Kenwood USA 31251110 AMATEUR TRANSMITTER WITH SCANNING RECEIVER User Manual 00 Cover

Kenwood USA Corporation AMATEUR TRANSMITTER WITH SCANNING RECEIVER 00 Cover

UserManual.wiki >

Kenwood USA >

31251110 User Manual

MANUAL

THANK YOU!Thank you for choosing this KENWOOD transceiver.KENWOOD always provides Amateur Radio productswhich surprise and excite serious hobbyists. Thistransceiver is no exception. As you learn how to use thistransceiver, you will find that KENWOOD is pursuing“user friendliness”. For example, each time you changethe Menu No. in Menu mode, you will see a textmessage on the display that lets you know what you areconfiguring.Though user friendly, this transceiver is technicallysophisticated and some features may be new to you.Consider this manual to be a personal tutorial from thedesigners. Allow the manual to guide you through thelearning process now, then act as a reference in thecoming years.KENWOOD believes that this product will satisfy yourrequirements on both voice and data communications.MODELS COVERED BY THIS MANUALThe models listed below are covered by this manual.TM-271A: 144 MHz FM TransceiverTM-271E: 144 MHz FM TransceiverMARKET CODESK: The AmericasE: EuropeMn:General(Where “n” represents a variation number.)The market code is printed on the bar-code label of thecarton box.Refer to the product specifications {pages 71 ~ 72} forinformation on the available operating frequencies withineach model. For accessories supplied with the model,refer to page 1.FEATURES•Weather Alert Radio function checks the 1050 Hz tone fromNOAA (U.S.A./ Canada only).•Menu allows for easy control and selecting of variousfunctions.•Up to 200 memory channels to program frequencies andother various data. (Up to 100 memory channels if MemoryChannel Names are assigned to the channels.)•Continuous Tone Coded Squelch System (CTCSS) orDigital Code Squelch (DCS) rejects unwanted calls fromother stations.•Equipped with an easy-to-read large LCD withalphanumeric display capability.•TNC (E market models only)•Free PC software (Memory Control Program) is available toprogram the frequency, signalling, and other settings of yourtransceiver. The MCP can be downloaded at:http://www.kenwood.com/i/products/info/amateur.html

iPRECAUTIONSPlease observe the following precautions to preventfire, personal injury, and/or transceiver damage:•Do not attempt to configure your transceiver whiledriving; it is simply too dangerous.•Be aware of local laws pertaining to the use ofheadphones/headsets while driving on publicroads. If in doubt, do not wear headphones whilemobiling.•Do not transmit with high output power forextended periods; the transceiver may overheat.•Do not modify the transceiver unless instructed bythis manual or other KENWOOD documentation.•Do not expose the transceiver to long periods ofdirect sunlight nor place it close to heatingappliances.•Do not place the transceiver in excessively dusty,humid or wet areas, nor on unstable surfaces.•If an abnormal odor or smoke is detected comingfrom the transceiver, turn OFF the powerimmediately. Contact a KENWOOD service stationor your dealer.•This transceiver is designed for a 13.8 V powersource. Never use a 24 V battery to power thetransceiver.NOTICES TO THE USEROne or more of the following statements may be applicable:FCC WARNINGThis equipment generates or uses radio frequency energy. Changesor modifications to this equipment may cause harmful interferenceunless the modifications are expressly approved in the instructionmanual. The user could lose the authority to operate this equipment ifan unauthorized change or modification is made.INFORMATION TO THE DIGITAL DEVICE USER REQUIRED BYTHE FCCThis equipment has been tested and found to comply with the limitsfor a Class B digital device, pursuant to Part 15 of the FCC Rules.These limits are designed to provide reasonable protection againstharmful interference in a residential installation.This equipment generates, uses and can generate radio frequencyenergy and, if not installed and used in accordance with theinstructions, may cause harmful interference to radio communications.However, there is no guarantee that the interference will not occur in aparticular installation. If this equipment does cause harmfulinterference to radio or television reception, which can be determinedby turning the equipment off and on, the user is encouraged to try tocorrect the interference by one or more of the following measures:•Reorient or relocate the receiving antenna.•Increase the separation between the equipment and receiver.•Connect the equipment to an outlet on a circuit different from thatto which the receiver is connected.•Consult the dealer for technical assistance.When condensation occurs inside the transceiver:Condensation may occur inside the transceiver when the room iswarmed using a heater on a cold day or when the transceiver isquickly moved from a cold location to a warm location. Whencondensation occurs, the microcomputer and/or the transmit/receivecircuits may become unstable, resulting in transceiver malfunction. Ifthis happens, turn OFF the transceiver and wait for a while. When thecondensed droplets disappear, the transceiver will function normally.

iiCONTENTSSELECTING A FREQUENCY .................................. 15VFO MODE .......................................................... 15MHz MODE .......................................................... 16DIRECT FREQUENCY ENTRY ...................................... 16CHAPTER 5MENU SETUPWHAT IS A MENU? ................................................. 18MENU ACCESS ...................................................... 18MENU FUNCTION LIST .......................................... 19CHAPTER 6OPERATING THROUGH REPEATERSOFFSET PROGRAMMING FLOW ........................... 22PROGRAMMING AN OFFSET ................................ 23SELECTING AN OFFSET DIRECTION .............................. 23SELECTING AN OFFSET FREQUENCY ............................ 23ACTIVATING THE TONE FUNCTION ................................ 24SELECTING A TONE FREQUENCY ................................. 24AUTOMATIC REPEATER OFFSET .......................... 25TRANSMITTING A 1750 Hz TONE .......................... 25REVERSE FUNCTION ............................................ 26AUTOMATIC SIMPLEX CHECK (ASC) .................... 26TONE FREQUENCY ID SCAN ................................ 27CHAPTER 7MEMORY CHANNELSNUMBER OF MEMORY CHANNELS ...................... 28SIMPLEX & REPEATER OR ODD-SPLITMEMORY CHANNEL? ............................................. 28STORING SIMPLEX FREQUENCIES ORSTANDARD REPEATER FREQUENCIES ............... 29STORING ODD-SPLIT REPEATERFREQUENCIES ....................................................... 30SUPPLIED ACCESSORIES ...................................... 1WRITING CONVENTIONS FOLLOWEDIN THIS MANUAL ...................................................... 1CHAPTER 1PREPARATIONMOBILE INSTALLATION ........................................... 2DC POWER CABLE CONNECTION .......................... 3Mobile Operation .................................................. 3Fixed Station Operation ........................................ 4Replacing Fuses ................................................... 5ANTENNA CONNECTION ......................................... 5ACCESSORY CONNECTIONS ................................. 6External Speaker .................................................. 6Microphone ........................................................... 6PC Connection ..................................................... 6CONNECTING TO A TNC (E MARKET MODELS ONLY).... 7CHAPTER 2YOUR FIRST QSOCHAPTER 3GETTING ACQUAINTEDFRONT PANEL .......................................................... 9DISPLAY .................................................................. 10REAR PANEL .......................................................... 12MICROPHONE ........................................................ 12MIC KEYPAD DIRECT ENTRY ...................................... 13CHAPTER 4OPERATING BASICSSWITCHING THE POWER ON/OFF ........................ 14ADJUSTING THE VOLUME ..................................... 14ADJUSTING THE SQUELCH .................................. 14TRANSMITTING ...................................................... 15SELECTING AN OUTPUT POWER ................................. 15

$iii1234567891011121314SCAN RESUME METHOD ...................................... 45CHAPTER 9SELECTIVE CALLCTCSS AND DCS ................................................... 46CTCSS .................................................................... 46SELECTING A CTCSS FREQUENCY ............................ 47CTCSS FREQUENCY ID SCAN ................................. 48DCS ......................................................................... 48SELECTING A DCS CODE ......................................... 48DCS CODE ID SCAN .............................................. 49CHAPTER 10 DUAL TONE MULTI-FREQUENCY(DTMF) FUNCTIONSMANUAL DIALING .................................................. 50DTMF MONITOR .................................................... 50DTMF TX HOLD ................................................... 51AUTOMATIC DIALER .............................................. 51STORING A DTMF NUMBER IN MEMORY ...................... 51CONFIRMING STORED DTMF NUMBERS ...................... 52TRANSMITTING A STORED DTMF NUMBER ................... 52ADJUSTING THE DTMF TONE TRANSMISSION SPEED ...... 52ADJUSTING THE PAUSE DURATION .............................. 53DTMF LOCK ............................................................ 53CHAPTER 11 AUXILIARY FUNCTIONSAPO (AUTO POWER OFF) ..................................... 54BEAT SHIFT ............................................................ 54S-METER SQUELCH .............................................. 54SQUELCH HANG TIME .............................................. 55BEEP FUNCTION .................................................... 55BUSY CHANNEL LOCKOUT ................................... 56RECALLING A MEMORY CHANNEL ....................... 30USING THE TUNING CONTROL .................................... 30USING THE MICROPHONE KEYPAD ............................... 31CLEARING A MEMORY CHANNEL ......................... 31NAMING A MEMORY CHANNEL ............................. 32MEMORY CHANNEL TRANSFER ........................... 33MEMORY \ VFO TRANSFER .................................... 33CHANNEL \ CHANNEL TRANSFER .............................. 33CALL CHANNEL ...................................................... 35RECALLING THE CALL CHANNEL ................................. 35REPROGRAMMING THE CALL CHANNEL ......................... 35WEATHER ALERT (K MARKET MODELS ONLY)............. 36PROGRAMMING THE WEATHER RADIO FREQUENCY ......... 36ENABLING A WEATHER ALERT .................................... 36CHANNEL DISPLAY ................................................ 37CHAPTER 8SCANNORMAL SCAN ...................................................... 40BAND SCAN ........................................................... 40PROGRAM SCAN ..................................................... 40MHz SCAN ........................................................... 41MEMORY SCAN ...................................................... 42ALL-CHANNEL SCAN ................................................ 42GROUP SCAN ......................................................... 42CALL SCAN ............................................................ 43PRIORITY SCAN ..................................................... 43PROGRAMMING A PRIORITY CHANNEL .......................... 43USING PRIORITY SCAN ............................................. 44MEMORY CHANNEL LOCKOUT ............................. 44$

ivFREQUENCY STEP SIZE ....................................... 56DISPLAY BACKLIGHT ............................................. 57PERMANENT BACKLIGHT ........................................... 57AUTOMATIC BACKLIGHT ............................................. 57LOCK FUNCTION ................................................... 58DATA COMMUNICATION SPEED ........................... 58TUNE ENABLE ........................................................ 58MICROPHONE PF KEYS (KEYPAD MODELS ONLY)...... 59NARROW BAND FM OPERATION .......................... 60POWER-ON MESSAGE .......................................... 60PROGRAMMABLE VFO .......................................... 60TIME-OUT TIMER ................................................... 61CHAPTER 12 MICROPHONE CONTROLMIC LOCK ............................................................... 64CHAPTER 13 OPTIONAL ACCESSORIESCHAPTER 14 TROUBLESHOOTINGMAINTENANCE ...................................................... 66GENERAL INFORMATION ............................................ 66SERVICE ................................................................ 66SERVICE NOTE ....................................................... 66CLEANING .............................................................. 67RESETTING THE TRANSCEIVER .......................... 67INITIAL SETTINGS ..................................................... 67FULL RESET ........................................................... 67VFO RESET .......................................................... 68TROUBLESHOOTING ............................................. 69SPECIFICATIONSINDEX

1SUPPLIED ACCESSORIESAfter carefully unpacking the transceiver, identify theitems listed in the table below. We recommend you keepthe box and packaging for shipping.A market area code (K, E, or M2) can be found on thelabel attached to the package box.yrosseccA rebmuNtraP ytQenohporciMtekram2M)03-CMK( XX-4260-19T1tekramE,K)23-CMK( XX-1460-19TrewopCDelbactekram2M,KXX-1112-03E 1tekramEXX-2543-03EesuF tekram2M,KXX-7100-15F 1tekramEXX-4200-25FtekcarbgnitnuoMXX-2660-92J1regnahenohporciMXX-4851-91J1teswercSXX-5930-99N1)ylnotekramE,K(dracytnarraW—1launamnoitcurtsnIXX-8371-26B1WRITING CONVENTIONS FOLLOWED IN THIS MANUALThe writing conventions described below have beenfollowed to simplify instructions and avoid unnecessaryrepetition.noitcurtsnI odottahWsserP ]YEK[ .esaelerdnasserP YEK .sserP)s1(]YEK[ .dlohdnasserP YEK rodnoces1rof.regnolsserP]1YEK[ ,]2YEK[ .sserP 1YEK esaeler,yliratnemom1YEK sserpneht, 2YEK .sserP]2YEK[+]1YEK[ .dlohdnasserP 1YEK sserpneht,2YEK owtnahteromeraerehtfI.niyekhcaedlohdnasserp,syekneebsahyeklanifehtlitnunrut.desserpsserP][+]YEK[ .,FFOrewopreviecsnartehthtiWdlohdnasserp YEK ehtnrutneht,gnisserpybNOrewopreviecsnart][ .)hctiwSrewoP(

21PREPARATION2Position the transceiver, then insert and tightenthe supplied hexagon SEMS screws (4) and flatwashers (4).•Double check that all hardware is tightened to preventvehicle vibration from loosening the bracket ortransceiver.•Determine the appropriate angle of the transceiver,using the 3 screw hole positions on the side of themounting bracket.MOBILE INSTALLATIONTo install the transceiver, select a safe, convenientlocation inside your vehicle that minimizes danger toyour passengers and yourself while the vehicle is inmotion. Consider installing the unit at an appropriateposition so that knees or legs will not strike it duringsudden braking of your vehicle. Try to pick a wellventilated location that is shielded from direct sunlight.1Install the mounting bracket in the vehicle using thesupplied self-tapping screws (4), flat washers (4), andspring washers (4).•The bracket must be installed so that the 3 screw holepositions on the side of the mounting bracket aretowards the rear of the bracket. Self-tapping screw(5 mm x 16 mm)Flat washerSEMSscrewSpring washer

314Confirm the correct polarity of the connections, thenattach the power cable to the battery terminals; redconnects to the positive (+) terminal and blackconnects to the negative (–) terminal.•Use the full length of the cable without cutting off excesseven if the cable is longer than required. In particular,never remove the fuse holders from the cable.5Reconnect any wiring removed from the negativeterminal.6Connect the DC power cable to the transceiver’spower supply connector.•Press the connectors firmly together until the locking tabclicks.DC POWER CABLE CONNECTIONLocate the power input connector as close to the transceiver aspossible.MOBILE OPERATIONThe vehicle battery must have a nominal rating of 12 V.Never connect the transceiver to a 24 V battery. Be sureto use a 12 V vehicle battery that has sufficient currentcapacity. If the current to the transceiver is insufficient,the display may darken during transmission, or transmitoutput power may drop excessively.1Route the DC power cable supplied with thetransceiver directly to the vehicle’s battery terminalsusing the shortest path from the transceiver.•If using a noise filter, it should be installed with aninsulator to prevent it from touching metal on the vehicle.•We recommend you do not use the cigarette lightersocket as some cigarette lighter sockets introduce anunacceptable voltage drop.•The entire length of the cable must be dressed so it isisolated from heat, moisture, and the engine secondary(high voltage) ignition system/ cables.2After the cable is in place, wrap heat-resistant tapearound the fuse holder to protect it from moisture andtie down the full run of cable.3To prevent the risk of short circuits, disconnect otherwiring from the negative (–) battery terminal beforeconnecting the transceiver.RedBlackFuse holderFuse holderFuse holder

412Connect the transceiver’s DC power connector to theconnector on the DC power cable.•Press the connectors firmly together until the locking tabclicks.Note:◆For your transceiver to fully exhibit its performance capabilities,we recommend using the optional PS-33 (20.5 A, 25% duty cycle)power supply.◆Before connecting the DC power supply to the transceiver, besure to switch the transceiver and the DC power supply OFF.◆Do not plug the DC power supply into an AC outlet until you makeall connections.FIXED STATION OPERATIONIn order to use this transceiver for fixed station operation,you will need a separate 13.8 V DC power supply (notincluded). The recommended current capacity of yourpower supply is 12 A.1Connect the DC power cable to the regulated DCpower supply and ensure that the polarities arecorrect (Red: positive, Black: negative).•Do not directly connect the transceiver to an AC outlet.•Use the supplied DC power cable to connect thetransceiver to a regulated power supply.•Do not substitute a cable with smaller gauge wires.To AC outletRegulated DCpower supplyBlack (–)Red (+)Fuse holderFuse holderFuse holder

51REPLACING FUSESIf the fuse blows, determine the cause, then correct theproblem. After the problem is resolved, replace the fuse.If newly installed fuses continue to blow, disconnect thepower cable and contact your authorized KENWOODdealer or an authorized KENWOOD service center forassistance.noitacoLesuF gnitaRtnerruCesuFreviecsnarTA51yrosseccAdeilppuSelbaCrewoPCD A02Only use fuses of the specified type and rating; otherwise thetransceiver could be damaged.Note: If you use the transceiver for a long period when the vehiclebattery is not fully charged, or when the engine is OFF, the batterymay become discharged, and will not have sufficient reserves to startthe vehicle. Avoid using the transceiver under these conditions.ANTENNA CONNECTIONBefore operating, install an efficient, well-tuned antenna.The success of your installation will depend largely onthe type of antenna and its correct installation. Thetransceiver can give excellent results if the antennasystem and its installation are given careful attention.Use a 50 Ω impedance antenna and low-loss coaxialfeed line that has a characteristic impedance of 50 Ω, tomatch the transceiver input impedance. Coupling theantenna to the transceiver via feed lines having animpedance other than 50 Ω reduces the efficiency of theantenna system and can cause interference to nearbybroadcast television receivers, radio receivers, and otherelectronic equipment.Note: E market models use an N-type antenna connector while othermodels use an M-type (SO-239) connector.◆Transmitting without first connecting an antenna or other matchedload may damage the transceiver. Always connect the antenna tothe transceiver before transmitting.◆All fixed stations should be equipped with a lightning arrester toreduce the risk of fire, electric shock, and transceiver damage.Feed line connectorAntenna connectorTo antenna

61ACCESSORY CONNECTIONSEXTERNAL SPEAKERIf you plan to use an external speaker, choose a speakerwith an impedance of 8 Ω. The external speaker jackaccepts a 3.5 mm (1/8") mono (2-conductor) plug. Werecommend using the SP-50B speaker.MICROPHONEFor voice communications, connect a 600 Ω microphoneequipped with an 8-pin modular plug into the modularsocket on the front of the main unit. Press firmly on theplug until the locking tab clicks.Attach the supplied microphone hanger in an appropriatelocation using the screws included in the screw set.Microphone hangerMicrophonehanger screw(3 mm x 10 mm)CMHOOKMICMEPTTEPSBBLCPC CONNECTIONTo utilize the optional MCP-1A software, you must firstconnect the transceiver to your PC using the KPG-46Programming Cable (via the microphone jack).The MCP-1A is free downloadable software availablefrom KENWOOD at the following URL:http://www.kenwood.com/i/products/info/amateur.html

71CONNECTING TO A TNC (E MARKET MODELS ONLY)To connect an external TNC to the transceiver, use anoptional PG-5A cable. The DATA connector on the rearof the transceiver mates with the 6-pin mini-DIN plug onthis cable..oNniP emaNniP noitcnuF1GKP tupniatadtekcaP•reviecsnartotCNTmorfatadXT2DNGGKProfdnuorG3SKPybdnatstekcaP•ehttibihniotnipsihtesunacCNTtupnienohporcimreviecsnart.slangistekcapgnittimsnartelihw49RPspb0069detcetedfotuptuOVm005(atadP-Pk01, Ω)•nipnommocasasnoitcnufoslAatadspb0069dnaspb0021rof.tuptuo51RP spb0021detcetedfotuptuOVm005(atadP-Pk01, Ω)6CQStuptuolortnochcleuqS•gnittimsnartatadCNTstibihnI.neposihcleuqsreviecsnartelihw•eciovotecnerefretnistneverPemasehtnosnoitacinummoc.seirterstneverposlA.ycneuqerf•leveLtuptuO)hgiH(V5+:hcleuqsnepO)woL(V0:hcleuqsdesolCNote:◆If the external TNC has a common pin for 1200 bps and 9600 bpsdata output, connect this pin to the DATA connector PR9 pin.Shorting the PR9 and PR1 pins will cause the TNC to malfunction.◆Adjust the transceiver data communication speed (1200 bps or9600 bps) as necessary {page 58}.◆If DC voltage is input to the PR1 pin, the external TNC may notfunction. If this problem happens, add a 10 µF capacitor betweenthe PR1 pin and the TNC. Be careful with the polarity of thecapacitor.GND

82YOUR FIRST QSOAre you ready to give your transceiver a quick try?Reading this section should get your voice on theair right away. The instructions below are intendedonly as a quick guide. If you encounter problemsor there is something you would like to know more,read the detailed explanations given later in thismanual.YOUR FIRST QSOqPress [ ] (Power) briefly to switch the transceiverpower ON.•A high pitched double beep sounds and a Power-onmessage appears momentarily. The various indicatorsand the current operating frequency appear on the LCD.•The transceiver stores the current parameters when it isturned OFF and automatically recalls those parametersthe next time you turn the transceiver ON.wTurn the Volume control clockwise, to the 9 o’clockposition.eTurn the Tuning control to select a receptionfrequency.•You may further turn the Volume control to adjust thevolume level of the signal.rTo transmit, hold the microphone approximately 5 cm(2 inches) from your mouth.tPress and hold Mic [PTT], then speak in your normaltone of voice.yRelease Mic [PTT] to receive.uRepeat steps r, t, and y to continuecommunication.TM-271 MENUqw ety

93GETTING ACQUAINTEDFRONT PANELNote: This section describes only the main functions of the frontpanel controls. Explanations for functions not described here areprovided in the appropriate sections of this instruction manual.q we r t y uTM-271MENUqqqqq (Power) switch/ Volume controlPress to switch the transceiver power ON or OFF{page 14}.Turn to adjust the level of the receive audio from thespeaker {page 14}.wwwwwMENU button/ Tuning controlPress to enter MHz Mode {page 16}. In this mode,you can change the operating frequency in 1 MHzsteps using the Tuning control or Mic [UP]/[DWN].Press and hold for 1 second while in VFO Mode tobegin MHz Scan {page 41} or while in MR Mode tobegin Group Scan {page 42}.Press [F] then press [MENU] to enter Menu Mode{page 18}.Turn to select:•Operating frequencies when in VFO Mode {page 15}.•Memory Channels when in Memory Recall Mode{page 30}.•Menu Nos. when in Menu Mode {page 18}.•Scan direction while scanning {pages 27, 39, 47, 49}.eeeeeCALL keyPress to recall the Call Channel {page 35}. Pressand hold for 1 second while in VFO Mode to beginCall/VFO Scan {page 43}. Press and hold for1 second while in Memory Recall Mode to begin Call/Memory Scan {page 43}.Press [F] then press [CALL] to activate the Tone{page 24}, CTCSS {page 46}, or DCS {page 48}function.rrrrrVFO keyPress to enter VFO Mode {page 15}. In this mode,you can change the operating frequency using theTuning control or Mic [UP]/[DWN]. Press and holdfor 1 second while in VFO Mode to begin Band Scan{page 40}. Press and hold for 1 second while in VFOMode after programming a scan range to beginProgram Scan {page 40}.

103In MR Mode, press [F] then press [VFO] to transferthe contents of the selected Memory Channel to theVFO {page 33}.tttttMR keyPress to enter Memory Recall Mode {page 30}. Inthis mode, you can change memory channels usingthe Tuning control or Mic [UP]/[DWN]. Press andhold for 1 second while in Memory Recall Mode tobegin Memory Scan {page 42}.Press [F] then press [MR] to reprogram the CallChannel or a Memory Channel.yyyyyREV keyPress to switch the transmit frequency and receivefrequency when operating with an offset {page 23} oran odd-split Memory Channel {page 28}.Press [F] then press [REV] and rotate the Tuningcontrol to increase or decrease the squelch level.uuuuu/F keyPress and hold for 1 second to lock the transceiverkeys.Press momentarily to access the second functions ofthe transceiver keys.DISPLAYiuytrqwe!1!2!4 !3o!5!6!7!0qAppears when the CTCSS function is activated {page 46}.w Appears when the Tone function is activated {page 24}.eAppears when the DCS function is activated {page 48}.rAppears when the repeater shift function is activated{pages 23, 30}. (“ ” is not used on this transceiver.)tAppears when the Reverse function is activated {page 26}.

113yAppears when the Automatic Simplex Check (ASC)function is activated {page 26}.uAppears when the Priority Scan function is activated{page 43}.iAppears when the Weather Alert function is activated{page 36}. (K market models only.)oAppears when narrow FM Mode is selected {page 60}.!0Displays the frequencies, Menu settings, Memory nameand other information.!1Displays the Menu No., Memory Channel number, andstatus {pages 18, 29}.!2Appears when the displayed Memory Channel has data{page 29}.!3Appears when the Key Lock function is ON {page 58}.!4Appears when the Memory Channel Lockout function isON {page 44}.!5Shows the strength of transmitted {page 15} and received{page 54} signals. indicates the squelch is open and the frequency is“busy”. It also appears when the squelch is set tominimum {page 14}. If using CTCSS or DCS, it indicatesthe squelch is open due to a received signal thatcontains the same CTCSS tone or DCS code that is setin your transceiver. acts as an S-meter whilereceiving and an RF power meter while transmitting. indicates the transceiver is transmitting.!6Appears when the function key is pressed.!7H appears when high power transmission is selectedand L appears when low power is selected {page 15}.(“M” is not used on this transceiver.)

123REAR PANELq w e rqqqqqAntenna connectorConnect an external antenna {page 5} here. Whenmaking test transmissions, connect a dummy load inplace of the antenna. The antenna system or loadshould have an impedance of 50 Ω.Note: E market models use an N-type antenna connector whileother models use an M-type (SO-239) connector.wwwwwData cable (E market versions only)Connect this cable to a TNC {page 7}.eeeeePower Input 13.8 V DC cableConnect a 13.8 V DC power source here. Use thesupplied DC power cable {pages 3, 4}.rrrrrSP (speaker) jackIf desired, connect an optional external speaker forclearer audio. This jack accepts a 3.5 mm (1/8")mono (2-conductor) plug. See page 6.MICROPHONEqqrtyuiweqqqqqPTT (Push-to-Talk) switchPress and hold to transmit. Release to receive.wwwwwDWN/ keyPress to lower the operating frequency, MemoryChannel number, Menu Number, etc. Hold down torepeat the action. Also press to switch betweenvalues for functions with multiple choices. Press andhold Mic [PTT], then press [DWN/ ] to transmit .eeeeeUP/ keyPress to raise the operating frequency, MemoryChannel number, Menu Number, etc. Hold down torepeat the action. Also press to switch betweenvalues for functions with multiple choices. Press andhold Mic [PTT], then press [UP/ ] to transmit .KMC-32 KMC-30

133rrrrrCALL/A keyIdentical to the front panel CALL key. This key canbe reprogrammed if desired {page 59}. Press andhold Mic [PTT], then press [CALL/A] to transmit A.tttttVFO/B keyIdentical to the front panel VFO key. This key can bereprogrammed if desired {page 59}. Press and holdMic [PTT], then press [VFO/B] to transmit B.yyyyyMR/C keyIdentical to the front panel MR key. This key can bereprogrammed if desired {page 59}. Press and holdMic [PTT], then press [MR/C] to transmit C.uuuuuPF/D keyThe default function of this key is 1 MHz step. Thiskey can be reprogrammed if desired {page 59}.Press and hold Mic [PTT], then press [PF/D] totransmit D.iiiiiDTMF keypadThis 16-key keypad is used for DTMF functions{page 50} or to directly enter an operating frequency{page 16}, or a Memory Channel number {page 30}.The keypad can also be used to program a MemoryChannel name, Power-on message, or othercharacter strings {page 63}.MIC KEYPAD DIRECT ENTRYThe microphone keypad (keypad models only) allowsyou to make various entries depending on which modethe transceiver is in.In VFO or Memory Recall mode, use the Mic keypad toselect a frequency {page 16} or Memory Channelnumber {page 30}. First press the Mic PF key assignedthe ENTER function {page 59}.To manually send a DTMF number, press and hold Mic[PTT], then press the DTMF keys on the Mic keypad{page 50} in sequence.You can also use the Mic keypad to program a MemoryChannel name, Power-on message, or other characterstrings {page 63}.

144OPERATING BASICSSWITCHING THE POWER ON/OFF1Press [ ] (Power) to switch the transceiver power ON.•A high pitched double beep sounds and a Power-onmessage {page 60} appears briefly, followed by thefrequency and other indicators.2To switch the transceiver OFF, press [ ] (Power) (1s).•When you turn the transceiver OFF, a low pitcheddouble beep sounds.•The transceiver stores the current frequency andparameters when it is turned OFF and recalls theseparameters the next time you turn the transceiver ON.ADJUSTING THE VOLUMETurn the Volume control clockwise to increase the audiooutput level and counterclockwise to decrease the outputlevel.•If you are not receiving a signal, press the Mic PF keyassigned the MONI function {page 59}, then adjust theVolume control to a comfortable audio output level. Pressthe MONI key again to cancel the Monitor function.ADJUSTING THE SQUELCHThe purpose of Squelch is to mute the speaker when nosignals are present. With the squelch level correctly set,you will hear sound only while actually receiving signals.The higher the selected squelch level, the stronger thesignals must be to receive.The appropriate squelch level depends on the ambientRF noise conditions.1Press [F], [REV].•The current squelch level appears.2Turn the Tuning control to adjust the level.•Select the level at which the background noise is justeliminated when no signal is present.•The higher the level, the stronger the signals must be toreceive.•10 different levels can be set.(0: Minimum ~ 9: Maximum; 1 is the default value)3Press any key other than [ ] (Power) to store thenew setting and exit the squelch adjustment.

154TRANSMITTING1To transmit, hold the microphone approximately 5 cm(2 inches) from your mouth, then press and hold Mic[PTT] and speak into the microphone in your normaltone of voice.•“ ” and the RF Power meter appears. The RFPower meter shows the relative transmit output power().•If you press Mic [PTT] while you are outside thetransmission coverage, a high pitched error beepsounds.2When you finish speaking, release Mic [PTT].Note: If you continuously transmit for longer than the time specified inMenu No. 21 (default is 10 minutes) {page 62}, the internal time-outtimer generates a warning beep and the transceiver stops transmitting.In this case, release Mic [PTT] and let the transceiver cool down for awhile, then press Mic [PTT] again to resume transmission.SELECTING AN OUTPUT POWERYou can configure different power levels for transmission.1Press [F], [MENU] and turn the Tuning control toselect Menu No. 6 (TXP).2Press [MENU] and turn the Tuning control to select“H” (high; default) or “L” (low) power.3Press [MENU] to store the setting or any other key tocancel.4Press any key other than [MENU] to exit Menu Mode.◆Do not transmit at high output power for an extended period oftime. The transceiver could overheat and malfunction.◆Continuous transmission causes the heat sink to overheat. Nevertouch the heat sink when it may be hot.Note: When the transceiver overheats because of ambient hightemperature or continuous transmission, the protective circuit mayfunction to lower transmit output power.SELECTING A FREQUENCYVFO MODEThis is the basic mode for changing the operatingfrequency. To enter VFO Mode, press [VFO].Turn the Tuning control clockwise to increase thefrequency and counterclockwise to decrease thefrequency, or use Mic [UP]/[DWN].

164MHZ MODEIf the desired operating frequency is far away from thecurrent frequency, it is quicker to use the MHz TuningMode.To adjust the MHz digit:1While in VFO or Call Mode, press [MENU].•The MHz digit blinks.2Turn the Tuning control to select the desired MHzvalue.3Press any key to set the selected frequency andreturn to normal VFO Mode.4Continue adjusting the frequency as necessary, usingthe Tuning control or Mic [UP]/[DWN].DIRECT FREQUENCY ENTRYIn addition to turning the Tuning control or pressing Mic[UP]/[DWN], there is another way to select thefrequency. When the desired frequency is far away fromthe current frequency, you can directly enter a frequencyusing the Mic keypad (keypad models only).1Press [VFO].•You must be in VFO mode to make a direct frequencyentry.2Press the Mic PF key assigned the ENTER function{page 59}.3Press the numeric keys ([0] to [9]) to enter yourdesired frequency.•Pressing Mic [Enter] fills all remaining digits (the digitsyou did not enter) with 0 and completes the entry. Forexample, to select 145.000 MHz, press [1], [4], [5] andpress Mic [Enter] to complete the entry.•If you want to revise the MHz digits only, leaving the kHzdigits as they are, press Mic [VFO] in place of [Enter].

174Example 1To enter 145.750 MHz:Key in Display[Enter] – –– –––[1], [4], [5] 1 4 5. – – –[7], [5], [0] 1 4 5. 7 5 0Example 2To enter 145.000 MHz:Key in Display[Enter] – –– –––[1], [4], [5] 1 4 5. – – –[Enter] 1 4 5. 0 0 0Example 3To change 144.650 MHz to 145.650 MHz:Key in Display1 4 4. 6 5 0[Enter] – –– –––[1], [4], [5] 1 4 5. – – –Mic [VFO] 1 4 5. 6 5 0Note: If the entered frequency does not match the current frequencystep size, the frequency is automatically rounded down to the nextavailable frequency. When the desired frequency cannot be enteredexactly, confirm the frequency step size {page 56}.

185MENU SETUPWHAT IS A MENU?Many functions on this transceiver are selected orconfigured via a software-controlled Menu rather thanthrough the physical controls of the transceiver. Onceyou become familiar with the Menu system, you willappreciate its versatility. You can customize the varioustimings, settings, and programming functions on thistransceiver to meet your needs without using manycontrols and switches.MENU ACCESS1Press [F], [MENU].•A brief explanation of the menu, and the setting andMenu No. appear on the display.Menu Name Setting Menu Number2Turn the Tuning control to select your desired Menu.•As you change the Menu No., a brief explanation ofeach menu appears along with its current parameter.3Press [MENU] to configure the parameter of thecurrently selected Menu No.4Turn the Tuning control to select your desiredparameter.5Press [MENU] to store the new setting or any otherkey to cancel.6Press any key other than [MENU] to exit Menu Mode.

195MENU FUNCTION LISTehtnOyalpsiduneM.oN noitcnuF snoitceleS tluafeD .feRegaPPTS1 ezispetsycneuqerF /05/03/52/02/51/5.21/01/52.6/5/5.2zHk001ees(seiraV)egapecnerefer 65T2 ycneuqerfenoTzH1.452~0.765.8842TC3 ycneuqerfSSCTCzH1.452~0.765.8874SCD4edocSCD457~32032084TFS5 noitceridtfihS–/+/FFOFFO32PXT6 rewopnoissimsnarTwoL/hgiHhgiH51OFV.P7 OFVelbammargorPzHM371~631zHM371~63116QSS8 hcleuqsreteM-SFFO/NOFFO45HQS9 emitgnahhcleuqSsm005/052/521/FFOFFO55TESFFO01ycneuqerftesfforetaepeRzHM59.96~0 ees(seiraV)egapecnerefer 32ORA11tesffOretaepeRcitamotuAFFO/NO ees(seiraV)egapecnerefer 52IRP21nacSytiroirPFFO/NOFFO34NACS31dohtememuseRnacSES/OC/OTOT54TUO.L41tuokcoLlennahCyromeMFFO/NOFFO44HC.M51yticapaclennahCyromeM002/00100182EMAN.M61emaNyromeMsretcarahc6–23FDM71ycneuqerF/emaNyromeMyalpsid QRF/NMNM23OPA81ffo-rewoPcitamotuA.nim081/021/09/06/03/FFOFFO45

205ehtnOyalpsiduneM.oN noitcnuF snoitceleS tluafeD .feRegaPKC91yekLLAC0571/LLAC ees(seiraV)egapecnerefer 53,52DLH02dlohXTenotzH0571FFO/NOFFO52TOT12remiTtuo-emiT.nim01/5/30126LCB22tuokcoLlennahCysuBFFO/NOFFO65GSM.NO.P32egassemno-rewoPsretcarahc6–06PB42peeBFFO/NONO55SB52tfihStaeBFFO/NOFFO45NMF62MFworraNFFO/NOFFO06CNE72kcollortnocgninuTFFO/NOFFO85RM.FMTD82relaidcitamotuAstigid61otpU–15DPS92deepsXTFMTDLS/AFAF25H.TD03dlohXTFMTDFFO/NOFFO15AP13doirepesuapFMTDsm0002/0051/0001/057/005/052/00100535L.TD23kcolyekFMTDFFO/NOFFO35M.TD33rotinomFMTDFFO/NOFFO05L.CM43kcolyekenohporciMFFO/NOFFO461FP53elbammargorpenohporciMyeknoitcnuf/LLAC/RM/OFV/0571/RETNE/INOM/NI.C/NI.M/V--M/LQS/VER/ZHM/KCOL/THGIRB/WOL/TFIHS/UNEMPETS/ENOTZHM95

215ehtnOyalpsiduneM.oN noitcnuF snoitceleS tluafeD .feRegaP2FP63elbammargorpenohporciMyeknoitcnuf/LLAC/RM/OFV/0571/RETNE/INOM/NI.C/NI.M/V--M/LQS/VER/ZHM/KCOL/THGIRB/WOL/TFIHS/UNEMPETS/ENOTRM953FP73elbammargorpenohporciMyeknoitcnuf/LLAC/RM/OFV/0571/RETNE/INOM/NI.C/NI.M/V--M/LQS/VER/ZHM/KCOL/THGIRB/WOL/TFIHS/UNEMPETS/ENOTOFV954FP83elbammargorpenohporciMyeknoitcnuf/LLAC/RM/OFV/0571/RETNE/INOM/NI.C/NI.M/V--M/LQS/VER/ZHM/KCOL/THGIRB/WOL/TFIHS/UNEMPETS/ENOTLLAC95TD93deepsXTataDspb0069/0021002185THGIRB04ssenthgirbyalpsiD— levelmumixaM75RBA14ssenthgirbyalpsidcitamotuAFFO/NOFFO75AXW124trelArehtaeWFFO/NOFFO63TESER99noitcelesteseRLLUF/OFVOFV761 WXA (Weather Alert) is available only for K market models.

226OPERATING THROUGH REPEATERSRepeaters, which are often installed and maintained byradio clubs, are usually located on mountain tops orother elevated locations. They generally operate athigher ERP (Effective Radiated Power) than a typicalstation. This combination of elevation and high ERPallows communications over much greater distancesthan communicating without using repeaters.Most repeaters use a receive and transmit frequencypair with a standard or non-standard offset (odd-split).In addition, some repeaters must receive a tone from thetransceiver to be accessed. For details, consult yourlocal repeater reference.TX: 144.725 MHzTX tone: 88.5 HzRX: 145.325 MHzTX: 144.725 MHzTX tone: 88.5 HzRX: 145.325 MHzOFFSET PROGRAMMING FLOWqwertSelect a receive frequency.Select an offset direction.Select an offset frequency(only when programming odd-split repeater frequencies).Activate the Tone function (if necessary).Select a tone frequency (if necessary).If you store all the above data in a Memory Channel, youwill not need to reprogram the parameters every time.Refer to “MEMORY CHANNELS” {page 28}.

236PROGRAMMING AN OFFSETYou must first select an amateur radio repeater downlinkfrequency as described in “SELECTING AN OFFSETFREQUENCY”.SELECTING AN OFFSET DIRECTIONSelect whether the transmit frequency will be higher (+)or lower (–) than the receive frequency.1Press [F], [MENU] and turn the Tuning control toselect Menu No. 5 (SFT).2Press [MENU] and turn the Tuning control to select“+” or “–”.3Press [MENU] to store the setting or any other key tocancel.4Press any key other than [MENU] to exit Menu Mode.•“+” or “–” appears above the frequency, indicating whichoffset direction is selected.If the offset transmit frequency falls outside the allowablerange, transmission is inhibited. In this case, adjust thereception frequency so that the transmit frequency iswithin the band limits or change the offset direction.Note: While using an odd-split memory channel or transmitting, youcannot change the offset direction.SELECTING AN OFFSET FREQUENCYTo access a repeater which requires an odd-splitfrequency pair, change the offset frequency from thedefault which is used by most repeaters. The defaultoffset frequency is 600 kHz.1Press [F], [MENU] and turn the Tuning control toselect Menu No. 10 (OFFSET).2Press [MENU] and turn the Tuning control to selectthe appropriate offset frequency.•The selectable range is from 0.00 MHz to 69.95 MHz insteps of 50 kHz.3Press [MENU] to store the setting or any other key tocancel.4Press any key other than [MENU] to exit Menu Mode.Note: After changing the offset frequency, the new offset frequencywill also be used by Automatic Repeater Offset.

246ACTIVATING THE TONE FUNCTIONTo activate Tone, press [F], [CALL].•As you press [F], [CALL], the selection cycles as follows:“OFF” ➞ “TONE” ➞ “CTCSS” ➞ “DCS” ➞ “OFF”.•“T” appears on the upper part of display, indicating that theTone function is activated.Note: You cannot use the Tone function and CTCSS/ DCS functionssimultaneously. Switching the Tone function ON after having activatedthe CTCSS/ DCS functions deactivates the CTCSS/ DCS functions.E market version only: When you access repeaters that require a1750 Hz tone, you do not need to activate the Tone function. Simplypress [CALL] without pressing Mic [PTT] to transmit a 1750 Hz tone(default setting).SELECTING A TONE FREQUENCY1Press [F], [MENU] and turn the Tuning control toselect Menu No. 2 (T).2Press [MENU] and turn the Tuning control to selectthe desired tone frequency (default is 88.5 Hz).3Press [MENU] to store the setting or any other key tocancel.4Press any key other than [MENU] to exit Menu Mode.Available Tone Frequencies)zH(seicneuqerFenoT240.764.582.7015.6318.3711.8123.965.889.0113.1419.9717.5229.175.198.4112.6412.6811.9224.478.498.8114.1518.2916.3320.774.790.3217.6515.3028.1427.970.0013.7212.2615.6023.0525.285.3018.1319.7617.0121.452Note: 42 different tones are available for the transceiver. These42 tones includes 37 EIA standard tones and 5 non-standard tones.E market version only:◆To transmit a 1750 Hz tone, simply press [CALL] without pressingMic [PTT] (default setting). Release [CALL] to quit transmitting.You can also make the transceiver remain in the transmit mode for2 seconds after releasing [CALL]; a 1750 Hz tone is notcontinuously transmitted. Access Menu No. 20 (HLD) and select“ON”.◆To use [CALL] for recalling the Call Channel in place oftransmitting a 1750 Hz tone, access Menu No. 19 (CK) and select“CALL”.

256AUTOMATIC REPEATER OFFSETThis function automatically selects an offset direction,according to the frequency on the VHF band. Thetransceiver is programmed for an offset direction asshown below. To obtain an up-to-date band plan forrepeater offset direction, contact your national AmateurRadio association.K market version only+––– +SSSS144.0 145.5 146.4 147.0 147.6145.1 146.0 146.6 147.4 148.0 MHzS: SimplexThis complies with the standard ARRL band plan.E market version onlySSS: Simplex–144.0 146.0 MHz145.8145.6Note: Automatic Repeater Offset does not function when the Reversefunction is ON. However, pressing [REV] after Automatic RepeaterOffset has selected an offset (split) status, exchanges the receive andtransmit frequencies.1Press [F], [MENU] and turn the Tuning control toselect Menu No. 11 (ARO).2Press [MENU] and turn the Tuning control to switchthe function “ON” (default) or “OFF”.3Press [MENU] to store the setting or any other key tocancel.4Press any key other than [MENU] to exit Menu Mode.TRANSMITTING A 1750 Hz TONEMost of the repeaters in Europe require the transceiverto transmit a 1750 Hz tone. On E market versions,simply pressing [CALL] causes the transceiver totransmit a 1750 Hz tone. (On other market versions,pressing [CALL] changes the transceiver to the CallChannel {page 35}.)To change the setting of the CALL key:1Press [F], [MENU] and turn the Tuning control toselect Menu No. 19 (CK).2Press [MENU] and turn the Tuning control to select“CALL” or “1750”.3Press [MENU] to store the setting or any other key tocancel.4Press any key other than [MENU] to exit Menu Mode.Some repeaters in Europe must receive continuoussignals for a certain period of time, following a 1750 Hztone. This transceiver is also capable of remaining in thetransmit mode for 2 seconds after transmitting the tone.1Press [F], [MENU] and turn the Tuning control toselect Menu No. 20 (HLD).2Press [MENU] and turn the Tuning control to select“ON”.3Press [MENU] to store the setting or any other key tocancel.4Press any key other than [MENU] to exit Menu Mode.

266REVERSE FUNCTIONThe reverse function exchanges a separate receive andtransmission frequency. So, while using a repeater, youcan manually check the strength of a signal that youreceive directly from the other station. If the station’ssignal is strong, both stations should move to a simplexfrequency and free up the repeater. To swap the transmit and receive frequencies:Press [REV] to switch the Reverse function ON (orOFF).• “R” appears when the function is ON.Note:◆You can turn the Reverse function ON when you are operating inSimplex Mode. However, it does not change the Transmission/Reception frequencies.◆If pressing [REV] places the reception frequency outside theallowable range, an error tone sounds and the function does notoperate.◆If pressing [REV] places the transmission frequency outside theallowable range, pressing Mic [PTT] causes an error tone tosound and transmission is inhibited.◆You cannot switch Reverse ON or OFF while transmitting.AUTOMATIC SIMPLEX CHECK (ASC)While using a repeater, the ASC function periodicallychecks the strength of the signal you are receiving fromthe other station. If the station’s signal is strong enoughto allow direct contact without a repeater, the “ ”indicator starts blinking.Press [REV] (1s) to switch the function ON (or OFF).•“ ” appears when the function is ON.•While direct contact is possible, “ ” blinks.REV ON144.725 MHz145.325 MHz144.725 MHzTX: 144.725 MHz TX: 144.725 MHzRX: 145.325 MHz RX: 145.325 MHzTX: 144.725 MHz TX: 145.325 MHzRX: 145.325 MHz RX: 144.725 MHz

276Note:◆Pressing [PTT] causes the “ ” icon to quit blinking.◆ASC can be activated while operating in Simplex mode. However,it does not change the Transmission/Reception frequencies.◆ASC does not function while scanning.◆Activating ASC while using Reverse switches Reverse OFF.◆If you recall a Memory Channel or the Call Channel that containsa Reverse ON status, ASC is switched OFF.◆ASC causes received audio to be momentarily intermitted every3 seconds.TONE FREQUENCY ID SCANThis function scans through all tone frequencies to identifythe incoming tone frequency on a received signal. Youcan use this function to determine which tone frequency isrequired by accessing your local repeater.1Press [F], [MENU] and turn the Tuning control toselect Menu No. 2 (T).2Press [MENU] (1s) to start the Tone Frequency IDScan.•When the transceiver receives a signal, scan starts.The decimal point blinks during scan.•While the transceiver is receiving a signal during ToneFrequency ID Scan, the signal is emitted from thespeaker.•To reverse the scan direction, turn the Tuning control.•To quit the function, press any key.•When the tone frequency is identified, a beep soundsand the identified frequency blinks.3Press [MENU] to program the identified tonefrequency in place of the current tone frequency orpress any other key to exit the Tone Frequency IDScan.•Turn the Tuning control while the identified tonefrequency is blinking to resume scanning.4Press any key other than [MENU] to exit Menu Mode.Note:◆Some repeaters do not re-transmit the access tone in thedownload signal. In this case, check the other station’s uplinksignal to detect the repeater access tone.◆The transceiver continues to check the Weather Alert Channeland Priority Channel during Tone Frequency ID Scan.

287MEMORY CHANNELSIn Memory Channels, you can store frequencies andrelated data that you frequently use so that you do notneed to reprogram that data every time. You can quicklyrecall a programmed channel through simple operation.A total of 200 Memory Channels (100 when using theMemory Name function) are available for storingfrequencies, modes, and other operating conditions.NUMBER OF MEMORY CHANNELSThe transceiver must be configured to either 200Memory Channels without using the Memory Namefunction or 100 Memory Channels with the MemoryName function (default).To change the Memory Channel capacity:1Press [F], [MENU] and turn the Tuning control toselect Menu No. 15 (M.CH).2Press [MENU] and turn the Tuning control to selecteither “100” (default) or “200”.3Press [MENU].•“SURE ?” appears.4Press [MENU] to accept or press any other key tocancel.Note:◆If you change the Memory Channel capacity from 200 channels to100 channels after having stored data in channels 100 to 199, allMemory Channel data in channels 100 to 199 will be erased.◆If you change the Memory Channel capacity from 100 channels to200 channels after storing Memory Names in those channels, theMemory Name data will be erased.SIMPLEX & REPEATER OR ODD-SPLIT MEMORYCHANNEL?You can use each Memory Channel as a simplex &repeater channel or an odd-split channel. Store only onefrequency to use as a simplex & repeater channel or twoseparate frequencies to use as an odd-split channel.Select either application for each channel depending onthe operations you have in mind.Simplex & repeater channels allow:•Simplex frequency operation•Repeater operation with a standard offset (if an offsetdirection is stored)Odd-split channels allow:•Repeater operation with a non-standard offsetNote: Not only can you store data in Memory Channels, but you canalso overwrite existing data with new data.

297The data listed below can be stored in each MemoryChannel:retemaraP &xelpmiSretaepeR tilpS-ddOycneuqerfevieceR seY seYycneuqerftimsnarTseYycneuqerfenoTseYseYNOenoTseYseYycneuqerfSSCTCseYseYNOSSCTCseYseYedocSCDseYseYNOSCDseYseYnoitceridtesffOseYA/NycneuqerftesffOseYA/NNOesreveRseYA/NezispetsycneuqerFseYseYMFdnabworraNseYseYtfihStaeBseYseYtuokcollennahCyromeMseYseYemanlennahCyromeMseYseYYes: Can be stored in memory.N/A: Cannot be stored in memory.Note:◆Memory Channel Lockout cannot be set to the Program ScanMemory (L0/U0 ~ L2/U2), the Priority Channel (Pr), or theWeather Alert Channel (AL).◆Tone, CTCSS, and DCS are automatically turned OFF whensetting up the Weather Alert Channel (AL).STORING SIMPLEX FREQUENCIES OR STANDARDREPEATER FREQUENCIES1Press [VFO].2Turn the Tuning control to select your desiredfrequency.•You can also directly enter a desired frequency usingthe keypad {page 13}.3If storing a standard repeater frequency, select thefollowing data:•Offset direction {page 23}•Tone function, if necessary {page 24}•CTCSS/ DCS function, if necessary {pages 46, 48}If storing a simplex frequency, you may select otherrelated data (CTCSS or DCS settings, etc.).4Press [F].•A Memory Channel number appears and blinks.•“ ” appears if the channel contains data.

307•Memory Channel numbers L0/U0 ~ L2/U2 {page 40}, Pr{page 43}, and AL (Weather Alert) {page 36} (K marketmodels only) are reserved for other functions.5Turn the Tuning control or press Mic [UP]/[DWN] toselect the Memory Channel in which you want tostore the data.6Press [MR] to store the data to the channel.STORING ODD-SPLIT REPEATER FREQUENCIESSome repeaters use a pair of reception and transmissionfrequencies with a non-standard offset. If you store twoseparate frequencies in a Memory Channel, you canoperate on those repeaters without programming theoffset frequency and direction.1Store the desired reception frequency and relateddata by following steps 1 to 6 given for simplex orstandard repeater frequencies {page 29}.2Turn the Tuning control or press Mic [UP]/[DWN] toselect your desired transmit frequency.3Press [F].4Turn the Tuning control or press Mic [UP]/[DWN] toselect the pre-programmed reception MemoryChannel in which you want to store the data.5Press [MR] (1s).•The transmission frequency is stored in the memorychannel.Note:◆When you recall an odd-split memory channel, “+” and “–” appearon the display. To confirm the transmission frequency, press[REV].◆Transmit offset status and reverse status are not stored inodd-split memory channels.RECALLING A MEMORY CHANNELUSING THE TUNING CONTROL1Press [MR] to enter Memory Recall mode.•The Memory Channel last used is recalled.2Turn the Tuning control to select your desiredMemory Channel.•You cannot recall an empty Memory Channel.•To restore VFO mode, press [VFO].

317USING THE MICROPHONE KEYPADYou can also recall a Memory Channel by entering adesired Memory Channel number with the microphonekeypad.1Press [MR] to enter Memory Recall mode.2Press the microphone key assigned the ENTERfunction.3Enter the channel number using the microphonekeypad.•For single-digit channel numbers, enter “0” first or pressMic [Enter] after entering the channel number.•For two-digit channel numbers that begin with “1”, pressMic [Enter] after entering the channel number.Note:◆You cannot recall an empty Memory Channel. An error beepsounds.◆You cannot recall the Program Scan Memory Channels(L0/U0 ~ L2/U2), the Priority Channel (Pr), and the Weather AlertChannel (AL) (K market models only) using the numeric keypad.◆When you recall an odd-split memory channel, “+” and “–” appearon the display. Press [REV] to display the transmissionfrequency.◆After recalling a Memory Channel, you may modify data such asNarrow Band, Tone, or CTCSS. However, these settings arecleared once you select another channel or the VFO Mode. Topermanently store the data, overwrite the channel contents.CLEARING A MEMORY CHANNELTo erase an individual Memory Channel:1Recall the Memory Channel you want to erase.2Press [ ] (Power) (1s) to switch the transceiverOFF.3Press [MR]+[ ] (Power).•An erase confirmation message appears.4Press [MR] to erase the channel data.•The contents of the Memory Channel are erased.•To quit clearing the Memory Channel, press any keyother than [MR].Note:◆You can also clear the Priority Channel, the AL Channel, andL0/U0 ~ L2/U2 data. (The Call Channel cannot be cleared.)◆To clear all Memory Channel contents at once, perform Full Reset{page 67}.◆You cannot clear channels while in Channel Display Mode.

327NAMING A MEMORY CHANNELYou can name Memory Channels using up to 6alphanumeric characters. When you recall a namedMemory Channel, its name appears on the display inplace of the stored frequency. Names can be call signs,repeater names, cities, names of people, etc. In order touse the Memory Name function, the Memory Channelcapacity must be set to 100 channels. To change theMemory Channel capacity from 200 to 100, accessMenu No. 15 (M.CH) {page 28}.1Press [MR] and turn the Tuning control to recall yourdesired Memory Channel.2Press [F], [MENU] and turn the Tuning control toselect Menu No. 16 (M.NAME).3Press [MENU].•A blinking cursor appears.4Turn the Tuning control to select a desiredalphanumeric character.•You can enter the following alphanumeric characters:0 ~ 9, A ~ Z, – (hyphen), / (slash), and a space.•Rather than using the Tuning control, you can use theMic keypad (keypad models only) to enter alphanumericcharacters {page 64}.5Press [MR].•The cursor moves to the next digit.•To move to the previous digit, press [VFO]. To deletethe character at the current cursor position, press [F].6Repeat steps 4 and 5 to enter up to 6 digits.7Press [MENU] to complete the entry.•Press any key other than [MR], [VFO], [F], and [MENU]to cancel the entry.•To complete an entry of less than 6 characters, press[MENU] two times.8Press any key other than [MENU] to exit Menu Mode.After storing a Memory Name, the Memory Nameappears in place of the operating frequency. However,you can still display the operating frequency, if desired.To display the frequency rather than Memory Name,access Menu No. 17 (MDF) and select “FRQ”. Thismenu toggles the display mode between the MemoryName (“MN”) and frequency display (“FRQ”).Note:◆You cannot name the Call Channel {page 35}.◆You cannot assign a Memory Name to a channel that does notcontain data.◆You can overwrite stored names by repeating steps 1 to 8.◆The stored name is erased when you clear the Memory Channeldata.

$337MEMORY CHANNEL TRANSFERMEMORY \ VFO TRANSFERAfter retrieving frequencies and associated data fromMemory Recall Mode, you can copy the data to the VFO.This function is useful, for example, when the frequencyyou want to monitor is near the frequency stored in aMemory Channel.1Press [MR], then turn the Tuning control or press Mic[UP]/[DWN] to recall the desired Memory Channel.•Alternatively, press [CALL] to select the Call Channel.2Press [F], [VFO] to copy the Memory Channel data tothe VFO.Note:◆To copy an odd-split channel data {page 30}, press [REV] beforeperforming the transfer.◆You can also transfer the Program Scan memory channels(L0/U0 ~ L2/U2), the Priority Channel (Pr), and the Weather AlertChannel (AL) (K market models only) to the VFO.◆Lockout status and Memory Names are not copied from aMemory Channel to the VFO.CHANNEL \ CHANNEL TRANSFERYou can copy channel information from one MemoryChannel to another. This function is useful when storingfrequencies and associated data that you temporarilychange in Memory Recall Mode.1Press [MR], then turn the Tuning control or press Mic[UP]/[DWN] to recall the desired Memory Channel.2Press [F].3Select the Memory Channel where you would like thedata copied by using the Tuning control or pressingMic [UP]/[DWN].4Press [MR].$