LG Electronics USA D690 Cellular/PCS GSM/WCDMA Phone with WLAN and Bluetooth User Manual
LG Electronics MobileComm USA, Inc. Cellular/PCS GSM/WCDMA Phone with WLAN and Bluetooth Users Manual
Users Manual

www.lg.com
ENGLISH
MFL00000000 (1.0)
User Guide
LG-D690

2CTVUVCVGOGPV
&KDQJHRU0RGLILFDWLRQVWKDWDUHQRWH[SUHVVO\DSSURYHGE\WKHPDQXIDFWXUHUFRXOGYRLG
WKHXVHUVDXWKRULW\WRRSHUDWHWKHHTXLSPHQW
2CTVUVCVGOGPV
7KLVHTXLSPHQWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWKWKHOLPLWVIRUDFODVV%GLJLWDO
GHYLFHSXUVXDQWWR3DUWRIWKH)&&5XOHV7KHVHOLPLWVDUHGHVLJQHGWRSURYLGH
UHDVRQDEOHSURWHFWLRQDJDLQVWKDUPIXOLQWHUIHUHQFHLQDUHVLGHQWLDOLQVWDOODWLRQ7KLV
HTXLSPHQWJHQHUDWHVXVHVDQGFDQUDGLDWHUDGLRIUHTXHQF\HQHUJ\DQGLIQRWLQVWDOOHGDQG
XVHGLQDFFRUGDQFHZLWKWKHLQVWUXFWLRQVPD\FDXVHKDUPIXOLQWHUIHUHQFHWRUDGLR
FRPPXQLFDWLRQV+RZHYHUWKHUHLVQRJXDUDQWHHWKDWLQWHUIHUHQFHZLOOQRWRFFXULQD
SDUWLFXODULQVWDOODWLRQ,IWKLVHTXLSPHQWGRHVFDXVHKDUPIXOLQWHUIHUHQFHRUWHOHYLVLRQ
UHFHSWLRQZKLFKFDQEHGHWHUPLQHGE\WXUQLQJWKHHTXLSPHQWRIIDQGRQWKHXVHULV
HQFRXUDJHGWRWU\WRFRUUHFWWKHLQWHUIHUHQFHE\RQHRUPRUHRIWKHIROORZLQJPHDVXUHV
5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD
,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKH HTXLSPHQWDQGUHFHLYHU
&RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLWGLIIHUHQWIURPWKDWWRZKLFKWKH
UHFHLYHULVFRQQHFWHG
&RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLR79WHFKQLFLDQIRUKHOS
Part .19 statement
7KLVGHYLFHFRPSOiesZLWKSDUWRI)&&UXOHV.2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJ
WZRFRQGLWLRQV7KLVGHYLFHPD\QRWFDXVHKDUPIXOLQWHUIHUHQFHDQG
WKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHGLQFOXGLQJ
LQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHGRSHUDWLRQ
$QF[YQTP1RGTCVKQP
7KLVGHYLFHwasWHVWHGIRUtypical ERG\ZRUQRSHUDWLRQVZLWKWKH back of the phone kept
FP LQFKHVEHWZHHQWKHXVHUĜVERG\DQGWKHback of the SKRQH
7RFRPSO\ZLWK)&&5)H[SRVXUH UHTXLUHPHQWVDPLQLPXPVHSDUDWLRQGLVWDQFHRIFP
LQFKHVPXVWEHPDLQWDLQHG betweenWKHXVHUVERG\ and the back of the phone
Any EHOWFOLSVKROVWHUVDQGVLPLODUDFFHVVRULHVFRQWDLQLQJ PHWDOOLFFRPSRQHQWVPD\
QRWEHXVHG%RG\ZRUQDFFHVVRULHVWKDWFDQQRWPDLQWDLQFPLQFKHVVHSDUDWLRQ
GLVWDQFHEHWZHHQWKHXVHUVERG\DQGWKHback of SKRQHDQGKDYHQRW EHHQWHVWHGIRU
W\SLFDOERG\ZRUQRSHUDWLRQVPD\QRWFRPSO\ZLWK)&&5)H[SRVXUHOLPLWV DQG
VKRXOGEHDYRLGHG
7KLV GHYLFHLVQRWLQWHQGHGIRUVDOHLQWKH86$

User Guide
• Screen displays and illustrations may differ from
those you see on actual phone.
• Some of the contents of this guide may not apply
to your phone, depending on the software and your
service provider. All information in this document is
subject to change without notice.
• This handset is not suitable for people who have a
visual impairment due to the tap screen keyboard.
• Copyright ©2014 LG Electronics, Inc. All rights
reserved. LG and the LG logo are registered
trademarks of LG Group and its related entities. All
other trademarks are the property of their respective
owners.
• Google™, Google Maps™, Gmail™, YouTube™,
Hangouts™ and Play Store™ are trademarks of
Google, Inc.
ENGLISH

2
Table of contents
For your safety .......................................... 5
Safety instructions .................................12
Important notice .....................................20
Getting to know your phone ................... 26
Phone overview .....................................26
Installing the SIM card and battery .........28
Charging your phone .............................30
Using the memory card..........................31
Locking and unlocking the screen .......... 32
Knock Code ......................................... 33
KnockON ............................................. 33
Your Home screen ................................... 34
Touch screen tips ..................................34
Home screen .........................................35
Extended home screen ....................... 35
Customizing the Home screen ..............36
Returning to recently-used applications .37
Notifications panel .................................37
Opening the notifications panel ............. 38
Indicator icons on the Status Bar ..........38
On-screen keyboard ..............................40
Entering accented letters ...................... 40
Google account setup ............................. 41
Connecting to Networks and Devices .... 42
Wi-Fi .....................................................42
Connecting to Wi-Fi networks ...............42
Turning Wi-Fi on and connecting to a
Wi-Fi network ......................................42
Bluetooth ...............................................43
Sharing your phone's data connection ...44
Wi-Fi Direct ...........................................46
PC connections with a USB cable ........... 46
Calls ........................................................48
Making a call .........................................48
Calling your contacts .............................48
Answering and rejecting a call ...............48
When the screen is locked/unlocked .....48
Adjusting the in-call volume ...................49
Making a second call .............................49
Viewing your call logs ............................49
Call settings ........................................... 50
Contacts ..................................................51
Searching for a contact .......................... 51
Adding a new contact ............................51
Favourites contacts ................................51
Creating a group .................................... 52
Messaging ............................................... 53
Sending a message ...............................53
View mode ...........................................54
Changing your message settings ...........54
E-mail ......................................................55
Managing an email account ................... 55
Working with account folders .................55
Composing and sending email ...............56

3
Camera and Video ...................................57
To open the Camera application ............. 57
Getting to know the viewfinder ..............57
Take Pictures ......................................... 58
Record Videos ........................................ 58
Camera and Video Settings ....................59
Gesture shot ..........................................60
View Your Pictures .................................60
Gallery ................................................... 60
To open the Gallery application .............60
Working with photos ............................61
Working with videos .............................62
QSlide while playing videos ..................63
Function ..................................................64
QuickMemo+ ......................................... 64
Using the QuickMemo+ options ............ 65
Viewing the saved QuickMemo+ .......... 65
QSlide ....................................................66
QuickRemote .........................................67
Dual window..........................................68
LG SmartWorld ......................................69
How to Get to LG SmartWorld from Your
Phone .................................................69
Multimedia ..............................................70
Music ....................................................70
Add music files to your phone ............... 70
Transfer music using Media device
(MTP) .................................................. 70
Playing a song .....................................70
Utilities ....................................................73
Setting your alarm .................................73
Using your calculator .............................73
Adding an event to your calendar ........... 73
Voice Recorder ......................................74
Recording a sound or voice ..................74
Sending the voice recording .................74
Tasks ..................................................... 74
Google+ ................................................75
Voice Search..........................................75
Downloads ............................................75
ThinkFree Viewer ...................................76
FM radio ................................................76
The Web ..................................................77
Internet .................................................. 77
Using the Web toolbar ..........................77
Viewing webpages ...............................77
Opening a page ...................................77
Searching the web by voice ..................78
Bookmarks ..........................................78
History ................................................78
Chrome .................................................78
Viewing webpages ...............................78
Opening a page ...................................78
Syncing with other devices ...................79
Adding and viewing bookmarks ............79
Settings ...................................................80
Networks ...............................................80
Sound .................................................... 83
Display ..................................................85

4
General .................................................. 87
PC software (LG PC Suite) ......................96
Phone software update ..........................99
Phone software update ..........................99
About this user guide ...........................101
About this user guide ........................... 101
Trademarks .........................................101
DivX HD ...............................................102
Dolby Digital Plus ................................. 102
Accessories ........................................... 103
Troubleshooting ....................................104
FAQ ........................................................108
Table of contents

6
Product care and maintenance
WARNING
Only use batteries, chargers and accessories approved for use with this
particular phone model. The use of any other types may invalidate any
approval or warranty applying to the phone and may be dangerous.
• Do not disassemble this unit. Take it to a qualified service technician when repair
work is required.
• Repairs under warranty, at LG's discretion, may include replacement parts or boards
that are either new or reconditioned, provided that they have functionality equal to
that of the parts being replaced.
• Keep away from electrical appliances such as TVs, radios and personal computers.
• The unit should be kept away from heat sources such as radiators or cookers.
• Do not drop.
• Do not subject this unit to mechanical vibration or shock.
• Switch off the phone in any area where you are required to by special regulations.
For example, do not use your phone in hospitals as it may affect sensitive medical
equipment.
Please read these simple guidelines. Not following these guidelines may be dangerous
or illegal.
Should a fault occur, a software tool is built into your device that will gather a fault log.
This tool gathers only data specific to the fault, such as signal strength, cell ID position
in sudden call drop and applications loaded. The log is used only to help determine the
cause of the fault. These logs are encrypted and can only be accessed by an authorized
LG Repair centre should you need to return your device for repair.
Guidelines for safe and efficient use

7
• Do not handle the phone with wet hands while it is being charged. It may cause an
electric shock and can seriously damage your phone.
• Do not charge a handset near flammable material as the handset can become hot
and create a fire hazard.
• Use a dry cloth to clean the exterior of the unit (do not use solvents such as benzene,
thinner or alcohol).
• Do not charge the phone when it is on soft furnishings.
• The phone should be charged in a well ventilated area.
• Do not subject this unit to excessive smoke or dust.
• Do not keep the phone next to credit cards or transport tickets; it can affect the
information on the magnetic strips.
• Do not tap the screen with a sharp object as it may damage the phone.
• Do not expose the phone to liquid or moisture.
• Use accessories like earphones cautiously. Do not touch the antenna unnecessarily.
• Do not use, touch or attempt to remove or fix broken, chipped or cracked glass.
Damage to the glass display due to abuse or misuse is not covered under the
warranty.
• Your phone is an electronic device that generates heat during normal operation.
Extremely prolonged, direct skin contact in the absence of adequate ventilation may
result in discomfort or minor burns. Therefore, use care when handling your phone
during or immediately after operation.
• If your phone gets wet, immediately unplug it to dry off completely. Do not attempt
to accelerate the drying process with an external heating source, such as an oven,
microwave or hair dryer.
• The liquid in your wet phone, changes the color of the product label inside your
phone. Damage to your device as a result of exposure to liquid is not covered under
your warranty.

8
Efficient phone operation
Electronics devices
All mobile phones may receive interference, which could affect performance.
• Do not use your mobile phone near medical equipment without requesting
permission. Avoid placing the phone over pacemakers, for example, in your breast
pocket.
• Some hearing aids might be disturbed by mobile phones.
• Minor interference may affect TVs, radios, PCs etc.
• Use your phone in temperatures between 0ºC and 40ºC, if possible. Exposing your
phone to extremely low or high temperatures may result in damage, malfunction, or
even explosion.
Road safety
Check the laws and regulations on the use of mobile phones in the area when you
drive.
• Do not use a hand-held phone while driving.
• Give full attention to driving.
• Pull off the road and park before making or answering a call if driving conditions so
require.
• RF energy may affect some electronic systems in your vehicle such as car stereos
and safety equipment.
• When your vehicle is equipped with an air bag, do not obstruct with installed or
portable wireless equipment. It can cause the air bag to fail or cause serious injury
due to improper performance.
• If you are listening to music whilst out and about, please ensure that the volume is
at a reasonable level so that you are aware of your surroundings. This is of particular
importance when near roads.
Guidelines for safe and efficient use

9
Avoid damage to your hearing
To prevent possible hearing damage, do not listen at high volume
levels for long periods.
Damage to your hearing can occur if you are exposed to loud sound for long periods of
time. We therefore recommend that you do not turn on or off the handset close to your
ear. We also recommend that music and call volumes are set to a reasonable level.
• When using headphones, turn the volume down if you cannot hear the people
speaking near you, or if the person sitting next to you can hear what you are listening
to.
NOTE: Excessive sound pressure from earphones and headphones can
cause hearing loss
Glass Parts
Some parts of your mobile device are made of glass. This glass could break if your
mobile device is dropped on a hard surface or receives a substantial impact. If the glass
breaks, do not touch or attempt to remove it. Stop using your mobile device until the
glass is replaced by an authorised service provider.
Blasting area
Do not use the phone where blasting is in progress. Observe restrictions and follow any
regulations or rules.

10
Potentially explosive atmospheres
• Do not use your phone at a refueling point.
• Do not use near fuel or chemicals.
• Do not transport or store flammable gas, liquid or explosives in the same
compartment of your vehicle as your mobile phone or accessories.
In aircraft
Wireless devices can cause interference in aircraft.
• Turn your mobile phone off before boarding any aircraft.
• Do not use it on the ground without permission from the crew.
Children
Keep the phone in a safe place out of the reach of small children. It includes small parts
which may cause a choking hazard if detached.
Emergency calls
Emergency calls may not be available on all mobile networks. Therefore you should
never depend solely on your phone for emergency calls. Check with your local service
provider.
Guidelines for safe and efficient use

11
Battery information and care
• You do not need to completely discharge the battery before recharging. Unlike other
battery systems, there is no memory effect that could compromise the battery's
performance.
• Use only LG batteries and chargers. LG chargers are designed to maximise the
battery life.
• Do not disassemble or short-circuit the battery.
• Replace the battery when it no longer provides acceptable performance. The battery
pack may be recharged hundreds of times before it needs replacing.
• Recharge the battery if it has not been used for a long time to maximise usability.
• Do not expose the battery charger to direct sunlight or use it in high humidity, such as
in the bathroom.
• Do not leave the battery in hot or cold places, as this may deteriorate battery
performance.
• There is risk of explosion if the battery is replaced with an incorrect type.
• Dispose of used batteries according to the manufacturer's instructions. Please recycle
when possible. Do not dispose as household waste.
• If you need to replace the battery, take it to the nearest authorised LG Electronics
service point or dealer for assistance.
• Always unplug the charger from the wall socket after the phone is fully charged to
save unnecessary power consumption of the charger.
• Actual battery life will depend on network configuration, product settings, usage
patterns, battery and environmental conditions.
• Make sure that no sharp-edged items such as animal’s teeth or nails, come into
contact with the battery. This could cause a fire.

12
Guidelines for safe and efficient use
DECLARATION OF CONFORMITY
Hereby, LG Electronics declares that this LG-D690 product is in compliance
with the essential requirements and other relevant provisions of Directive
1999/5/EC. A copy of the Declaration of Conformity can be found at http://
www.lg.com/global/declaration
Notice: Open Source Software
To obtain the corresponding source code under GPL, LGPL, MPL and other
open source licences, please visit http://opensource.lge.com/
All referred licence terms, disclaimers and notices are available for download
with the source code.
Contact office for compliance of this product :
LG Electronics Inc.
EU Representative, Krijgsman 1,
1186 DM Amstelveen, The Netherlands
HOW TO UPDATE YOUR SMARTPHONE
Access to latest firmware releases, new software functions and improvements.
•Update your smartphone without a PC. Select Update Center >
Software Update.
•Update your smartphone by connecting it to your PC. For
more information about using this function, please visit http://www.
lg.com/common/index.jsp select country and language.

13
Disposal of waste batteries/accumulators
1 This symbol may be combined with chemical symbols for mercury (Hg), cadmium
(Cd) or lead (Pb) if the battery contains more than 0.0005% of mercury, 0.002% of
cadmium or 0.004% of lead.
2 All batteries/accumulators should be disposed separately from the municipal waste
stream via designated collection facilities appointed by the government or the local
authorities.
3 The correct disposal of your old batteries/accumulators will help to prevent potential
negative consequences for the environment, animal and human health.
4 For more detailed information about disposal of your old batteries/ accumulators,
please contact your city office, waste disposal service or the shop where you
purchased the product.
Disposal of your old appliance
1 All electrical and electronic products should be disposed of separately from the
municipal waste stream via designated collection facilities appointed by the
government or the local authorities.
2 The correct disposal of your old appliance will help prevent potential negative
consequences for the environment and human health.
3 For more detailed information about disposal of your old appliance, please contact
your city office, waste disposal service or the shop where you purchased the
product.

14
Important notice
Please check to see whether any problems you encountered with your phone are
described in this section before taking the phone in for service or calling a service
representative.
1. Phone memory
When there is less than 10% of space available in your phone memory, your phone
cannot receive new messages. You need to check your phone memory and delete some
data, such as applications or messages, to make more memory available.
To uninstall applications:
1 Tap > > Apps tab > Settings > General tab > Apps.
2 Once all applications appear, scroll to and select the application you want to
uninstall.
3 Tap Uninstall, then tap OK to confirm.
2. Optimizing battery life
Extend your battery's power by turning off features that you don't have to run constantly
in the background. You can monitor how applications and system resources consume
battery power.
Extending your phone's battery life:
• Turn off radio communications when you are not using. If you are not using Wi-Fi,
Bluetooth or GPS, turn them off.
• Reduce screen brightness and set a shorter screen timeout.
• Turn off automatic syncing for Gmail, Calendar, Contacts and other applications.
• Some applications you have downloaded may reduce battery power.
• While using downloaded applications, check the battery charge level.
Please read this before you start using your phone!

15
NOTE: If you accidently press the Power/Lock Key while the device is in your
pocket, the screen will turn off automatically in order to save battery power.
To check the battery power level:
• Tap > > Apps tab > Settings > General tab > About phone >
Common tab > Battery.
The battery status (charging or discharging) and battery level (percentage charged) is
displayed at the top of the screen.
To monitor and control how battery power is being used:
• Tap > > Apps tab > Settings > General tab > About phone >
Common tab > Battery > Battery use.
Battery usage time is displayed on the screen. It tells you how long it has been since
you last connected your phone to a power source or, if currently connected, how long
the phone was last running on battery power. The screen shows the applications or
services using battery power, listed in order from the greatest to smallest amount used.
3. Before installing an open source application and OS
WARNING
If you install and use an OS other than the one provided by the manufacturer
it may cause your phone to malfunction. In addition, your phone will no longer
be covered by the warranty.

16
Important notice
WARNING
To protect your phone and personal data, only download applications from
trusted sources, such as Play Store™. If there are improperly installed
applications on your phone, the phone may not work normally or a serious
error may occur. You must uninstall those applications and all associated data
and settings from the phone.
4. Using an unlock pattern
Set an unlock pattern to secure your phone. Tap > > Apps tab > Settings
> Display tab > Lock screen > Select screen lock > Pattern. This opens a screen
that will guide you through how to draw a screen unlock pattern. You have to create a
Backup PIN as a safety measure in case you forget your unlock pattern.
Caution: Create a Google account before setting an unlock pattern and
remember the Backup PIN you created when creating your pattern lock.
WARNING
Precautions to take when using pattern lock.
It is very important to remember the unlock pattern you set. You will not be
able to access your phone if you use an incorrect pattern 5 times. You have 5
opportunities to enter your unlock pattern, PIN or password. If you have used
all 5 opportunities, you can try again after 30 seconds.
When you can’t recall your unlock Pattern, PIN or Password:
< If you have forgotten your pattern >
If you logged in to your Google account on the phone but failed to enter the correct
pattern 5 times, tap the Forgot pattern? button at the bottom of the screen. You are
then required to log in with your Google Account or you have to enter the Backup PIN
which you entered when creating your Pattern Lock.

17
If you have not created a Google account on the phone or you forgot Backup PIN, you
have to perform a hard reset.
< If you have forgotten your PIN or Password >
If you forget your PIN or Password, you will need to perform a hard reset.
Caution: If you perform a hard reset, all user applications and user data will be
deleted.
NOTE: If you have not logged into your Google Account and have forgotten
your Unlock Pattern, you will need to enter your Backup PIN.
5. Using the Hard Reset (Factory Reset)
If your phone does not restore to its original condition, use a Hard Reset (Factory Reset)
to initialize it.
1 Turn the power off.
2 Press and hold the Power/Lock key + Volume Down key on the back of the
phone.
3 Release the Power/Lock Key only when the LG logo is displayed, then immediately
press and hold the Power/Lock Key again.
4 Release all keys when the Factory hard reset screen is displayed.
5 Select Yes using Volume Up/Down Key and press the Power/Lock Key to
continue, or select No (Exit) using Volume Up/Down Key and press the Power/
Lock Key to cancel.
WARNING
If you perform a Hard Reset, all user applications, user data and DRM licenses
will be deleted. Please remember to backup any important data before
performing a Hard Reset.

18
Important notice
6. Opening and switching applications
Multi-tasking is easy with Android, you can keep more than one application running
at the same time. There is no need to quit an application before opening another one.
Use and switch between several open applications. Android manages each application,
stopping and starting them as needed to ensure that idle applications don't consume
resources unnecessarily.
1 Tap Recent Key . A list of recently used applications will be displayed.
2 Tap the application you want to access. This does not stop the previous app
running in the background on the phone. Make sure to tap Back Key to exit
an app after using it.
• To remove an app from the recent apps list, swipe the app preview to the left or right.
To clear all apps, tap Clear all.
7. Transferring music, photos and videos using Media
device (MTP)
1 Tap > > Apps tab > Settings > General tab > Storage to check out
the storage media.
2 Connect the phone to your PC using the USB cable.
3 Slide down the status bar and tap Tap for more USB options and select Media
device (MTP) option.
4 Open the memory folder on your PC. You can view the mass storage content on
your PC and transfer the files from PC to Device memory folder or vice versa.
5 After transfering files ,slide down the status bar and tap Tap for more USB
options and select Charge phone from USB connection type list.

19
8. Hold your phone upright
Hold your cell phone vertically, as you would a regular phone. Your phone has an
internal antenna. Be careful not to scratch or damage the back of the phone, as this
may affect performance.
When making/receiving calls or sending/receiving data, avoid holding the lower part of
the phone where the antenna is located. Doing so may affect call quality.
9. Do not connect your phone when you power on/off
your PC
Make sure to disconnect your phone from the PC when powering your PC on or off as it
might result in PC errors.

20
Phone overview
Back Key
• Returns to the previous screen. Also closes pop-up
items such as menus, dialog boxes, and the on-screen
keyboard. Touch and hold it to access Dual window.
Front Camera Lens
Proximity Sensor
Home Key
• Return to the Home screen from any screen.
Notification LED
Earpiece
Touch Screen
Recent Apps Key
• Displays recently used applications. If you touch and hold
this key, it opens available options menu.
Dual SIM Key
• Choose which SIM card you’re going to use.
NOTE: Proximity sensor
When receiving and making calls, the proximity sensor automatically turns the backlight off
and locks the touch screen by sensing when the phone is near your ear. This extends battery
life and prevents you from unintentionally activating the touch screen during calls.
WARNING
Placing a heavy object on the phone or sitting on it can damage the LCD and touch screen
functions. Do not cover the LCD proximity sensor with protective film. This could cause the
sensor to malfunction.
Getting to know your phone

21
WARNING
• Please be careful not to block the microphone by your hand when you call.
• Be careful not to damage the NFC touch point on the phone, which is part
of the NFC antenna.
Volume Keys (While screen is
switched off)
• Long Press Up to launch
QuickMemo
• Long Press Down to launch
Camera
Earphone Jack
Microphone
Charger/USB port
Power/Lock Key
• Switch your phone on/
off by pressing and
holding this key
• Short press to lock/
unlock the screen
NFC Touch Point
Speaker
Rear Camera Lens
Flash
Microphone
Stylus Pen
Infrared LED

22
Getting to know your phone
Installing the SIM card and battery
Before you can start exploring your new phone, you'll need to set it up.
1 To remove the back cover, hold the phone firmly in one hand. With your other hand,
lift off the back cover with your thumbnail as shown in figure below.
2 Slide the SIM card into the lower slot for the SIM card as shown in figure. Make
sure the gold contact area on the card is facing downwards.

23
3 Insert the battery into place by aligning the gold contacts on the phone and the
battery (1) and pressing it down until it clicks into place (2).
4 Align the back cover over the battery compartment (1) and press it down until it
clicks into place (2).

24
Getting to know your phone
Charging your phone
Charge the battery before using it for the first time. Use the charger to charge the
battery. A computer can be also used to charge the device by connecting them via the
USB cable.
WARNING
Use only LG-approved chargers, batteries and cables. If you use unapproved
chargers, batteries or cables, it may cause battery charging delay or pop up
message regarding slow charging, Or this can cause the battery to explode or
damage the device, which are not covered by the warranty.
The charger connector is at the bottom of the phone. Insert the charger and plug it into
an electrical outlet.

25
NOTE:
• The battery must be fully charged initially to improve battery lifetime.
• Do not open the back cover while your phone is charging.
Using the memory card
Your phone supports the use of microSDTM or microSDHCTM memory cards of up
to 32GB capacity. These memory cards are specifically designed for mobile phones
and other ultra-small devices and are ideal for storing media-rich files such as music,
programs, videos, and photographs for use with your phone.
To insert a memory card:
Insert the memory card into the upper slot for the memory card. Make sure the gold
contact area of Memory card is facing downwards.
To safely remove the memory card:
Touch > Apps tab > Settings > General tab > Storage > Unmount SD card.

26
Getting to know your phone
NOTE:
• Use only compatible memory cards with your phone. Using incompatible
memory cards may damage the card and data stored on the card, as well
as the phone.
• It’s important to unmount the memory card prior to removing it from the
phone to avoid damage to it or the data saved on the card.
To format the memory card:
Your memory card may already be formatted. If it isn't, you must format it before you
can use it.
NOTE: All files on your memory card are deleted when it is formatted.
1 Touch > Apps tab > Settings > General tab > Storage.
2 Touch Unmount SD card.
3 Touch Erase SD card > Erase SD card > Erase everything.
4 If you have set a pattern lock, input the pattern lock then select Erase everything.
NOTE: If there is content on your memory card, the folder structure may be
different after formatting, as all the files will have been deleted.
Locking and unlocking the screen
If you do not use the phone for a while, the screen will be automatically turned off and
locked. This helps to prevent accidental taps and saves battery power.
When you are not using the phone, press the Power/Lock key to lock your phone.
If there are any programs running when you lock your screen, they may be still running
in Lock mode. It is recommended that you exit all programs before entering Lock mode
to avoid unnecessary charges (e.g. phone calls, web access and data communications).
To wake up your phone, press the Power/Lock key . The Lock screen will appear.
Touch and slide the Lock screen in any direction to unlock your Home screen. The last
screen you viewed will open.

27
Knock Code
You can unlock the screen when screen is off by taping the correct area and sequence.
The Knock Code feature allows you to tap the screen with your own Knock Code
pattern using the screen divided by 4 squares to easily turn the screen on or off. You
can disable this feature in the Lock screen settings.
To activate Knock Code feature
1 Tap > > Apps tab > Settings > Display tab > Lock screen.
2 Tap Select screen lock > Knock Code.
3 This opens a screen that will guide you through how to select the unlock sequence.
You have to create a Backup PIN as a safety measure in case you forget your
unlock sequence.
NOTE:
• If you enter the wrong Knock Code 6 times, it will compulsorily take you to
your google account log in/backup PIN.
• Use the fingertip instead of finger nail to tap the screen for turning it on or
off.
• When the Knock Code is not in use, you can use Knock On function by taping the
screen.
KnockON
You can turn on/off the screen by just double-tap.
Double-tap the center screen quickly to unlock the screen. To lock the screen, double-
tap the status bar in any screen (except on the camera viewfinder) or empty area on the
Home screen.
NOTE: When turning the screen on, make sure you do not cover the proximity
sensor. Doing so will turn the screen off immediately after turning it on in order
to prevent abnormal turning on in your pocket or bag.

28
Your Home screen
Touch screen tips
Here are some tips on how to navigate on your phone.
Tap or touch – A single finger tap selects items, links, shortcuts and letters on the
on-screen keyboard.
Touch and hold – Touch and hold an item on the screen by tapping it and not lifting
your finger until an action occurs. For example, to open a contact's available options,
touch and hold the contact in the Contacts list until the context menu opens.
Drag – Touch and hold an item for a moment and then, without lifting your finger, move
your finger on the screen until you reach the target position. You can drag items on the
Home screen to reposition them.
Swipe or slide – To swipe or slide, quickly move your finger across the surface of the
screen, without pausing when you first tap it (so you don’t drag an item instead). For
example, you can slide the screen up or down to scroll through a list, or browse through
the different Home screens by swiping from left to right (and vice versa).
Double-tap – Double-tap to zoom on a webpage or a map. For example, quickly
double-tap a section of a webpage to adjust that section to fit the width of the screen.
You can also double-tap to zoom in and out while viewing the picture.
Pinch-to-Zoom – Use your index finger and thumb in a pinching or spreading motion
to zoom in or out when using the browser or Maps, or when browsing pictures.
Rotate the screen – From many applications and menus, the orientation of the screen
adjusts to the device's physical orientation.
NOTE:
• To select an item, tap the center of the icon.
• Do not press too hard; the tap screen is sensitive enough to pick up a light,
yet firm tap.
• Use the tip of your finger to tap the option you want. Be careful not to tap
any other keys.

29
Home screen
The Home screen is the starting point for many applications and functions, and it allows
you to add items like application shortcuts, or Google widgets to give you instant access
to information and applications. This is the default canvas and accessible from any
menu by tapping .Status Bar
Shows phone's status information including the time,
signal strength, battery status, and notification icons.
Widget
Widgets are self-contained applications that can be
accessed through the Apps screen or on the Home
screen or an extended home screen. Unlike a shortcut,
the Widget appears as an on-screen application.
Application Icons
Tap an icon (application, folder, etc.) to open and use it.
Location Indicator
Indicates which Home screen canvas you are viewing.
Quick Key Area
Provides one-touch access to the function in any home
screen canvas.
Home touch buttons
Extended home screen
The operating system provides multiple Home screen canvases to provide more space
for adding icons, widgets, and more.
XSlide your finger left or right across the Home screen.

30
Your Home screen
Customizing the Home screen
You can customize your Home screen by adding apps, widgets or changing wallpapers.
To add items on your Home screen
1 Touch and hold the empty part of the Home screen.
2 In the Add Mode menu, select the item you wish to add. You will then see this
added item on the Home screen.
3 Drag it to the desired location and lift your finger.
TIP! To add an application icon to the Home screen from the Apps menu,
touch and hold the application you want to add.
To remove an item from the Home screen
XHome screen > touch and hold the icon you want to remove > drag it to .
To add an app as a Quick key
XFrom the Apps menu or on the Home screen, touch and hold an application icon
and drag it to the Quick key area. Up to 7 apps can be added.
To remove an app from the Quick key area
XTouch and hold the desired quick key and drag it to .
NOTE: Apps key cannot be removed.
To customize apps icons on the Home screen
1 Touch and hold an application icon until it is unlocked from its current position.
Then drop it on the screen. The editing icon will appear in the upper right
corner of the application.
2 Tap the application icon again and select the desired icon design and size.
3 Tap OK to save the change.

31
Returning to recently-used applications
1 Tap . A list of recently used applications will be displayed.
2 Tap an icon to open the application. Or tap to return to your previous screen.
Notifications panel
Notifications alert you the arrival of new messages, calendar events, and alarms, as
well as to ongoing events, such as when you are on a call.
When a notification arrives, its icon appears at the top of the screen. Icons for pending
notifications appear on the left, and system icons such as Wi-Fi or battery strength
shown on the right.
NOTE: The available options may vary depending on the region or service
provider.
Pending
notifications
Bluetooth, Wi-Fi &
battery status

32
Your Home screen
Opening the notifications panel
Swipe down from the status bar to open the notifications panel.
Quick Toggle Area
Tap each quick toggle key to turn it on/off. Touch
and hold the key to access the settings menu of the
function. To see more toggle keys, swipe left or right.
Tap to remove, add, or rearrange toggle keys.
Tap to clear all the notifications.
Notifications
The current notifications are listed, each with a brief
description. Tap a notification to view it.
To close the notifications panel, touch and drag the tab
toward the top of the screen.
Indicator icons on the Status Bar
Indicator icons appear on the status bar at the top of the screen to report missed calls,
new messages, calendar events, device status and more.

33
The icons displayed at the top of the screen provide information about the status of the
device. The icons listed in the table below are some of the most common ones.
Icon Description Icon Description
No SIM card inserted Ringer is silenced
No network signal available Vibrate mode is on
Airplane mode is on Battery fully charged
Connected to a Wi-Fi network Battery is charging
Wired headset connected Phone is connected to PC via
USB cable
Call in progress Downloading data
Missed call Uploading data
Bluetooth is on GPS is on
NFC is on Data is synchronizing
System warning New Gmail message available
An alarm is set New Hangouts message
available
New voicemail available Choose input method
New text or multimedia
message
Media server content sharing
on

34
Your Home screen
A song is currently playing Mobile hotspot is active
NOTE: The icons location in the status bar may differ according to the
function or service.
On-screen keyboard
You can enter text using the on-screen keyboard. The on-screen keyboard appears
automatically on the screen when you need to enter text. To manually display the
keyboard, simply tap a text field where you want to enter text.
Using the keypad & entering text
Tap once to capitalize the next letter you type. Double-tap for all caps.
Tap to switch to the numbers and symbols keyboard.
Tap to access the keyboard settings. Tap and hold to access the clip tray or enter
text by voice and handwriting.
Tap to enter a space.
Tap to create a new line.
Tap to delete the previous character.
Entering accented letters
When you select French or Spanish as the text entry language, you can enter special
French or Spanish characters (e.g. "á").
For example, to input "á", touch and hold the "a" key until the zoom-in key grows
bigger and displays characters from different languages.
Then select the special character you want.

35
Google account setup
When you first turn on your phone, you have the opportunity to activate the network, to
sign into your Google Account and select how you want to use certain Google services.
To set up your Google account:
• Sign into a Google Account from the prompted set-up screen.
OR
• Tap > > Apps tab > select a Google application, such as Gmail > select
New to create a new account.
If you have a Google account, tap Existing, enter your email address and password,
then tap .
Once you have set up your Google account on your phone, your phone automatically
synchronizes with your Google account on the Web.
Your contacts, Gmail messages, Calendar events and other information from these
applications and services on the Web are synchronized with your phone. (This will
depend on your synchronization settings.)
After signing in, you can use Gmail™ and take advantage of Google services on your
phone.

36
Connecting to Networks and Devices
Wi-Fi
With Wi-Fi, you can use high-speed Internet access within the coverage of the wireless
access point (AP). Enjoy wireless Internet using Wi-Fi, without extra charges.
Connecting to Wi-Fi networks
To use Wi-Fi on your phone, you need to access a wireless access point or ‘hotspot’.
Some access points are open and you can simply connect to them. Others are hidden
or use security features; you must configure your phone to be able to connect to them.
Turn off Wi-Fi when you're not using it to extend the life of your battery.
NOTE: If you are out of the Wi-Fi zone or have set Wi-Fi to OFF, additional
charges may be applied by your mobile operator for mobile data use.
Turning Wi-Fi on and connecting to a Wi-Fi network
1 Tap > > Apps tab > Settings > Networks tab > Wi-Fi.
2 Set Wi-Fi to ON to turn it on and start scanning for available Wi-Fi networks.
3 Tap the Wi-Fi menu again to see a list of active and in-range Wi-Fi networks.
• Secured networks are indicated by a lock icon.
4 Tap a network to connect to it.
• If the network is secured, you are prompted to enter a password or other
credentials. (Ask your network administrator for details)
5 The status bar displays icons that indicate Wi-Fi status.

37
Bluetooth
You can use Bluetooth to send data by running a corresponding application, but not
from the Bluetooth menu as on most other mobile phones.
NOTE:
• LG is not responsible for the loss, interception or misuse of data sent or
received via the Bluetooth wireless feature.
• Always ensure that you share and receive data with devices that are trusted
and properly secured. If there are obstacles between the devices, the
operating distance may be reduced.
• Some devices, especially those that are not tested or approved by Bluetooth
SIG, may be incompatible with your device.
Turning on Bluetooth and pairing up your phone with a Bluetooth device
You must pair your device with another device before you connect to it.
1 Tap > > Apps tab > Settings > Networks tab > set Bluetooth to ON.
2 Tap the Bluetooth menu again. Tap the check box next to your phone's name to
make your phone visible to other Bluetooth devices.
3 A list of available devices will be displayed. Choose the device you want to pair with
from the list.
4 Depending on the type of device, you may have to enter matching codes, confirm
matching codes, or the devices will automatically pair.
Once the paring is successful, your device will connect to the other device.
NOTE: Some devices, especially headsets or hands-free car kits, may have a
fixed Bluetooth PIN, such as 0000. If the other device has a PIN, you will be
asked to enter it.

38
Connecting to Networks and Devices
Send data using the Bluetooth wireless feature
1 Select a file or item, such as a contact, calendar event or media file, from an
appropriate application or from Downloads.
2 Select the option for sending data via Bluetooth.
NOTE: The method for selecting an option may vary by data type.
3 Search for and pair with a Bluetooth-enabled device.
Receive data using the Bluetooth wireless feature
1 Tap > > Apps tab > Settings > Networks tab > set Bluetooth to ON.
2 Tap the Bluetooth menu again and tap the check box next to your phone's name
to make your phone visible to other Bluetooth devices.
NOTE: To select the length of time that your device will be visible, tap >
Visibility timeout.
3 Select Accept to confirm that you are willing to receive data from the device.
Sharing your phone's data connection
USB tethering and portable Wi-Fi hotspot are great features when there are no wireless
connections available. You can share your phone's mobile data connection with a
single computer via a USB cable (USB tethering). You can also share your phone's data
connection with more than one device at a time by turning your phone into a portable
Wi-Fi hotspot.
When your phone is sharing its data connection, an icon appears in the status bar and
as an ongoing notification in the notifications drawer.
For the latest information about tethering and portable hotspots, including supported
operating systems and other details, visit http://www.android.com/tether.

39
To share your phone's data connection as a portable Wi-Fi hotspot
1 Tap > > Apps tab > Settings > Networks tab > Tethering &
networks > Wi-Fi hotspot switch to activate.
2 Enter a password and tap Save.
TIP! If your computer is running Windows 7 or a recent distribution of some
flavours of Linux (such as Ubuntu), you will not usually need to prepare your
computer for tethering. But, if you are running an earlier version of Windows
or another operating system, you may need to prepare your computer to
establish a network connection via USB. For the most current information
about which operating systems support USB tethering and how to configure
them, visit http://www.android.com/tether.
To rename or secure your portable hotspot
You can change the name of your phone's Wi-Fi network name (SSID) and secure its
Wi-Fi network.
1 Tap > > Apps tab > Settings > Networks tab > Tethering &
networks > Wi-Fi hotspot.
2 Tap Set up Wi-Fi hotspot.
• The Set up Wi-Fi hotspot dialogue box will open.
• You can change the Wi-Fi name (SSID) that other devices see when scanning for
Wi-Fi networks.
• You can also tap the Security menu to configure the network with Wi-Fi Protected
Access 2 (WPA2) security using a pre-shared key (PSK).
• If you touch the WPA2 PSK security option, a password field is added to the Set
up Wi-Fi hotspot dialogue box. If you enter a password, you will need to enter
that password when you connect to the phone's hotspot with a computer or other
device. You can set Open in the Security menu to remove security from your Wi-Fi
network.
3 Tap Save.

40
Connecting to Networks and Devices
ATTENTION! If you set the security option as Open, you cannot prevent
unauthorised usage of online services by other people and additional charges
may be incurred. To avoid unauthorized usage, you are advised to keep the
security option active.
Wi-Fi Direct
Wi-Fi Direct supports a direct connection between Wi-Fi enabled devices without an
access point. Due to the high battery usage of Wi-Fi direct, it is recommended that you
plug your phone into a power outlet while using the Wi-Fi Direct feature. Check your
Wi-Fi & Wi-Fi Directed network in advance and make sure the users are connected to
the same network.
To turn on Wi-Fi Direct:
1 Tap > > Apps tab > Settings > Networks tab > Wi-Fi.
2 Tap the Menu Key > Wi-Fi Direct.
3 Select a device to connect with from the scanned device list.
PC connections with a USB cable
Learn to connect your device to a PC with a USB cable in USB connection modes.
Transferring music, photos and videos using the USB mass storage mode
1 Connect your phone to a PC using a USB cable.
2 If you haven't installed the LG Android Platform Driver on your PC, you will need to
manually change the settings. Slide down the status bar > Tap USB connected >
Select USB connection method, then select Media device (MTP).
3 You can now view the mass storage content on your PC and transfer the files.

41
Synchronize with Windows Media Player
Ensure that Windows Media Player is installed on your PC.
1 Use the USB cable to connect the phone to a PC on which Windows Media Player
has been installed.
2 Select the Media device (MTP) option. When connected, a pop-up window will
appear on the PC.
3 Open Windows Media Player to synchronize music files.
4 Edit or enter your device’s name in the pop-up window (if necessary).
5 Select and drag the music files you want to the sync list.
6 Start synchronization.
• The following requirements must be satisfied to synchronize with Windows Media
Player.
Items Requirement
OS Microsoft Windows XP SP2, Vista or higher
Window Media Player version Windows Media Player 10 or higher
• If the Windows Media Player version is lower than 10, install version 10 or higher.

42
Calls
Making a call
1 Tap to open the keypad.
2 Enter the number using the keypad. To delete a digit, tap the .
3 Tap to make a call.
4 To end a call, tap the End icon .
TIP! To enter "+" to make international calls, touch and hold .
Calling your contacts
1 Tap to open your contacts.
2 Scroll through the contact list or enter the first few letters of the contact you want
to call by tapping Search contacts.
3 In the list, tap you want to call.
Answering and rejecting a call
When the screen is locked/unlocked
• Swipe in any direction to answer the incoming call.
• Swipe in any direction to decline an incoming call.
• Swipe if you want to send a message.
TIP! Decline with message
You can send a message quickly using this function. This is useful if you need
to reject a call with message during a meeting.

43
Adjusting the in-call volume
To adjust the in-call volume during a call, use the Volume up and down keys on the
back side of the phone.
Making a second call
1 During your first call, tap Menu key > Add call and dial the number. You can
also go to the recently dialled numbers list by tapping Call logs or can search
contacts by tapping Contacts and selecting the contact you want to call. Also, you
can search contacts by tapping Favorites or Groups.
2 Tap to make the call.
3 Both calls are displayed on the call screen. Your initial call is locked and put on
hold.
4 Tap the displayed number to toggle between calls. Or tap Merge calls to start
a conference call.
5 To end active calls, tap End or tap and slide the notification bar down and
select the End call icon .
NOTE: You are charged for each call you make.
Viewing your call logs
On the Home screen, tap and choose the Call logs.
View a complete list of all dialled, received and missed calls.
TIP!
• Tap any call log entry to view the date, time and duration of the call.
• Tap the Menu key , then tap Delete all to delete all the recorded items or
tap Delete to delete individual items.

44
Call settings
You can configure phone call settings such as call forwarding, as well as other special
features offered by your carrier.
1 From the Home screen, tap .
2 Tap .
3 Tap Call settings and choose the options that you wish to adjust.
Calls

45
Contacts
Add contacts to your phone and synchronize them with the contacts in your Google
account or other accounts that support contact syncing.
Searching for a contact
1 From the Home screen, tap to open your contacts.
2 Tap Search contacts and enter the contact name. You can also scroll the alphabet
bar along the right side of the screen.
Adding a new contact
1 From the Home screen, tap and enter the new contact's number, then tap New
contact.
2 If you want to add a picture to the new contact, tap the image area.
Choose from Take photo or Select from Gallery.
3 Tap a category of contact information and enter the details about your contact.
4 Tap Save.
Favourites contacts
You can classify frequently called contacts as favourites.
Adding a contact to your favourites
1 Tap to open your contacts.
2 Tap a contact to view its details.
3 Tap the star to the right corner of the contact's name. The star will turn yellow color.

46
Contacts
Removing a contact from your favourites list
1 Tap to open your contacts.
2 Tap the Favourites tab, and choose a contact to view its details.
3 Tap the yellow color star to the right corner of the contact's name. The star turns
white color and the contact is removed from your favourites.
Creating a group
1 Tap to open your contacts.
2 Tap Groups and tap the Menu key . Select New group.
3 Enter a name for the new group. You can also set a ringtone for the newly created
group.
4 Tap Save to save the group.
NOTE: If you delete a group, the contacts assigned to that group will not be
lost. They will remain in your contacts.

47
Messaging
Your phone combines text and multimedia messages into one intuitive, easy-to-use
menu.
Sending a message
1 Tap on the Home screen and tap to open a blank message.
2 Enter a contact name or contact number in the To field. As you enter the contact
name, matching contacts will appear. You can tap a suggested recipient. You can
add more than one contact.
NOTE: You will be charged for a text message for every person to whom you
send the message.
3 Tap the text field and begin composing your message.
4 Tap to open the Options menu. Choose from Quick message, Insert smiley,
Schedule sending, Add subject and Discard.
TIP! You can tap the icon to attach the file, that you want to share with
message.
5 Tap Send to send your message.
6 Responses will appear on the screen. As you view and send additional messages, a
message thread is created.
WARNING:
• The 160-character limit may vary from country to country, depending on the
language and how the text message is coded.
• If an image, video or audio file is added to a text message, it is automatically
converted into a multimedia message and you are charged accordingly.

48
View mode
Unread messages are located at the top. Other messages exchanged with another party
are displayed in threads and in chronological order so that you can conveniently see an
overview of your conversation.
Changing your message settings
Your phone message settings are pre-defined, so you can send messages immediately.
You can change the settings according to your preferences.
• Tap the Messaging icon on the Home screen, tap and then tap Settings.
Messaging

49
E-mail
You can use the E-mail application to read emails from services like Gmail. The E-mail
application supports the following account types: POP3, IMAP and Exchange.
Your service provider or system administrator can provide you with the account settings
you need.
Managing an email account
The first time you open the E-mail application, a set-up wizard opens to help you to set
up an email account.
After the initial set-up, E-mail displays the contents of your inbox.
To add another email account:
• Tap > > Apps tab > E-mail >tap > Settings > Add account.
To change an email account's settings:
• Tap > > Apps tab > E-mail > tap > Settings > General settings.
To delete an email account:
• Tap > > Apps tab > E-mail > tap > Settings > tap > Remove
account > Select the account to delete > Remove > select Yes.
Working with account folders
Tap > > Apps tab > E-mail > tap and select Folders.
Each account has an Inbox, Outbox, Sent and Drafts folder. Depending on the features
supported by your account's service provider, you may have additional folders.

50
Composing and sending email
To compose and send a message
1 While in the E-mail application, tap the .
2 Enter an address for the message's intended recipient. As you enter text, matching
addresses will be proposed from your Contacts. Separate multiple addresses using
semicolons.
3 Tap the to add a Cc/Bcc and tap to attach files, if required.
4 Enter the text of the message.
5 Tap .
TIP! When a new email arrives in your Inbox, you will be notified by a sound
or vibration.
E-mail

51
You can use the camera or camcorder to take and share pictures and videos.
To open the Camera application
From the Home screen, tap the Apps Key > Camera .
OR
Tap the Camera icon from the Home screen.
TIP! If you’ve set your phone to use the Swipe unlock method, from
the locked screen, simply press the Power/Lock Key , on the back of
the phone, then drag the Camera icon upward to open the Camera
application.
Getting to know the viewfinder
5
1
6
2
7
8
3
4
1
Flash – Taps to turn the flash On, Off or set it to Auto.
2
Swap camera – Tap to swap between the rear camera lens and the front camera
lens.
3
Mode – Mode to select the mode from Auto and Panorama.
Camera and Video

52
4
Settings – Tap to adjust the following camera and video settings.
5
Gallery – Tap to access your Gallery.
6
Video Recording button – Tap to start recording a video.
7
Capture button – Tap to take a photo.
8
Back button – Tap to exit the Camera apps.
Take Pictures
Taking pictures with your phone’s built-in camera is as simple as choosing a subject,
pointing the lens, and pressing a button.
To take a picture
1 From the Home screen, tap the Apps Key > Camera .
2 Frame your subject on the screen.
3 A square around the subject indicates that the camera has focused.
4 Tap to take a photo. Your picture will be automatically saved to the Gallery.
Record Videos
In addition to taking pictures, you can record, view, and send videos with your phone’s
built-in video camera.
To record a video
1 From the Home screen, tap the Apps Key > Camera .
2 Frame your subject on the screen.
3 Tap to start recording the video.
4 The length of the recording is displayed on the top of the screen.
NOTE: Tap to take pictures while recording video.
Camera and Video

53
5 Tap to pause recording video. You can resume recording again tapping .
OR
6 Tap to stop recording. Your video will be automatically saved to the Gallery.
Camera and Video Settings
From the camera mode, tap each icon to adjust the following camera settings.
• Flash : Taps to turn the flash On, Off or set it to Auto.
• Swap camera : To swap between the rear camera lens and the front camera lens.
• Mode : Mode to select the mode from Auto and Panorama.
XAuto: Captures a auto photo shot.
XPanorama: Creates a wide photo of a panoramic view. Hold the phone horizontally,
press the shutter to start and slowly sweep the camera across the scene.
• Settings : To adjust the following camera and video settings.
XImage size: Set the size of your picture. Choose from 13M 4160x3120, W10M
4160x2336, 9M 3120x3120 or 3M 2048x1536. Set the size of your video. Choose
from FHD 1920x1080 or HD 1280x720.
XCheese shutter: Allows you to take pictures with voice commands. When on, you
just say "Cheese", "Smile", "Whiskey", "Kimchi", or "LG" to take a picture.
XTimer: Set your camera's timer. This is ideal if you want to be a part of the picture.
XGrid: It is easily used to take better pictures to keeping horizontal and verticals.
XSD card: Set the storage location for your pictures. Choose from IN or SD. This
menu appears only when the SD card is inserted.
XHelp: Allows you to learn how a function works. This icon will provide you with a
quick guide.

54
Gesture shot
Take a picture with hand gesture. To take photo, raise your hand until front camera
detects it and a box appears on the screen.
View Your Pictures
The Gallery is where you can access the Gallery of stored camera images. You can view
them in a slideshow, share them with your friends, and delete and edit them.
1 From the Home screen, tap the Apps Key > Gallery .
2 Select a location and tap an image to view your picture.
Gallery
Open the Gallery application to view albums of your pictures and videos.
To open the Gallery application
• From the Home screen, tap the Apps Key > Gallery .
Camera and Video

55
Viewing your albums
The Gallery application presents the pictures and videos saved in your phone, including
those you’ve taken with the Camera application and those you downloaded from the
web or other locations.
• Tap the Menu Key (at the top right corner of the screen) to access New Album,
Delete, Hide/Show album, and Settings.
• Tap the Camera icon to return to the Camera application.
• Tap an album to open it and view its contents.
• Tap a picture or video in an album to view it.
To share an album
You can share the entire contents of one or more albums or individual images or videos
from an album.
1 From the Home screen, tap the Apps Key > Gallery .
2 Touch and hold the desired album, tap Share, select the application to use to share
your images, then complete the sending method as necessary.
Working with photos
Use the Gallery application to view pictures that you’ve taken with the Camera
application, downloaded.
To view a photo
1 From the Home screen, tap the Apps Key > Gallery .
2 Open an album and tap a picture.
3 Tap the Menu Key (at the top right corner of the screen) to access Set image
as, Move, Copy, Copy to Clip Tray, Slideshow, Rotate left, Rotate right, Crop,
Add/Remove location, Rename, Print, or Details.

56
Share Icon
Tap here to share the photo using
the method you select.
Camera Mode Icon
Tap here to go to camera mode.
Gallery Icon
Tap here to return to your
Gallery.
Edit Icon
Tap here to edit your picture.
Delete Icon
Tap here to delete the photo.
Swipe horizontally to scroll through
the photos in the current album.
Swipe here to quickly scroll through
the images in the album, then tap
the one you want to view.
Working with videos
The Gallery is where you can access the Gallery of stored video images. You can view
them, share them with your friends, and delete and edit them.
To view a video
1 From the Home screen, tap the Apps Key > Gallery to view the videos
stored in storage.
2 Tap an album to open it and view its contents.
3 Tap a video to view it. You can access the following options:
X Rotation: Changing the orientation of screen content.
X QSlide: Enables an overlay on your phone’s display for easy multitasking.
X Menu: Tap to access Screen ratio, Subtitles, Share, Settings, Details options.
X Screen shot: Captures a screen shot while playing a video.
NOTE: Tap > Settings > Screenshot on.
Camera and Video

57
X Volume: Tap to display the Volume slider bar, then adjust the playback volume
on the slider bar.
X Lock/Unlock: Locks the touch keys to prevent unintentional touches.
NOTE:
• While a video is playing, slide the left side of the screen up or down to adjust
the screen brightness.
• While a video is playing, slide the right side of the screen up or down to
adjust the sound.
• While playing a video, slide your finger from left to right (or vice versa) to fast-
forward and rewind.
• Do not press too hard; the touch screen is sensitive enough to pick up a
light, but firm touch.
QSlide while playing videos
You can play videos in a QSlide window allowing you to use other applications while the
video is playing.
1 Open the Gallery application and begin playing the video.
2 Tap the QSlide icon at the top right corner of the screen to activate the QSlide
feature to play the video in a QSlide window.
3 To close the QSlide window, tap the in the upper-right corner of its title bar.

58
Function
QuickMemo+
The QuickMemo+ allows you to create memos and capture screen shots.Capture
screens, draw on them and share them with family and friends with QuickMemo+.
OR
1 (While screen is switched off) Press
and hold the Volume Up key.
OR
Touch and slide the status bar downward
and tap .
2 Select the desired menu option from
Pen type, Colour, Eraser and create
a memo.

59
3 Tap in the Edit menu to save the
memo with the current screen. To exit
QuickMemo+ at any time, tap .
NOTE: Please use a fingertip while using the QuickMemo+. Do not use your
fingernail.
Using the QuickMemo+ options
You can easily use the editing tools when using the QuickMemo+.
Undo or Redo.
Use complex concept function.
Select the pen type and the colour.
Erase the memo that you created.
Save the memo with the current screen in the Gallery or QuickMemo+.
Option: Tap to choose Share, Paper style for the memo.
Viewing the saved QuickMemo+
From the Home screen, tap > QuickMemo+.
Or tap Gallery and select the Quickmemo+ album.

60
Function
QSlide
From any screen, bring up a notepad, calendar, and more as a window inside your
screen.
OR
Tap to exit the QSlide and return to
full window.
Tap to adjust transparency.
Tap to end the QSlide.
Tap to adjust the size.
1 Touch and slide the status bar downwards > tap QSLIDE APPS or while using
applications that support QSlide, tap . The function will be continuously displayed
as a small window on your screen.
2 You can make a call, browse the Web, or choose other phone options. You can also
use and tap the screen under the small windows when the transparency bar is not
full .
NOTE: The QSlide can support up to two windows at the same time.

61
QuickRemote
QuickRemote turns your phone into a Universal Remote for your home TV,
and set-top box.
NOTE: QuickRemote may not be available for some devices.
To open the QuickRemote app
1 From the Home screen, tap > Peel Smart Remote.
2 Select the country or region, then choose the room to set up and tap Done.
3 Select your TV service, then follow the on-screen instructions.
To set up your QuickRemote
1 From the Home screen, tap > Peel Smart Remote.
2 Tap the Remote Control , then tap the Continue.
3 Select the brand of device, then follow the on-screen instructions to configure the
device.
Using QuickRemote
1 From the Home screen, tap > Peel Smart Remote.
2 Tap the Remote Control , then tap to select the remote you want.
3 Tap the buttons on the displayed remote.
NOTE: The QuickRemote operates the same way as an ordinary remote control
infrared (IR) signals. Be careful not to cover the infrared sensor at the top of
the phone when you use the QuickRemote function. This function may not be
supported depending on the model, the manufacturer or service company.

62
Function
Dual window
The Dual window function allows you to split the screen to view two apps at the same
time. To use this function, activate it in the Settings menu.
To activate the Dual window function
1 From the Home screen, tap > Settings > General tab > Dual window.
2 Tap the Dual window switch to toggle it On or Off.
To open and use the Dual window function
1 Touch and hold the Back Key to start the Dual window function.
2 Tap or drag the app icon you want to use. The first app you tap opens in a window
at the top of the screen. The second app opens in the bottom window.
3 Tap a window to select and use it.
XA blue box appears around the selected window with a blue semicircle handle
between the windows.
XDrag the blue handle to change the window sizes (one larger and one smaller).
4 Tap the blue handle to access the Dual window options.
XTap the Swap icon to switch the app positons.
XTap the View app list icon to redisplay the apps list so you can change the
app for the selected window.
XTap the Full screen icon to open the selected app in full screen view.
XTap the Close icon to close the selected window.

63
LG SmartWorld
LG SmartWorld offers an assortment of exciting content – fonts, themes, games,
applications.
How to Get to LG SmartWorld from Your Phone
1 Tap > > Apps tab > tap the icon to access LG SmartWorld.
2 Tap Sign in and enter ID/PW for LG SmartWorld. If you have not signed up yet, tap
Register to receive your LG SmartWorld membership.
3 Download the content you want.
* When you use Cellular network, data fee could be charged by data plan that you
signed-up with carrier.
* LG SmartWorld may not be available from all carriers or in all countries.
NOTE: What if there is no icon?
1 Using a mobile Web browser, access LG SmartWorld (www.lgworld.com)
and select your country.
2 Download the LG SmartWorld App.
3 Run and install the downloaded file.
4 Access LG SmartWorld by tapping the icon.
Special benefit only in LG SmartWorld
1 Decorate your own style on your Smartphone, Use Home Theme &
Keyboard Theme & Font that provided on LG SmartWorld. (However this
service is available to specific device. please check in LG SmartWorld
website whether it is feasible or not whether it is feasible or not)
2 Enjoy LG SmartWorld's special service by joining promotion that consistently
provided.

64
Music
Your phone has a built-in music player that lets you play all your favorite tracks. To
access the music player, tap > > Apps tab > Music.
Add music files to your phone
Start by transferring music files to your phone:
• Transfer music using Media device (MTP).
• Download from the wireless Web.
• Synchronize your phone to a computer.
• Receive files via Bluetooth.
Transfer music using Media device (MTP)
1 Connect the phone to your PC using the USB cable.
2 Select the Media device (MTP) option. Your phone will appear as another hard
drive on your computer. Click on the drive to view it. Copy the files from your PC to
the drive folder.
3 When you’re finished transferring files, swipe down on the Status Bar and tap
Media device (MTP) > Charge phone. You may now safely unplug your device.
Playing a song
1 Tap > > Apps tab > Music.
2 Tap Songs.
3 Select the song you want to play.
Tap to pause playback.
Tap to resume playback.
Tap to skip to the next track in the album, playlist, or shuffle. Touch and hold
to fast forward.
Multimedia

65
Tap to restart the current track or skip to the previous track in the album,
playlist, or shuffle. Touch and hold to rewind.
Tap to display the Volume slider bar, then adjust the playback volume on the
slider bar.
Tap to set audio effects.
Tap to open the current playlist.
Tap to add the song to your favourites.
Tap to play the current playlist in shuffle mode (tracks are played in random
order).
Tap to toggle through the repeat modes to repeat all songs, repeat current
song, or repeat off.
To change the volume while listening to music, press the up and down volume keys on
the back side of the phone.
Touch and hold any song in the list. The Play, Add to playlist, Delete, Share, Set as
ringtone, Details and Search options will be displayed.
NOTE:
• Some file formats are not supported, depending on the device software.
• If the file size exceeds the available memory, an error can occur when you
open files.

66
Multimedia
NOTE: Music file copyrights may be protected by international treaties and
national copyright laws.
Therefore, it may be necessary to obtain permission or a licence to reproduce
or copy music.
In some countries, national laws prohibit private copying of copyrighted
material. Before downloading or copying the file, check the national laws of
the relevant country concerning the use of such material.

67
Setting your alarm
1 Tap > > Apps tab > Clock > .
2 Set the desired alarm time.
3 Set Repeat, Snooze duration, Vibration, Alarm sound, Alarm volume, Auto app
starter, Puzzle lock and Memo. Tap Save.
4 Tap Save to save the alarm.
NOTE: To change alarm settings in the alarm list screen, tap the Menu key
and select Settings.
Using your calculator
1 Tap > > Apps tab > Calculator.
2 Tap the number keys to enter numbers.
3 For simple calculations, tap the function you want to perform ( , , or )
followed by .
4 For more complex calculations, tap the Menu Key and select Scientific
calculator, then choose the desired functions.
5 To check the history, tap the Menu Key .
Adding an event to your calendar
1 Tap > > Apps tab > Calendar.
2 Tap and choose from Day, Week, Month, Year, or Agenda to change the month
view.
3 Tap on the date for which you wish to add an event and tap .
4 Tap Event name and enter the event name.
5 Tap Location and enter the location. Check the date and enter the time you wish
your event to start and finish.
6 If you wish to repeat the alarm, set REPEAT and set REMINDERS, if necessary.
Utilities

68
7 Tap Save to save the event in the calendar.
Voice Recorder
Use the voice recorder to record voice memos or other audio files.
Recording a sound or voice
1 Tap > > Voice Recorder.
2 Tap to begin recording.
3 Tap to end the recording.
4 Tap to listen to the recording.
NOTE: Tap to access your album. You can listen to the saved recording.
The available recording time may differ from actual recording time.
Sending the voice recording
1 Once you have finished recording, you can send the audio clip by tapping .
2 Choose from any of the available methods for sharing.
Tasks
This task can be synchronized with MS Exchange account. You can create task, revise it
and delete it in MS outlook or MS Office Outlook Web Access.
To Synchronize MS Exchange
1 From the Home Screen, Tap > > Apps tab > Settings.
2 Tap General tab > Accounts & sync > Add account.
3 Tap Microsoft Exchange to create Email address and Password.
4 Make sure if you checkmark Sync task.
Utilities

69
NOTE: MS Exchange may not be supported depending on email server.
Google+
Use this application to stay connected with people via Google’s social network service.
• Tap > > Apps tab > Google folder > Google+.
NOTE: This application may not be available depending on the region or
service provider.
Voice Search
Use this application to search webpages using voice.
1 Tap > > Apps tab > Google folder > Voice Search.
2 Say a keyword or phrase when Speak now appears on the screen. Select one of
the suggested keywords that appear.
NOTE: This application may not be available depending on the region or
service provider.
Downloads
Use this application to see what files have been downloaded through the applications.
• Tap > > Apps tab > Downloads.
NOTE: This application may not be available depending on the region or
service provider.

70
Utilities
ThinkFree Viewer
ThinkFree Viewer is a professional mobile office solution that lets users conveniently
view various types of office documents, including Word, Excel and PowerPoint files,
anywhere or anytime, using their mobile devices.
• Tap > > Apps tab > ThinkFree Viewer.
FM radio
Your phone has a built-in FM radio so you can tune in to your favorite stations and
listen on the go.
• Tap > > Apps tab > FM radio.

71
The Web
Internet
Use this application to browse the Internet. Browser gives you a fast, full-color world of
games, music, news, sports, entertainment and much more, right on your mobile phone
wherever you are and whatever you enjoy.
NOTE: Additional charges apply when connecting to these services and
downloading content. Check data charges with your network provider.
1 Tap > > Apps tab > Internet.
Using the Web toolbar
Tap slide it upwards with your finger to open.
Tap to go back one page.
Tap to go forward one page, to the page you connected to after the current
one. This is the opposite of what happens when you tap , which takes
you to the previous page.
Tap to go to the Home page.
Tap to add a new window.
Tap to access bookmarks.
Viewing webpages
Tap the address field, enter the web address and tap Go.
Opening a page
To go to new page, tap .
To go to another webpage, tap , scroll up or down, and tap the page to select it.

72
Searching the web by voice
Tap the address field, tap , speak a keyword, and then select one of the suggested
keywords that appear.
NOTE: This feature may not be available depending on the region or service
provider.
Bookmarks
To bookmark the current webpage, tap > Add to bookmarks > OK.
To open a bookmarked webpage, tap and select one.
History
Tap > History to open a webpage from the list of recently-visited webpages. To
clear all history, tap Yes.
Chrome
Use Chrome to search for information and browse webpages.
1 Tap > > Apps tab > Chrome.
NOTE: This application may not be available, depending on your region and
service provider.
Viewing webpages
Tap the Address field, and then enter a web address or search criteria.
Opening a page
To go to a new page, tab New tab.
To go to another webpage, tap , scroll up or down and tap the page to select it.
The Web

73
Syncing with other devices
Sync open tabs and bookmarks to use with Chrome on another device when you are
logged in with the same Google account.
To view open tabs on other devices, tap Menu key Other devices.
Select a webpage to open.
Adding and viewing bookmarks
To add bookmarks, tap the Menu Key > .
To open a bookmarked webpage, tap the Menu Key > Bookmarks and select the
desired page.

74
Settings
This section provides an overview of items you can change using your phone's System
settings menus.
To access the Settings menu:
Tap , touch and hold the Recent Apps Key and select the System
settings.
- or -
Tap > > Apps tab > Settings.
Networks
< Dual SIM card >
You can configure Dual SIM settings.
SIM card colour theme – Allows you to select your desired colors.
Cost save mode – Every contact is added along with assigned SIM when adding in
phone book. During Calling, matching operator SIM is identified and the operation is
completed using the matching operator SIM. This makes possible to use benefit from
using same operator.
NOTE: Cost save mode doesn’t work during in-call.
Mobile data – Checkmark to enable data access over the mobile network.
SIM card to use – You can change the default data network. All mobile packet services
(Web, MMS, Email, etc) will use SIM selected on this value. When only one SIM card
is inserted, the default data network is set as the inserted SIM and it is not allowed to
change.
NOTE: When airplane mode is on, dual SIM settings is disabled.
< Wi-Fi >
Wi-Fi – Turns on Wi-Fi to connect to available Wi-Fi networks.

75
TIP! How to obtain the MAC address
To set up a connection in some wireless networks with MAC filters, you may
need to enter the MAC address of your phone in the router.
You can find the MAC address in the following user interface: tap > >
Apps tab > Settings > Networks tab > Wi-Fi > > Advanced Wi-Fi >
MAC address.
< Bluetooth >
Turn the Bluetooth wireless feature on or off to use Bluetooth.
< Mobile data >
Displays the data usage and set mobile data usage limit.
< Call >
Configure phone call settings such as call forwarding and other special features offered
by your carrier.
[SIM card 1/SIM card 2 Tab]
Voicemail – Allows you to select your carrier’s voicemail service.
Fixed dialing numbers – Turn on and compile a list of numbers that can be called
from your phone. You’ll need your PIN2, which is available from your operator. Only
numbers within the fixed dial list can be called from your phone.
Call forwarding – Choose whether to divert all calls when the line is busy, when there
is no answer or when you have no signal.
Call barring – Lock incoming, outgoing or international calls.
Call duration – View the duration of calls including Last call, Outgoing calls, Incoming
calls and All calls.
Additional call settings – Allows you to change the following settings:
Caller ID: Choose whether to display your number in an outgoing call.
Call waiting: If call waiting is activated, the handset will notify you of an incoming call
while you are on a call (depending on your network provider).

76
[Common Tab]
Smart forward – Allows you to receive SIM2 calls if you are busy on SIM1 and vice
versa.
Incoming voice call pop-up – Display incoming voice call pop-up when an app is in
use.
Call reject – Allows you to set the call reject function. Choose from Call reject mode
or Reject calls from.
Decline with message – When you want to reject a call, you can send a quick
message using this function. This is useful if you need to reject a call during a meeting.
Privacy keeper – Hides the caller name and number for an incoming call.
Auto answer – Set the time before a connected hands-free device automatically
answers an incoming call. Choose from Off, 1 sec, 3 sec, and 5 sec.
Connection vibration – Vibrates your phone when the other party answers the call.
Save unknown numbers – Add unknown numbers to contacts after a call.
Power key ends call – Allows you to select your end call.
< Share & connect >
NFC – Your phone is an NFC-enabled mobile phone. NFC (Near Field Communication) is a
wireless connectivity technology that enables two-way communication between electronic
devices. It operates over a distance of a few centimeters. You can share your content with
an NFC tag or another NFC support device by simply tapping it with your device. If you tap
an NFC tag with your device, it will display the tag content on your device.
Tap & pay: When NFC is turned on, you can use the Tap & pay feature to pay for
items just by touching your phone to a reader at a register. If your device doesn’t
have a default app, you can browse Google Play for other payment apps.
Android Beam – When this feature is turned on, you can beam app content to another
NFC-capable device by holding the devices close together.
Just bring the device together(typically back to back) and then tap your screen. The app
determines what gets beamed.
Settings

77
LG PC Suite – Connect LG PC Suite with your phone to easily Manage multimedia
content and apps.
< Tethering & networks >
USB tethering – Connect the USB cable to share the internet connection with the
computer.
Wi-Fi hotspot – Allows you to use your device as a Wi-Fi hotspot for other devices to
use your mobile network connection.
Set up Wi-Fi hotspot: Sets the SSID and password for your Wi-Fi hotspot.
Timeout: Allows you to set the time after which Wi-Fi hotspot automatically turns off.
Bluetooth tethering – Allows you to set your phone whether you are sharing the
Internet connection or not.
Help – Tap to view help information on the USB tethering, Wi-Fi hotspot and Bluetooth
tethering functions.
Airplane mode – After switching to Airplane mode, all wireless connections are
disabled.
Mobile networks – Set options for data roaming, network mode & operators, access
point names (APNs) etc.
VPN – Displays the list of Virtual Private Networks (VPNs) that you've previously
configured. Allows you to add different types of VPNs.
Sound
< Sound profile >
Choose the Sound, either Sound, Vibrate only or Silent.
< Volumes >
Adjust the phone's volume settings to suit your needs and your environment.

78
< Quiet mode >
Set up your Quiet mode. Tap the Quiet mode switch to toggle it On or Off. You can
schedule Quiet mode to activate automatically and designate exceptions to your Quiet
mode.
Sound profile – Choose the sound, either Silent or Vibrate only.
Set time – Choose the Set time, either Always on or Schedule. If you tap schedule,
you can set the days and times to automatically turn Quiet mode on.
Block notification LED – Checkmark to turn LED notification off.
Block alarms – Checkmark to allow the screen not to turn on and no alarms sound.
Block incoming calls – Checkmark to allow or block incoming calls from certain
contacts.
Incoming call settings
Auto reply to block calls – Set how to you want to automaticlly reply to silenced
calls.
Allow repeated calls – Checkmark to allow a call that is repeated within 3 minutes.
Allowed contact lists – Designate which contacts calls will be allowed.
Help – Display Quiet mode setting information.
< Ringtone >
Set the ringtone for calls. You can also add a ringtone by tapping at the top right
corner of the screen.
< Notification sound >
Set the notification sound. You can also add a notification sound by tapping at the
top right corner of the screen.
< Ringtone with vibration >
Checkmark to set the phone to vibrate in addition to the ringtone when you receive
calls.
Settings

79
< Vibration type >
Set the vibration type.
< Vibrate on tap >
Checkmark to vibrate when tapping the Home touch buttons and during other UI
interactions.
< Sound effect >
Tap to set the dial pad touch tones, touch sounds, and screen lock sound.
Dial pad touch tones – Checkmark to play tones while using dial pad.
Touch sounds – Checkmark to play sound when making screen selection.
Screen lock sound – Checkmark to play sound when locking and unlocking the
screen.
< Message/Call voice notifications >
Tap the Message/call voice notification switch to toggle it On or Off. On allows your
phone to automatically read your incoming calls and/or messages out loud.
Display
< Home scree >
Select Home – Set Home or EasyHome as default home.
Theme – Sets the screen theme for your device. You can download it from LG
SmartWorld.
Wallpaper – Sets the wallpaper to use on your Home screen. Select it from Gallery,
Live Wallpapers, Photos or Wallpaper gallery.
Screen swipe effect – Sets the screen swipe effect options. Choose from Slide,
Breeze, Accordion, Panorama, Carousel, Layer, or Domino.
Allow Home screen looping – Checkmark to allow continuous Home screen scrolling
(loop back to first screen after last screen).
Home backup & restore – Set to backup and restore Home app layout and wallpaper.

80
Help – Displays information regarding the Home screen items and functions.
< Lock screen >
Select screen lock – Set a screen lock type to secure your phone. Opens a set of
screens that guide you through drawing a screen unlock pattern. Set None, Swipe,
Face Unlock, Knock Code, Pattern, PIN or Password.
If you have enabled a Pattern lock type when you turn on your phone or wake up the
screen, you will be asked to draw your unlock pattern to unlock the screen.
Screen swipe effect – Sets the screen swipe effect options. Choose from Particle,
Dewdrop, Crystal, Ripple, and White hole.
NOTE: This setting name may be Pattern effect if the Screen lock is set to
Pattern.
Wallpaper – Sets your Lock screen wallpaper. Select it from Gallery or Wallpaper
gallery.
Widgets – Checkmark to show the wigets on Lock screen.
Shortcuts – Allows you to change the shortcuts on the Swipe Lock screen.
Contact info for lost phone – Show contact info on Lock screen in the event phone
is lost.
Lock timer – Sets the amount of time before the screen automatically locks after the
screen has timed-out.
Power button instantly locks – Checkmark to instantly lock the screen when the
Power/Lock Key is pressed. This setting overrides the Security lock timer setting.
< Home touch buttons >
Set the Home Touch Keys displayed at the bottom of all of the screens. Set which
ones are displayed, their position on the bar, and what they look like. Select Button
combination, Colour, and Transparent background.
< Font type >
Sets the type of font used for the phone and menus.
Settings

81
< Font size >
Sets the size of the font displayed in the phone and menus.
< Brightness >
Adjusts the brightness of the screen. For best battery performance, use the dimmest
comfortable brightness.
< Notification LED >
Tap the switch to toggle it On or Off. On will activate the LED light for the notifications
you checkmark.
< Auto-rotate screen >
Checkmark to set the phone to automatically rotate the screen based on the phone
orientation (portrait or landscape).
< Screen timeout >
Sets the amount of time before the screen times out.
< Screen-off effect >
Sets the screen-off effect. Choose from Retro TV, Black hole, and Fade out.
< Daydream >
Tap the Daydream switch to toggle it On or Off. On allows the set screensaver to be
displayed when the phone is sleeping while docked and/or charging. Choose from
Clock and Goole Photos.
General
< Language & input >
Use the Language & input settings to select the language for the text on your phone
and to configure the on-screen keyboard, including words you've added to its dictionary.
Language – Sets the language to use on your device.
Default – Sets the default on-screen keyboard to use when entering text.

82
LG Keyboard – Checkmark to select the LG Keyboard to enter data. Tap the Settings
icon to change the following settings:
Input language and keyboard layout – Sets the keyboard language and characters.
Keyboard height and layout – Personalizes your keyboard.
Path input – Checkmark to enter a word by drawing a path through all of the letters.
Show word suggestions – Checkmark to show words through text prediction.
Auto-correction – Sets your level for automatic word correction. Choose from Off,
Mild, Moderate, and Aggressive.
Update word suggestions - Uses Swype Connect to provide more word
suggestions. To use this feature, accept the Agreement Rights.
Additional settings – Sets advanced settings.
Help – Tap the Help for more information.
Google voice typing – Checkmark to select Google voice typing to enter data. Tap the
Settings icon to change the Google voice settings.
Choose input languages – Sets the languages supported with Google voice typing.
Block offensive words – Checkmark to hide recognized offensive text.
Offline speech recognition – Enables voice input while offline.
Voice Search – Sets voice search options.
Language – Sets the Google search by voice language.
“OK Google” hotword detection – Turn this feature On to start the Google Search
app simply by saying “OK Google”.
Speech output – Sets when to use speech output. Choose from On, Hands-free
Only, and Off. To turn on speech output only when you’ve got a headset attached to
your phone, select Hands-free only.
Block offensive words – Checkmark to hide offensive voice results.
Offline speech recognition – Sets one or more additional languages for speech
recognition when you don’t have a network connection.
Bluetooth headset – Checkmark to record audio through a connected Bluetooth
headset.
Settings

83
Text-to-speech output – Sets the preferred speech engine and speech rate (very slow
to very fast). Also plays a short demonstration of speech synthesis.
Pointer speed – Sets the pointer speed on a slide bar.
< Location >
Turn on location service, your phone determines your approximate location using GPS,
Wi-Fi and mobile networks.
Mode – Set the location mode from High accuracy, Battery saving and Device
sensors only.
Google Play services – Tap to check Google Play services app information.
Camera – Checkmark to tag photos or videos with their locations.
Google Location Reporting – Select whether to turn on or off Google Location
Reporting options. For further information, tap > Help.
< Accounts & sync >
Permits applications to synchronize data in the background, whether or not you are
actively working in them. Deselecting this setting can save battery power and lower (but
not eliminate) data usage.
< Accessibility >
Improves accessibility for users who have impaired vision, hearing, or reduced dexterity.
TalkBack – Allows you to set up the TalkBack function which assists people with
impaired vision by providing verbal feedback.
Font size – Sets the font size.
Touch zoom – Allows you to zoom in and out by triple-tapping the screen.
Message/call voice notifications – Tap the Message/call voice notifications switch
to toggle it On or Off. On allows you to hear automatic spoken alerts for incoming calls
and messages.
Screen shades – Checkmark to dim the screen's backlight for less contrast.
Accessibility shortcut – Allows you to open the Accessibility feature quickly on any
screen.

84
Text-to-speech output – Tap to customize text-to-speech (TTS) settings.
Audio type – Sets the audio type. Choose Mono or Stereo.
Sound balance – Routes the sound through both the right and left channel when a
headset is connected. To manually set the audio route, move the slider on the sound
balance slide bar to set it.
Notification LED – Tap the switch to toggle it On or Off. On will activate the LED light
for the notifications you checkmark.
Flash alerts – Checkmark to set the flash to blink for incoming calls and notifications.
Call reject message – Checkmark to send a message customized for those with
hearing impairments when a call is rejected.
Turn off all sounds – Checkmark to turn off all device sounds.
Captions – Allows you to customize caption settings for those with hearing
impairments. Set Language, Font size, and Caption style.
Touch feedback time – Sets the touch feedback time.
Universal touch – Allows you to replace the hardware keys with a Universal touch
board.
Screen timeout – Sets the screen timeout.
Touch control areas – Allows you to select an area of the screen to limit touch
activation to just that area of the screen.
Auto-rotate screen – Checkmark to allow the phone to rotate the screen depending
on the phone orientation (portrait or landscape).
Password voice confirmation – Checkmark so that your phone can read passwords
you touch.
Power key ends call – Checkmark so that you can end voice calls by pressing the
Power/Lock Key.
Home key answers call – Checkmark so that you can answer voice calls by pressing
the Home Key.
Accessibility settings shortcut – Sets quick, easy access to selected features when
you triple-tap the Home Key.
Settings

85
One-touch input – Checkmark to enable one-touch input. It allows each finger touch
to enter a letter or character on the LG keyboard.
SERVICES
Displays the list of accessibility services installed on your phone. If none are installed,
No services installed is displayed instead.
< One-handed operation >
Dial keypad – Checkmark to enable you move the dial keypad to the right or left side
of the device. Simply tap the arrow to move it to one side or the other.
LG keyboard – Checkmark to enable you move the keyboard to the right or left side of
the device. Simply tap the arrow to move it to one side or the other.
Lock screen – Checkmark to enable you move the PIN Lock screen keypad to the right
or left side of the device. Simply tap the arrow to move it to one side or the other.
Help – Displays information regarding one-handed operation.
< Shortcut key >
Get quick access to apps by pressing and holding the Volume keys when screen is off
or locked. Tap the Shortcut key switch at the top right corner of the screen to toggle it
On or Off.
< Security >
Encrypt phone – Allows you to encrypt data on the phone for security. You will be
required to enter a PIN or password to decrypt your phone each time you power it on.
Encrypt SD card storage – Allows you to encrypt SD card storage and keep data
unavailable for other devices.
Set up SIM card lock – Sets the PIN to lock your SIM card and allows you to change
the PIN.
Password typing visible – Show the last character of the hidden password as you
type.
Phone administrators – Displays the list of administrators, allowing you to deactivate
device administrators.

86
Unknown source – Checkmark to allow installation of non-Play Store apps.
Verify apps – Checkmark to disallows or warn before installation of apps that may
cause harm to your phone.
Notification access – Sets to enable the Lock screen to read your notifications.
Storage type – Displays the current storage type.
Trusted credentials – Display trusted CA certificates.
Install from storage – Allows you to install a secure certificate from storage.
Clear credentials – Deletes all secure certificates and related credentials and erases
the secure storage’s own password. you’re prompted to confirm you want to clear this
data.
< Guest mode >
Use Guest mode when you let someone else use your phone. They’ll only be able to
use the apps that you’ve selected. Once you set it up, you can easily put your phone
in Guest mode by drawing a specified guest pattern on the Lock screen that you set,
which is different from your normal pattern.
Allowed app – Tap to select the apps available to be viewed in Guest mode.
Wallpaper – Sets the background (wallpaper) for your Guest mode Lock screen.
Lock screen type – Tap to create the unlock sequence for Guest mode.
Help – Displays information regarding Guest mode.
< Gestures >
Silence incoming calls – Checkmark to enable you to flip the phone to silence
incoming calls.
Snooze or stop alarm – Checkmark to enable you to simply flip the phone to snooze
or stop the alarm.
Pause video – Checkmark to enable you to simply flip the phone to pause the
currently playing video.
Help – Opens a help guide on how to use the Gestures features of your device.
Settings

87
Motion sensor calibration – Allows you to improve the accuracy of the tilt and speed
of the sensor.
< QuickCircle case >
Allows you to see a small portion of the screen through the closed case.
Select apps – Sets the apps that can be used directly in the case’s window without
opening the case.
Auto-unlock screen – Checkmark to automatically unlock the screen when you open
the case and the screen lock is set to swipe.
Help – Displays QuickCircle case information.
< Dual Window >
Tap the Dual window switch to toggle it On or Off. On enables you to touch and hold
the Back Key to activate two app windows at the same time.
Split view – Checkmark to automatically open the Dual window feature when you tap
a link on the full screen or tap an email attachment (images only).
Help – Displays help information about using the Dual window feature.
< Date & time >
Use Date & time settings to set how dates will be displayed. You can also use these
settings to set your own time and time zone rather than obtaining the current time from
the mobile network.
< Storage >
Use the Storage menu to monitor the used and available space in your phone.
< Battery >
BATTERY INFORMATION
The Battery charge information is displayed on a battery graphic along with the
percentage of the remaining charge and its status.
Touch the Battery charge icon to display the Battery use screen to see battery usage
level and battery use details. It displays which components and applications are using
the most battery power. Tap one of the entries to see more detailed information.

88
Settings
Battery percentage on status bar – Checkmark to display the battery level
percentage on the Status Bar next to the battery icon.
BATTERY SAVER
Tap the Battery saver switch to toggle it On or Off. Tap Battery saver to access the
following settings:
Battery saver – Sets the battery charge percent level that will automatically turn on
Battery saver. Choose from Immediately, 10% battery, 20% battery, 30% battery, and
50% battery.
Help – Display battery saving items information.
< Smart cleaning >
Display the space in use and free in your phone. Tap the Menu Key , then tap
Settings to set notification interval and idle time period.
< Apps >
Allows you to view details about the apps installed on your phone, manage their data,
and force them to stop.
< Default message app >
Set Messaging or Hangouts as default app.
< Backup & reset >
This menu allows you to back up and/or erase your data.
Backup my data – Checkmark to backup app data, Wi-Fi passwords, and other
settings to Google servers.
Backup account – Sets the account to backup.
Automatic restore – Checkmark to allow your phone to automatically restore backed
up settings and data when an app is reinstalled on the phone.
LG Backup service – Backs up all information on the device and restores it in the
event of data loss or replacement.

89
Factory data reset – Reset your settings to the factory default values and delete all
your data. If you reset the phone this way, you are prompted to re-enter the same
information as when you first started Android.
< Printing >
Cloud Print – Tap the Cloud Print switch to toggle it On or Off. On allows you to select
a printer via the Cloud feature.
< About phone >
View legal information and check your phone status and software version.

90
"LG PC Suite" PC software is a program that helps you connect your device to a PC via
a USB cable and Wi-Fi. Once connected, you can use the functions of your device from
your PC.
With your "LG PC Suite" PC Software, You Can...
• Manage and play your media contents (music, movie, picture) on your PC.
• Send multimedia contents to your device.
• Synchronizes data (schedules, contacts, bookmarks) in your device and PC.
• Backup the applications in your device.
• Update the softwares in your device.
• Backup and restore the device data.
• Play multimedia contents of your PC from your device.
• Backup and create and edit the memos in your device
NOTE: You can use the Help menu from the application to find out how to use
your "LG PC Suite" PC software.
Installing "LG PC Suite" PC Software
"LG PC Suite" PC software can be downloaded from the webpage of LG.
1 Go to www.lg.com and select a country of your choice.
2 Go to Support > MOBILE SUPPORT > LG Mobile Phones > Select the Model
or
Go to Support > Mobile > Select the Model.
3 Click PC SYNC from MANUALS & DOWNLOAD and click DOWNLOAD to download
"LG PC Suite" PC software.
PC software (LG PC Suite)

91
System Requirements for "LG PC Suite" PC software
• OS: Windows XP (Service pack 3) 32bit, Windows Vista, Windows 7, Windows 8
• CPU: 1 GHz or higher processors
• Memory: 512 MB or higher RAMs
• Graphic card: 1024 x 768 resolution, 32 bit color or higher
• HDD: 500 MB or more free hard disk space (More free hard disk space may be
needed depending on the volume of data stored.)
• Required software: LG integrated drivers, Windows Media Player 10 or later
NOTE: LG Integrated USB Driver
LG integrated USB driver is required to connect an LG device and PC and
installed automatically when you install "LG PC Suite" PC software application.
Synchronizing your Device to a PC
Data from your device and PC can be synchronized easily with "LG PC Suite"
PC software for your convenience. Contacts, schedules and bookmarks can be
synchronized.
The procedure is as follows:
1 Connect your device to PC. (Use a USB cable or Wi-Fi connection.)
2 Slide down the status bar > Tap Tap for more USB options then select Media
device (MTP).
3 After connection, run the program and select the device section from the category
on the left side of the screen.
4 Click Personal information to select.
5 Select the checkbox of contents to synchronize and click the Sync button.
NOTE: To synchronize your phone with your PC, you need to install LG PC
Suite onto your PC. Please refer to previous pages to install LG PC Suite.

92
PC software (LG PC Suite)
Moving contacts from your Old Device to your New Device
1 Export your contacts as a CSV file from your old device to your PC using a PC sync
program.
2 Install "LG PC Suite" on the PC first. Run the program and connect your Android
mobile phone to the PC using a USB cable.
3 On the top menu, select phone > Import/Export contacts > Export to your
phone.
4 A popup window to select the file type and a file to export will appear.
5 On the popup, click the Select a file and Windows Explorer will appear.
6 Select the contacts file to export in Windows Explorer and click the Open.
7 Click Export.
8 A Field mapping popup to link the contacts in your device and new contacts data
will appear.
9 If there is a conflict between the data in your PC contacts and device contacts,
make the necessary selections or modifications in LG PC Suite.
10 Click OK.

93
Phone software update
LG Mobile phone software update from the Internet
For more information about using this function, please visit http://www.lg.com/common/
index.jsp select your country and language.
This feature allows you to conveniently update the firmware on your phone to a newer
version from the Internet without needing to visit a service center. This feature will only
be available if and when LG makes a newer firmware version available for your device.
Because the mobile phone firmware update requires the user's full attention for the
duration of the update process, please make sure you check all instructions and notes
that appear at each step before proceeding. Please note that removing the USB data
cable during the upgrade may seriously damage your mobile phone.
NOTE: LG reserves the right to make firmware updates available only for
selected models at its own discretion and does not guarantee the availability
of the newer version of the firmware for all handset models.
LG Mobile Phone software update via Over-the-Air (OTA)
This feature allows you to conveniently update your phone's software to a newer
version via OTA, without connecting using a USB data cable. This feature will only be
available if and when LG makes a newer firmware version available for your device.
You should first check the software version on your mobile phone: Settings > General
tab > About phone > Common tab > Update Center > Software Update > Check
now for update.
Phone software update

94
Phone software update
NOTE: Your personal data from internal phone storage—including information
about your Google account and any other accounts, your system/application
data and settings, any downloaded applications and your DRM licence—
might be lost in the process of updating your phone's software. Therefore,
LG recommends that you backup your personal data before updating your
phone's software. LG does not take responsibility for any loss of personal
data.
NOTE: This feature depends on your network service provider, region and
country.

95
About this user guide
• Before using your device, please carefully read this manual. This will ensure that you
use your phone safely and correctly.
• Some of the images and screenshots provided in this guide may appear differently on
your phone.
• Your content may differ from the final product, or from software supplied by service
providers or carriers, This content may be subject to change without prior notice. For
the latest version of this manual, please visit the LG website at www.lg.com.
• Your phone's applications and their functions may vary by country, region, or
hardware specifications. LG cannot be held liable for any performance issues resulting
from the use of applications developed by providers other than LG.
• LG cannot be held liable for performance or incompatibility issues resulting from
edited registry settings being edited or operating system software being modified. Any
attempt to customize your operating system may cause the device or its applications
to not work as they should.
• Software, audio, wallpaper, images, and other media supplied with your device are
licensed for limited use. If you extract and use these materials for commercial or
other purposes is, you may be infringing copyright laws. As a user, you are fully are
entirely responsible for the illegal use of media.
• Additional charges may be applied for data services, such as messaging, uploading
and downloading, auto-syncing, or using location services. To avoid additional
charges, select a data plan to is suitable for your needs. Contact your service provider
to obtain additional details.
Trademarks
• LG and the LG logo are registered trademarks of LG Electronics.
• All other trademarks and copyrights are the property of their respective owners.
About this user guide

96
About this user guide
DivX HD
ABOUT DIVX VIDEO: DivX
®
is a digital video format created by DivX, LLC, a subsidiary
of Rovi Corporation. This is an official DivX Certified
®
device that has passed rigorous
testing to verify that it plays DivX video. Visit divx.com for more information and software
tools to convert your files into DivX videos.
ABOUT DIVX VIDEO-ON-DEMAND: This DivX Certified
®
device must be registered
in order to play purchased DivX Video-on-Demand (VOD) movies. To obtain your
registration code, locate the DivX VOD section in your device setup menu. Go to
vod.divx.com for more information on how to complete your registration.
DivX Certified
®
to play DivX
®
video up to HD 720p, including premium content.
DivX
®
, DivX Certified
®
and associated logos are trademarks of Rovi Corporation
or its subsidiaries and are used under license.
Dolby Digital Plus
Manufactured under license from Dolby Laboratories. Dolby, Dolby Digital Plus,
and the double-D symbol are trademarks of Dolby Laboratories.
Notice: Open Source Software
To obtain the corresponding source code under GPL, LGPL, MPL and other
open source licences, please visit http://opensource.lge.com/
All referred licence terms, disclaimers and notices are available for download
with the source code.

97
These accessories are available for use with the your phone. (Items described below
may be optional.)
Travel adaptor Stereo headset
Quick Start Guide Data cable
Battery
Accessories
NOTE:
• Always use genuine LG accessories.
• Failure to do this may void your warranty.
• Accessories may vary in different regions.

98
Troubleshooting
This chapter lists some problems you might encounter when using your phone. Some
problems require you to call your service provider, but most are easy to fix yourself.
Message Possible causes Possible corrective measures
Micro-USIM
card error
There is no
Micro-USIM card
in the phone
or it is inserted
incorrectly.
Make sure that the Micro-USIM card is
correctly inserted.
No network
connection/
Dropped
network
Signal is weak or
you are outside the
carrier network.
Move toward a window or into
an open area. Check the network
operator coverage map.
Operator applied
new services.
Check whether the Micro-USIM card
is more than 6~12 months old. If so,
change your Micro-USIM card at your
network provider's nearest branch.
Contact your service provider.
Codes do
not match
To change a
security code,
you will need
to confirm the
new code by
re-entering it.
If you forget the code, contact your
service provider.
The two codes
you have entered
do not match.

99
Message Possible causes Possible corrective measures
No
applications
can be set
Not supported by
service provider
or registration
required.
Contact your service provider.
Calls not
available
Dialling error New network not authorized.
New Micro-USIM
card inserted. Check for new restrictions.
Pre-paid charge
limit reached.
Contact service provider or reset limit
with PIN2.
Phone
cannot be
switched on
On/Off key
pressed too briefly.
Press the On/Off key for at least two
seconds.
Battery is not
charged.
Charge battery. Check the charging
indicator on the display.

100
Troubleshooting
Message Possible causes Possible corrective measures
Charging
error
Battery is not
charged. Charge battery.
Outside
temperature is too
hot or cold.
Make sure phone is charging at a
normal temperature.
Contact problem Check the charger and its connection
to the phone.
No voltage Plug the charger into a different socket.
Charger defective Replace the charger.
Wrong charger Use only original LG accessories.
Number not
allowed
The Fixed dialling
number function
is on.
Check the Settings menu and turn the
function off.
Impossible
to receive /
send SMS
& photos
Memory full Delete some messages from your
phone.
Files do not
open
Unsupported file
format Check the supported file formats.

101
Message Possible causes Possible corrective measures
The screen
does not
turn on
when I
receive a
call.
Proximity sensor
problem
If you use a protection tape or case,
make sure it has not covered the area
around the proximity sensor. Make
sure that the area around the proximity
sensor is clean.
No sound Vibration mode
Check the settings status in the sound
menu to make sure you are not in
vibration or silent mode.
Hangs up
or freezes
Intermittent
software problem
Try to perform a software update via
the website.

102
Category
Sub-
Category
Question Answer
BT
Bluetooth
Devices
What are the functions
available via Bluetooth
You can connect a Bluetooth audio
device such as a Stereo/Mono headset
or Car Kit. Also, when the FTP server
is connected to a compatible device,
you can share content stored on the
storage media.
BT
Bluetooth
Headset
If my Bluetooth
headset is connected,
can I listen to my
music through
my 3.5 mm wired
headphones?
Yes, you can listen to your music
through the last connected device.
Data
Contacts
Backup
How can I backup
Contacts?
The Contacts data can be
synchronized between your phone and
Gmail™.
Data
Synchronization
Is it possible to set up
one-way sync with
Gmail?
Only two-way synchronization is
available.
Data
Synchronization
Is it possible to
synchronize all email
folders?
The Inbox is automatically
synchronized. You can view other
folders by tapping the Menu Key
and select Folders to choose a folder.
Google™
Service
Gmail Log-In
Do I have to log into
Gmail whenever I want
to access Gmail?
Once you have logged into Gmail, no
need to log into Gmail again.
FAQ

103
Category
Sub-
Category
Question Answer
Google™
Service
Google
Account
Is it possible to filter
emails?
No, email filtering is not supported via
the phone.
Phone
Function
Email
What happens when
I execute another
application while
writing an email?
Your email will automatically be saved
as a draft.
Phone
Function
Ringtone
Is there a file size
limitation for when I
want to use MP3 file
as ring tone?
There is no file size limitation.
Phone
Function
Message
Time
My phone does not
display the time of
receipt for messages
older than 24 hrs. How
can I change this?
You will only be able to see the times
for messages received the same day.
Phone
Function
Navigation
Is it possible to install
another navigation
application on my
phone?
Any application that is available at Play
Store™ and is compatible with the
hardware can be installed and used.
Phone
Function
Synchronisation
Is it possible to
synchronize my
contacts from all my
email accounts?
Only Gmail and MS Exchange server
(company email server) contacts can
be synchronized.

104
FAQ
Category
Sub-
Category
Question Answer
Phone
Function
Wait and
Pause
Is it possible to save a
contact with Wait and
Pause in the numbers?
If you transferred a contact with the W
& P functions saved into the number,
you will not be able to use those
features. You will need to re-save each
number.
How to save with Wait and Pause:
1. From the Home screen, tap the
Phone icon .
2. Dial the number, then tap the Menu
Key .
3. Tap Add 2-sec pause or Add wait.
Phone
Function
Security
What are the phone’s
security functions?
You are able to set the phone to
require that an Unlock Pattern be
entered before the phone can be
accessed or used.

105
Category
Sub-
Category
Question Answer
Phone
Function
Unlock
Pattern
How do I create the
Unlock Pattern?
1. From the Home screen, tap the
Apps Key .
2. Tap Settings > Display tab > Lock
screen.
3. Tap Select screen lock > Pattern.
The first time you do this, a short
tutorial about creating an Unlock
Pattern will appear.
4. Set up by drawing your pattern
once, and once again for
confirmation.
Precautions to take when using the
pattern lock.
It is very important to remember the
unlock pattern you set. You will not
be able to access your phone if you
use an incorrect pattern five times.
You have five chances to enter your
unlock pattern, PIN or password. If you
have used all 5 opportunities, you can
try again after 30 seconds. (Or, if you
preset the backup PIN, you can use
the backup PIN code to unlock the
pattern.)

106
FAQ
Category
Sub-
Category
Question Answer
Phone
Function
Unlock
Pattern
What should I do if
I forget the unlock
pattern and I didn’t
create my Google
account on the
phone?
If you have forgotten your pattern:
If you logged into your Google account
on the phone but failed to enter the
correct pattern 5 times, tap the forgot
pattern button. You are then required
to log in with your Google account
to unlock your phone. If you have
not created a Google account on the
phone or you have forgotten it, you will
have to perform a hard reset.
Caution: If you perform a factory reset,
all user applications and user data
will be deleted. Please remember to
backup any important data before
performing a factory reset.
Phone
Function
Memory
Will I know when my
memory is full? Yes, you will receive a notification.
Phone
Function
Language
Support
Is it possible to change
my phone's language?
The phone has multilingual capabilities.
To change the language:
1. From the Home screen, tap the
Apps Key and tap Settings.
2. Tap General tab > Language &
input > Language.
3. Tap the desired language.

107
Category
Sub-
Category
Question Answer
Phone
Function
VPN
How do I set up a
VPN?
VPN access configuration is different
for each company. To configure VPN
access from your phone, you must
obtain the details from your company’s
network administrator.
Phone
Function
Screen time
out
My screen turns off
after only 15 seconds.
How can I change the
amount of time for the
backlight to turn off?
1. From the Home screen, tap the
Apps Key .
2. Tap Settings > Display tab.
3. Tap Screen timeout.
4. Tap the preferred screen backlight
timeout time.
Phone
Function
Wi-Fi &
mobile
network
When Wi-Fi and
mobile network are
both available, which
service will my phone
use?
When using data, your phone may
default to the Wi-Fi connection (if
Wi-Fi connectivity on your phone is
set to On). However, there will be no
notification when your phone switches
from one to the other.
To know which data connection is
being used, view the mobile network or
Wi-Fi icon at the top of your screen.
Phone
Function
Home
screen
Is it possible to remove
an application from the
Home screen?
Yes. Just touch and hold the icon until
the dustbin icon appears at the top
and center of the screen. Then, without
lifting your finger, drag the icon to the
trash can.

108
FAQ
Category
Sub-
Category
Question Answer
Phone
Function
Application
I downloaded an
application and it
causes a lot of errors.
How do I remove it?
1. From the Home screen, tap the
Apps Key .
2. Tap Settings > General tab > Apps
> DOWNLOADED.
3. Tap the application, then tap
Uninstall.
Phone
Function
Charger
Is it possible to charge
my phone using a USB
data cable without
installing the necessary
USB driver?
Yes, the phone will be charged by the
USB cable regardless of whether the
necessary drivers are installed or not.
Phone
Function
Alarm
Can I use music files
for my alarm?
Yes. After saving a music file as a
ringtone, you can use it as your alarm.
1. Touch and hold a song in a library
list. In the menu that opens, tap Set
as ringtone > Phone ringtone or
Contact ringtone.
2. In the alarm clock setting screen,
select the song as a ringtone.
Phone
Function
Alarm
Will my alarm be
audible or will it go off
if the phone is turned
off?
No, this is not supported.
Phone
Function
Alarm
If my ringer volume is
set to Off or Vibrate,
will I hear my alarm?
Your alarm is programmed to be
audible even in these scenarios.

109
Category
Sub-
Category
Question Answer
Recovery
Solution
Hard Reset
(Factory
Reset)
How can I perform a
factory reset if I can’t
access the phone’s
setting menu?
If your phone does not restore to its
original condition, use a hard reset
(factory reset) to initialize it.
