately after the system starts up or an X-ray exposure is made, it may take time before the next exposure becomes available. Troubleshooting (YHQLIÂł,QLWLDOL]LQJ´RUÂł&KDQJLQJ)3'´LVGLVSOD\HGIRUDOOWKHĂDWSDQHOVHQVRUVRQO\WKRVHZKLFKDUHDGGHGRU replaced or those whose battery is replaced will be initialized. >@,IWKHĂDWSDQHOVHQVRUFDQQRWEHXVHGLQZLUHOHVV communication mode ,IWKHĂDWSDQHOVHQVRULVQRWUHFRJQL]HGLQDZLUHOHVVFRPPXQLFDWLRQPRGHXVHWKHFDEOHWR connect the system in wired communication mode. 4-6 FDR D-EVO II Operation Manual 897N120339A [7] If an error occurs on an output destination device If an error occurs on an output destination device, In such a case, operate as follows. Select is displayed in the connected devices status. The âOutput Device Status windowâ is displayed. Select after checking the connection status, and then take an appropriate action. 7URXEOHVKRRWLQJ âOutput Device Status windowâ FDR D-EVO II Operation Manual 897N120339A 4-7 4 Troubleshooting 4-8 FDR D-EVO II Operation Manual 897N120339A Chapter 5 Daily Inspection and Maintenance 5.1 Daily User Inspection and Maintenance During maintenance and inspection, strictly observe precautions contained in âChapter 1 For Safe Operationâ in this manual for you to use the FDR D-EVO II under best conditions. 5.1.1 Daily Inspection (DR-ID 1200) Inspection Before Use ⢠Make sure that the equipment starts up normally. ⢠Make sure that the equipment communicates with connected devices normally. ⢠Make sure that the time displayed is correct. See â3.2 Starting Up and Shutting Down the Systemâ (page 3-9). ,QVSHFWLRQ'XULQJ8VH ⢠Make sure that images are output normally. See â3.3 Routine Operationsâ (page 3-13). Daily Inspection and Maintenance Inspection After Use ⢠Shut down the equipment. See â3.2 Starting Up and Shutting Down the Systemâ (page 3-9). &OHDQLQJLQVWUXFWLRQV Use a neutral detergent or ethanol to clean the outer surfaces. CAUTIONS Ć Do not use a solvent such as thinner or benzine, as it corrodes the outer surfaces. Ć 0DNHVXUHQRWWROHWZDWHUGHWHUJHQWDQGHWKDQROJHWLQVLGHWKHHTXLSPHQW FDR D-EVO II Operation Manual 897N120339A 5-1 5.1.2 Periodical Inspection Inspection Every Three Months Once every three months, remove any dirt or dust accumulated in each part of the equipment using a vacuum cleaner or air duster, clean each part with a slightly moistened soft cloth and then wipe off any moisture with a dry cloth. See â2.2 Unit Names and the Functionsâ (page 2-4). CAUTIONS %HVXUHWRWXUQRIIWKHSRZHUEHIRUHFOHDQLQJHDFKSDUWRIWKHGHYLFH Ĺś DR-ID 1200 DR-ID 1200 NO. Unit NO. Flat panel sensor Unit NO. Power supply unit Unit Power supply unit $LUÂżOWHU NO. $LUÂżOWHU &OHDQWKHDLUÂżOWHURQWKHUHDURIWKHSRZHU supply unit with a vacuum cleaner. Remove the louver while pressing the lever RQWKHULJKWVLGHDQGWKHQFOHDQWKHDLUÂżOWHU with a vacuum cleaner after detaching it from the louver. Daily Inspection and Maintenance Unit NO. Control cabinet Unit Periphery of devices Optional NO. Unit NO. Battery charger Unit Battery pack NO. Unit Access Point CAUTIONS Ć (QVXUHVXIÂżFLHQWVSDFHZKHQFOHDQLQJWKHHTXLSPHQWRQDWDEOHHWF Ć ,IWKHLPDJHSURFHVVLQJXQLWLVVHFXUHGLQSODFHXQORFNLWEHIRUHFOHDQLQJ 5-2 FDR D-EVO II Operation Manual 897N120339A Image processing unit Air filter DR-ID 1200MC NO. Unit Appendix A Specifications A.1 Specifications 6SHFLÂżFDWLRQVRIWKH)'5D-EVO II are shown below. $ 3URFHVVLQJ&DSDFLW\ '5,' Ĺś 5RXWLQHSURFHVVLQJ ZKHQWKHWZRLPDJHRXWSXWIRUPDWLVXVHGLQ standard mode) (1) Exposure interval The exposure interval of the FDR D-EVO II is at least 9 seconds. However, the interval varies depending on the region, the load to network communication, etc. $ ,PDJH2XWSXW '5,' Ĺś 6WDQGDUGSURFHVVLQJ (1) Film output Connection to the Imager makes it possible to obtain hard copies at the image reduction ratios and in the formats below. Ć)RUVWDQGDUGSL[HOGHQVLW\LPDJHV '5,'6(DQG'5,'6( Output size 2QHLPDJHRXWSXW 61% 61% 85% 100% 100% 100% 100% 100% 100% 100% Appendix A Specifications 14â Ă 17â (35 Ă 43cm) 14â Ă 14â (35 Ă 35cm) 10â Ă12â 8â Ă 10â 18 Ă 43cm Reduction ratio 7ZRLPDJHRXWSXW Ć)RUVWDQGDUGSL[HOGHQVLW\LPDJHV '5,'6(DQG'5,'6( Output size 17â Ă 17â (43 Ă 43cm) 14â Ă 17â (35 Ă 43cm) 14â Ă 14â (35 Ă 35cm) 10â Ă 12â 8â Ă 10â 18 Ă 43cm Reduction ratio 7ZRLPDJHRXWSXW 2QHLPDJHRXWSXW 50% 61% 61% 85% 100% 100% 82% 100% 100% 100% 100% 100% FDR D-EVO II Operation Manual 897N120339A A-1 [Fig. A.1] (a) 14â Ă 17â one-image output (b) 17â Ă 14â one-image output (c) 14â Ă 14â one-image output ID information ID information Image Image Image (14â Ă 17â film) ID information (14â Ă 17â film) (14â Ă 17â film) (d) 18 Ă 43cm one-image output (e) 18 Ă 43cm two-image output ID information Image Image Image (f) 18 Ă 43cm two-image output ID information Image Image ID information (14â Ă 17â film) (26 Ă 36cm film) ID information (26 Ă 36cm film) (g) Two-image output Image ID information (26 Ă 36cm film) For one-image output using 17â Ă 14â, 14â Ă 17â, 14â Ă 14â or 18 Ă 43cm, images are output on 14â δ¿OP,QRWKHUFDVHVLPDJHVDUHRXWSXWRQĂŽFPÂżOP Appendix A Specifications Depending on the printer connected or image processing unit software version used, image outputs in the following formats are available. ÂVL]HRXWSXWRI´Î´LPDJHRQ´Î´¿OP ÂVL]HRXWSXWRI´Î´LPDJHRQ´Î´¿OPDVZHOODVUHGXFHGLPDJHRXWSXWRQÂżOPVRIRWKHUVL]HV ÂVL]HRXWSXWRI´Î´LPDJHRQ´Î´¿OP $ 5HGXFHG(TXLYDOHQW 3HDNUHGXFHGHTXLYDOHQWRQWKHIURQWSDQHORIWKHĂDWSDQHOVHQVRUPP$O A-2 FDR D-EVO II Operation Manual 897N120339A A.1.4 Power Supply Conditions Ĺś DR-ID 1200PU 5DWHGYROWDJH9a ,QSXWFXUUHQW $ )UHTXHQF\ +] Ĺś DR-ID 1200DU 5DWHGYROWDJH9a ,QSXWFXUUHQW $ )UHTXHQF\ +] Ĺś DR-ID 1200MC* 5DWHGYROWDJH9a ,QSXWFXUUHQW $ )UHTXHQF\ +] * Since the DR-ID 1200MC is general-purpose electrical equipment, the electric rating above is an example. A.1.5 Environmental Conditions Ĺś DR-ID 1200PU 2SHUDWLQJ&RQGLWLRQV 7HPSHUDWXUH Â& 5+ Â& 5+ +XPLGLW\ 5+ Â& 5+ Â& QRGHZFRQGHQVDWLRQ $WPRVSKHULFSUHVVXUHK3DK3D 1RQRSHUDWLQJ&RQGLWLRQV (Environmental conditions under which power can be supplied) 7HPSHUDWXUH Â&Â& +XPLGLW\ 5+5+ QRGHZFRQGHQVDWLRQ $WPRVSKHULFSUHVVXUHK3DK3D Appendix A Specifications 6WRUDJH&RQGLWLRQV 7HPSHUDWXUH Â&Â& +XPLGLW\ 5+5+ QRGHZFRQGHQVDWLRQ $WPRVSKHULFSUHVVXUHK3DK3D Ĺś DR-ID 1200DU 2SHUDWLQJ&RQGLWLRQV 7HPSHUDWXUH Â& 5+ Â& 5+ +XPLGLW\ 5+ Â& 5+ Â& QRGHZFRQGHQVDWLRQ $WPRVSKHULFSUHVVXUHK3DK3D 1RQRSHUDWLQJ&RQGLWLRQV (Environmental conditions under which power can be supplied) 7HPSHUDWXUH Â&Â& +XPLGLW\ 5+5+ QRGHZFRQGHQVDWLRQ $WPRVSKHULFSUHVVXUHK3DK3D 6WRUDJH&RQGLWLRQV 7HPSHUDWXUH Â&Â& +XPLGLW\ 5+5+ QRGHZFRQGHQVDWLRQ $WPRVSKHULFSUHVVXUHK3DK3D FDR D-EVO II Operation Manual 897N120339A A-3 CAUTIONS Ć : KHQWKHĂDWSDQHOVHQVRULVXVHGLQKLJKWHPSHUDWXUHFRQGLWLRQIRUORQJSHULRGRIWLPHLW PD\FDXVHLPDJHDUWLIDFWVDQGRUIDLOXUHRIWKHGHYLFH Ć : KHQXVLQJWKH'5,'6(RU'5,'6(LIWKHWHPSHUDWXUHLVÂ&DQGWKHKXPLGLW\ LV5+ QRGHZFRQGHQVDWLRQ FRQWLQXRXVXVHRIPLQXWHVRUOHVVLVSRVVLEOH 8 VLQJ0DQXDO0RGH HQHUJ\VDYLQJPRGH IURPWKHLPDJHSURFHVVLQJXQLWZKHQWKH temperature and humidity are the same allows up to 1 hour of continuous use. Ĺś DR-ID 1200MC 2SHUDWLQJ&RQGLWLRQV 7HPSHUDWXUH Â&Â& +XPLGLW\ 5+5+ QRGHZFRQGHQVDWLRQ $WPRVSKHULFSUHVVXUHK3DK3D 1RQRSHUDWLQJ&RQGLWLRQV (Environmental conditions under which power can be supplied) 7HPSHUDWXUH Â&Â& +XPLGLW\ 5+5+ QRGHZFRQGHQVDWLRQ $WPRVSKHULFSUHVVXUHK3DK3D For details on the power supply conditions and environmental conditions of the image processing unit, see the âConsole Advance (DR-ID 300CL) Operation Manualâ. Ĺś %DWWHU\FKDUJHU RSWLRQDO 2SHUDWLQJ&RQGLWLRQV 7HPSHUDWXUH Â&Â& +XPLGLW\ 5+5+ QRGHZFRQGHQVDWLRQ Appendix A Specifications 1RQRSHUDWLQJ&RQGLWLRQV (Environmental conditions under which power can be supplied) 7HPSHUDWXUH Â&Â& +XPLGLW\ 5+5+ QRGHZFRQGHQVDWLRQ CAUTIONS &KDUJHWKHEDWWHU\SDFNLQWKHRSHUDWLQJHQYLURQPHQW A-4 FDR D-EVO II Operation Manual 897N120339A $ ([WHUQDO9LHZDQG:HLJKW The external view and weight of the FDR D-EVO II are shown below. 6SHFLÂżFDWLRQVGLPHQVLRQVDQGZHLJKWDUHVXEMHFWWRFKDQJHIRULPSURYHPHQWZLWKRXWSULRUQRWLFH A.2.1 DR-ID 1200 Ĺś '5,'38'5,''8 Width (mm(in.)) Depth (mm(in.)) +HLJKW (mm(in.)) :HLJKW NJ OE Flat panel sensor (DR-ID 1201SE) 460(18.1) 384(15.1) 15(0.6) 2.6(5.8)*1 Flat panel sensor (DR-ID 1202SE) 460(18.1) 460(18.1) 15(0.6) 3.2(7.1)*1 Flat panel sensor (DR-ID 1211SE) 460(18.1) 384(15.1) 15(0.6) 2.6(5.8)*1 Flat panel sensor (DR-ID 1212SE) 460(18.1) 460(18.1) 15(0.6) 3.2(7.1)*1 Power supply unit 120(4.7) 388(15.3)*2 361(14.2) 8.7(19.2) Docking stand 579(22.8) 93(3.7) 202(8.0) 5.5(12.1) *1 The weight of the battery pack is included. *2 Protrusions are excluded 8QLWPP LQ 459.9(18.1) 15(0.6) 459.9(18.1) Flat panel sensor (DR-ID 1201SE) Flat panel sensor (DR-ID 1202SE) 459.9(18.1) 15.5(0.6) 459.9(18.1) 15(0.6) 384(15.1) 460(18.1) Flat panel sensor (DR-ID 1211SE) Appendix A Specifications 384(15.1) 460(18.1) 15.5(0.6) Flat panel sensor (DR-ID 1212SE) FDR D-EVO II Operation Manual 897N120339A A-5 8QLWPP LQ 8QLWPP LQ 120(4.7) 388(15.3) 93(3.7) 206.1(8.1) 361(14.2) 581(22.9) Power supply unit Docking stand 16.75 (0.66) Appendix A Specifications A-6 Effective area DR-ID 1201SE/DR-ID 1211SE FDR D-EVO II Operation Manual 897N120339A 17.55 (0.69) 17.25 (0.68) 17.25 (0.68) 425.4(16.7) 17.25 (0.68) Effective area 424.8(16.7) 425.4(16.7) 17.55 (0.69) 17.25 (0.68) 350.4(13.8) 16.75 (0.66) 7KHHIIHFWLYHDUHDRIWKHĂDWSDQHOVHQVRULVDVVKRZQLQWKHÂżJXUHEHORZ DR-ID 1202SE/DR-ID 1212SE Ĺś DR-ID 1200MC * Control cabinet Width (mm(in.)) Depth (mm(in.)) +HLJKW (mm(in.)) :HLJKW NJ OE 114(4.5) 353(13.9) 399(15.7) 8.3(18.3) * The exterior, external dimensions and weight are examples since this is a general-purpose electric device. 8QLWPP LQ 353(13.9) 399(15.7) 114(4.5) Control cabinet Ĺś %DWWHU\FKDUJHU RSWLRQDO Depth (mm(in.)) +HLJKW (mm(in.)) :HLJKW NJ OE Battery charger 92.5(3.6) 259(10.2) 56(2.2) 0.6(1.3) AC adapter 153(6.0) 67(2.6) 35(1.4) Approx.0.51(1.1) Appendix A Specifications Width (mm(in.)) 8QLWPP LQ 67(2.6) 35(1.4) 153(6.0) AC adapter 259(10.2) 56(2.2) 92.5 (3.6) Battery charger FDR D-EVO II Operation Manual 897N120339A A-7 Ĺś Access point (optional) Access point Width (mm(in.)) Depth (mm(in.)) +HLJKW (mm(in.)) :HLJKW NJ OE 39(1.5) 95(3.7) 27(1.1) Less than approx. 0.1(0.2) 8QLWPP LQ 27(1.1) 39(1.5) 95(3.7) Access point Appendix A Specifications A-8 FDR D-EVO II Operation Manual 897N120339A A.3 Characteristics (1) Sensitometoric Response Characteristics and Dynamic Range FDR D-EVO II has a linear response against the exposure range where it can depict the clinical information. 7KHĂDWSDQHOVHQVRUFRYHUVDG\QDPLFUDQJHRIČ*\DWOHDVWDW54$ (2) Spatial Resolution Properties A typical MTF value of DR-ID 1201SE/DR-ID 1202SE at 1cyc/mm, RQA5 is 0.75 (high sharpness mode) and 0.60 (standard sharpness mode). A typical MTF value of DR-ID 1211SE/DR-ID 1212SE at 1cyc/mm, RQA5 is 0.80. The level of uncertainty is estimated as less than Âą10% '4( 'HWHFWLYH4XDQWXP(IÂżFLHQF\ 7\SLFDO'4(YDOXHRI'5,'6('5,'6(DWČ*\LQF\FPPLV 7\SLFDO'4(YDOXHRI'5,'6('5,'6(DWČ*\LQF\FPPLV The level of uncertainty is estimated as less than Âą10% (4) Display To deliver the detector characteristics above, it is recommended to use a monitor with the following VSHFLÂżFDWLRQV Ć,PDJHPDWUL[VL]H0LQLPXP[SL[HOV '5,'6('5,'6( Ć,PDJHPDWUL[VL]H0LQLPXP[SL[HOV '5,'6('5,'6( Ć*UD\VFDOH0LQLPXPELW Ć',&20FDOLEUDWHG Appendix A Specifications (5) Image Quality Evaluation )XMLÂżOPW\SLFDOO\FRQGXFWVUHDGHUVWXGLHVWKDWFRPSDUHQHZ)'5'(92II detector models to chosen PDUNHWHGGHYLFHV7KHVHVWXGLHVLQYROYLQJDQDVVHVVPHQWRILPDJHTXDOLW\E\ERDUGFHUWLÂżHGUDGLRORJLVWV have demonstrated that the images acquired using the FDR D-EVO II detectors are deemed to be of diagnostic capability. Additionally, reader studies have concluded that, when used in conjunction with FUJIFILMâs recommended exposure conditions as a reference, both the GOS-based and Csl-based FDR D-EVO II detectors can provide acceptable diagnostic capability and image quality at reasonably low dose levels typically used for pediatric use. (6) Typical Patient Dose $VZLWKDQ\QHZSURGXFWDSSOLFDWLRQ)XMLÂżOPSURYLGHVDSSOLFDWLRQVWUDLQLQJVXSSRUWWRHDFKFXVWRPHU to establish the dose levels that meet the image quality standards of the medical facility. As part of this training, we provide both recommended technique charts as well as guidance for optimizing AEC conditions for each detector type. When using any FDR D-EVO II detector, typical patient dose levels should not H[FHHGWKDWRIVFUHHQÂżOPRU&RPSXWHG5DGLRJUDSK\ FDR D-EVO II Operation Manual 897N120339A A-9 Appendix A Specifications A-10 FDR D-EVO II Operation Manual 897N120339A Appendix Z Precautions for Exposure Z.1 Precautions for Exposure in AUTO MODE In AUTO MODE, stable image output can be obtained by means of the following. 5DGLDWLRQÂżHOG (2) EDR image data analysis (3) Detailed depiction of the cervical region However, problems may arise due to differences in the multiple diaphragms or scattered rays of the ;UD\HTXLSPHQW)RUVXFKSUREOHPVFRQWDFWRXURIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYHDQGXVH other recording modes, such as SEMI-AUTO MODE or FIX MODE. Z.1.1 Radiation Field 1 'RQRWVHWWKHUDGLDWLRQÂżHOGH[WUHPHO\VPDOO%HVXUHWRVXEMHFWRQHWKLUGRUPRUHRIWKHOHQJWKRI each side of the bucky of the DR system to X-ray exposure. 2 0DNHVXUHWKDWQRQHRIWKHVLGHVRIWKHUDGLDWLRQÂżHOGRYHUODSZLWKWKHFRQWUDVWPHGLXP(UURUVZLOO result if they overlap. $YDLODEOHIRU(DFK$QDWRPLFDO5HJLRQ0HWKRG Plain Contrast Medium 7RPRJUDSK\ Head 1HFN â Chest 4 (1 for esophagus) â Abdomen 4 (1 for stomach and intestines) â Pelvis â Appendix Z Precautions for Exposure 3 Notes on PRIEF [PRIEF 4] Used, with some exceptions, for both plain and contrast medium exposure menus, from the head to the pelvis. The diaphragm shape will be any convex polygon, including rectangles, circles, ellipses, tracks, etc. [PRIEF 1] Used with esophagus, stomach and intestines contrast medium menus. FDR D-EVO II Operation Manual 897N120339A Z-1 = 'HSLFWLRQRIWKH&HUYLFDO5HJLRQ 1 7KHUDGLDWLRQÂżHOGPXVWQRWLQFOXGHWKHZKROHKHDG%HVXUHWRVHFXUHWUDQVSDUHQWSRUWLRQVRQERWK sides of the neck. 8VHWKHÂł+HDG´PHQXWRLQFOXGHWKHZKROHKHDGLQWKHUDGLDWLRQÂżHOG 2 )RUH[SRVXUHRIWKHSKDU\Q[RUODU\Q[EHVXUHWKDWWKHQHFNFRPHVWRWKHFHQWHURIWKHUDGLDWLRQÂżHOG so that the frontal and lateral orientations can be recognized appropriately. Image area Radiation field 3 In pharynx and/or larynx exposure, do not use lead characters in the oblique line section. Appendix Z Precautions for Exposure = 'HSLFWLRQRIWKH+,3-2,17$;/Âą0HQX 1 Make sure to position the region of interest within the slanted-line area shown below. Do not collimate further inside. 2 Positioning should be done so that the condyle and the femur run along the longer edge. (Do not position them against the shorter edge.) Condyle side 7/12 Femur side 1/12 1/4 Z-2 FDR D-EVO II Operation Manual 897N120339A 1/4 = ('5,PDJH'DWD$QDO\VLV 1 Image unevenness due to grid misalignment, X-ray beam misalignment, or shadow of clothes may cause EDR image data analysis problems resulting in unstable density on the image. 2 If the target includes such materials as gypsum, denture, etc., stable density may not be obtained, EHFDXVHVXFKPDWHULDOVPDNHLWGLIÂżFXOWWRDQDO\]H('5LPDJHGDWD In such cases, use FIX MODE. 3 The EDR performs processing for the image area trimmed by the DR system. :KHQXVLQJOHDGFKDUDFWHUVRUPHWDOVIRUPHDVXUHPHQWSODFHWKHPLQVLGHWKHUDGLDWLRQÂżHOGDQG then make an exposure. 4 Precautions when using AUTO MODE. Auto mode Precautions As this mode is available for extracting information on the skin, secure the positioning so that the direct X-rays are incident to an area other than the target. II No special precautions. III Be sure to use a Ba contrast medium. IV 1 Be sure to secure the positioning so that the X-rays are incident to the area directly outside the target. $VWKHUHDGLQJODWLWXGHLVÂż[HGLWLVQHFHVVDU\WRFRQWUROWKHWXEHYROWDJHDFFRUGLQJWRWKH thickness of the target, as usual. $VWKHUHDGLQJODWLWXGHLVÂż[HGLWLVQHFHVVDU\WRFRQWUROWKHWXEHYROWDJHDFFRUGLQJWRWKH thickness of the target, as usual. VI No special precautions. VII No special precautions. Appendix Z Precautions for Exposure FDR D-EVO II Operation Manual 897N120339A Z-3 Z.2 Precautions for Exposure in SEMIAUTO MODE These precautions are common to Semi I, II, III and III(**). 1 Position the portion you need to display often in the center areas (10cm Ă 10cm(3.9 in. Ă 3.9 in.) (Semi I), 7cm Ă 7cm(2.8 in. Ă 2.8 in.) (Semi II), 5cm Ă 5cm(2.0 in. Ă 2.0 in.) (Semi III)) of the images trimmed by the DR system. Position the portion you need to display often in each of the 5cm Ă 5cm(2.0 in. Ă 2.0 in.) center areas of the half-split images (both upper and lower halves and right and left halves) and quartersplit image trimmed by the DR system. 2 Never position anything other than the subject in the aforementioned areas. If anything other than the subject is positioned in such areas, the image density will become lower. ,QDGGLWLRQGRQRWSRVLWLRQDQ\PHWDOVRUDUWLÂżFLDOERQHVLQVXFKDUHDV7KHLPDJHGHQVLW\ZLOO become higher if such objects are positioned in these areas. 3 It is necessary to control tube voltage according to subject thickness, as usual. The following precautions should be observed for Semi IV. Appendix Z Precautions for Exposure Area Center Coordinate (x:y) cm(in.) Size (cm(in.)) (0(0), 0(0)) 10 Ă 10(3.9 Ă 3.9) (-5(-2.0), 7(2.8)) 6 Ă 6(2.4 Ă 2.4) (5(2.0), 7(2.8)) 6 Ă 6(2.4 Ă 2.4) (-5(-2.0), -7(-2.8)) 6 Ă 6(2.4 Ă 2.4) (5(2.0), -7(-2.8)) 6 Ă 6(2.4 Ă 2.4) 'RQRWSRVLWLRQWUDQVSDUHQWSRUWLRQV DUHDVRWKHUWKDQWKHVXEMHFW LQWKHDIRUHPHQWLRQHGÂżYH areas. (2) It is necessary to control tube voltage according to subject thickness, as usual. For details of the menus preset in SEMI-AUTO MODE, see the âDR-ID 300CL Operation Manualâ and âDR-ID 300CL Reference Guide (Image Processing Parameters)â. Z-4 FDR D-EVO II Operation Manual 897N120339A = 3UHFDXWLRQVIRU([SRVXUHLQ6(0,; MODE The user will select one of the nine areas of the image trimmed by the DR system, on which SEMIAUTO MODE applies. (See the illustration below.) The same precautions as for SEMI-AUTO MODE apply. 5cm Ă 5cm (2.0 in. Ă 2.0 in.) Appendix Z Precautions for Exposure FDR D-EVO II Operation Manual 897N120339A Z-5 = 3UHFDXWLRQVIRU([SRVXUHLQ),;02'( $VUHDGLQJFRQGLWLRQVDUHÂż[HGH[SRVXUHFRQGLWLRQVPXVWEHFRQWUROOHGLQWKHVDPHZD\DVIRU conventional X-ray exposure. The reading conditions (sensitivity and latitude) have been preset according to the relevant menu in FIX MODE. Select the exposure conditions which correspond to that menu accordingly. Appendix Z Precautions for Exposure Z-6 FDR D-EVO II Operation Manual 897N120339A = 3UHFDXWLRQVIRUWKH$XWRPDWLF;UD\ Detection Function = 3UHFDXWLRQVIRU0DNLQJDQ([SRVXUH 1 7KHĂDWSDQHOVHQVRUFDQQRWGHWHFW;UD\VDXWRPDWLFDOO\XQOHVV6KRW5HDG\ H[SRVXUHUHDG\VWDWXV LQGLFDWRU RQWKHLPDJHSURFHVVLQJXQLWWKH5($'<ODPSDPRQJWKHVWDWXVODPSVRQWKHĂDWSDQHO sensor, or the READY lamp on the docking stand is lit green. Even if the indicator is not lit green, radiation can be delivered but an image will not be output. Make sure that the indicator is lit green before making an exposure. 2 Check the tube current of the X-ray equipment in advance, and set exposure conditions based on the tube current by referring to the table below. If the conditions are not met, X-rays cannot be detected automatically and an image may not be acquired. Tube current Tube voltage Exposure time SID 5DGLDWLRQÂżHOG More than 40 mA Set the tube voltage according to the anatomical region and body thickness. More than 1 ms (*3) Set the SID according to the anatomical region. Do not limit the radiation ÂżHOGWRWKHERQHUHJLRQ (*1) only. More than 20 mA and less than 40 mA Set the tube voltage to more than 50 kV according to the anatomical region and body thickness. More than 10 mA and less than 20 mA Less than 10 mA Set the SID to 100 cm (39.4 in.) or less and do not OLPLWWKHUDGLDWLRQÂżHOGWRWKHERQHUHJLRQ RQO\ Alternatively, set the SID according to the anatomical region and include the directly exposed area (*2). 100 cm (39.4 in.) or less Include the directly exposed area (*2). The automatic X-ray detection function cannot be used. Appendix Z Precautions for Exposure :KHQPDNLQJDQH[SRVXUHIRUH[DPSOHIRUDÂżQJHURUNQHHVHWWKHUDGLDWLRQÂżHOGWRDWOHDVWFPĂŽFP LQĂŽLQ IRUWKHIRUPHUDQGDWOHDVWFPĂŽFP LQĂŽLQ IRUWKHODWWHUVRWKDWWKHÂżHOGLV not limited to the bone region only. 7KHDUHDVRIWKHĂDWSDQHOVHQVRUZKLFKDUHGLUHFWO\H[SRVHGWR;UD\VWKDWGRQRWSDVVWKURXJKWKH subject, must have a width of more than 3 cm (1.2 in.) from the subject. *3 Depending on the X-ray equipment, the actual exposure time may differ from the set time. Before use, PDNHVXUHWKDWWKHĂDWSDQHOVHQVRUFDQGHWHFW;UD\VDXWRPDWLFDOO\ 3 As illustrated below, if the subject whose thinnest part is at least 40 cm (15.7 in.) in thickness FRYHUVWKHHQWLUHVXUIDFHRIWKHĂDWSDQHOVHQVRULWFDQQRWGHWHFW;UD\VDXWRPDWLFDOO\DQGDQ image may not be acquired. In this case, make an exposure for the region including the directly exposed area or switch to the High Sensitivity Mode. While the high sensitivity mode is being set, a shock might cause a blank image. Figure of an exposure for the subject covering the entire surface of the flat panel sensor FDR D-EVO II Operation Manual 897N120339A Z-7 4 :KHQDQH[SRVXUHPHQXLVUHJLVWHUHGDQGWKHV\VWHPLVUHDG\IRUDQH[SRVXUHWKHĂDWSDQHO sensor enters X-ray detection mode. If an exposure is not made for a period of time while an H[SRVXUHPHQXLVUHJLVWHUHGWKHRSHUDWLQJWLPHRIWKHĂDWSDQHOVHQVRUÂśVEDWWHU\SDFNPD\EH reduced to half. In addition, the battery pack cannot be charged with an exposure menu registered, HYHQLIWKHĂDWSDQHOVHQVRUKDVDZLUHGFRQQHFWLRQ)RUWKHVHUHDVRQVGRQRWNHHSWKHV\VWHPRQ standby, unless you make an exposure. = 3UHFDXWLRQV5HODWHGWRWKH;UD\([SRVXUH7LPH :KHQGHOLYHULQJUDGLDWLRQGRQRWVHWWKHH[SRVXUHWLPHEH\RQGWKHPD[LPXPOLPLWVSHFLÂżHGIRUWKH ĂDWSDQHOVHQVRUDWWKHWLPHRILQVWDOODWLRQ2WKHUZLVHYHUWLFDODUWLIDFWVPD\DSSHDULQWKHLPDJH Appendix Z Precautions for Exposure Z-8 FDR D-EVO II Operation Manual 897N120339A Z.6 Precautions for Use in Wireless Communication Mode Care should be taken when the devices are used in wireless communication mode. Thoroughly read the following precautions in order to use the devices properly. Ĺś,FRQV'LVSOD\HGRQWKH,PDJH3URFHVVLQJ8QLW An icon indicating the status of wireless communication is displayed in the connected devices status at the lower right of the image processing unit display. Before an exposure is made, check the displayed icon to make sure that proper wireless communication is established. ([SRVXUHXQLWGLVSOD\ÂżHOG * The following display order is an example. (1) (2) Connected devices status (1) Exposure unit communication indicator 7KHZLUHOHVVFRPPXQLFDWLRQVWDWXVRIWKHĂDWSDQHOVHQVRUDVVLJQHGWRWKHVHOHFWRULVGLVSOD\HG (2) Hospital wireless communication indicator Appendix Z Precautions for Exposure Displays the status of wireless communication between the image processing unit and the inhospital LAN. Details on the icons regarding wireless communication displayed in the areas (1) and (2) are as follows. Icon Description Display Area Communication is established. The radio wave strength is displayed in four levels. While is displayed, wireless communication or image transfer to the hospital LAN becomes unstable. (1) and (2) ([SRVXUHLVQRWDYDLODEOH &RPPXQLFDWLRQZLWKWKHĂDWSDQHO sensor is disconnected.) (1) Wireless communication is not available. (Since the radio wave strength is weak, wireless communication cannot be used. If this icon is displayed in the area (1), exposures cannot be made.) (1) and (2) Information on the radio wave strength is being received. (1) The in-hospital LAN connection is being switched. (2) For details on other icons, see the âConsole Advance (DR-ID 300CL) Reference Guideâ. FDR D-EVO II Operation Manual 897N120339A Z-9 Z.7 Other Precautions Z.7.1 Precautions for Exposure of a Subject in Relatively /DUJH&RQWUDVW 1 Exposures using a contrast medium may cause artifacts around it. 2 When exposing a subject with any metal objects implanted, artifacts may appear around them. 3 For exposures with objects of large X-ray absorption, such as lead characters and metals for measurement, artifacts may appear around them. Place such objects outside a subject. Z.7.2 Precautions for Flat Panel Sensor *HQHUDOO\ZKHQSHUIRUPLQJDKLJKVHQVLWLYLW\H[SRVXUHVKRUWO\DIWHUDQH[SRVXUHWKDWWKHĂDW panel sensor excessively receives direct X-ray, the output image may contain image lags of the previous exposure. This phenomenon rarely occurs and does not occur insofar as normal sensitivity exposures are performed. Exposures at longer intervals can reduce occurrences of this phenomenon. Also observe precautions as follows. ⢠Continuous high sensitivity exposures to vertebral body part (chest/lumbar spine) should be performed at longer intervals than normal exposures.  $KLJKVHQVLWLYLW\H[SRVXUHVKRUWO\DIWHUDKLJKGRVHH[SRVXUHVKRXOGEHSHUIRUPHGDWVXIÂżFLHQWO\ long interval.  :KHQSHUIRUPLQJKLJKGRVHH[SRVXUHVUHSHDWHGO\GRQRWXVHFROOLPDWLRQRIWKHUDGLDWLRQÂżHOG lead characters or metals for measurement at the same position. = 3UHFDXWLRQVIRU$VVXULQJWKH5DGLDWLRQ)LHOG Appendix Z Precautions for Exposure CAUTIONS Ć ,WLVLPSRUWDQWWRUHDGWKHIROORZLQJEHIRUHXVLQJWKH)'5'(92IIGLJLWDOGHWHFWRUFOLQLFDOO\ Ć 'RQRWPDNHWKHUDGLDWLRQÂżHOGODUJHUWKDQWKHVL]HRIWKHĂDWSDQHOVHQVRU(VSHFLDOO\ZKHQ WKHKLJKWXEHYROWDJHLVVHWWKHUDGLDWLRQÂżHOGVL]HVKRXOGQRWEHODUJHUWKDQWKHVXEMHFW unless necessary. The FDR D-EVO II is a digital X-ray detector designed for use both within and outside of a standard UDGLRJUDSKLFEXFN\5DGLDWLRQÂżHOGFDQEHVHWXSWR´Î´ '5,'6('5,'6( RUXS to 17â Ă 17â (DR-ID 1202SE/DR-ID1212SE) and this product may be used with the X-ray equipment LQDQ\VLWXDWLRQZKHUHDÂżOPFDVVHWWHPD\EHXVHG The collimator will open up to 14âĂ 17â for DR-ID 1201SE/DR-ID 1211SE and 17âĂ 17â for DR-ID 1202SE/DR-ID 1212SE, when the FDR D-EVO II cassette is inserted in the bucky tray of the X-ray equipment with positive beam limitation (PBL). )ROORZWKH;UD\V\VWHPPDQXIDFWXUHUÂśVLQVWUXFWLRQVWRDVVXUHWKHLQGLFDWHGÂżHOGVL]HPDWFKHVDQG GRHVQRWH[FHHGWKHDFWXDOUDGLDWLRQÂżHOGVL]HIRUWKHDYDLODEOHUDQJHRI6,'V = ,PDJHV2XWSXW:KHQWKH;UD\6KRW6ZLWFKLV2SHUDWHG Incorrectly In case that you press the X-ray shot switch only momentarily after selecting exposure menus, VXIÂżFLHQW;UD\GRVHPD\QRWEHDFKLHYHG7KHRXWSXWLPDJHFRQWDLQVLPDJHODJVRIWKHSUHYLRXV exposure occasionally. If this happens, select exposure menus again, and then make an exposure. Z-10 FDR D-EVO II Operation Manual 897N120339A = 3UHFDXWLRQVIRU8UJHQW8VH When you start a study before completion of the calibration at the time of startup, the operation will be in Urgent Use Mode. At this time, âUrgent use is possibleâ appears in the âOutput Device Status windowâ of the image processing unit. ⢠There is no guarantee that the image taken in Urgent Use Mode can be used for diagnostic purposes. Vertical artifact could appear in the image, if the temperature difference is large from the previous shutdown of the system. Check the image quality before use. ⢠Move from the Study Screen to the Patient Information Input Screen immediately after exiting Urgent Use Mode, so that the calibration will start over automatically. Z.7.6 Precautions Related to Continuous Operation If you plan to continuously run the system for over 24 hours, perform post-operation check, and then restart the system. Otherwise, calibration will not be performed normally, and image quality cannot be guaranteed as a result. Z.7.7 Precautions Related to Grid Depending on the type of the grid used, its stripes may appear in the image after making an exposure. To avoid such moire effects, sway the grid from side to side, or use the Grid Pattern Removal Processing Software in conjunction with the grid with 40 lines. = 3UHFDXWLRQVGXULQJ&DOLEUDWLRQ 2EVHUYHWKHIROORZLQJZKHQWKH5($'<VWDWXVODPSRQWKHĂDWSDQHOVHQVRULVEOLQNLQJRUZKHQWKH message âCalibrating...â is displayed on the image processing unit. Appendix Z Precautions for Exposure  'RQRWVXEMHFWWKHĂDWSDQHOVHQVRUWRVKRFN ⢠Do not deliver radiation.  'RQRWFRQQHFWGLVFRQQHFWWKHĂDWSDQHOVHQVRUWRIURPWKHSRZHUVXSSO\XQLWRUWRIURPWKH docking stand. = 3UHFDXWLRQVIRU([SRVLQJWKH)ODW3DQHO6HQVRUWR;UD\ :KHQ\RXH[SRVHWKHĂDWSDQHOVHQVRUWR;UD\DWDQ\RWKHUWLPHH[FHSWGXULQJUDGLRJUDSK\ artifacts could appear in the image. If artifacts appeared in the image due to X-ray irradiation, perform a test X-ray radiography after waiting for more than 2 minutes and then restart exposure DIWHUFRQÂżUPLQJWKDWWKHDUWLIDFWVGLVDSSHDU =3UHFDXWLRQVIRU([WHQGHG,PDJH5HDGRXW ,IDQ\LPSDFWLVDSSOLHGWRWKHĂDWSDQHOVHQVRUZKLOHDQLPDJHLVEHLQJDFTXLUHGZLWK([WHQGHG ,PDJH5HDGRXWDUWLIDFWVPD\DSSHDULQWKHLPDJH%HIRUHUHPRYLQJWKHĂDWSDQHOVHQVRUIURPWKH radiographic examination stand, be sure to check the acquired image on the image processing unit. In addition, note that when Extended Image Readout is enabled, the system cannot be used in an emergency since the system start-up time becomes longer. FDR D-EVO II Operation Manual 897N120339A Z-11 =3UHFDXWLRQVIRU8VLQJWKH$FFHVV3RLQW When making an exposure with the access point, do not remove the USB cable until the image appears on the image processing unit and ShotReady lights green. Also, with the supplied Velcro tape and clamp or by other means, secure the USB cable before use to prevent it from being disconnected accidentally. Appendix Z Precautions for Exposure Z-12 FDR D-EVO II Operation Manual 897N120339A Appendix O Use of Optional Items O.1 Optional Items Name SE storage case Description $FDVHXVHGIRUFDUU\LQJDQGVWRULQJWKHĂDWSDQHOVHQVRU For the external view and precautions, see âO.2 Using the SE Storage Caseâ (page O-2). Battery pack $EDWWHU\SDFNIRUWKHĂDWSDQHOVHQVRU For precautions, charging and installing/removing, see pages 1-8, 1-9, 3-6, 3-7 and 3-8. Battery charger A battery charger for the battery pack. For precautions, external view and charging, see pages 1-8, 1-9, 2-5, 3-6 and 3-7. Retaining bracket for MP $VHWRIDQDQFKRUDQGDÂż[WXUHZKLFKLVXVHGIRUVHFXULQJWKHSRZHUVXSSO\ XQLWWRWKHĂRRU For the external view, see âO.3 Using the Retaining bracket for MPâ (page O-3). SE cable $FDEOHWKDWFRQQHFWVWKHĂDWSDQHOVHQVRUDQGWKHSRZHUVXSSO\XQLW 7KLVFDEOHLVXVHGIRUDGGLQJWKHVHFRQGDQGVXEVHTXHQWĂDWSDQHO VHQVRUVFKDQJLQJRYHUWKHFRQQHFWLRQEHWZHHQWKHĂDWSDQHOVHQVRUVDQG other usages. Relay unit for AC bucky A relay unit consisting of the relay and terminal block for the AC bucky. )RXUW\SHVDUHDYDLODEOH)RU999DQG9 0DJQHWLFFODPSIRUĂDWSDQHO sensor cable $FODPSIRUÂż[LQJWKH6(FDEOHWRWKHUDGLRJUDSKLFH[DPLQDWLRQVWDQGHWF Adapter for the docking stand $QDGDSWHUXVHGIRUDWWDFKLQJWKHĂDWSDQHOVHQVRUWRWKHGRFNLQJVWDQG DS Anchor Fixing Bracket $QDQFKRUDQGÂż[LQJWRROVHWXVHGIRUÂż[LQJWKHGRFNLQJVWDQGWRWKHĂRRU Appendix O Use of Optional Items For the external view, see âO.4 DS Anchor Fixing Bracketâ (page O-4). Wall Fixing Bracket $QDQFKRUDQGÂż[LQJWRROVHWXVHGIRUÂż[LQJWKHGRFNLQJVWDQGWRWKHĂRRU For the external view, see âO.5 Wall Fixing Bracketâ (page O-5). SE communication cable $FDEOHXVHGIRUFRQQHFWLQJWKHĂDWSDQHOVHQVRUDQGWKHRSWLRQDODFFHVVSRLQW This cable is used for wired communication if wireless communication is not available. ,QDGGLWLRQWKLVFDEOHLVXVHGIRUUHJLVWHULQJRUUHFRJQL]LQJWKHĂDWSDQHOVHQVRU &DEOHOHQJWK$SSUR[P IW Access point $QDFFHVVSRLQWXVHGIRUZLUHOHVVFRPPXQLFDWLRQEHWZHHQWKHĂDWSDQHOVHQVRU and the image processing unit. FDR D-EVO II Operation Manual 897N120339A O-1 28VLQJWKH6(6WRUDJH&DVH SE storage case for 35 (DR-ID 1201SE/DR-ID 1211SE) SE storage case for 43 (DR-ID 1202SE/DR-ID 1212SE) CAUTIONS Ć 'RQRWVWRUHWKH6(VWRUDJHFDVHLQDORFDWLRQZLWKWKHIROORZLQJFRQGLWLRQV Ć:KHUHWKH6(VWRUDJHFDVHLVH[SRVHGWRGLUHFWVXQOLJKW Ć:KHUHWKHWHPSHUDWXUHDQGKXPLGLW\FKDQJHGUDPDWLFDOO\ Ć:KHUHWKHUHLVH[FHVVLYHGXVW Ć:KHUHFKHPLFDOVDUHVWRUHG Ć:KHUHWKH6(VWRUDJHFDVHPD\EHH[SRVHGWRZDWHUGXHWRZDWHUOHDNDJHRULQJUHVV Ć 6WRUHWKHĂDWSDQHOVHQVRUDQGWKHFDEOHSURSHUO\LQWKH6(VWRUDJHFDVH 2WKHUZLVHWKH\PD\EHFDXJKWXQGHUWKHFDVHOLGDQGGDPDJHG Ć 'RQRWFRQQHFWWKHĂDWSDQHOVHQVRUWRWKH6(FDEOHRU6(FRPPXQLFDWLRQFDEOHZKLOHLWLV VWRUHGLQWKH6(VWRUDJHFDVH Ć 'RQRWVWRUHDQ\WKLQJRWKHUWKDQWKHĂDWSDQHOVHQVRULQWKH6(VWRUDJHFDVH Ć &DUHIXOO\FDUU\WKH6(VWRUDJHFDVHZKHQWKHĂDWSDQHOVHQVRULVLQVLGH Ć 7 KH6(VWRUDJHFDVHDQGRUWKHĂDWSDQHOVHQVRULQVLGHPD\EHGDPDJHGLIWKHFDVHLV subject to an impact. Ć 'RQRWRSHQFORVHWKH6(VWRUDJHFDVHLQDORFDWLRQZKHUHWKHUHLVH[FHVVLYHGXVWRUGLUW Ć 'RQRWSXWWKH6(VWRUDJHFDVHRQDQXQVWDEOHSODFH,ILWIDOOVRUGURSVSHUVRQDOLQMXU\PD\UHVXOW Ć %HFDUHIXOQRWWRKDYH\RXUKDQGRUDQREMHFWFDXJKWZKHQFORVLQJWKH6(VWRUDJHFDVH Appendix O Use of Optional Items :KHQVWRULQJWKHĂDWSDQHOVHQVRULQWKH6(VWRUDJHFDVHSODFHLWZLWKWKHH[SRVXUHSODQHGRZQ For details, see the illustrations below. Battery holder pockets SE storage case for 35 (DR-ID 1201SE/DR-ID 1211SE) O-2 FDR D-EVO II Operation Manual 897N120339A Battery holder pockets SE storage case for 43 (DR-ID 1202SE/DR-ID 1212SE) 28VLQJWKH5HWDLQLQJ%UDFNHWIRU03 &RQWDFWD)8-,),/0GHDOHUIRULQVWDOODWLRQRIWKH5HWDLQLQJEUDFNHWIRU03 Appendix O Use of Optional Items FDR D-EVO II Operation Manual 897N120339A O-3 2'6$QFKRU)L[LQJ%UDFNHW &RQWDFWD)8-,),/0GHDOHUIRULQVWDOODWLRQRIWKH'6DQFKRUÂż[LQJEUDFNHW Appendix O Use of Optional Items O-4 FDR D-EVO II Operation Manual 897N120339A 2:DOO)L[LQJ%UDFNHW &RQWDFWD)8-,),/0GHDOHUIRULQVWDOODWLRQRIWKHZDOOÂż[LQJEUDFNHW Appendix O Use of Optional Items FDR D-EVO II Operation Manual 897N120339A O-5 O.6 Access Point Precautions for Use CAUTIONS Appendix O Use of Optional Items Ć7KH$FFHVV3RLQWLQFRUSRUDWHVDZLUHOHVVGHYLFHWKDWFRPSOLHVZLWKWKHWHFKQLFDOVWDQGDUGV Do not disassemble or modify the Access Point. In addition, do not remove the name plate attached to this product. If the name plate is not attached, use of this product is prohibited. Ć8VHRIWKH$FFHVV3RLQWLVDOORZHGLQWKHDUHDRISXUFKDVH Ć0DNHVXUHWKDWWKHUHDUHQRVKLHOGLQJPDWHULDOVEHWZHHQWKH$FFHVV3RLQWDQGWKHFRPPXQLFDWLRQ device. For example, if there is a metal plate or concrete wall between them, wireless communication may not be available. In addition, do not cover the plane with the status lamps. Ć'RQRWXVHWKH$FFHVV3RLQWQHDUWKHIROORZLQJGHYLFHV ,QGXVWULDOVFLHQWLÂżFDQGPHGLFDOHTXLSPHQWVXFKDVDPLFURZDYHRYHQSDFHPDNHUHWF - /RFDOSULYDWHUDGLRVWDWLRQVIRUPRELOHREMHFWLGHQWLÂżFDWLRQXVHGLQIDFWRU\SURGXFWLRQOLQHVHWF UDGLRVWDWLRQVUHTXLULQJDOLFHQVH 6SHFLÂżHGORZSRZHUUDGLRVWDWLRQV UDGLRVWDWLRQVUHTXLULQJQROLFHQVH Ć'RQRWXVHWKH$FFHVV3RLQWQHDUUDGLRVWHOHYLVLRQVPRELOHSKRQHVRU3+6SKRQHVDVIDUDV possible. If these devices are placed near the wireless LAN products, audio or video noise may RFFXUGXHWRHOHFWURPDJQHWLFZDYHVJHQHUDWHGIURPWKHZLUHOHVV/$1SURGXFWVLQFOXGLQJWKH Access Point. Ć'RQRWXVHWKH$FFHVV3RLQWQHDUDKHDWVRXUFH,QDGGLWLRQGRQRWFRYHUWKHYHQWLODWLRQKROHV Ć'RQRWDOORZWKH$FFHVV3RLQWJHWZHWRUGXVW\ Ć7DNHFDUHQRWWRWULSRYHUWKHFDEOH,IWKHFDEOHLVGLVFRQQHFWHGRUDOPRVWGLVFRQQHFWHG wireless communication may not be established. Ć'RQRWVXEMHFWWKH$FFHVV3RLQWWRVHYHUHVKRFN E\GURSSLQJLWHWF Ć:KHQXVLQJWKH$FFHVV3RLQWSODFHLWDWOHDVWFP LQ DZD\IURPWKHERG\ Ć7RVXSSO\SRZHUWRWKH$FFHVV3RLQWFRQQHFWLWWRWKH)8-,),/0VSHFLÂżHGSHUVRQDOFRPSXWHU VXSSRUWLQJ86% Ć8VHWKH$FFHVV3RLQWE\FRQQHFWLQJLWWRWKHSUHVHWLPDJHSURFHVVLQJXQLWDQGWRWKH86% connector. Ć'LUHFWO\FRQQHFWWKH$FFHVV3RLQWDQGWKHLPDJHSURFHVVLQJXQLWRQO\ZLWKWKHVXSSOLHG86% cable. Do not use a hub for connection. Ć'RQRWGHOHWHRUFKDQJHWKH86%GULYHULQVWDOOHGLQWKHLPDJHSURFHVVLQJXQLW Ć'RQRWSODFHWKHVXSSOLHG9HOFURWDSHRYHUWKH$FFHVV3RLQW3URGXFW/DEHODQG$FFHVV3RLQW 5DGLR/DZ&HUWLÂżFDWLRQ/DEHO O-6 O II Operation Manual 897N120339A Precautions for LAN Connection CAUTIONS Ć)RUWKH/$1FRQQHFWLRQXVHWKHGHGLFDWHG/$1FRQYHUVLRQFDEOH,QDGGLWLRQZKHQFRQQHFWLQJ RUGLVFRQQHFWLQJWKH/$1FRQYHUVLRQFDEOHEHVXUHWRKROGWKHFRQQHFWRUSRUWLRQ ,ILWLVFRQQHFWHGRUGLVFRQQHFWHGZKLOHKROGLQJWKHFDEOHWKHFDEOHPD\EHEURNHQ Ć5DGLRZDYHVDYDLODEOHRXWGRRUVYDU\GHSHQGLQJRQWKHFRXQWU\ZKHUHWKHV\VWHPLVXVHG (For U.S.) 5DGLRZDYHVLQWKH*+]IUHTXHQF\EDQGFDQEHXVHGLQGRRUVRQO\ : KHQUDGLRZDYHVLQWKH*+]DQG*+]IUHTXHQF\EDQGVDUHVHOHFWHGWKH')6IXQFWLRQZLOO operate. Ć:KHQWKH$FFHVV3RLQWDQGDSHUVRQDOFRPSXWHULVFRQQHFWHGXVLQJWKH86%FDEOHGRQRW connect the Access Point and the personal computer via the LAN connection. 3UHFDXWLRQVIRU8VLQJWKH')6 '\QDPLF)UHTXHQF\6HOHFWLRQ )XQFWLRQ CAUTIONS Ć7KH$FFHVV3RLQWVXSSRUWVWKH')6IXQFWLRQFRQIRUPLQJWR,(((Q,IDUDGDUZDYHLV GHWHFWHGZKLOHVHWWLQJDFKDQQHOWKHFKDQQHOPD\EHFKDQJHGDXWRPDWLFDOO\LQRUGHUWRDYRLG interference to weather radar, etc. Ć'XULQJVWDUWXSWKH$FFHVV3RLQWFKHFNVLIWKHUHDUHDQ\UDGDUZDYHV:KLOHWKHFKHFNLVLQ SURJUHVVFRPPXQLFDWLRQZLWKWKH$FFHVV3RLQWLVQRWDYDLODEOH Ć,IDUDGDUZDYHLVGHWHFWHGWKHUDGDUZDYHLVPRQLWRUHGIRUDVSHFLÂżHGWLPH DERXWPLQXWH :KLOHPRQLWRULQJWKHUDGDUZDYHZLUHOHVVFRPPXQLFDWLRQLVQRWDYDLODEOH,QDGGLWLRQDERXW PLQXWHVDUHUHTXLUHGXQWLOWKHFKDQQHOLQZKLFKDUDGDUZDYHZDVGHWHFWHGEHFRPHVDYDLODEOH For details of the access point, see âAccess point Operation Manualâ. Appendix O Use of Optional Items FDR D-EVO II Operation Manual 897N120339A O-7 Appendix O Use of Optional Items O-8 O II Operation Manual 897N120339A Maintenance and Inspection 0DLQWHQDQFHDQG,QVSHFWLRQ,WHPV$VVLJQHGWR6SHFLÂżHG'HDOHU )RUSHULRGLFDOLQVSHFWLRQRIWKHHTXLSPHQWDQGQHFHVVDU\DUUDQJHPHQWVFRQVXOWRXURIÂżFLDOGHDOHU or local representative. Periodical Maintenance 0DNHVXUHWKDWWKHSHULRGLFDOPDLQWHQDQFHDQGLQVSHFWLRQDVVLJQHGWRRXURIÂżFLDOGHDOHURU )8-,),/05HSUHVHQWDWLYHDUHSHUIRUPHGDVVSHFLÂżHG 0DLQWHQDQFHDQG,QVSHFWLRQ,WHPV$VVLJQHGWR6SHFLÂżHG'HDOHU Periodical Maintenance and Inspection Items Period Checking of the image Every year Checking of the operation record by referring to the error log Every year Checking of the units Every 2 years Main Periodical Replacement Parts Name of Periodical Replacement Parts Relay (optional) Period Every 1 year 1XPEHURIH[SRVXUHV * It is recommended that the battery pack be replaced, if the battery storage capacity becomes lower than 60%. The battery pack should be replaced when the operable time is less than the following. Ć'5,'6('5,'6('5,'6('5,'6(PLQXWHV KRXUDQGPLQXWHV * Refer to the operable time displayed on the image processing unit when the battery pack is fully charged and no exposure menu is registered. * Depending on the usage environment, etc., the displayed time is slightly different from the actual operable time. (Reference) Time for battery pack replacement 120 Battery storage capacity [%] 100 80 60 40 Time for replacement: Less than 100 minutes (1 hour and 40 minutes) 20 30 60 90 120 150 180 210 240 Operable time [Minute] The cycles of periodical maintenance and inspection and of parts replacement differ depending on the usage and the daily operation time. )RUGHWDLOVFRQWDFWRXURIÂżFLDOGHDOHURU)8-,),/05HSUHVHQWDWLYH FDR D-EVO II Operation Manual 897N120339A Maintenance and Inspection Maintenance and Inspection FDR D-EVO II Operation Manual 897N120339A 5DGLRIUHTXHQF\ 5) FRPSOLDQFHLQIRUPDWLRQ &RPSOLDQFHZLWK(& 0DQXIDFWXUHUÂśV1DPH 0DQXIDFWXUHUÂśV$GGUHVV )8-,),/0&RUSRUDWLRQ 1LVKLD]DEX&KRPH0LQDWR.X7RN\R-$3$1 GHFODUHVWKDWWKHSURGXFW 3URGXFW1DPH 3$1(/81,7 0RGHO1XPEHU '5,'38 (DR-ID 1200MP, DR-ID 1201SE, DR-ID 1202SE, DR-ID 1211SE and DR-ID 1212SE) DR-ID 1200DU (DR-ID 1200DS, DR-ID 1201SE, DR-ID 1202SE, DR-ID 1211SE and DR-ID 1212SE) 7KHSURGXFWFRPSOLHVZLWKWKHUHTXLUHPHQWVRIWKH5 77('LUHFWLYH(& The formal âDeclaration of Conformityâ can be obtained in the following-mentioned address. $GGUHVV0L\DQRGDL.DLVHLPDFKL$VKLJDUDNDPLJXQ.DQDJDZD-$3$1 The shipment schedule country is as follows. AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MK MT NL NO PL PT RO SE SI SK TR [BG] Bulgarian [CS] ÉɧÉɍɏɨɚɳÉɏɨ)8-,),/0ÉÉɤɼÉɪɢɪÉÉąÉ'5,'38'5,''8 ÉÉɍɴɨɏÉÉÉŹÉŤÉŹÉɢÉÉŤÉ´ÉŤÉŤÉ´ÉłÉÉŤÉŹÉÉɧɢɏÉɢɥɢɍɤÉÉɧɢɚɢÉÉŞÉÉɢɏÉÉŠÉŞÉ˘ÉĽÉ¨É É˘ÉŚÉ˘ ÉŞÉɥɊɨɪÉÉÉɢɧÉȞɢɪÉɤɏɢÉÉ(& )8-,),/0WtPWRSURKODĂŁXMHĂĽH'5,'38'5,''8VSOÄXMH ]iNODGQtSRĂĽDGDYN\DYĂŁHFKQDSÄtVOXĂŁQiXVWDQRYHQL6PÄUQLFH(6 Czech [DA] Danish [DE] German [EN] English [ES] Spanish Undertegnede FUJIFILM erklĂŚrer herved, at følgende udstyr DR-ID 1200PU, DR-ID 1200DU overholder de vĂŚsentlige krav og øvrige relevante krav i direktiv 1999/5/EF. Hiermit erklärt FUJIFILM, dass sich das Gerät DR-ID 1200PU, DR-ID 1200DU in Ăbereinstimmung mit den grundlegenden Anforderungen und den Ăźbrigen HLQVFKOlJLJHQ%HVWLPPXQJHQGHU5LFKWOLQLH(*EHÂżQGHW Hereby, FUJIFILM, declares that this DR-ID 1200PU, DR-ID 1200DU is in compliance with the essential requirements and other relevant provisions of Directive 1999/5/EC. Por la presente, FUJIFILM, declara que este DR-ID 1200PU, DR-ID 1200DU cumple con los requisitos esenciales y otras exigencias relevantes de la Directiva 1999/5/EC. FDR D-EVO II Operation Manual 897N120339A [ET] Estonian [FI] Finish [FR] French [EL] Greek [HU] Hungarian [HR] Croatian [IS] Icelandic [IT] Italian [LV] Latvian [LT] Käesolevaga kinnitab FUJIFILM seadme DR-ID 1200PU, DR-ID 1200DU vastavust direktiivi 1999/5/EĂ pĂľhinĂľuetele ja nimetatud direktiivist tulenevatele teistele asjakohastele sätetele. FUJIFILM vakuuttaa täten että DR-ID 1200PU, DR-ID 1200DU tyyppinen laite on direktiivin 1999/5/EY oleellisten vaatimusten ja sitä koskevien direktiivin muiden ehtojen mukainen. Par la prĂŠsente, FUJIFILM dĂŠclare que lâappareil DR-ID 1200PU, DR-ID 1200DU est conforme aux exigences essentielles et aux autres dispositions pertinentes de la directive 1999/5/CE. ČÇźČÇžČČÇšČČ ČČÇšČ ČÇšČÇšČČÇźČÇšČČÇžČ)8-,),/0ǝǞČČČÇźÇżČ ČÇż '5,'38'5,''8ČČČČČ ČÄČČÇźČǚǿČČČ ČČÇżČČ ČČÇżČÇťÇźÇżČ ÇšČǚǿČÇžČǟǿČČǚǿČÇżČČČ ÇżČÇźČČČÇźČÇżČÇźČǝǿǚČÇšČǟǿČČÇžČČ ÇťÇžÄŤÇżÇšČ ÇźČ A FUJIFILM ezzennel kijelenti, hogy a DR-ID 1200PU, DR-ID 1200DU WtSXV~EHUHQGH]pVWHOMHVtWLD]DODSYHWÄN|YHWHOPpQ\HNHWpVPiV(. irĂĄnyelvben meghatĂĄrozott vonatkozĂł rendelkezĂŠseket. 2YLPH)8-,),/0SRWYUĂżXMHGDMH'5,'38'5,''8X VXNODGQRVWVDRVQRYQLP]DKWMHYLPDLGUXJLPYDĂĽQLPRGUHGEDPD'LUHNWLYH 1999/5/EC. +pUPHèOĂŞVLU)8-,),/0\ÂżUĂŹYtDè'5,'38'5,''8HUt VDPU PLYLèJUXQQNU|IXURJDèUDUNU|IXUVHPJHUèDUHUXtWLOVNLSXQ EC Con la presente FUJIFILM dichiara che questo DR-ID 1200PU, DR-ID 1200DU è conforme ai requisiti essenziali ed alle altre disposizioni pertinenti stabilite dalla direttiva 1999/5/CE. $UĂŁR)8-,),/0GHNODUĆND'5,'38'5,''8DWELOVW 'LUHNWĆŻYDV(.EÇWLVNDMĆPSUDVĆŻEĆPXQFLWLHPDUWRVDLVWĆŻWDMLHP noteikumiem. Ĺ iuo FUJIFILM deklaruoja, kad ĹĄis DR-ID 1200PU, DR-ID 1200DU atitinka esminius reikalavimus ir kitas 1999/5/EB Direktyvos nuostatas Lithuanian >ÉÉ@ Macedonian [MT] Maltese [NL] Dutch [NO] Norwegian [PL] Polish [PT] )8-,),/0ɢɥĘÉÉÉÉÉÉÉɤÉɨÉɨĘ'5,'38'5,''8ÉÉɨ ɍɨÉÉĽÉɍɧɨɍɏɍɨɍÉɲɏɢɧɍɤɢɏÉÉÉÉŞÉĘÉɢÉÉŞÉÉɢɪÉÉĽÉÉÉɧɏɧɢɨÉÉŞÉÉÉÉ˘É§É ČžÉ˘ÉŞÉɤɏɢÉÉÉŹÉ(& Hawnhekk, FUJIFILM, jiddikjara li dan DR-ID 1200PU, DR-ID 1200DU MLNNRQIRUPDPDOĆŤWLĆĽLMLHWHVVHQ]MDOLXPDSURYYHGLPHQWLRĆŤUDMQUHOHYDQWLOL KHPPÂżG'LUUHWWLYD(& Hierbij verklaart FUJIFILM dat het toestel l DR-ID 1200PU, DR-ID 1200DU in overeenstemming is met de essentiĂŤle eisen en de andere relevante bepalin-gen van richtlijn 1999/5/EG. FUJIFILM erklĂŚrer herved at utstyret DR-ID 1200PU, DR-ID 1200DU er i samsvar med de grunnleggende krav og øvrige relevante krav i direktiv 1999/5/EF. 1LQLHMV]\P)8-,),/0GHNODUXMHÄŞH'5,'38'5,''8MHVW ]JRGQ\]]DVDGQLF]\PLZ\PDJDQLDPLLLQQ\PLZĂĄDÄFLZ\PLSRVWDQRZLHQLDPL Dyrektywy 1999/5/EC. Eu, FUJIFILM, declaro que o DR-ID 1200PU, DR-ID 1200DU cumpre os requisitos essenciais e outras provisĂľes relevantes da Directiva 1999/5/EC. Portuguese FDR D-EVO II Operation Manual 897N120339A [RO] Romanian [SK] 3ULQSUH]HQWD)8-,),/0GHFODUÄFÄDSDUDWXO'5,'38'5,''8 HVWHvQFRQIRUPLWDWHFXFHULQÄ HOHHVHQÄ LDOHĂşLFXDOWHSUHYHGHULSHUWLQHQWHDOH Directivei 1999/5/CE. )8-,),/0WĂŞPWRY\KODVXMHĂĽH'5,'38'5,''8VSÄÄD ]iNODGQpSRĂĽLDGDYN\DYĂŁHWN\SUtVOXĂŁQpXVWDQRYHQLD6PHUQLFH(6 Slovak [SL] FUJIFILM izjavlja, da je ta DR-ID 1200PU, DR-ID 1200DU v skladu z ELVWYHQLPL]DKWHYDPLLQGUXJLPLUHOHYDQWQLPLGRORĂžLOLGLUHNWLYH(6 Slovenian [SV] Swedish [TR] Turkish Härmed intygar FUJIFILM, att denna DR-ID 1200PU, DR-ID 1200DU är I|UHQOLJWPHGGHJUXQGOlJJDQGHNUDYHQRFKDQGUDUHOHYDQWDEHVWlPPHOVHUL direktivet 1999/5/EG. øúEXEHOJHLOH)8-,),/0EX'5,'38'5,''8ÂUÂQÂQÂQ (&VD\ĂOĂ<|QHUJHÂśQLQWHPHOĂşDUWODUĂ\ODYHGLáHULOJLOLKÂNÂPOHUL\OH X\XPOXROGXáXQXEH\DQHGHU FDR D-EVO II Operation Manual 897N120339A FUJIFILM MEDICAL SYSTEMS U.S.A., INC. :(67$9(18(67$0)25'&786$
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.5 Linearized : Yes Author : 14539 Create Date : 2014:11:19 11:48:11+09:00 Modify Date : 2014:11:19 11:48:11+09:00 XMP Toolkit : Adobe XMP Core 5.2-c001 63.139439, 2010/09/27-13:37:26 Instance ID : uuid:0e6f0676-8382-476b-b746-e692e5af4a42 Original Document ID : adobe:docid:indd:b00e80c8-89dd-11e1-8720-8420a54dfcb3 Document ID : xmp.id:476C7F181150E411A09A82C810678A03 Rendition Class : proof:pdf Derived From Instance ID : xmp.iid:466C7F181150E411A09A82C810678A03 Derived From Document ID : adobe:docid:indd:b00e80c8-89dd-11e1-8720-8420a54dfcb3 Derived From Original Document ID: adobe:docid:indd:b00e80c8-89dd-11e1-8720-8420a54dfcb3 Derived From Rendition Class : default History Action : converted History Parameters : from application/x-indesign to application/pdf History Software Agent : Adobe InDesign CS6 (Windows) History Changed : / History When : 2014:10:10 09:05:47+09:00 Metadata Date : 2014:10:15 14:12:44+09:00 Creator Tool : Adobe InDesign CS6 (Windows) Format : application/pdf Creator : 14539 Title : 897N120339A_Z72N3191A_141015.pdf Producer : Acrobat Distiller 10.1.2 (Windows) Trapped : False Page Count : 130EXIF Metadata provided by EXIF.tools