LG Electronics USA D290N Cellular/PCS GSM/EDGE Phone with WLAN, Bluetooth and RFID User Manual
LG Electronics MobileComm USA, Inc. Cellular/PCS GSM/EDGE Phone with WLAN, Bluetooth and RFID Users Manual
Users Manual

ENGLISH
MFL00000000 (1.0)
User Guide
LG-D290n
www.lg.com

2CTVUVCVGOGPV
&KDQJHRU0RGLILFDWLRQVWKDWDUHQRWH[SUHVVO\DSSURYHGE\WKHPDQXIDFWXUHUFRXOGYRLG
WKHXVHUVDXWKRULW\WRRSHUDWHWKHHTXLSPHQW
2CTVUVCVGOGPV
7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWKWKHOLPLWVIRUDFODVV%GLJLWDO
GHYLFHSXUVXDQWWR3DUWRIWKH)&&5XOHV7KHVHOLPLWVDUHGHVLJQHGWRSURYLGH
UHDVRQDEOHSURWHFWLRQDJDLQVWKDUPIXOLQWHUIHUHQFHLQDUHVLGHQWLDOLQVWDOODWLRQ7KLV
HTXLSPHQWJHQHUDWHVXVHVDQGFDQUDGLDWHUDGLRIUHTXHQF\HQHUJ\DQGLIQRWLQVWDOOHGDQG
XVHGLQDFFRUGDQFHZLWKWKHLQVWUXFWLRQVPD\FDXVHKDUPIXOLQWHUIHUHQFHWRUDGLR
FRPPXQLFDWLRQV+RZHYHUWKHUHLVQRJXDUDQWHHWKDWLQWHUIHUHQFHZLOOQRWRFFXULQD
SDUWLFXODULQVWDOODWLRQ,IWKLVHTXLSPHQWGRHVFDXVHKDUPIXOLQWHUIHUHQFHRUWHOHYLVLRQ
UHFHSWLRQZKLFKFDQEHGHWHUPLQHGE\WXUQLQJWKHHTXLSPHQWRIIDQGRQWKHXVHULV
HQFRXUDJHGWRWU\WRFRUUHFWWKHLQWHUIHUHQFHE\RQHRUPRUHRIWKHIROORZLQJPHDVXUHV
5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD
,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKH HTXLSPHQWDQGUHFHLYHU
&RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLWGLIIHUHQWIURPWKDWWRZKLFKWKH
UHFHLYHULVFRQQHFWHG
&RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLR79WHFKQLFLDQIRUKHOS
Part .19 statement
7KLVGHYLFHFRPSOiesZLWKSDUWRI)&&UXOHV.2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJ
WZRFRQGLWLRQV7KLVGHYLFHPD\QRWFDXVHKDUPIXOLQWHUIHUHQFHDQG
WKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHGLQFOXGLQJ
LQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHGRSHUDWLRQ
$QF[YQTP1RGTCVKQP
7KLVGHYLFHwasWHVWHGIRUtypical ERG\ZRUQRSHUDWLRQVZLWKWKH back of the phone kept
FP LQFKHVEHWZHHQWKHXVHUĜVERG\DQGWKHback of the SKRQH
7RFRPSO\ZLWK)&&5)H[SRVXUH UHTXLUHPHQWVDPLQLPXPVHSDUDWLRQGLVWDQFHRIFP
LQFKHVPXVWEHPDLQWDLQHG betweenWKHXVHUVERG\ and the back of the phone
7KLUGSDUW\EHOWFOLSVKROVWHUVDQGVLPLODUDFFHVVRULHVFRQWDLQLQJ PHWDOOLFFRPSRQHQWVPD\
QRWEHXVHG%RG\ZRUQDFFHVVRULHVWKDWFDQQRWPDLQWDLQFPLQFKHVVHSDUDWLRQ
GLVWDQFHEHWZHHQWKHXVHUVERG\DQGWKHback of SKRQHDQGKDYHQRW EHHQWHVWHGIRU
W\SLFDOERG\ZRUQRSHUDWLRQVPD\QRWFRPSO\ZLWK)&&5)H[SRVXUHOLPLWV DQGVKRXOGEHDYRLGHG
7KLV GHYLFHLVQRWLQWHQGHGIRUVDOHLQWKH86$

User Guide
ENGLISH
• Screen displays and illustrations may differ from those you see
on actual phone.
• Some of the contents of this guide may not apply to your
phone, depending on the software and your service provider.
All information in this document is subject to change without
notice.
• This handset is not suitable for people who have a visual
impairment due to the tap screen keyboard.
• Copyright ©2014 LG Electronics, Inc. All rights reserved. LG
and the LG logo are registered trademarks of LG Group and its
related entities. All other trademarks are the property of their
respective owners.
• Google™, Google Maps™, Gmail™, YouTube™, Hangouts™
and Play Store™ are trademarks of Google, Inc.

2
Guidelines for safe and efficient use .................5
Important notice ...............................................12
Getting to know your phone .............................16
Phone overview ...............................................16
Installing the SIM card and battery ..................18
Charging your phone .......................................20
Using the memory card ...................................21
Locking and unlocking the screen ...................23
Your Home screen .............................................24
Touch screen tips ............................................24
Home screen ...................................................25
Extended home screen ..................................25
Customizing the Home screen .......................26
Returning to recently-used applications...........27
Notifications panel...........................................27
Opening the notifications panel ......................28
Indicator icons on the Status Bar....................28
On-screen keyboard ........................................30
Entering accented letters ...............................30
Google account setup .......................................31
Connecting to Networks and Devices ..............32
Wi-Fi ...............................................................32
Connecting to Wi-Fi networks ........................32
Turning Wi-Fi on and connecting to a Wi-Fi
network ........................................................32
Bluetooth ........................................................33
Sharing your phone's data connection .............34
Wi-Fi Direct .....................................................35
PC connections with a USB cable ....................35
Calls ..................................................................37
Making a call ..................................................37
Calling your contacts .......................................37
Answering and rejecting a call.........................37
Adjusting the in-call volume ............................37
Making a second call ......................................38
Viewing your call logs ......................................38
Call settings ....................................................38
Contacts ............................................................39
Searching for a contact ...................................39
Adding a new contact ......................................39
Favourites contacts .........................................39
Creating a group .............................................40
Messaging .........................................................41
Sending a message .........................................41
Threaded box .................................................42
Changing your message settings .....................42
E-mail ................................................................43
Managing an email account ............................43
Working with account folders ..........................43
Composing and sending email .........................43
Camera and Video .............................................44
Getting to know the viewfinder ........................44
Using the advanced settings ............................45
Taking a quick photo .......................................45
Once you've taken a photo ..............................46
Gesture shot ....................................................47
Table of contents

3
Using Panorama mode ....................................47
Recording a quick video ..................................48
After recording a video ....................................48
From your Gallery ............................................49
Function ............................................................50
Guest Mode .....................................................50
Knock Code .....................................................50
KnockON .........................................................50
QuickMemo+ ..................................................51
Using the QuickMemo+ options .....................52
Viewing the saved QuickMemo+ ...................52
QSlide .............................................................53
Smart Keyboard ..............................................54
Live Zooming ..................................................55
Multimedia ........................................................56
Gallery ............................................................56
Viewing pictures ...........................................56
Playing videos...............................................56
Editing photos ...............................................58
Deleting photos/videos ..................................58
Setting as wallpaper ......................................58
Music ..............................................................58
Playing a song ..............................................58
Add music files to your phone ........................60
Transfer music using Media device (MTP) .......60
FM radio..........................................................61
Utilities ..............................................................62
Setting your alarm ...........................................62
Using your calculator .......................................62
Adding an event to your calendar ....................62
Voice Recorder ................................................63
Recording a sound or voice ...........................63
Tasks ..............................................................63
ThinkFree Viewer .............................................63
Google+ ..........................................................64
Voice Search ...................................................64
Downloads ......................................................64
LG SmartWorld ................................................65
How to Get to LG SmartWorld from Your
Phone ..........................................................65
The Web ............................................................66
Internet ...........................................................66
Using the Web toolbar ...................................66
Viewing webpages ........................................66
Opening a page ............................................66
Bookmarks ...................................................67
History .........................................................67
Chrome ...........................................................67
Viewing webpages ........................................67
Opening a page ............................................67
Syncing with other devices ............................67
Settings .............................................................68
Networks ........................................................68
Sound .............................................................70
Display ............................................................71
General ...........................................................73
PC software (LG PC Suite) ................................76

4
Table of contents
Phone software update ....................................78
About this user guide .......................................79
About this user guide ......................................79
Trademarks .....................................................79
Accessories .......................................................80
Troubleshooting ................................................81
FAQ ....................................................................84

6
Product care and maintenance
WARNING
Only use batteries, chargers and accessories approved for use with this particular phone
model. The use of any other types may invalidate any approval or warranty applying to
the phone and may be dangerous.
• Do not disassemble this unit. Take it to a qualified service technician when repair work is required.
• Repairs under warranty, at LG's discretion, may include replacement parts or boards that are either new or
reconditioned, provided that they have functionality equal to that of the parts being replaced.
• Keep away from electrical appliances such as TVs, radios and personal computers.
• The unit should be kept away from heat sources such as radiators or cookers.
• Do not drop.
• Do not subject this unit to mechanical vibration or shock.
• Switch off the phone in any area where you are required to by special regulations. For example, do not use
your phone in hospitals as it may affect sensitive medical equipment.
• Do not handle the phone with wet hands while it is being charged. It may cause an electric shock and can
seriously damage your phone.
• Do not charge a handset near flammable material as the handset can become hot and create a fire hazard.
• Use a dry cloth to clean the exterior of the unit (do not use solvents such as benzene, thinner or alcohol).
• Do not charge the phone when it is on soft furnishings.
• The phone should be charged in a well ventilated area.
• Do not subject this unit to excessive smoke or dust.
• Do not keep the phone next to credit cards or transport tickets; it can affect the information on the magnetic
strips.
• Do not tap the screen with a sharp object as it may damage the phone.
• Do not expose the phone to liquid or moisture.
• Use accessories like earphones cautiously. Do not touch the antenna unnecessarily.
• Do not use, touch or attempt to remove or fix broken, chipped or cracked glass. Damage to the glass display
due to abuse or misuse is not covered under the warranty.
Guidelines for safe and efficient use

7
• Your phone is an electronic device that generates heat during normal operation. Extremely prolonged, direct
skin contact in the absence of adequate ventilation may result in discomfort or minor burns. Therefore, use
care when handling your phone during or immediately after operation.
• If your phone gets wet, immediately unplug it to dry off completely. Do not attempt to accelerate the drying
process with an external heating source, such as an oven, microwave or hair dryer.
• The liquid in your wet phone, changes the color of the product label inside your phone. Damage to your device
as a result of exposure to liquid is not covered under your warranty.
Efficient phone operation
Electronics devices
All mobile phones may receive interference, which could affect performance.
• Do not use your mobile phone near medical equipment without requesting permission. Avoid placing the
phone over pacemakers, for example, in your breast pocket.
• Some hearing aids might be disturbed by mobile phones.
• Minor interference may affect TVs, radios, PCs etc.
• Use your phone in temperatures between 0ºC and 40ºC, if possible. Exposing your phone to extremely low or
high temperatures may result in damage, malfunction, or even explosion.
Road safety
Check the laws and regulations on the use of mobile phones in the area when you drive.
• Do not use a hand-held phone while driving.
• Give full attention to driving.
• Pull off the road and park before making or answering a call if driving conditions so require.
• RF energy may affect some electronic systems in your vehicle such as car stereos and safety equipment.
• When your vehicle is equipped with an air bag, do not obstruct with installed or portable wireless equipment. It
can cause the air bag to fail or cause serious injury due to improper performance.
• If you are listening to music whilst out and about, please ensure that the volume is at a reasonable level so
that you are aware of your surroundings. This is of particular importance when near roads.

8
Guidelines for safe and efficient use
Avoid damage to your hearing
To prevent possible hearing damage, do not listen at high volume levels for long
periods.
Damage to your hearing can occur if you are exposed to loud sound for long periods of time. We therefore
recommend that you do not turn on or off the handset close to your ear. We also recommend that music and call
volumes are set to a reasonable level.
• When using headphones, turn the volume down if you cannot hear the people speaking near you, or if the
person sitting next to you can hear what you are listening to.
NOTE: Excessive sound pressure from earphones and headphones can cause hearing
loss.
Glass Parts
Some parts of your mobile device are made of glass. This glass could break if your mobile device is dropped on
a hard surface or receives a substantial impact. If the glass breaks, do not touch or attempt to remove it. Stop
using your mobile device until the glass is replaced by an authorised service provider.
Blasting area
Do not use the phone where blasting is in progress. Observe restrictions and follow any regulations or rules.
Potentially explosive atmospheres
• Do not use your phone at a refueling point.
• Do not use near fuel or chemicals.
• Do not transport or store flammable gas, liquid or explosives in the same compartment of your vehicle as your
mobile phone or accessories.

9
In aircraft
Wireless devices can cause interference in aircraft.
• Turn your mobile phone off before boarding any aircraft.
• Do not use it on the ground without permission from the crew.
Children
Keep the phone in a safe place out of the reach of small children. It includes small parts which may cause a
choking hazard if detached.
Emergency calls
Emergency calls may not be available on all mobile networks. Therefore you should never depend solely on your
phone for emergency calls. Check with your local service provider.
Battery information and care
• You do not need to completely discharge the battery before recharging. Unlike other battery systems, there is
no memory effect that could compromise the battery's performance.
• Use only LG batteries and chargers. LG chargers are designed to maximise the battery life.
• Do not disassemble or short-circuit the battery.
• Replace the battery when it no longer provides acceptable performance. The battery pack may be recharged
hundreds of times before it needs replacing.
• Recharge the battery if it has not been used for a long time to maximise usability.
• Do not expose the battery charger to direct sunlight or use it in high humidity, such as in the bathroom.
• Do not leave the battery in hot or cold places, as this may deteriorate battery performance.
• There is risk of explosion if the battery is replaced with an incorrect type.
• Dispose of used batteries according to the manufacturer's instructions. Please recycle when possible. Do not
dispose as household waste.

10
Guidelines for safe and efficient use
• If you need to replace the battery, take it to the nearest authorised LG Electronics service point or dealer for
assistance.
• Always unplug the charger from the wall socket after the phone is fully charged to save unnecessary power
consumption of the charger.
• Actual battery life will depend on network configuration, product settings, usage patterns, battery and
environmental conditions.
• Make sure that no sharp-edged items such as animal’s teeth or nails, come into contact with the battery. This
could cause a fire.
DECLARATION OF CONFORMITY
Hereby, LG Electronics declares that this LG-D290n product is in compliance with the
essential requirements and other relevant provisions of Directive 1999/5/EC. A copy of
the Declaration of Conformity can be found at http://www.lg.com/global/declaration
Contact office for compliance of this product :
LG Electronics Inc.
EU Representative, Krijgsman 1,
1186 DM Amstelveen, The Netherlands
HOW TO UPDATE YOUR SMARTPHONE
Access to latest firmware releases, new software functions and improvements.
• Update your smartphone without a PC. Select Update Center > Software
Update.
• Update your smartphone by connecting it to your PC. For more information about
using this function, please visit http://www.lg.com/common/index.jsp select country
and language.

11
Disposal of your old appliance
1 All electrical and electronic products should be disposed of separately from the municipal waste
stream via designated collection facilities appointed by the government or the local authorities.
2 The correct disposal of your old appliance will help prevent potential negative consequences for
the environment and human health.
3 For more detailed information about disposal of your old appliance, please contact your city office,
waste disposal service or the shop where you purchased the product.
Disposal of waste batteries/accumulators
1 This symbol may be combined with chemical symbols for mercury (Hg), cadmium (Cd) or lead (Pb)
if the battery contains more than 0.0005% of mercury, 0.002% of cadmium or 0.004% of lead.
2 All batteries/accumulators should be disposed separately from the municipal waste stream via
designated collection facilities appointed by the government or the local authorities.
3 The correct disposal of your old batteries/accumulators will help to prevent potential negative
consequences for the environment, animal and human health.
4 For more detailed information about disposal of your old batteries/ accumulators, please contact
your city office, waste disposal service or the shop where you purchased the product.

12
Please read this before you start using your phone!
Please check to see whether any problems you encountered with your phone are described in this section before
taking the phone in for service or calling a service representative.
1. Phone memory
When there is less than 10% of space available in your phone memory, your phone cannot receive new
messages. You need to check your phone memory and delete some data, such as applications or messages, to
make more memory available.
To uninstall applications:
1 Tap > > Apps tab > Settings > General tab > Apps.
2 Once all applications appear, scroll to and select the application you want to uninstall.
3 Tap Uninstall.
2. Optimizing battery life
Extend your battery's power by turning off features that you don't have to run constantly in the background. You
can monitor how applications and system resources consume battery power.
Extending your phone's battery life:
• Turn off radio communications when you are not using. If you are not using Wi-Fi, Bluetooth or GPS, turn them
off.
• Reduce screen brightness and set a shorter screen timeout.
• Turn off automatic syncing for Gmail, Calendar, Contacts and other applications.
• Some applications you have downloaded may reduce battery power.
• While using downloaded applications, check the battery charge level.
To check the battery power level:
• Tap > > Apps tab > Settings > General tab > About phone > Battery.
The battery status (charging or discharging) and battery level (percentage charged) is displayed at the top of the
screen.
Important notice

13
To monitor and control how battery power is being used:
• Tap > > Apps tab > Settings > General tab > About phone > Battery > Battery use.
Battery usage time is displayed on the screen. It tells you how long it has been since you last connected your
phone to a power source or, if currently connected, how long the phone was last running on battery power.
The screen shows the applications or services using battery power, listed in order from the greatest to smallest
amount used.
3. Before installing an open source application and OS
WARNING
If you install and use an OS other than the one provided by the manufacturer it may
cause your phone to malfunction. In addition, your phone will no longer be covered by
the warranty.
WARNING
To protect your phone and personal data, only download applications from trusted
sources, such as Play Store™. If there are improperly installed applications on your
phone, the phone may not work normally or a serious error may occur. You must uninstall
those applications and all associated data and settings from the phone.
4. Using an unlock pattern
Set an unlock pattern to secure your phone. Tap > > Apps tab > Settings > Display tab > Lock
screen > Select screen lock > Pattern. This opens a screen that will guide you through how to draw a screen
unlock pattern. You have to create a Backup PIN as a safety measure in case you forget your unlock pattern.
Caution: Create a Google account before setting an unlock pattern and remember the
Backup PIN you created when creating your pattern lock.

14
WARNING
Precautions to take when using pattern lock.
It is very important to remember the unlock pattern you set. You will not be able to
access your phone if you use an incorrect pattern 5 times. You have 5 opportunities to
enter your unlock pattern, PIN or password. If you have used all 5 opportunities, you can
try again after 30seconds.
When you can’t recall your unlock Pattern, PIN or Password:
< If you have forgotten your pattern >
If you logged in to your Google account on the phone but failed to enter the correct pattern 5 times, tap the
Forgot pattern? button at the bottom of the screen. You are then required to log in with your Google Account or
you have to enter the Backup PIN which you entered when creating your Pattern Lock.
If you have not created a Google account on the phone or you forgot Backup PIN, you have to perform a hard
reset.
< If you have forgotten your PIN or Password >
If you forget your PIN or Password, you will need to perform a hard reset.
Caution: If you perform a hard reset, all user applications and user data will be deleted.
NOTE: If you have not logged into your Google Account and have forgotten your Unlock
Pattern, you will need to enter your Backup PIN.
5. Using the Hard Reset (Factory Reset)
If your phone does not restore to its original condition, use a Hard Reset (Factory Reset) to initialize it.
1 Turn the power off.
2 Press and hold the Power/Lock Key + Volume Down Key on the phone.
3 Release the Power/Lock Key only when the LG logo is displayed, then immediately press and hold the
Power/Lock Key again.
4 Release all keys when the Factory data reset screen is displayed.
5 Press the Volume Key to scroll to the desired option, then press the Power/Lock Key to confirm.
6 Press the Volume Key to scroll to the desired option, then press the Power/Lock Key to confirm one more
time.
Important notice

15
WARNING
If you perform a Hard Reset, all user applications, user data and DRM licenses will be
deleted. Please remember to backup any important data before performing a Hard Reset.
6. Opening and switching applications
Multi-tasking is easy with Android, you can keep more than one application running at the same time. There is
no need to quit an application before opening another one. Use and switch between several open applications.
Android manages each application, stopping and starting them as needed to ensure that idle applications don't
consume resources unnecessarily.
1 Touch Recent Key . A list of recently used applications will be displayed.
2 Tap the application you want to access. This does not stop the previous app running in the background on
the phone. Make sure to tap Back Key to exit an app after using it.
• To remove an app from the recent apps list, swipe the app preview to the left or right. To clear all apps, tap
Clear all.
7. Transferring music, photos and videos using Media
sync (MTP)
1 Tap > > Apps tab > Settings > General tab > Storage to check out the storage media.
2 Connect the phone to your PC using the USB cable.
3 Select USB connection method will appear on your phone screen, select the Media device (MTP) option.
4 Open the memory folder on your PC. You can view the mass storage content on your PC and transfer the
files from PC to Device memory folder or vice versa.
8. Hold your phone upright
Hold your cell phone vertically, as you would a regular phone. Your phone has an internal antenna. Be careful not
to scratch or damage the back of the phone, as this may affect performance.
When making/receiving calls or sending/receiving data, avoid holding the lower part of the phone where the
antenna is located. Doing so may affect call quality.

16
Phone overview
Front-Facing Camera lens
Proximity Sensor
Earpiece
Home Key
Return to the Home screen from
any screen.
Back Key
• Return to the previous screen.
• Exit an app after using it.
Recent Key
Display recently used applications.
NOTE: Proximity sensor
When receiving and making calls, the proximity sensor automatically turns the backlight
off and locks the touch screen by sensing when the phone is near your ear. This extends
battery life and prevents you from unintentionally activating the touch screen during calls.
WARNING
Placing a heavy object on the phone or sitting on it can damage the LCD and touch
screen functions. Do not cover the LCD proximity sensor with protective film. This could
cause the sensor to malfunction.
Getting to know your phone

17
Microphone
Earphone Jack
Microphone
Charger/USB Port
Power/Lock Key
Camera lens
Volume keys
• In the Home screen: Control ringer
volume.
• During a call: Control your
earpiece volume.
• When playing a song: Control
volume continuously.
Flash
Speaker
Battery cover
SIM card slot
microSD cards slot
Battery
WARNING
Be careful not to damage the NFC touch point on the phone, which is part of the NFC
antenna.

18
Installing the SIM card and battery
Before you can start exploring your new phone, you'll need to set it up. To insert the SIM card and battery.
1 To remove the battery cover, hold the phone firmly in one hand. With your other hand, lift off the battery cover
with your thumbnail as shown in figure.
Getting to know your phone

19
2 Slide the SIM card into its slots as shown in the figure. Make sure the gold contact area on the card is facing
downwards.
3 Insert the battery into place by aligning the gold contacts on the phone and the battery (1) and pressing it
down until it clicks into place (2).

20
Getting to know your phone
4 Align the battery cover over the battery compartment (1) and press it down until it clicks into place (2).
NOTE: Power On/Off is available when battery cover is inserted to your phone.
Charging the phone
Charge the battery before using it for the first time. Use the charger to charge the battery. A computer can be
also used to charge the device by connecting them via the USB cable.
WARNING
Use only LG-approved chargers, batteries, and cables. When using unapproved
chargers or cables, it may cause battery charging delay or pop-up message regarding
slow charging. Or, unapproved chargers or cables can cause the battery to explode or
damage the device, which are not covered by the warranty.
The charger connector is at the bottom of the phone. Insert the charger and plug it into an electrical outlet.

21
NOTE:
• The battery must be fully charged initially to improve battery lifetime.
• Do not open the back cover while your phone is charging.
Using the memory card
Your phone supports the use of microSD™ or microSDHC™ memory cards of up to 32 GB capacity. These
memory cards are specifically designed for mobile phones and other ultra-small devices, and are ideal for storing
media-rich files such as music, programs, videos, and photographs for use with your phone.
To insert a memory card:
Insert the memory card into the slot. Make sure the gold contact area is facing downwards.
To safely remove the memory card:
Touch > Apps tab > Settings > General tab > Storage > Unmount SD card.

22
Getting to know your phone
NOTE:
• Use only compatible memory cards with your phone. Using incompatible memory
cards may damage the card and data stored on the card, as well as the phone.
• As the device uses FAT32, the maximum size for any given file is 4GB.
WARNING
Do not insert or remove the memory card when the phone is ON. Doing so may damage
the memory card as well as your phone, and the data stored on the memory card may
become corrupt.
To format the memory card:
Your memory card may already be formatted. If it isn't, you must format it before you can use it.
NOTE: All files on your memory card are deleted when it is formatted.

23
1 Touch to open the application list.
2 Scroll and touch Settings > General tab > Storage.
3 Touch Unmount SD card.
4 Touch Erase SD card > Erase SD card > Erase everything.
5 If you have set a pattern lock, input the pattern lock then select Erase everything.
NOTE: If there is content on your memory card, the folder structure may be different after
formatting, as all the files will have been deleted.
Locking and unlocking the screen
If you do not use the phone for a while, the screen will be automatically turned off and locked. This helps to
prevent accidental taps and saves battery power.
When you are not using the phone, press the Power/Lock key to lock your phone.
If there are any programs running when you lock your screen, they may be still running in Lock mode. It is
recommended that you exit all programs before entering Lock mode to avoid unnecessary charges (e.g. phone
calls, web access and data communications).
To wake up your phone, press the Power/Lock key . The Lock screen will appear. Touch and slide the Lock
screen in any direction to unlock your Home screen. The last screen you viewed will open.

24
Touch screen tips
Here are some tips on how to navigate on your phone.
Tap or touch – A single finger tap selects items, links, shortcuts and letters on the on-screen keyboard.
Touch and hold – Touch and hold an item on the screen by tapping it and not lifting your finger until an action
occurs. For example, to open a contact's available options, touch and hold the contact in the Contacts list until
the context menu opens.
Drag – Touch and hold an item for a moment and then, without lifting your finger, move your finger on the
screen until you reach the target position. You can drag items on the Home screen to reposition them.
Swipe or slide – To swipe or slide, quickly move your finger across the surface of the screen, without pausing
when you first tap it (so you don’t drag an item instead). For example, you can slide the screen up or down to
scroll through a list, or browse through the different Home screens by swiping from left to right (and vice versa).
Double-tap – Double-tap to zoom on a webpage or a map. For example, quickly double-tap a section of a
webpage to adjust that section to fit the width of the screen. You can also double-tap to zoom in and out while
viewing the picture.
Pinch-to-Zoom – Use your index finger and thumb in a pinching or spreading motion to zoom in or out when
using the browser or Maps, or when browsing pictures.
Rotate the screen – From many applications and menus, the orientation of the screen adjusts to the device's
physical orientation.
NOTE:
• To select an item, tap the center of the icon.
• Do not press too hard; the tap screen is sensitive enough to pick up a light, yet firm
tap.
• Use the tip of your finger to tap the option you want. Be careful not to tap any other
keys.
Your Home screen

25
Home screen
The Home screen is the starting point for many applications and functions, and it allows you to add items like
application shortcuts, or Google widgets to give you instant access to information and applications. This is the
default canvas and accessible from any menu by tapping .
Status Bar
Shows phone's status information including the time, signal strength,
battery status, and notification icons.
Widget
Widgets are self-contained applications that can be accessed through
the Apps screen or on the Home screen or an extended home screen.
Unlike a shortcut, the Widget appears as an on-screen application.
Application Icons
Tap an icon (application, folder, etc.) to open and use it.
Location Indicator
Indicates which Home screen canvas you are viewing.
Quick Key Area
Provides one-touch access to the function in any home screen canvas.
Extended home screen
The operating system provides multiple Home screen canvases to provide more space for adding icons, widgets,
and more.
Slide your finger left or right across the Home screen.

26
Customizing the Home screen
You can customize your Home screen by adding apps, widgets or changing wallpapers.
To add items on your Home screen
1 Touch and hold the empty part of the Home screen.
2 In the Add Mode menu, select the item you wish to add. You will then see this added item on the Home
screen.
3 Drag it to the desired location and lift your finger.
TIP! To add an application icon to the Home screen from the Apps menu, touch and hold
the application you want to add.
To remove an item from the Home screen
Home screen > touch and hold the icon you want to remove > drag it to .
To add an app as a Quick key
From the Apps menu or on the Home screen, touch and hold an application icon and drag it to the Quick
key area.
To remove an app from the Quick key area
Touch and hold the desired quick key and drag it to .
NOTE: Apps key cannot be removed.
To customize apps icons on the Home screen
1 Touch and hold an application icon until it is unlocked from its current position. Then drop it on the screen.
The editing icon will appear in the upper right corner of the application.
2 Tap the application icon again and select the desired icon design and size.
3 Tap OK to save the change.
Your Home screen

27
Returning to recently-used applications
1 Touch . The screen displays a pop-up containing the icons of applications you used recently.
2 Tap an icon to open the application. Or tap to return to your previous screen.
Notifications panel
Notifications alert you the arrival of new messages, calendar events, and alarms, as well as to ongoing events,
such as when you are on a call.
When a notification arrives, its icon appears at the top of the screen. Icons for pending notifications appear on
the left, and system icons such as Wi-Fi or battery strength shown on the right.
NOTE: The available options may vary depending on the region or service provider.
Pending
notifications
Bluetooth, Wi-Fi &
battery status

28
Your Home screen
Opening the notifications panel
Swipe down from the status bar to open the notifications panel.
Quick Toggle Area
Tap each quick toggle key to turn it on/off. Touch and hold the key to
access the settings menu of the function. To see more toggle keys,
swipe left or right. Tap to remove, add, or rearrange toggle keys.
QSlide apps
Tap a QSlide app to open as a small window on your screen. Tap
to remove, add, or rearrange QSlide apps.
Tap to clear all the notifications.
Notifications
The current notifications are listed, each with a brief description. Tap a
notification to view it.
To close the notifications panel, touch and drag the tab toward the top
of the screen.
Indicator icons on the Status Bar
Indicator icons appear on the status bar at the top of the screen to report missed calls, new messages, calendar
events, device status and more.

29
The icons displayed at the top of the screen provide information about the status of the device. The icons listed
in the table below are some of the most common ones.
Icon Description Icon Description
No SIM card inserted Ringer is silenced
No network signal available Vibrate mode is on
Airplane mode is on Battery fully charged
Connected to a Wi-Fi network Battery is charging
Wired headset connected Phone is connected to PC via USB cable
Call in progress Downloading data
Missed call Uploading data
Bluetooth is on Acquiring GPS
NFC is on Receving location data from GPS
System warning Data is synchronizing
An alarm is set New Gmail message available
New voicemail available New Hangouts message available
New text or multimedia message Choose input method
A song is currently playing Mobile hotspot is active
FM radio is on Content sharing is on

30
Your Home screen
NOTE: The icons location in the status bar may differ according to the function or
service.
On-screen keyboard
You can enter text using the on-screen keyboard. The on-screen keyboard appears automatically on the screen
when you need to enter text. To manually display the keyboard, simply tap a text field where you want to enter
text.
Using the keypad & entering text
Tap once to capitalize the next letter you type. Double-tap for all caps.
Tap to switch to the numbers and symbols keyboard.
Tap to access the keyboard settings. Touch and hold to enter text by voice or enter items copied to the Clip
Tray.
Tap to enter a space.
Tap to create a new line.
Tap to delete the previous character.
Entering accented letters
When you select French or Spanish as the text entry language, you can enter special French or Spanish
characters (e.g. "á").
For example, to input "á", touch and hold the "a" key until the zoom-in key grows bigger and displays characters
from different languages.
Then select the special character you want.

31
Google account setup
When you first turn on your phone, you have the opportunity to activate the network, to sign into your Google
Account and select how you want to use certain Google services.
To set up your Google account
• Sign into a Google Account from the prompted set-up screen.
OR
• Tap > > Apps tab > select a Google application, such as Gmail > select New to create a new
account.
If you have a Google account, tap Existing, enter your email address and password, then tap .
Once you have set up your Google account on your phone, your phone automatically synchronizes with your
Google account on the Web.
Your contacts, Gmail messages, Calendar events and other information from these applications and services on
the Web are synchronized with your phone. (This will depend on your synchronization settings.)
After signing in, you can use Gmail™ and take advantage of Google services on your phone.

32
Wi-Fi
With Wi-Fi, you can use high-speed Internet access within the coverage of the wireless access point (AP). Enjoy
wireless Internet using Wi-Fi, without extra charges.
Connecting to Wi-Fi networks
To use Wi-Fi on your phone, you need to access a wireless access point or ‘hotspot’. Some access points are
open and you can simply connect to them. Others are hidden or use security features; you must configure your
phone to be able to connect to them.
Turn off Wi-Fi when you're not using it to extend the life of your battery.
NOTE: If you are out of the Wi-Fi zone or have set Wi-Fi to OFF, additional charges may
be applied by your mobile operator for mobile data use.
Turning Wi-Fi on and connecting to a Wi-Fi network
1 Tap > > Apps tab > Settings > Networks tab > Wi-Fi.
2 Set Wi-Fi to ON to turn it on and start scanning for available Wi-Fi networks.
3 Tap the Wi-Fi menu again to see a list of active and in-range Wi-Fi networks.
• Secured networks are indicated by a lock icon.
4 Tap a network to connect to it.
• If the network is secured, you are prompted to enter a password or other credentials. (Ask your network
administrator for details)
5 The status bar displays icons that indicate Wi-Fi status.
Connecting to Networks and Devices

33
Bluetooth
You can use Bluetooth to send data by running a corresponding application, but not from the Bluetooth menu as
on most other mobile phones.
NOTE:
• LG is not responsible for the loss, interception or misuse of data sent or received via
the Bluetooth wireless feature.
• Always ensure that you share and receive data with devices that are trusted and
properly secured. If there are obstacles between the devices, the operating distance
may be reduced.
• Some devices, especially those that are not tested or approved by Bluetooth SIG, may
be incompatible with your device.
Turning on Bluetooth and pairing up your phone with a Bluetooth device
You must pair your device with another device before you connect to it.
1 Tap > > Apps tab > Settings > Networks tab > set Bluetooth to ON.
2 Tap the Bluetooth menu again. You will see the option to make your phone visible and option to search
devices. Now tap Search for devices to view the devices in the Bluetooth Range.
3 Choose the device you want to pair with from the list.
Once the paring is successful, your device will connect to the other device.
NOTE: Some devices, especially headsets or hands-free car kits, may have a fixed
Bluetooth PIN, such as 0000. If the other device has a PIN, you will be asked to enter it.
Send data using the Bluetooth wireless feature
1 Select a file or item, such as a contact, calendar event or media file, from an appropriate application or from
Downloads.
2 Select the option for sending data via Bluetooth.
NOTE: The method for selecting an option may vary by data type.
3 Search for and pair with a Bluetooth-enabled device.

34
Connecting to Networks and Devices
Receive data using the Bluetooth wireless feature
1 Tap > > Apps tab > Settings > Networks tab > set Bluetooth to ON.
2 Tap the Bluetooth menu again and mark the checkbox at the top of the screen to make your phone visible
to other devices.
NOTE: To select the length of time that your device will be visible, tap > Visibility
timeout.
3 Select Accept to confirm that you are willing to receive data from the device.
Sharing your phone's data connection
USB tethering and portable Wi-Fi hotspot are great features when there are no wireless connections available.
You can share your phone's mobile data connection with a single computer via a USB cable (USB tethering). You
can also share your phone's data connection with more than one device at a time by turning your phone into a
portable Wi-Fi hotspot.
When your phone is sharing its data connection, an icon appears in the status bar and as an ongoing notification
in the notifications drawer.
For the latest information about tethering and portable hotspots, including supported operating systems and
other details, visit http://www.android.com/tether.
To share your phone's data connection as a portable Wi-Fi hotspot
1 Tap > > Apps tab > Settings > Networks tab > Tethering & networks > Wi-Fi hotspot
switch to activate.
2 Enter a password and tap Save.
TIP! If your computer is running Windows 7 or a recent distribution of some flavours of
Linux (such as Ubuntu), you will not usually need to prepare your computer for tethering.
But, if you are running an earlier version of Windows or another operating system, you
may need to prepare your computer to establish a network connection via USB. For the
most current information about which operating systems support USB tethering and how
to configure them, visit http://www.android.com/tether.

35
To rename or secure your portable hotspot
You can change the name of your phone's Wi-Fi network name (SSID) and secure its Wi-Fi network.
1 Tap > > Apps tab > Settings > Networks tab > Tethering & networks > Wi-Fi hotspot.
2 Tap Set up Wi-Fi hotspot.
• The Set up Wi-Fi hotspot dialogue box will open.
• You can change the Wi-Fi name (SSID) that other devices see when scanning for Wi-Fi networks.
• You can also tap the Security menu to configure the network with Wi-Fi Protected Access 2 (WPA2)
security using a pre-shared key (PSK).
• If you touch the WPA2 PSK security option, a password field is added to the Set up Wi-Fi hotspot
dialogue box. If you enter a password, you will need to enter that password when you connect to the
phone's hotspot with a computer or other device. You can set Open in the Security menu to remove
security from your Wi-Fi network.
3 Tap Save.
ATTENTION! If you set the security option as Open, you cannot prevent unauthorised
usage of online services by other people and additional charges may be incurred. To
avoid unauthorized usage, you are advised to keep the security option active.
Wi-Fi Direct
Wi-Fi Direct supports a direct connection between Wi-Fi enabled devices without an access point. Due to the
high battery usage of Wi-Fi direct, it is recommended that you plug your phone into a power outlet while using
the Wi-Fi Direct feature. Check your Wi-Fi & Wi-Fi Directed network in advance and make sure the users are
connected to the same network.
PC connections with a USB cable
Learn to connect your device to a PC with a USB cable in USB connection modes.
Transferring music, photos and videos using the MTP mode
1 Connect your phone to a PC using a USB cable.
2 You can now view the mass storage content on your PC and transfer the files.

36
Synchronize with Windows Media Player
Ensure that Windows Media Player is installed on your PC.
1 Use the USB cable to connect the phone to a PC on which Windows Media Player has been installed.
2 Select the Media device (MTP) option. When connected, a pop-up window will appear on the PC.
3 Open Windows Media Player to synchronize music files.
4 Edit or enter your device’s name in the pop-up window (if necessary).
5 Select and drag the music files you want to the sync list.
6 Start synchronization.
• The following requirements must be satisfied to synchronize with Windows Media Player.
Items Requirement
OS Microsoft Windows XP SP2, Vista or higher
Window Media Player version Windows Media Player 10 or higher
Connecting to Networks and Devices

37
Making a call
1 Tap to open the keypad.
2 Enter the number using the keypad. To delete a digit, tap the .
3 Tap to make a call.
4 To end a call, tap the End icon .
TIP! To enter "+" to make international calls, touch and hold .
Calling your contacts
1 Tap to open your contacts.
2 Scroll through the contact list or enter the first few letters of the contact you want to call by tapping Search
contacts.
3 In the list, tap you want to call.
Answering and rejecting a call
When you receive a call in Lock state, swipe the in any direction to Answer the incoming call.
Swipe the in any direction to Decline an incoming call.
Swipe the Decline with message icon in any direction if you want to send a message.
TIP! Decline with message
You can send a message quickly using this function. This is useful if you need to reject a
call with message during a meeting.
Adjusting the in-call volume
To adjust the in-call volume during a call, use the Volume Keys on the back side of the phone.
Calls

38
Calls
Making a second call
1 During your first call, tap > Add call and dial the number. You can also go to the recently dialled numbers
list by tapping Call logs or can search contacts by tapping Contacts and selecting the contact you want to
call.
2 Tap to make the call.
3 Both calls are displayed on the call screen. Your initial call is locked and put on hold.
4 Tap the displayed number to toggle between calls. Or tap Merge calls to start a conference call.
5 To end active calls, tap End or tap and slide the notification bar down and select the End call icon
.
NOTE: You are charged for each call you make.
Viewing your call logs
On the Home screen, tap and choose the Call logs.
View a complete list of all dialled, received and missed calls.
TIP!
• Tap any call log entry to view the date, time and duration of the call.
• Tap , then tap Delete all to delete all the recorded items.
Call settings
You can configure phone call settings such as call forwarding, as well as other special features offered by your
carrier.
1 On the Home screen, tap .
2 Tap .
3 Tap Call settings and choose the options that you wish to adjust.

39
Contacts
Add contacts to your phone and synchronize them with the contacts in your Google account or other accounts
that support contact syncing.
Searching for a contact
On the Home screen
1 Tap to open your contacts.
2 Tap Search contacts and enter the contact name using the keyboard.
Adding a new contact
1 Tap , enter the new contact's number, then tap . Tap Add to Contacts > New contact.
2 If you want to add a picture to the new contact, tap the image area.
Choose from Take photo, Select from Gallery.
3 Select the contact type by tapping .
4 Tap a category of contact information and enter the details about your contact.
5 Tap Save.
Favourites contacts
You can classify frequently called contacts as favourites.
Adding a contact to your favourites
1 Tap to open your contacts.
2 Tap a contact to view its details.
3 Tap the star to the right corner of the contact's name. The star will turn yellow color.
Removing a contact from your favourites list
1 Tap to open your contacts.
2 Tap Favourites, and choose a contact to view its details.
3 Tap the yellow color star to the right corner of the contact's name. The star turns grey color and the contact
is removed from your favourites.

40
Contacts
Creating a group
1 Tap to open your contacts.
2 Tap Groups and tap . Select New group.
3 Enter a name for the new group. You can also set a ringtone for the newly created group.
4 Tap Save to save the group.
NOTE: If you delete a group, the contacts assigned to that group will not be lost. They
will remain in your contacts.

41
Your phone combines SMS and MMS into one intuitive, easy-to-use menu.
WARNING: LG message should be set up to default SMS app. If not, some message
functions will be limited.
Sending a message
1 Tap on the Home screen and tap to open a blank message.
2 Enter a contact name or contact number in the To field. As you enter the contact name, matching contacts
will appear. You can tap a suggested recipient. You can add more than one contact.
NOTE: You will be charged for a text message for every person to whom you send the
message.
3 Tap the Enter message field and begin composing your message.
4 Tap to open the Options menu. Choose from Quick message, Insert smiley, Schedule sending,
Addsubject and Discard.
TIP! You can tap the icon to attach the file, that you want to share with message.
5 Tap Send to send your message.
6 Responses will appear on the screen. As you view and send additional messages, a message thread is
created.
WARNING
• The 160-character limit may vary from country to country, depending on the language
and how the SMS is coded.
• If an image, video or audio file is added to an SMS message, it is automatically
converted into an MMS message and you are charged accordingly.
Messaging

42
Threaded box
Messages (SMS, MMS) exchanged with another party can be displayed in chronological order so that you can
conveniently see an overview of your conversation.
Changing your message settings
Your phone message settings are pre-defined, so you can send messages immediately. You can change the
settings according to your preferences.
• Tap the Messaging icon on the Home screen, tap and then tap Settings.
Messaging

43
E-mail
You can use the E-mail application to read emails from services like Gmail. The E-mail application supports the
following account types: POP3, IMAP and Exchange.
Your service provider or system administrator can provide you with the account settings you need.
Managing an email account
The first time you open the E-mail application, a set-up wizard opens to help you to set up an email account.
After the initial set-up, E-mail displays the contents of your inbox.
To add another email account:
• Tap > > Apps tab > E-mail >tap > Settings > Add account.
To change an email account's settings:
• Tap > > Apps tab > E-mail > tap > Settings > General settings.
To delete an email account:
• Tap > > Apps tab > E-mail > tap > Settings > tap > Remove account > Select the
account to delete > Remove > select Yes.
Working with account folders
Tap > > Apps tab > E-mail > tap and select Folders.
Each account has an Inbox, Outbox, Sent and Drafts folder. Depending on the features supported by your
account's service provider, you may have additional folders.
Composing and sending email
To compose and send a message
1 While in the E-mail application, tap the .
2 Enter an address for the message's intended recipient. As you enter text, matching addresses will be
proposed from your Contacts. Separate multiple addresses using semicolons.
3 Tap the to add a Cc/Bcc and tap to attach files, if required.
4 Enter the text of the message.
5 Tap .
TIP! When a new email arrives in your Inbox, you will be notified by a sound or vibration.

44
To open the Camera application, tap > > Apps tab > .
Getting to know the viewfinder
Flash – Choose from Off , On , Auto .
Swap camera – Switch between the rear–facing camera lens and the front–facing camera lens.
Shot mode – Choose from Auto or Panorama.
Settings – Tap this icon to open the settings menu.
Gallery – Tap to view the last photo you captured. This enables you to access your gallery and view saved
photos while in camera mode.
Record – Allows you to start recording.
Capture – Allows you to take a photo.
NOTE: Please ensure the camera lens is clean before taking pictures.
Camera and Video

45
Using the advanced settings
In the viewfinder, tap to open the advanced options. You can change the camera settings by scrolling
through the list. After selecting the option, tap .
Selects photo resolution. If you choose high resolution, file size will increase, which means you will
be able to store fewer photos in the memory.
To take a photo, say one of the following words: Cheese, Smile, Whiskey, Kimchi or LG.
Sets a delay after the capture button is pressed. This is ideal if you want to be in the photo.
It is easily used to take better pictures to keeping horizontal and verticals.
Opens the help guide to know how a function operates.
TIP! The setting menu is superimposed over the viewfinder, so when you change photo
color or quality elements, you will see a preview of the changed image behind the
Settings menu.
Taking a quick photo
1 Open the Camera application and point the lens toward the subject your want to photograph.
2 Focus boxes will appear in the center of the viewfinder screen. You can also tap anywhere on the screen to
focus on that spot.
3 When the focus box turns blue, the camera has focused on your subject.
4 Tap to capture the photo.

46
Camera and Video
Once you've taken a photo
Tap the image thumbnail at the bottom of the Camera screen to view the last photo you took.
Tap to edit the photo.
Tap to take another photo immediately.
Tap to send your photo to others or share it via social network services.
Tap to delete the photo.
Tap to access SmartShare, Set image as, Move, Copy, Copy to Clip Tray, Slideshow, Rotate
left, Rotate right, Crop, Add location, Rename, Print or Details.
Tap to add the photo to Favourites.
TIP! If you have an SNS account set up on your phone, you can share your photo with
your SNS community.
NOTE: Additional charges may apply when MMS messages are downloaded while
roaming.
Tap to open all advanced options.
Set image as – Tap to use the photo as a Contact photo, Home screen wallpaper, Lock screen wallpaper,
Wallpaper.
Move – Tap to move the photo to another place.
Copy – Tap to copy the selected photo and save it to another album.
Copy to Clip Tray – Tap to copy the photo and store in the Clip Tray.
Slideshow – Automatically shows you the images in the current folder one after the other.
Rotate left/right – To rotate left or right.
Crop – Crop your photo. Move your finger across the screen to select the area to be cropped.

47
Add location – To add the location information.
Rename – Tap to edit the name of the selected photo.
Details – Find out more information about the file.
Gesture shot
Take a picture with hand gesture. To take photo, raise your hand until front camera detects it and a box appears
on the screen.
Using Panorama mode
Allows you to take a picture a long way over a wide area of land.
1 Open the Camera application.
2 > Panorama.
3 Tap to start.
4 Pan your phone slowly to one direction.
5 Fit focus area to blue guideline to take photo.
6 Tap stop button when finished.

48
Camera and Video
Recording a quick video
1 Open the Camera application.
2 Holding the phone, point the lens towards the subject you wish to capture in your video.
3 Tap once to start recording.
4 A red light will appear at the top left corner of the viewfinder with a timer showing the length of the video.
5 Tap on the screen to stop recording.
TIP!
– Tap to capture an image during recording a video.
– Tap to pause recording a video.
After recording a video
In the viewfinder, tap the video thumbnail at the top of the screen to view the last video you took.
Tap to record another video immediately.
Tap to send your video to others or share it via social network services.
Tap to delete the video.
Tap to access SmartShare, Move, Copy, Trim, Rename, Details.
NOTE: Additional charges may apply when MMS messages are downloaded while
roaming.

49
From your Gallery
Tap Gallery.
• To view more photos, scroll left or right.
• To zoom in or out, double-tap the screen or place two fingers and spread them apart (move your fingers closer
together to zoom out).
• Tap on video play icon to play the video.

50
Function
Guest Mode
To protect your privacy or limit some applications to your children, you can use the Guest mode.
When you lend your phone to others, you can limit the applications to be displayed.
In advance, set the Guest mode and customize the options.
NOTE: To use the Guest mode, the pattern lock should be set in advance.
1 Tap > > Apps tab > Settings > General tab > Guest mode.
2 Tap the Guest Mode switch to enable this mode.
Knock Code
You can unlock the screen when screen is off by taping the correct area and sequence.
To activate Knock Code feature
1 Tap > > Apps tab > Settings > Display tab > Lock screen > Select screen lock >
KnockCode.
2 This opens a screen that will guide you through how to select the unlock sequence. You have to create a
Backup PIN as a safety measure in case you forget your unlock sequence.
KnockON
You can turn on/off the screen by just double-tap.
Double-tap the center screen quickly to unlock the screen. To lock the screen, double-tap the status bar in any
screen (except on the camera viewfinder) or empty area on the Home screen.
NOTE: When turning the screen on, make sure you do not cover the proximity sensor.
Doing so will turn the screen off immediately after turning it on in order to prevent
abnormal turning on in your pocket or bag.

51
QuickMemo+
The QuickMemo+ allows you to create memos and capture screen shots. Capture screens, draw on them and
share them with family and friends with QuickMemo+.
1 (While screen is switched off) Press and hold the Volume
Up key.
OR OR
Touch and slide the status bar downward and tap .
2 Select the desired menu option from Pen type, Colour,
Eraser and create a memo.

52
3 Tap in the Edit menu to save the memo with the
current screen. To exit QuickMemo+ at any time, tap .
NOTE: Please use a fingertip while using the QuickMemo+. Do not use your fingernail.
Using the QuickMemo+ options
You can easily use the editing tools when using the QuickMemo+.
Tap to keep the current QuickMemo+ as a text overlay on the screen and continue to use the
phone.
Undo or Redo.
Tap to insert text.
Selects the pen type and the colour.
Erases the memo that you created.
Saves the memo with the current screen in the Gallery or QuickMemo+.
Options: Tap to choose Insert, Move, Delete, Export, Share, or Paper style for the memo.
Viewing the saved QuickMemo+
Tap QuickMemo+/Gallery and select the QuickMemo+ album.
Function

53
QSlide
From any screen, bring up a notepad, calendar, and more as a window inside your screen.
OR
Tap to exit the QSlide and return to
full window.
Tap to adjust transparency.
Tap to end the QSlide.
Tap to adjust the size.
1 Touch and slide the status bar downwards > tap QSlide apps or while using applications that support QSlide,
tap . The function will be continuously displayed as a small window on your screen.
2 You can make a call, browse the Web, or choose other phone options. You can also use and tap the screen
under the small windows when the transparency bar is not full .
NOTE: The QSlide can support up to two windows at the same time.

54
Function
Smart Keyboard
Smart Keyboard recognizes your keyboard input habit and provide your own keyboard quickly inputting without
errors.

55
Live Zooming
Live Zooming allows you to zoom in or zoom out on a portion of a video that is being played to make the desired
section appear larger or smaller.
When viewing a video, use your index finger and thumb in a pinching or spreading motion to zoom in or out.
NOTE:
• While a video is playing, slide left side on the screen up or down to adjust the screen
brightness.
• While a video is playing, slide right side of the screen up or down to adjust the screen
volume.
• While playing a video, slide the screen left or right to rewind or fast-forward.
• Do not press too hard; the touch screen is sensitive enough to pick up a light, but firm
tap.

56
Multimedia
Gallery
Open the Gallery application to view albums of your pictures and videos.
1 Tap > > Apps tab > Gallery.
You can manage and share all your image and video files with Gallery.
NOTE:
• Some file formats are not supported, depending on the software installed on the
device.
• Some files may not play properly, depending on how they are encoded.
Viewing pictures
Launching Gallery displays your available folders. When another application, such as E-mail, saves a picture, the
download folder is automatically created to contain the picture. Likewise, capturing a screenshot automatically
creates the Screenshots folder. Select a folder to open it.
Pictures are displayed by creation date in a folder. Select a picture to view it full screen. Scroll left or right to view
the next or previous image.
Zooming in and out
Use one of the following methods to zoom in on an image:
• Double-tap anywhere to zoom in.
• Spread two fingers apart on any place to zoom in. Pinch to zoom out, or double-tap to return.
Playing videos
Video files show the icon in the preview. Select a video to watch it and tap . The Videos application will
launch.
1 Touch > Apps tab > Gallery.
2 Select the video you want to play.

57
Touch to pause/resume video playback.
Touch to go 10 seconds forward.
Touch to go 10 seconds backward.
Touch to manage the video volume.
Touch to lock/unlock a video screen.
Touch to use QSlide.
Tap to access Screen ratio, Subtitles, Share, Trim, Settings or Details.
To change the volume while watching a video, press the up and down volume keys on the back of the phone.
Touch and hold a video in the list. The Share, Delete, Rename and Details options will be displayed.

58
Multimedia
Editing photos
When viewing an photo, tap .
Deleting photos/videos
Use one of the following methods:
• In a folder, tap and select photos/videos by ticking, and then tap on Delete.
• When viewing a photo, tap .
Setting as wallpaper
When viewing a photo, tap > Set image as to set the image as wallpaper or assign to a contact.
NOTE:
• Some file formats are not supported, depending on the device software.
• If the file size exceeds the available memory, an error can occur when you open files.
Music
Your phone has a built-in music player that lets you play all your favorite tracks. To access the music player, tap
> > Apps tab > Music.
Playing a song
1 Tap > > Apps tab > Music.
2 Tap Songs.
3 Select the song you want to play.

59
Tap to pause/resume playback.
Tap to skip to the next track in the album, playlist, or shuffle. Touch and hold to fast
forward.
Tap to restart the current track or skip to the previous track in the album, playlist, or
shuffle. Touch and hold to rewind.
Tap to display the Volume slider bar, then adjust the playback volume on the slider bar.
Tap to open the music library.
Tap to play the current playlist in shuffle mode (tracks are played in random order).
Tap to toggle through the repeat modes to repeat all songs, repeat current song, or
repeat off.
Tap to add the song to your favourites.

60
Multimedia
Tap to open the current playlist.
Tap to access Search, Add to playlist, Delete, Share, Set as ringtone, Music video,
Details or Settings.
To change the volume while listening to music, press the up and down volume keys on the left-hand side of the
phone.
Touch and hold any song in the list. The Play, Add to playlist, Delete, Share, Set as ringtone, Details and
Search options will be displayed.
Add music files to your phone
Start by transferring music files to your phone:
• Transfer music using Media device (MTP).
• Download from the wireless Web.
• Synchronize your phone to a computer.
• Receive files via Bluetooth.
Transfer music using Media device (MTP)
1 Connect the phone to your PC using the USB cable.
2 Select the Media device (MTP) option. Your phone will appear as another hard drive on your computer. Click
on the drive to view it. Copy the files from your PC to the drive folder.
NOTE:
• Some file formats are not supported, depending on the device software.
• If the file size exceeds the available memory, an error can occur when you open files.
• Music file copyrights may be protected by international treaties and national copyright
laws. Therefore, it may be necessary to obtain permission or a licence to reproduce or
copy music. In some countries, national laws prohibit private copying of copyrighted
material. Before downloading or copying the file, check the national laws of the relevant
country concerning the use of such material.

61
FM radio
Your phone has a built-in FM radio so you can tune in to your favorite stations and listen on the go.
Tap > > Apps tap > FM radio.
NOTE: You need to use your headphones to listen to the radio. Insert it into the
headphone jack.

62
Utilities
Setting your alarm
1 Tap > > Apps tab > Clock > .
2 After you set the alarm, your phone lets you know how much time is left before the alarm will go off.
3 Set Repeat, Snooze duration, Vibration, Alarm sound, Alarm volume, Auto app starter, Puzzle lock
and Memo.
4 Tap Save.
NOTE: To change alarm settings in the alarm list screen, tap and select Settings.
Using your calculator
1 Tap > > Apps tab > Calculator.
2 Tap the number keys to enter numbers.
3 For simple calculations, tap the function you want to perform (+, –, x or ÷) followed by =.
4 For more complex calculations, touch and select the Scientific calculator, then choose sin, cos, tan,
log etc.
5 To check the history, touch and select the Calculation history.
Adding an event to your calendar
1 Tap > > Apps tab > Calendar.
2 On the screen, you can find the different view types for the Calendar (Day, Week, Month, Year, Agenda).
3 Tap on the date for which you wish to add an event and tap .
4 Tap Event name and enter the event name.
5 Tap Location and enter the location. Check the date and enter the time you wish your event to start and
finish.
6 If you wish to repeat the alarm, set REPEAT and set REMINDERS, if necessary.
7 Tap Save to save the event in the calendar.

63
Voice Recorder
Use the voice recorder to record voice memos or other audio files.
Recording a sound or voice
1 Tap > > Apps tab > Voice Recorder.
2 Tap to begin recording.
3 Tap to end the recording.
4 Tap to listen to the recording.
NOTE: Tap to access your album. You can listen to the saved recording. The
available recording time may differ from actual recording time.
Tasks
This task can be synchronized with MS Exchange account. You can create task, revise it and delete it in MS
outlook or MS Office Outlook Web Access.
To Synchronize MS Exchange
1 From the Home Screen, Tap > > Apps tab > Settings.
2 Tap General tab > Accounts & sync > Add account.
3 Tap Microsoft Exchange to create E-mail address and Password.
4 Make sure if you checkmark Sync task.
NOTE: MS Exchange may not be supported depending on email server.
ThinkFree Viewer
ThinkFree Viewer is a professional mobile office solution that lets users conveniently view various types of office
documents, including Word, Excel and PowerPoint files, anywhere or anytime, using their mobile devices.
• Tap > > Apps tab > ThinkFree Viewer.

64
Utilities
Viewing files
Mobile users can now easily view a wide variety of file types, including Microsoft Office documents and Adobe
PDF, right on their mobile devices. When viewing documents using ThinkFree Viewer, the objects and layout
remain the similar in the original documents.
Google+
Use this application to stay connected with people via Google’s social network service.
• Tap > > Apps tab > tap Google folder > Google+.
NOTE: This application may not be available depending on the region or service provider.
Voice Search
Use this application to search webpages using voice.
1 Tap > > Apps tab > tap Google folder > Voice Search.
2 Say a keyword or phrase when Speak now appears on the screen. Select one of the suggested keywords
that appear.
NOTE: This application may not be available depending on the region or service provider.
Downloads
Use this application to see what files have been downloaded through the applications.
• Tap > > Apps tab > Downloads.
NOTE: This application may not be available depending on the region or service provider.

65
LG SmartWorld
LG SmartWorld offers an assortment of exciting content – fonts, themes, games, applications.
How to Get to LG SmartWorld from Your Phone
1 Tap > > Apps tab > tap the icon to access LG SmartWorld.
2 Tap Sign in and enter ID/PW for LG SmartWorld. If you have not signed up yet, tap Register to receive your
LG SmartWorld membership.
3 Download the content you want.
• When you use Cellular network, data fee could be charged by data plan that you signed-up with carrier.
• LG SmartWorld may not be available from all carriers or in all countries.
NOTE: What if there is no icon?
1 Using a mobile Web browser, access LG SmartWorld (www.lgworld.com) and select
your country.
2 Download the LG SmartWorld App.
3 Run and install the downloaded file.
4 Access LG SmartWorld by tapping the icon.
Special benefit only in LG SmartWorld
1 Decorate your own style on your Smartphone, Use Home Theme & Keyboard Theme
& Font that provided on LG SmartWorld. (However this service is available to specific
device. Please check in LG SmartWorld website whether it is feasible or not whether it
is feasible or not)
2 Enjoy LG SmartWorld's special service by joining promotion that consistently provided.

66
The Web
Internet
Use this application to browse the Internet. Browser gives you a fast, full-color world of games, music, news,
sports, entertainment and much more, right on your mobile phone wherever you are and whatever you enjoy.
NOTE: Additional charges apply when connecting to these services and downloading
content. Check data charges with your network provider.
1 Tap > > Apps tab > Internet.
Using the Web toolbar
Tap slide it upwards with your finger to open.
Tap to go back one page.
Tap to go forward one page, to the page you connected to after the current one. This is the
opposite of what happens when you tap , which takes you to the previous page.
Tap to go to the Home page.
Tap to add a new window.
Tap to access bookmarks.
Viewing webpages
Tap the address field, enter the web address and tap Go.
Opening a page
To go to new page, tap > .
To go to another webpage, tap , scroll up or down, and tap the page to select it.
NOTE: This feature may not be available depending on the region or service provider.

67
Bookmarks
To bookmark the current webpage, tap > Add to bookmarks > OK.
To open a bookmarked webpage, tap and select one.
History
Tap > History to open a webpage from the list of recently-visited webpages. To clear the history, tap .
Chrome
Use Chrome to search for information and browse webpages.
1 Tap > > Apps tab > Chrome.
NOTE: This application may not be available, depending on your region and service
provider.
Viewing webpages
Tap the Address field, and then enter a web address or search criteria.
Opening a page
To go to a new page, tab > New tab.
To go to another webpage, tap , scroll up or down and tap the page to select it.
Syncing with other devices
Sync open tabs and bookmarks to use with Chrome on another device when you are logged in with the same
Google account.
To view open tabs on other devices, tap > Other devices.
Select a webpage to open.
To add bookmarks, tap .

68
This section provides an overview of items you can change using your phone's System settings menus.
To access the Settings menu:
Tap > tap and hold > System settings.
- or -
Tap > > Apps tab > Settings.
Networks
< Wi-Fi >
Wi-Fi – Turns on Wi-Fi to connect to available Wi-Fi networks.
TIP! How to obtain the MAC address
To set up a connection in some wireless networks with MAC filters, you may need to
enter the MAC address of your phone in the router.
You can find the MAC address in the following user interface: tap > > Apps tab
> Settings > Networks tab > Wi-Fi > > Advanced Wi-Fi > MAC address.
< Bluetooth >
Turn the Bluetooth wireless feature on or off to use Bluetooth.
< Mobile data >
Displays the data usage and set mobile data usage limit.
< Call >
Configure phone call settings such as call forwarding and other special features offered by your carrier.
Voicemail – Allows you to select your carrier’s voicemail service.
Fixed dialing numbers – Turn on and compile a list of numbers that can be called from your phone. You’ll need
your PIN2, which is available from your operator. Only numbers within the fixed dial list can be called from your
phone.
Incoming voice call pop-up – Display incoming call popup when using camera and videos.
Call reject – Allows you to set the call reject function. Choose from Call reject mode or Reject calls from.
Settings

69
Decline with message – When you want to reject a call, you can send a quick message using this function.
This is useful if you need to reject a call during a meeting.
Privacy keeper – Hides the caller name and number for an incoming call.
Call forwarding – Choose whether to divert all calls when the line is busy, when there is no answer or when you
have no signal.
Auto answer – Set the time before a connected hands-free device automatically answers an incoming call.
Choose from Disable, 1second, 3seconds, and 5seconds.
Connection vibration – Vibrates your phone when the other party answers the call.
Save unknown numbers – Add unknown numbers to contacts after a call.
Power key ends call – Allows you to select your end call.
Call barring – Lock incoming, outgoing or international calls.
Call duration – View the duration of calls including Last call, Outgoing calls, Incoming calls and All calls.
Additional call settings – Allows you to change the following settings:
Caller ID: Choose whether to display your number in an outgoing call.
Call waiting: If call waiting is activated, the handset will notify you of an incoming call while you are on a call
(depending on your network provider).
< Share & connect >
NFC – Your phone is an NFC-enabled mobile phone. NFC (Near Field Communication) is a wireless connectivity
technology that enables two-way communication between electronic devices. It operates over a distance of a few
centimeters. You can share your content with an NFC tag or another NFC support device by simply tapping it with
your device. If you tap an NFC tag with your device, it will display the tag content on your device.
To switch NFC on or off – From the Home screen, touch and slide the notification panel down with your
finger, then select the NFC icon to turn it on.
NOTE: When airplane mode is activated, the NFC application can be used.
Using NFC – To use NFC, make sure your device is switched on, and activate NFC if disabled.
Android Beam – When this feature is turned on, you can beam app content to another NFC-capable device by
holding the devices close together.
Just bring the device together(typically back to back) and then tap your screen. The app determines what gets
beamed.

70
Settings
LG PC Suite – Check this to use LG PC Suite with your Wi-Fi connection. Please note that Wi-Fi network should
be connected to LG PC Suite via a Wi-Fi connection.
Notice: The NFC antenna for this model is on the back cover and this back cover is the
only one that is offered with the device.
<Tap & pay>
When NFC is turned on, you can use the tap & pay feature to pay for items just by touching your phone to a
reader at a register. If your device doesn’t have a default app, you can browse Google Play for other payment
apps.
< Tethering & networks >
USB tethering – Connect the USB cable to share the internet connection with the computer.
Wi-Fi hotspot – You can also use your phone to provide a mobile broadband connection. Create a hotspot and
share your connection. Please read "Sharing your phone's data connection" for more information.
Bluetooth tethering – Allows you to set your phone whether you are sharing the Internet connection or not.
Help – Tap to view help information on the Wi-Fi hotspot and Bluetooth tethering functions.
Airplane mode – After switching to Airplane mode, all wireless connections are disabled.
NOTE: You must set a lock screen PIN or password before you can use credential
storage.
Mobile networks – Set options for data roaming, network mode & operators, access point names (APNs) etc.
VPN – Displays the list of Virtual Private Networks (VPNs) that you've previously configured. Allows you to add
different types of VPNs.
Sound
Sound profile – Choose Sound, Vibrate only or Silent.
Volumes – Adjust the phone's volume settings to suit your needs and your environment.
Quiet mode – Set up your Quiet mode.
Sound profile – Choose the sound, either Silent or Vibrate only.
Set time – Choose the Set time, either Always on or schedule. If you tap schedule, you can set the days and
times to automatically turn Quiet mode on.

71
Block alarms – Checkmark to allow the screen not to turn on and no alarms sound.
Block incoming calls – Checkmark to allow or block incoming calls from certain contacts.
Incoming call settings
Auto reply to blocked calls – Set how to you want to automatically reply to silenced calls.
Allow repeated calls – Checkmark to allow a call that is repeated within 3 minutes.
Allowed contact lists – Designate which contacts calls will be allowed.
Help – Tap to view help information on quiet mode.
Ringtone – Set the ringtone for calls. You can also add a ringtone by tapping at the top right corner of the
screen.
Notification sound – Allows you to set the sound for notifications. You can also add a sound by tapping at
the top right corner of the screen.
Ringtone with vibration – Checkmark to set the phone to vibrate in addition to the ringtone when you receive
calls.
Vibration type – Allows you to choose the type of vibration.
Vibrate on tap – Checkmark to vibrate when tapping the Home touch buttons and during other UI interactions.
Sound effect – Tap to set the dial pad touch tones, touch sounds, and screen lock sound.
Dial pad touch tones – Checkmark to play tones while using dial pad.
Touch sounds – Checkmark to play sound when making screen selection.
Screen lock sound – Checkmark to play sound when locking and unlocking the screen.
Message/call voice notifications – To read out the incoming call and the message event automatically.
Display
< Home screen >
Set the Select Home, Theme, Wallpaper, Screen swipe effect, Allow Home screen looping, Home backup
& restore, Help.
< Lock screen >
Select screen lock – Set a screen lock type to secure your phone. Opens a set of screens that guide you
through drawing a screen unlock pattern. Set None, Swipe, Face Unlock, Knock Code, Pattern, PIN or
Password.
If you have enabled a Pattern lock type when you turn on your phone or wake up the screen, you will be asked
to draw your unlock pattern to unlock the screen.

72
Settings
Screen swipe effect – Sets the screen swipe effect options. Choose from Particle, Dewdrop, Crystal, Ripple,
White hole.
NOTE: Screen swipe effect becomes Pattern effect if the screen lock is set to Pattern.
Wallpaper – Sets your Lock screen wallpaper. Select it from Gallery or Wallpaper gallery.
Widgets – This menu allows you to show widgets on the Lock screen.
Shortcuts – Allows you to change the shortcuts on the Swipe Lock screen.
Contact info for lost phone – Select whether to display the owner information on the lock screen and
customize the owner information.
Lock timer – Sets the amount of time before the screen automatically locks after the screen has timed-out.
Power button instantly locks – Checkmark to instantly lock the screen when the Power/Lock Key is pressed.
This setting overrides the Security lock timer setting.
< Home touch buttons >
Set the Home Touch Keys displayed at the bottom of all of the screens. Set which ones are displayed, their
position on the bar, and what they look like. Select the keys and order, the theme, and the background.
< FONT >
Font type – Sets the type of font used for the phone and menus.
Font size – Sets the size of the font displayed in the phone and menus.
< OTHER SCREEN SETTINGS >
Brightness – Adjusts the brightness of the screen. For best battery performance, use the dimmest comfortable
brightness.
Auto-rotate screen – Checkmark to set the phone to automatically rotate the screen based on the phone
orientation (portrait or landscape).
Screen timeout – Sets the amount of time before the screen times out.
< ADVANCED SETTINGS >
Screen-off effect – Sets the screen-off effect. Choose from Retro TV, Black hole, and Fade out.
Daydream – Tap the Daydream switch to toggle it On or Off. On allows the set screensaver to be displayed
when the phone is sleeping while docked and/or charging. Choose from Clock and Google Photos.

73
General
< Language & input >
Use the Language & input settings to select the language for the text on your phone and to configure the
on-screen keyboard, including words you've added to its dictionary.
< Location >
Turn on location service, your phone determines your approximate location using GPS, Wi-Fi and mobile
networks.
Mode – Set the location mode from High accuracy (GPS and networks), Battery saving (Networks only)
and Device sensors only (GPS only).
< Accounts & sync >
Permits applications to synchronize data in the background, whether or not you are actively working in them.
Deselecting this setting can save battery power and lower (but not eliminate) data usage.
< Accessibility >
Use the Accessibility settings to configure accessibility plug-ins you have installed on your phone.
< Shortcut key >
Get quick access to apps by pressing and holding the volume keys when screen is off or locked.
< Security >
Encrypt phone – Allows you to encrypt data on the phone for security. You will be required to enter a PIN or
password to decrypt your phone each time you power it on.
Encrypt SD card storage – Allows you to encrypt SD card data on the phone for security.
Phone administrators – View or deactivate phone administrators.
Unknown sources – Default setting to install non-Play store applications.
Verify apps – Disallow or warn before installation of apps that may cause harm.
Notification access – Checkmark to enable the Lock screen to read your notifications.
Storage type – Software only.
Trusted credentials – Display trusted CA certificates.
Install from storage – Choose to install encrypted certificates.
Clear credentials – Remove all certificates.

74
Settings
< Guest mode >
To protect your privacy or limit some applications to your children, you can use the Guest mode.
When you lend your phone to others, you can limit the applications to be displayed. In advance, set the Guest
mode and customize the options.
< Gestures >
Silence incoming calls – Checkmark to enable you to flip the phone to silence incoming calls.
Snooze or stop alarm – Checkmark to enable you to simply flip the device to snooze or stop the alarm.
Pause video – Checkmark to enable you to simply flip the device to pause the currently playing video.
Help – Opens a help guide on how to use the Gestures features of your device.
Motion sensor calibration – Allows you to improve the accuracy of the tilt and speed of the sensor.
< QuickCircle case >
Keep in mind that turning on these quickcircle case settings may result in irregular device behavior.
< Date & time >
Use Date & time settings to set how dates will be displayed. You can also use these settings to set your own
time and time zone rather than obtaining the current time from the mobile network.
< Storage >
INTERNAL STORAGE – View the internal storage usage.
SD CARD – Check total available SD card space. Touch Unmount SD card for safe removal. Erase SD card if you
want to delete all data from the SD card.
< Battery >
BATTERY INFORMATION
The Battery charge information is displayed on a battery graphic along with the percentage of the remaining
charge and its status.
Touch the Battery charge icon to display the Battery use screen to see battery usage level and battery use
details. It displays which components and applications are using the most battery power. Tap one of the entries
to see more detailed information.
Battery percentage on status bar – Checkmark to display the battery level percentage on the Status Bar next
to the battery icon.

75
BATTERY SAVER
Tap the Battery saver switch to toggle it On or Off. Tap Battery saver to access the following settings:
Turn Battery saver On – Sets the battery charge percent level that will automatically turn on Battery saver.
Choose from Immediately, 10% battery, 20% battery, 30% battery, and 50% battery.
Help – Tap to view help information on the battery saver tips.
< Smart cleaning >
Display the space in use and free in your phone. Tap at the top right corner of the screen to set notification
interval and idle time period.
< Apps >
View and manage your applications.
< Default message app >
Set Messaging or Hangouts as default app.
< Backup & reset >
Change the settings for managing your settings and data.
Back up my data – Set to backup your settings and application data to the Google server.
Backup account – Set to backup your account.
Automatic restore – Set to restore your settings and application data when the applications are reinstalled on
your device.
LG Backup service – Backs up all information on the device and restores it in the event of data loss or
replacement.
Factory data reset – Reset your settings to the factory default values and delete all your data. If you reset the
phone this way, you are prompted to re-enter the same information as when you first started Android.
< Printing >
Allows you to print the content of certain screens (such as web pages displayed in Chrome) to a printer
connected to the same Wi-Fi network as your Android device.
< About phone >
View legal information and check your phone status and software version.

76
PC software (LG PC Suite)
"LG PC Suite" PC software is a program that helps you connect your device to a PC via a USB cable and Wi-Fi.
Once connected, you can use the functions of your device from your PC.
With your "LG PC Suite" PC Software, You Can...
• Manage and play your media contents (music, movie, picture) on your PC.
• Send multimedia contents to your device.
• Synchronizes data (schedules, contacts, bookmarks) in your device and PC.
• Backup the applications in your device.
• Update the softwares in your device.
• Backup and restore the device data.
• Play multimedia contents of your PC from your device.
• Backup and create and edit the memos in your device.
NOTE: You can use the Help menu from the application to find out how to use your "LG
PC Suite" PC software.
Installing "LG PC Suite" PC Software
"LG PC Suite" PC software can be downloaded from the webpage of LG.
1 Go to www.lg.com and select a country of your choice.
2 Go to Support > MOBILE SUPPORT > LG Mobile Phones > Select the Model
or
Go to Support > Mobile > Select the Model.
3 Click PC SYNC from MANUALS & DOWNLOAD and click DOWNLOAD to download "LG PC Suite" PC
software.
System Requirements for "LG PC Suite" PC software
• OS: Windows XP (Service pack 3) 32bit, Windows Vista, Windows7, Windows8
• CPU: 1GHz or higher processors
• Memory: 512MB or higher RAMs
• Graphic card: 1024x768 resolution, 32bit color or higher
• HDD: 500MB or more free hard disk space (More free hard disk space may be needed depending on the
volume of data stored.)
• Required software: LG integrated drivers, Windows Media Player10 or later

77
NOTE: LG Integrated USB Driver
LG integrated USB driver is required to connect an LG device and PC and is installed
automatically when you install "LG PC Suite" PC software application.
Synchronizing your Device to a PC
Data from your device and PC can be synchronized easily with "LG PC Suite" PC software for your convenience.
Contacts, schedules and bookmarks can be synchronized.
The procedure is as follows:
1 Connect your device to PC. (Use a USB cable or Wi-Fi connection.)
2 The Select USB connection method will appear, then select Media device (MTP).
3 After connection, run the program and select the device section from the category on the left side of the
screen.
4 Click Personal information to select.
5 Select the checkbox of contents to synchronize and click the Sync button.
NOTE: To synchronize your phone with your PC, you need to install LG PC Suite onto
your PC. Please refer to previous pages to install LG PC Suite.
Moving contacts from your Old Device to your New Device
1 Import your contacts as a CSV file from your old device to your PC using a PC sync program.
2 Install "LG PC Suite" on the PC first. Run the program and connect your Android mobile phone to the PC
using a USB cable.
3 On the top menu, select Phone > Import/Export contacts > Export to your phone.
4 A popup window to select the file type and a file to export will appear.
5 On the popup, click the Select a file and Windows Explorer will appear.
6 Select the contacts file to export in Windows Explorer and click the Open.
7 Click OK.
8 A Field mapping popup to link the contacts in your device and new contacts data will appear.
9 If there is a conflict between the data in your PC contacts and device contacts, make the necessary
selections or modifications in LG PC Suite.
10 Click OK.

78
Phone software update
LG Mobile phone software update from the Internet
For more information about using this function, please visit http://www.lg.com/common/index.jsp
select your country and language.
This feature allows you to conveniently update the firmware on your phone to a newer version from the Internet
without needing to visit a service center. This feature will only be available if and when LG makes a newer
firmware version available for your device.
Because the mobile phone firmware update requires the user's full attention for the duration of the update
process, please make sure you check all instructions and notes that appear at each step before proceeding.
Please note that removing the USB data cable during the upgrade may seriously damage your mobile phone.
NOTE: LG reserves the right to make firmware updates available only for selected models
at its own discretion and does not guarantee the availability of the newer version of the
firmware for all handset models.
LG Mobile Phone software update via Over-the-Air (OTA)
This feature allows you to conveniently update your phone's software to a newer version via OTA, without
connecting using a USB data cable. This feature will only be available if and when LG makes a newer firmware
version available for your device.
You should first check the software version on your mobile phone: Settings > General tab > About phone >
Update Center > Software Update > Check now for update.
NOTE: Your personal data from internal phone storage—including information about
your Google account and any other accounts, your system/application data and settings,
any downloaded applications and your DRM licence—might be lost in the process of
updating your phone's software. Therefore, LG recommends that you backup your
personal data before updating your phone's software. LG does not take responsibility for
any loss of personal data.
NOTE: This feature depends on your network service provider, region and country.
Phone software update

79
About this user guide
About this user guide
• Before using your device, please carefully read this manual. This will ensure that you use your phone safely
and correctly.
• Some of the images and screenshots provided in this guide may appear differently on your phone.
• Your content may differ from the final product, or from software supplied by service providers or carriers, This
content may be subject to change without prior notice. For the latest version of this manual, please visit the LG
website at www.lg.com.
• Your phone's applications and their functions may vary by country, region, or hardware specifications. LG
cannot be held liable for any performance issues resulting from the use of applications developed by providers
other than LG.
• LG cannot be held liable for performance or incompatibility issues resulting from registry settings being edited
or operating system software being modified. Any attempt to customize your operating system may cause the
device or its applications to not work as they should.
• Software, audio, wallpaper, images, and other media supplied with your device are licensed for limited use. If
you extract and use these materials for commercial or other purposes, you may be infringing copyright laws.
As a user, you are fully and entirely responsible for the illegal use of media.
• Additional charges may be applied for data services, such as messaging, uploading and downloading, auto-
syncing, or using location services. To avoid additional charges, select a data plan that is suitable for your
needs. Contact your service provider to obtain additional details.
Trademarks
• LG and the LG logo are registered trademarks of LG Electronics.
• All other trademarks and copyrights are the property of their respective owners.
Notice: Open Source Software
To obtain the corresponding source code under GPL, LGPL, MPL and other open source
licences, please visit http://opensource.lge.com/
All referred licence terms, disclaimers and notices are available for download with the
source code.

80
These accessories are available for use with the your phone. (Items described below may be optional.)
Travel adaptor Stereo headset
Quick Start Guide Data cable
Battery
NOTE:
• Always use genuine LG accessories.
• Failure to do this may void your warranty.
• Accessories may vary in different regions.
Accessories

81
This chapter lists some problems you might encounter when using your phone. Some problems require you to
call your service provider, but most are easy to fix yourself.
Message Possible causes Possible corrective measures
SIM card error
There is no SIM card
in the phone or it is
inserted incorrectly.
Make sure that the SIM card is correctly
inserted.
No network
connection/
Dropped
network
Signal is weak or you
are outside the carrier
network.
Move toward a window or into an open
area. Check the network operator
coverage map.
Operator applied new
services.
Check whether the SIM card is more than
6~12 months old. If so, change your SIM
card at your network provider's nearest
branch. Contact your service provider.
Codes do not
match
To change a security
code, you will need to
confirm the new code
by re-entering it. If you forget the code, contact your
service provider.
The two codes you
have entered do not
match.
No applications
can be set
Not supported by
service provider or
registration required.
Contact your service provider.
Troubleshooting

82
Troubleshooting
Message Possible causes Possible corrective measures
Calls not
available
Dialling error New network not authorized.
New SIM card
inserted. Check for new restrictions.
Pre-paid charge limit
reached.
Contact service provider or reset limit
with PIN2.
Phone cannot
be switched on
On/Off key pressed
too briefly.
Press the On/Off key for at least two
seconds.
Battery is not
charged.
Charge battery. Check the charging
indicator on the display.
Charging error
Battery is not
charged. Charge battery.
Outside temperature
is too hot or cold.
Make sure phone is charging at a normal
temperature.
Contact problem Check the charger and its connection to
the phone.
No voltage Plug the charger into a different socket.
Charger defective Replace the charger.
Wrong charger Use only original LG accessories.
Number not
allowed
The Fixed dialling
number function
is on.
Check the Settings menu and turn the
function off.

83
Message Possible causes Possible corrective measures
Impossible to
receive / send
SMS & photos
Memory full Delete some messages from your phone.
Files do not
open
Unsupported file
format Check the supported file formats.
The screen
does not turn
on when I
receive a call.
Proximity sensor
problem
If you use a protection tape or case, make
sure it has not covered the area around
the proximity sensor. Make sure that the
area around the proximity sensor is clean.
No sound Vibration mode
Check the settings status in the sound
menu to make sure you are not in
vibration or silent mode.
Hangs up or
freezes
Intermittent software
problem
Try to perform a software update via the
website.

84
FAQ
Category
Sub-Category Question Answer
BT
Bluetooth Devices
What are the functions
available via Bluetooth
You can connect a Bluetooth audio
device such as a Stereo/Mono
headset or Car Kit. Also, when
the FTP server is connected to a
compatible device, you can share
content stored on the storage media.
Data
Contacts Backup
How can I backup
Contacts?
The Contacts data can be
synchronized between your phone
and Gmail™.
Data
Synchronization
Is it possible to set up
one-way sync with
Gmail?
Only two-way synchronization is
available.
Data
Synchronization
Is it possible to
synchronize all email
folders?
The Inbox is automatically
synchronized. You can view other
folders by tapping and select
Folders to choose a folder.
Google™
Service
Gmail Log-In
Do I have to log into
Gmail whenever I want
to access Gmail?
Once you have logged into Gmail, no
need to log into Gmail again.
Google™
Service
Google Account
Is it possible to filter
emails?
No, email filtering is not supported via
the phone.

85
Category
Sub-Category Question Answer
Phone Function
E-mail
What happens when
I execute another
application while writing
an email?
Your email will automatically be saved
as a draft.
Phone Function
Ringtone
Is there a file size
limitation for when I
want to use MP3 file as
ring tone?
There is no file size limitation.
Phone Function
Message Time
My phone does not
display the time of
receipt for messages
older than 24 hrs. How
can I change this?
You will only be able to see the times
for messages received the same day.
Phone Function
Navigation
Is it possible to install
another navigation
application on my
phone?
Any application that is available at
Play Store™ and is compatible with
the hardware can be installed and
used.
Phone Function
Synchronisation
Is it possible to
synchronize my
contacts from all my
email accounts?
Only Gmail and MS Exchange server
(company email server) contacts can
be synchronized.

86
FAQ
Category
Sub-Category Question Answer
Phone Function
Wait and Pause
Is it possible to save a
contact with Wait and
Pause in the numbers?
If you transferred a contact with the W
& P functions saved into the number,
you will not be able to use those
features. You will need to re-save
each number.
How to save with Wait and Pause:
1. From the Home screen, tap the
Phone icon .
2. Dial the number, then tap .
3. Tap Add 2-sec pause or Add
wait.
Phone Function
Security
What are the phone’s
security functions?
You are able to set the phone to
require that an Unlock Pattern be
entered before the phone can be
accessed or used.

87
Category
Sub-Category Question Answer
Phone Function
Unlock Pattern
How do I create the
Unlock Pattern?
1. From the Home screen, tap and
hold the Recent Key .
2. Tap System settings > Display
tab > Lock screen.
3. Tap Select screen lock > Pattern.
The first time you do this, a short
tutorial about creating an Unlock
Pattern will appear.
4. Set up by drawing your pattern
once, and once again for
confirmation.
Precautions to take when using the
pattern lock.
It is very important to remember the
unlock pattern you set. You will not
be able to access your phone if you
use an incorrect pattern five times.
You have five chances to enter your
unlock pattern, PIN or password. If
you have used all 5 opportunities, you
can try again after 30 seconds. (Or, if
you preset the backup PIN, you can
use the backup PIN code to unlock
the pattern.)

88
FAQ
Category
Sub-Category Question Answer
Phone Function
Unlock Pattern
What should I do if
I forget the unlock
pattern and I didn’t
create my Google
account on the phone?
If you have forgotten your pattern:
If you logged into your Google
account on the phone but failed to
enter the correct pattern 5 times,
tap the forgot pattern button. You
are then required to log in with your
Google account to unlock your
phone. If you have not created a
Google account on the phone or you
have forgotten it, you will have to
perform a hard reset.
Caution: If you perform a factory
reset, all user applications and
user data will be deleted. Please
remember to backup any important
data before performing a factory
reset.
Phone Function
Memory
Will I know when my
memory is full? Yes, you will receive a notification.
Phone Function
Language
Support
Is it possible to change
my phone's language?
The phone has multilingual
capabilities.
To change the language:
1. From the Home screen, tap and
hold the Recent Key and tap
System settings.
2. Tap General tab > Language &
input > Language.
3. Tap the desired language.

89
Category
Sub-Category Question Answer
Phone Function
VPN
How do I set up a
VPN?
VPN access configuration is different
for each company. To configure
VPN access from your phone, you
must obtain the details from your
company’s network administrator.
Phone Function
Screen time out
My screen turns off
after only 15 seconds.
How can I change the
amount of time for the
backlight to turn off?
1. From the Home screen, tap and
hold the Recent Key .
2. Tap System settings > Display
tab.
3. Tap Screen timeout.
4. Tap the preferred screen backlight
timeout time.
Phone Function
Wi-Fi & mobile
network
When Wi-Fi and mobile
network are both
available, which service
will my phone use?
When using data, your phone may
default to the Wi-Fi connection (if
Wi-Fi connectivity on your phone is
set to On). However, there will be no
notification when your phone switches
from one to the other.
To know which data connection is
being used, view the mobile network
or Wi-Fi icon at the top of your
screen.
Phone Function
Home screen
Is it possible to remove
an application from the
Home screen?
Yes. Just touch and hold the icon until
the dustbin icon appears at the top
right hand side of the screen. Then,
without lifting your finger, drag the
icon to the trash can.

90
FAQ
Category
Sub-Category Question Answer
Phone Function
Application
I downloaded an
application and it
causes a lot of errors.
How do I remove it?
1. From the Home screen, tap and
hold the Recent Key .
2. Tap System settings > General
tab > Apps > DOWNLOADED.
3. Tap the application, then tap
Uninstall.
Phone Function
Charger
Is it possible to charge
my phone using a USB
data cable without
installing the necessary
USB driver?
Yes, the phone will be charged by the
USB cable regardless of whether the
necessary drivers are installed or not.
Phone Function
Alarm
Can I use music files for
my alarm?
Yes. In the Alarm clock setting, select
the song as the Alarm sound.
Phone Function
Alarm
Will my alarm be
audible if the phone is
turned off?
No, this is not supported.
Phone Function
Alarm
If my ringer volume is
set to Off or Vibrate, will
I hear my alarm?
Your alarm is programmed to be
audible even in these scenarios.
Recovery
Solution
Hard Reset
(Factory Reset)
How can I perform a
factory reset if I can’t
access the phone’s
setting menu?
If your phone does not restore to its
original condition, use a hard reset
(factory reset) to initialize it.
