LG Electronics USA L35G Cellular/PCS GSM/WCDMA Phone with WLAN and Bluetooth User Manual
LG Electronics MobileComm USA, Inc. Cellular/PCS GSM/WCDMA Phone with WLAN and Bluetooth
Users Manual

Congratulations on your purchase of the advanced and compact
LGL35G phone by LG, designed to operate with the latest digital mobile
communication technology.
Some of the contents in this manual may differ from your phone
depending on the software of the phone or your service provider.
• This handset is not recommended for
the visually impaired because of its
touch-screen keypad.
• Copyright ©2012 LG Electronics, Inc. All
rights reserved. LG and the LG logo are
registered trademarks of LG Group and
its related entities. All other trademarks
are the property of their respective
owners.
• Google™, Google Maps™, Gmail™,
YouTube™, Google Talk™ and Android
Market™ are trademarks of Google, Inc.

Part 15.21 statement
" Change or Modifications that are not expressly approved by the manufacturer could void
the user's authority to operate the equipment. “
Part 15.105 statement
This equipment has been tested and found to comply with the limits for a class B digital
device, pursuant to Part 15 of the FCC Rules.
These limits are designed to provide reasonable protection against harmful interference in
a residential installation. This equipment generates uses and can radiate radio frequency
energy and, if not installed and used in accordance with the instructions, may cause harmful
interference to radio communications. However, there is no guarantee that interference will
not occur in a particular installation. If this equipment does cause harmful interference or
television reception, which can be determined by turning the equipment off and on, the user
is encouraged to try to correct the interference by one or more of the following measures:
- Reorient or relocate the receiving antenna.
- Increase the separation between the equipment and receiver.
- Connect the equipment into an outlet on a circuit different from that to
which the receiver is connected.
- Consult the dealer or an experienced radio/TV technician for help.
This device is not intended for sale in the USA.

(%%2CTV%NCUU$%QORNKCPEG
7KLVGHYLFHDQGLWVDFFHVVRULHVFRPSO\ZLWKSDUWRI)&&
UXOHVDQG,&(6&ODVV%GLJLWDODSSDUDWXVUHTXLUHPHQWV
IRU,QGXVWU\&DQDGD2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJ
WZRFRQGLWLRQV7KLVGHYLFHDQGLWVDFFHVVRULHVPD\QRW
FDXVHKDUPIXOLQWHUIHUHQFHDQGWKLVGHYLFHDQGLWV
DFFHVVRULHVPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHGLQFOXGLQJ
LQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHGRSHUDWLRQ
$QF[YQTP1RGTCVKQP
7KLVGHYLFHZDVWHVWHGIRUW\SLFDOERG\ZRUQRSHUDWLRQV
ZLWKWKHEDFNRIWKHSKRQHNHSWFPLQFKHVEHWZHHQ
WKHXVHUĜVERG\DQGWKHEDFNRIWKHSKRQH7RFRPSO\ZLWK
)&&5)H[SRVXUHUHTXLUHPHQWVDPLQLPXPVHSDUDWLRQ
GLVWDQFHRIFPLQFKHVPXVWEHPDLQWDLQHGEHWZHHQ
WKHXVHUVERG\DQGWKHEDFNRIWKHSKRQH7KLUGSDUW\
EHOWFOLSVKROVWHUVDQGVLPLODUDFFHVVRULHVFRQWDLQLQJ
PHWDOOLFFRPSRQHQWVVKRXOGQRWEHXVHG%RG\ZRUQ
DFFHVVRULHVWKDWFDQQRWPDLQWDLQFPLQFKHV
VHSDUDWLRQGLVWDQFHEHWZHHQWKHXVHUVERG\DQGWKHEDFN
RIWKHSKRQHDQGKDYHQRWEHHQWHVWHGIRUW\SLFDOERG\
ZRUQRSHUDWLRQVPD\QRWFRPSO\ZLWK)&&5)H[SRVXUH
OLPLWVDQGVKRXOGEHDYRLGHG

%QPHQTOKVoCWZPQTOGU(%%2CTV%NCUU$
&HWDSSDUHLOHWVHVDFFHVVRLUHVVRQWFRQIRUPHVDX[
QRUPHV)&&3DUW&ODVV%GHOD)HGHUDO
&RPPXQLFDWLRQV&RPPLVVLRQHWDX[H[LJHQFHVSRXU
DSSDUHLOVQXPpULTXHV,&(6&ODVV%GĜ,QGXVWULH
&DQDGD6RQIRQFWLRQQHPHQWHVWVXMHWDX[GHX[FRQGLWLRQV
VXLYDQWHV&HWDSSDUHLOHWVHVDFFHVVRLUHVQHGRLYHQW
SDVSURYRTXHUGHEURXLOODJHSUpMXGLFLDEOHHWFHW
DSSDUHLOHWVHVDFFHVVRLUHVGRLYHQWDFFHSWHUWRXWHVOHV
LQWHUIpUHQFHVUHoXHV\FRPSULVFHOOHVSRXYDQWFDXVHUXQ
IRQFWLRQQHPHQWLQGpVLUDEOH
7VKNKUCVKQPEQOOGCRRCTGKNRQTVCVKH
&HWpOpSKRQHDpWpWHVWpHQYXHGĜXQHXWLOLVDWLRQW\SH
FRPPHDSSDUHLOSRUWDWLIDYHFXQHGLVWDQFHGHFP
SRXFHVHQWUHOĜDUULqUHGHOĜDSSDUHLOHWOHFRUSVGH
OĜXWLOLVDWHXU3RXUVDWLVIDLUHDX[H[LJHQFHVGHOD)&&HQ
PDWLqUHGĜH[SRVLWLRQDX[UDGLRIUpTXHQFHVXQHGLVWDQFH
GĜDXPRLQVFPSRXFHVGRLWrWUHPDLQWHQXHHQWUH
OHFRUSVGHOĜXWLOLVDWHXUHWOĜDUULqUHGXWpOpSKRQH/HV
SLQFHVGHFHLQWXUHOHVpWXLVHWDXWUHVDFFHVVRLUHV
VHPEODEOHVGĜDXWUHVPDUTXHVHWFRQWHQDQWGHV
FRPSRVDQWHVPpWDOOLTXHVQHGRLYHQWSDVrWUHXWLOLVpV/HV
DFFHVVRLUHVSRUWDWLIVHPSrFKDQWOHPDLQWLHQGĜXQH
GLVWDQFHGHFPSRXFHVHQWUHOHFRUSVGH
OĜXWLOLVDWHXUHWOĜDUULqUHGXWpOpSKRQHHWTXLQĜRQWSDVpWp
WHVWpVHQYXHGĜXQHXWLOLVDWLRQW\SHFRPPHDFFHVVRLUHV
SRUWDWLIVSHXYHQWQHSDVVDWLVIDLUHDX[OLPLWHVGĜH[SRVLWLRQ
DX[UDGLRIUpTXHQFHVVWLSXOpHVSDUOD)&&HWSDU
FRQVpTXHQWQHGRLYHQWSDVrWUHXWLOLVpV
About this user manual
Please read this user manual carefully before you use your phone and
keep it handy for future reference.
Should your phone fail to operate correctly, refer to FAQ section.
Some features and services may vary by area, phone, carrier, plan and
version of phone software.
Screen displays and illustrations on this user manual may differ from
those you see on the actual phone.
Designs and specifications of the phone and other accessories are
subject to change without any notice.
•
•
•

LGL35G | User Guide
Important notice
Please check to see whether any problems you encountered with your
phone are described in this section before taking the phone in for service
or calling a service representative.
1. Phone memory
When available space in your phone memory is less than 10%, your phone
cannot receive new messages. You need to check your phone memory
and delete some data, such as applications or messages, to make more
memory available.
Managing applications
In the Home screen, touch the Applications tab, then select Settings >
Applications > Manage applications.
Once all applications appear, scroll to and select the application you want
to uninstall.
Tap Uninstall, then touch OK to uninstall the application you selected.
2. Optimising battery life
Extend your battery's life between charges by turning off features you
don't need to run constantly in the background. You can monitor how
applications and system resources consume battery power.
Extending your battery's life
Turn off radio communications you are not using. If you are not using Wi-
Fi, Bluetooth or GPS, turn them off.
Reduce screen brightness and set a shorter screen timeout.
1.
2.
3.
•
•

Turn off automatic syncing for Gmail, Calendar, Contacts and other
applications.
Some applications you have downloaded may cause your battery life to be
reduced.
Checking the battery charge level
In the Home screen, touch the Applications tab, then select Settings >
About phone > Status.
The battery status (Charging, Not charging) and level (percentage
charged) is displayed at the top of the screen.
Monitoring and controlling what uses the battery
In the Home screen, touch the Applications tab, then select Settings >
About phone > Battery use.
Battery usage time is displayed at the top of the screen. It tells you
how long it has been since you last connected to a power source or, if
connected to a power source, how long you were last running on battery
power. The body of the screen lists applications or services using battery
power, from greatest amount to least.
3. Installing an open source operating system
If you install and use an open source operating system (OS) on your phone
rather than using the OS provided by the manufacturer, your phone may
malfunction.
•
•
1.
2.
1.
2.

LGL35G | User Guide
WARNING: If you install and use an OS other than the one provided by the
manufacturer, your phone is no longer covered by the warranty.
WARNING: To protect your phone and personal data, only download
applications from trusted sources, such as Android Market. If there are
improperly installed applications on your phone, your phone may not work
normally or a serious error may occur. You must uninstall those applications
and all their data and settings from the phone.
4. Using unlock pattern
Set unlock pattern to secure your phone. This opens a set of screens that
guide you through how to draw a screen unlock pattern.
Caution: Create a Google account before setting an unlock pattern.
WARNING: Precautions to take when using pattern lock.
It is very important to remember the unlock pattern you set. You will not be
able to access your phone if you use an incorrect pattern 5 times. You have 5
opportunities to enter your unlock pattern, PIN or password. If you have used
all 5 opportunities, you can try again after 30 seconds.
When you can’t recall your unlock Pattern, PIN, or Password:
If you have forgotten pattern: If you logged in to your Google account on
the phone but failed to enter the correct pattern 5 times, tab the Forgot
pattern button. You are then required to log in with your Google account to
unlock your phone.

If you have not created a Google account on the phone or you forgot it, you
have to perform a Hard reset.
If you have forgotten PIN or Password: If you forgot your PIN or Password,
you need to do Hard reset.
Caution: If you perform a hard reset, all user applications and user data are
deleted.
5. Using the hard reset
If it does not restore to the original condition, use hard reset to initialise
your phone.
When the phone is turned off, press and hold the Home key + Volume
down key + Power key for over ten seconds. When the screen shows the LG
logo, release the Power key.
After the screen shows the hard reset screen, release the other keys.
Leave your phone for at least a minute while it performs the hard reset,
then your phone will be turned on.
Caution: If you perform a hard reset, all user applications and user data are
deleted. This cannot be reversed. Remember to back up any important data
before performing a hard reset.

LGL35G | User Guide
6. Connecting to Wi-Fi networks
To use Wi-Fi on your phone, you need to access a wireless access point.
Some access points are open and you can simply connect to them. Others
are hidden or use security features; you must configure your phone to be
able to connect to them.
Turn off Wi-Fi when you're not using it to extend the life of your battery.
Turning Wi-Fi on and connecting to a Wi-Fi network
In the Home screen, touch the Applications tab, then select Settings >
Wireless & networks > Wi-Fi settings.
Touch Wi-Fi to turn it on and begin scanning for available Wi-Fi
networks.
A list of available Wi-Fi networks is displayed. Secured networks are
indicated by a lock icon.
Touch a network to connect to it.
If the network is open, you are asked to confirm that you want to connect
to that network by touching Connect.
If the network is secure, you're asked to enter a password or other
credentials. (Ask your network administrator for details)
The status bar displays icons that indicate Wi-Fi status.
1.
2.
•
3.
•
•
4.

7. Opening and switching applications
Multitasking is easy with Android because you can keep more than
one application running at the same time. There’s no need to quit an
application before opening another. Use and switch between several open
applications. Android manages each application, stopping and starting
them as needed to ensure that idle applications don’t consume resources
unnecessarily.
Stopping applications
In the Home screen, touch the Applications tab, then select Settings >
Applications > Manage applications > select Running.
Scroll to the desired application and touch Stop to stop it.
TIP! To return to recent applications, press and hold the Home key. The
screen then displays a list of the applications you used recently.
8. Transferring music, photos and videos using USB mass storage
devices
In the Home screen, touch the Applications tab, then select Settings
> Storage to check out the storage media. (If you want to transfer files
from or to a memory card, insert a memory card into the phone.)
Connect the phone to your PC using the USB cable.
USB Mass Storage mode screen will appear, and if you touch Tu r n o n
USB Storage button, your device connection would be recognized by PC.
1.
2.
1.
2.
3.

LGL35G | User Guide
Open the removable memory folder on your PC. You can view the mass
storage content on your PC and transfer the files.
Copy the files from your PC to the drive folder.
When you are finished, select “Charge only” option to disconnect the
phone.
9. Hold your phone straight up
Hold your mobile phone straight up, as you would a regular phone. The
LGL35G has an internal antenna. Be careful not to scratch or damage the
back of the phone, as that causes loss of performance.
While making/receiving calls or sending/receiving data, avoid holding the
lower part of the phone where the antenna is located. Doing so may affect
call quality.
10. When the screen freezes
If the screen freezes or the phone does not respond when you try to
operate it:
Remove the battery, reinsert it, then turn the phone on. If it still does not
work, please contact the service centre.
11. Do not connect your phone when you turn on/off your PC.
Make sure you disconnect the data cable between your phone and PC;
leaving it connected might cause errors on your PC.
4.
5.
6.

Getting to know your phone
To turn on your phone, press and hold the Power key for 3 seconds.
To turn off the phone, press and hold the Power key for 3 seconds, then touch
Power off and OK.
Menu key
Check what options are available.
Home key
Return to home from any screen.
Back key
Return to the previous screen.
Speaker/Receiver Power/Lock key
Switch your phone on/off by pressing and holding
this key. Turn off and lock the screen.
Proximity sensor
NOTE: Proximity sensor
When receiving and making calls, the proximity sensor automatically turns
the backlight off and locks the touch keypad by sensing when the phone is
near your ear. This extends battery life and prevents the touch keypad from
activating unintentionally during calls.
WARNING: Precautions to take when using pattern lock.
Placing a heavy object on the phone or sitting on it can damage its LCD
and touch screen functions. Do not cover the protective fi lm on the LCD’s
proximity sensor. This may cause the sensor to malfunction.

LGL35G | User Guide
SIM card slot
microSD memory card
slot
Camera lens
Charger, micro USB cable
connector
Battery
Back cover
Volume keys
On the home screen: control ringer volume.
During a call: control your In-Call volume.
When playing a track: control volume continuously.
•
•
•
Stereo earphone connector
Power/Lock key

Installing the SIM card and battery
To remove the back cover, hold the phone in your hand firmly. With the
other hand, firmly press your thumb on the back cover. Now lift off the
back cover.
Slide the SIM card into the SIM card slot. Make sure the gold contact
area on the card is facing downwards.
1.
2.

LGL35G | User Guide
Insert the battery by aligning the gold contacts on the phone and the
battery.
Replace the back cover of the phone.
3.
4.

Charging your phone
Insert the charger, then plug it into an electrical outlet. Your LGL35G must
be charged before you see .
NOTE: The
battery must be
fully charged
initially to improve
battery lifetime.
Installing the memory card
NOTE: The LGL35G supports memory cards up to 32 GB.
To insert a memory card:
Turn the phone off before inserting or removing a memory card. Remove
the back cover.
1.

LGL35G | User Guide
Your Home screen
Touch screen tips
Here are some tips on how to navigate around your phone.
To u c h – To choose a menu/option or open an application, touch it.
Touch and hold – To open an options menu or grab an object you want to
move, touch and hold it.
Drag – To scroll through a list or move slowly, drag across the touch screen.
Flick – To scroll through a list or move quickly, flick across the touch screen
(drag quickly and release).
NOTE:
To select an item, touch the centre of the icon.
Do not press too hard; the touch screen is sensitive enough to pick up a
light, firm touch.
Use the tip of your finger to touch the option you want. Be careful not to
touch any other keys.
Lock your phone
When you are not using the LGL35G, press the power key to lock your
phone. This helps prevent accidental presses and saves battery power.
Also, if you do not use the phone for a while, the Home screen or another
screen you are viewing is replaced with the lock screen to conserve battery
power.
If there are any programs running when you set the pattern, they may be
still running in Lock mode. It is recommended that you exit all programs
before entering the Lock mode to avoid unnecessary charges (e.g. phone
•
•
•

calls, Web access and data communications).
Setting an unlock pattern: you can draw your own unlock pattern by
connecting the dots.
If you set a pattern, the phone screen locks. To unlock the phone, draw the
pattern that you set on the screen.
Caution: When you set an unlock pattern, you need to create your Gmail account
fi rst.
Caution: If there are more than 5 pattern drawing errors in a row, you cannot
unlock the phone. In this case, refer to the point-4 under the Important Notice.
Unlock screen
Whenever your LGL35G is not in use, it returns to the lock screen. Drag
your finger from bottom to top to unlock the screen.
Silent mode
In the notification drawer, touch to change mode.
Home
Simply swipe your finger to the left or right to view the panels.
You can customise each panel with widgets, shortcuts (to your favourite
applications), folders and wallpaper.
NOTE: Some screen images may be different depending on your phone provider.
In your Home screen, you can view quick keys at the bottom of the screen.
Quick keys provide easy, one-touch access to the functions you use the
most.

LGL35G | User Guide
Touch the Phone icon to bring up the touch screen dialpad to make a
call.
Touch the Contacts icon to open your contacts.
Touch the Messaging icon to access the messaging menu. This is
where you can create a new message.
Touch the Applications tab at the bottom of the screen. You can then
view all your installed applications.
To open the desired application, simply touch the icon in the applications
list.
NOTE: Preloaded applications may differ according to your phone’s software or
your service provider.
Adding widgets to your Home screen
You can customise your Home screen by adding shortcuts, widgets or
folders to it. For more convenience using your phone, add your favourite
widgets to the Home screen.
In the Home screen, touch the Menu key and select Add. Or touch and
hold the empty part of the home screen.
In the Add to Home screen menu, touch the type of item you want to
add.
For example, select Folders from the list and tap it.
You then see a new folder icon on the Home screen. Drag it to the
desired location on the desired panel, then take your finger off the
screen.
1.
2.
3.
4.

TIP! To add an application icon to the Home screen from the Applications
menu, touch and hold the application you want to add.
TIP! To remove an application icon from the Home screen, touch and hold
the icon you want to remove, then drag it to .
NOTE: You cannot delete preloaded applications. (Only their icons can be
deleted from the screen.)
Returning to recently-used applications
Press and hold the Home key. The screen displays a pop-up with icons
of applications you used recently.
Touch an icon to open the application. Or touch the Back key to return to
the current application.
Notification drawer
The notification drawer runs across the top of your screen.
1.
2.

LGL35G | User Guide
Data
connectivity
GPSBluetooth
Wi-Fi
Sound/
Vibrate/
Silent
Touch and slide the notification drawer down with your finger.
Or, in the Home screen, touch the Menu key and select Notifications. Here
you can check and manage sound, Wi-Fi, Bluetooth and GPS as well as
other notifications.
Viewing the status bar
The status bar uses different icons to display phone information such as
signal strength, new messages, battery life and active Bluetooth and data
connections.
Below is a table explaining the meaning of icons you’re likely to see in the
status bar.
[Status bar]

Icon
Description
No SIM card
No signal
Airplane mode
Connected to a Wi-Fi network
Wired headset
Call in progress
Call hold
Speakerphone
Phone microphone is muted
Missed call
Bluetooth is on
Connected to a Bluetooth device
System warning
Alarm is set
New voicemail

LGL35G | User Guide
Icon
Description
Ringer is silenced
Vibrate mode
Battery fully charged
Battery is charging
Data in and out
Phone is connected to PC via USB cable
Downloading data
Uploading data
GPS is acquiring
Receiving location data from GPS
3 more notifications not displayed
Data is syncing
Download finished
New Gmail

Icon
Description
New Google Talk message
New message
Song is playing
Upcoming event
Onscreen keyboard
You can enter text using the onscreen keyboard. The onscreen keyboard
appears automatically on the screen when you need to enter text. To
manually display the keyboard, simply touch a text field where you want to
enter text.
Using the keypad & entering text
Tap once to capitalise the next letter you type. Double tap for all caps.
Tap to switch to the numeric and symbol keyboard. You can also
touch and hold this tab to view the Settings menu.
Tap to insert an emoticon when writing a message.
Tap to enter a space.
Tap to create a new line in the message field.
Tap to delete the previous character.
Tap to hide the onscreen keyboard.
LGL35G | User Guide
Entering accented letters
When you select French or Spanish as the text entry language, you can
enter special French or Spanish characters (e.g. “á”).
For example, to input "á", touch and hold the "a" key until the zoom-in key
grows bigger and displays characters from different languages. Then select
the special character you want.

When you first turn on your phone, you have the opportunity to activate the
network, to sign into your Google account and how you want to use some
Google services.
To set up your Google account :
* Sign into a Google account from the prompted set up screen.
OR
* Applications > select a Google application, such as Gmail > select Next >
select Create to create a new account.
If you have a Google account, enter your e-mail address and password,
then touch Sign in.
Once you have set up your Google account on your phone, your phone
automatically synchronises with your Google account on the Web.
Your contacts, Gmail messages, calendar events and other information
from these applications and services on the web are synchronised with your
phone. (This depends on your synchronisation settings.)
After signing in, you can use Gmail and take advantage of Google services
on your phone.
Google Account Set-up

LGL35G | User Guide
With Wi-Fi, you can use high-speed Internet access within the coverage of
the wireless access point (AP).
Enjoy wireless Internet using Wi-Fi, without extra charges.
Turning on Wi-Fi
In the Home screen, open the notification drawer and touch .
Or touch Application > Settings > Wireless & networks, then Wi-Fi .
Connecting to Wi-Fi
Choose the Wi-Fi network you want to connect to. If you see , you need
to enter a password to connect.
NOTE:
If you are outside the Wi-Fi coverage area and choose 3G connection,
additional charges may apply.
If your phone goes into sleep mode when connected to Wi-Fi, the Wi-Fi
connection is automatically disabled.
In this case, if your phone has access to 3G data, it may connect to the
3G network automatically and additional charges may apply.
The LGL35G supports WEP, WPA/WPA2-PSK and 802.1x EAP security.
If your Wi-Fi service provider or network administrator sets encryption for
network security, enter the key into the pop-up window. If encryption is
not set, this pop-up window is not shown. Obtain the key from your Wi-Fi
service provider or network administrator.
•
•
•
•
Wi-Fi

Connecting to Bluetooth Devices
Bluetooth is on
Connected to a Bluetooth device
To turn Bluetooth on or off
From the Home screen, press the Menu Key .
Touch Settings > Wireless & networks.
Touch Bluetooth to turn the function on or off.
Connecting to Virtual Private Networks
Virtual private networks (VPNs) allow you to connect to resources inside a
secured local network, from outside that network.
To add a VPN
From the Home screen, press the Menu Key .
Touch Settings > Wireless & networks > VPN settings.
Touch Add VPN.
Touch the type of VPN to add.
In the screen that opens, follow the instructions from your network
administrator to configure each component of the VPN settings.
Press the Menu Key and touch Save.
The VPN will be added to the list on the VPN settings screen.
1.
2.
3.
1.
2.
3.
4.
5.
6.

LGL35G | User Guide
Connecting to Mobile Networks
When you buy your phone and sign up for service, your phone is configured
to use your provider’s mobile networks for voice calls and for transmitting
data.
Different locations may have different mobile networks available. Initially,
your phone is configured to use the fastest mobile network available
for data. You can also configure your phone to access a different set of
networks entirely, or to behave in specific ways when roaming.
To disable data when roaming
You can prevent your phone from transmitting data over other carriers’
mobile networks when you leave an area that is covered by your carrier’s
networks. This is useful for controlling expenses if your cell plan doesn’t
include data roaming.
Touch the Applications Key > Settings > Wireless & networks >
Mobile networks > Data roaming.
Touch Data roaming to remove the checkmark from the box. With Data
roaming unchecked, you can still transmit data with a Wi-Fi connection.
1.
2.

Working With Secure Certificates
If your organization’s VPN or Wi-Fi network relies on secure certificates,
you must obtain the certificates and store them in your phone’s secure
credential storage before you can configure access to that VPN or Wi-Fi
network on your phone.
For specific instructions, contact your network administrator.
To install a secure certificate from the microSD card
Copy the certificate from your computer to the root (that is, not in a
folder) of the microSD card.
From the Home screen, press the Menu Key .
Touch Settings > Location & security.
Touch Install from SD card.
Touch the file name of the certificate to install.
Only the names of certificates that you have not already installed on your
phone are displayed.
If prompted, enter the certificate’s password and touch OK.
Enter a name for the certificate and touch OK.
1.
2.
3.
4.
5.
6.
7.

LGL35G | User Guide
Calls
Making a call
Touch to open the keypad.
Enter the number using the keypad. To delete a digit, touch the Clear
icon .
Touch the Call icon to make a call.
To end a call, touch the End icon .
TIP! To enter “+” to make international calls, touch and hold .
Calling your contacts
Touch to open your contacts.
Scroll through the contact list or enter the first letter(s) of the contact
you want to call by touching Search.
In the list, touch the contact which you want to call and tap on the
number or call icon to make call.
Answering and rejecting a call
When the screen is locked and your phone rings, drag the Answer icon
to the right.
Drag the Decline icon to the left to reject an incoming call.
Adjusting call volume
To adjust the in-call volume during a call, use the Volume Up and Down key
on the left side of the phone.
1.
2.
3.
4.
1.
2.
3.

Making a second call
During your initial call, tap .
Dial the number, or search your contacts.
Touch the Call icon to connect the call.
Both calls are displayed on the call screen. Your initial call is locked and
put on hold.
Touch the displayed number to toggle between calls. Or touch Merge
calls to make a conference call.
To end active calls, touch End.
NOTE: You are charged for each call you make.
Viewing your call logs
In the Home screen, touch and choose the Call log tab.
View a complete list of all dialled, received and missed voice calls.
TIP! Touch any call log entry to view the date, time and duration of the call.
TIP! Touch the Menu key, then touch Delete all to delete all the recorded
items.
1.
2.
3.
4.
5.
6.
LGL35G | User Guide
Call settings
You can configure phone call settings such as call forwarding and other
special features offered by your carrier.
In the Home screen, touch the Applications tab to open the applications
menu.
Scroll and touch Settings.
Tap Call settings and choose the options that you want to adjust.
1.
2.
3.

Contacts
Add contacts to your phone and synchronise them with the contacts in
your Google account or other accounts that support contact syncing.
Searching for a contact
In the Home screen
Touch to open your contacts.
Touch Search Tab on the top and enter the contact name using the
keyboard.
Adding a new contact
Touch , enter the new contact’s number, then touch the Menu key.
Touch Add to contacts and then Create new contact.
If you want to add a picture to the new contact, touch .
Choose from Capture picture or Pick from Gallery.
Select the contact type by touching .
Touch a category of contact information and enter the details about your
contact.
Touch Save.
Favorite contacts
You can classify frequently called contacts as favorites.
Adding a contact to your favorites
Touch to open your contacts.
Touch a contact to view its details.
1.
2.
1.
2.
3.
4.
5.
1.
2.

LGL35G | User Guide
Touch the star to the right of the contact’s name. The star turns gold.
Removing a contact from your favorites list
Touch to open your contacts.
Touch the Groups tab, select Favorites at the top of the list and choose a
contact to view its details.
Touch the gold star to the right of the contact’s name. The star turns
grey and the contact is removed from your favourites.
3.
1.
2.
3.

Messaging
Your LGL35G combines SMS and MMS into one intuitive, easy-to-use
menu.
Sending a message
Touch icon on the home screen, and touch New message to open a
blank message.
Enter a contact name or contact number in the To field. As you enter the
contact name, matching contacts appear. You can touch a suggested
recipient. You can add multiple contacts.
NOTE: You will be charged for a text message for every person you send the
message to.
Touch Enter message field and start to compose your message.
Touch the Menu key to open the options menu. Choose from Add
subject, Discard, Attach, Insert smiley and All messages.
Touch Send to send your message.
The message screen opens, with your message after Recipient Name/
Number. Responses appear on the screen. As you view and send
additional messages, a message thread is created.
WARNING: The 160-character limit may vary from country to country
depending on how the SMS is coded and in what language.
1.
2.
3.
4.
5.
6.
Messaging

LGL35G | User Guide
WARNING: If an image, video or audio fi le is added to an SMS, it will be
automatically converted into an MMS , and you will be charged accordingly.
NOTE: When you get an SMS message during a call, there will be a ring
notifi cation.
Threaded box
Messages (SMS, MMS) exchanged with another party can be displayed in
chronological order so that you can conveniently see an overview of your
conversation.
Using Smilies
Liven up your messages using Smilies.
When writing a new message, touch the Menu key, then Insert smiley.
Changing your message settings
Your LGL35G message settings are predefined, so you can send messages
immediately. You can change the settings based on your preferences.
WARNING: In this mode, the MMS Client device guides the user in
creating and sending messages with content belonging to the Core MM
Content Domain. This guidance is provided through warning dialogs.

Opening Email and the Accounts Screen
You can use the Email application to read email from services other than
Google Mail. The Email application supports the following account types:
POP3, IMAP and Exchange.
Managing an email account
In the Home screen, touch Downloads > Email, then select the Email
Service Provider.
A setup wizard opens to help you add an email account. After the initial
setup, Email displays the contents of your Inbox (if you have only one
account) or the Accounts screen (if you have multiple accounts).
The Accounts screen
The Accounts screen lists your Combined Inbox and each of your email
accounts.
Open the Email application. If you’re not on the Account screen, touch
the Menu Key and touch Accounts.
Select the Email service provider.
- Touch to open your Combined Inbox, with messages received to all of
your accounts.
- Touch to open a list of just your starred messages.
- Touch the folder icon to open the account’s folders.
You can touch an account to view its Inbox. The account from which you
send email by default is indicated with a tick.
1.
2.
Email
LGL35G | User Guide
To open your Combined Inbox
If you have configured Email to send and receive email from more than one
account, you can view all messages sent to all accounts in your Combined
Inbox.
Touch Email.
Touch Combined inbox (in the Accounts screen). Messages in the
Combined Inbox are colour coded along their left sides, by account,
using the same colours that are used for your accounts in the Accounts
screen.
Only your account’s most recent emails are downloaded to your phone. To
download more (earlier) email messages, touch Load more messages at the
bottom of the emails list.
Composing and Sending Email
To compose and send a message
While in the Email application, touch the Menu key and touch Compose.
Enter an address for the message’s intended recipient. As you enter text,
matching addresses are offered from your Contacts. Separate multiple
addresses with commas.
Touch the Menu key and then touch Add Cc/Bcc to send copy or blind
copy of the mail to other contacts/email addresses.
Enter the text of the message.
Touch the Menu key and touch Add attachment to send a file with the
message.
1.
2.
1.
2.
3.
4.
5.

Touch the Send button.
If you’re not ready to send the message, touch the Save as draft button
to save it in a Drafts folder. Touch a draft message in a Drafts folder to
resume working on it. Your message will also be saved as a draft if you
touch the Back key before sending it. Touch the Discard button to
abandon and delete a message, including any saved drafts. If you aren’ t
connected to a network, for example, if you’re working in airplane mode,
the messages that you send are stored in your Outbox folder until you’re
connected to a network again. If it contains any pending messages, the
Outbox is displayed on the Accounts screen.
Please note that messages sent using an Exchange account will not be
located on the phone; they will, however, be located on the Exchange server
itself.
If you want to see your sent messages in the Sent folder, then touch the
Menu key and touch on Folders then touch on Sent folder and select
Refresh from the options menu.
TIP! When a new email arrives in the inbox, you will receive a notifi cation by
sound or vibration.
Working with Account Folders
Each account has Inbox, Outbox, Sent, and Drafts folders. Depending on
the features supported by your account’s service provider, you may have
additional folders.
6.
LGL35G | User Guide
Adding and Editing email Accounts
To add an email account, touch the Applications tab and select Email.
Select MS Exchange or Others, and enter account settings.
If an email account is already set up, you need to touch the Menu key
then tap Add account from Accounts screen.
Enter a name for the account, confirm how you want your name to
appear in outgoing mail, then touch the Done button.
To change an account’s settings
Open the Accounts screen.
Touch and hold the account whose settings you want to change. In the
menu that opens, touch Account settings.
To delete an email account
Open the Accounts screen.
Touch and hold the account you want to delete.
Touch Remove account in the menu that opens.
Touch the OK button in the dialog box to confirm that you want to delete
the account.
1.
2.
3.
4.
1.
2.
1.
2.
3.
4.

Camera
Zoom - Zoom in or zoom out. Alternatively you can use the side volume keys.
Brightness - This defi nes and controls the amount of sunlight entering the
image. Slide the brightness indicator along the bar towards “-” to lower the
brightness of the image or towards “+” to increase it.
Scene mode - Choose from Auto, Portrait, Landscape, Sports, Sunset and
Night.
Image size - Touch to set the size (in pixels) of the picture you take.
Settings - Touch this icon to open the advanced settings menu.
Video mode - Slide this icon down to switch to video mode.
Taking a photo
Gallery - Touch to view the last photo you captured. This enables you to access
your gallery and view saved photos from within camera mode.
Getting to know the viewfinder

LGL35G | User Guide
Taking a quick photo
Open the Camera application.
Hold the phone horizontally and point the lens towards the subject you
want to photograph.
Press the capture button.
Once you’ve taken the photo
Your captured photo appears on the screen.
Share
Touch to share your photo using Bluetooth, Gmail, Google+,
Messaging and Picasa.
Set as
Touch to use the image as a Contact icon or Wallpaper.
Rename
Touch to edit the name of the picture just taken.
Touch to delete the image.
Touch to take another photo immediately. Your current photo is saved.
Touch to view the last photo you captured as well as the gallery.
Using the advanced settings
In the viewfinder, touch to open all advanced options.
Change camera settings by scrolling through the list. After selecting the
option, touch the Back key.
ISO – The ISO rating determines the sensitivity of the camera’s light
sensor. The higher the ISO, the more sensitive the camera is. This is useful
in darker conditions when you cannot use the flash.
1.
2.
3.

White balance – Choose from Auto, Incandescent, Sunny, Fluorescent and
Cloudy.
Color effect – Choose a colour tone for your new photo.
Timer – The self-timer allows you to set a delay after the capture button is
pressed. Select Off, 3 secs., 5 sec or 10 secs. This is ideal if you want to be
in the photo.
Shutter sound – Select one of four shutter sounds.
Auto review – If you turn Auto review on, it automatically shows you the
picture you just took.
Tag location – Activate to use your phone’s location-based services. Take
pictures wherever you are and tag them with the location. If you upload
tagged pictures to a blog that supports geotagging, you can see the
pictures displayed on a map.
NOTE: This function is only available when GPS is active.
Storage – Choose whether to save your photos to the phone memory or to
the external memory.
– Restore all camera default settings.
– Touch whenever you want to know how this function operates. This
provides you with a quick guide.
TIP! When you exit the camera, some settings return to their defaults, such as
white balance, color effect and timer . Check these before you take your next
photo.

LGL35G | User Guide
TIP! The Settings menu is superimposed over the viewfi nder, so when you
change elements of the image colour or quality, you see a preview of the
image change behind the Settings menu.
Viewing your saved photos
Access your saved photos while in Camera mode. Just touch and touch
the screen. You then see Slideshow and Menu.
TIP! Flick left or right to view other photos or videos.
- Touch to see a slideshow.
- Touch to share the contents or delete a photo. Touch More for more
options.
Details – Check information on the content.
Show on map
Set as – Set as a contact icon or wallpaper.
Crop – Crop your photo. Move your finger across the screen to select
the area.
Rotate Left / Rotate Right – Rotate left or right.

Video camera
Zoom - Zoom in or zoom out. Alternatively you can use the side volume keys.
Brightness - This defi nes and controls the amount of sunlight entering the
video. Slide the brightness indicator along the bar towards “-” to lower the
brightness of the video or towards “+” to increase it.
Video size - Touch to set the size (in pixels) of the video you record.
Audio recording - Choose Mute to record a video without sound.
Settings - Touch this icon to open the advanced settings menu.
Camera mode - Slide this icon up to switch to camera mode.
Start recording
Gallery - Touch to view the last video you recorded. This enables you to access
your gallery and view your saved videos from within video mode.
Getting to know the viewfinder

LGL35G | User Guide
Shooting a quick video
Slide the Camera mode button down and the icon changes to .
The video camera viewfinder appears on the screen.
Holding the phone horizontally, point the lens towards the subject you
want to capture in your video.
Touch the Record button once to start recording.
REC appears at the bottom of the viewfinder with a timer showing the
length of the video.
Touch on the screen to stop recording.
After shooting a video
A still image representing your video will appear on the screen.
Play
Touch to play the video.
Share
Touch to share your video using Bluetooth, Gmail, Messaging and
YouTube.
Rename
Touch to edit the name of the selected video.
Touch to delete the video you just made. Confirm by touching OK. The
viewfinder reappears.
Touch to shoot another video right away. Your current video is saved.
Touch to view the last recorded video as well as the gallery.
1.
2.
3.
4.
5.
6.

Using the advanced settings
Using the viewfinder, touch to open all the advanced options.
Adjust the video camera setting by scrolling through the list. After selecting
the option, touch the Back key.
White balance – White balance ensures that the white areas in your video
are realistic. To enable your camera to adjust the white balance correctly,
you may need to determine the light conditions. Choose from Auto,
Incandescent, Sunny, Fluorescent and Cloudy.
Color effect – Choose a colour tone to use for your new view.
Auto review – Auto review automatically shows you the video you just
recorded.
Storage – Choose whether to save your video clip to the phone memory or
to the external memory.
– Restore all video camera default settings.
– Touch if you want to know how this function operates. This provides
you with a quick guide.
Watching your saved videos
In the viewfinder, touch .
Your gallery appears on the screen.
Touch a video once to bring it to the front of the gallery. It starts playing
automatically.
1.
2.
3.
LGL35G | User Guide
Adjusting the volume when viewing a video
To adjust the volume of a video while it is playing, use the volume keys on
the left-hand side of the phone.

Preloaded App
There are useful applications preloaded on the Preloaded Apps. To use the
application, you need to install the application to your phone first.
NOTE: Preloaded applications may differ according to your phone’s software or
your service provider.
Gallery
Touch the Applications tab, then select Gallery. Open a list of catalogue
bars that store all your multimedia files.
View mode
Touch Gallery. Folder view is displayed.
Touch any folder and it turns to grid view mode. If you tap a photo, it
changes into full view mode.
Timeline view
LGL35G Gallery provides a timeline view of your photos and videos. In grid
view mode, drag to the right and the date you took your photos is
displayed, starting with the most recent. If you select a specific date, all the
photos you took on that day are grouped.
Music
Your LGL35G has a built-in music player that lets you play all your favourite
tracks. To access the music player, touch Applications, then touch Music.
Multimedia

LGL35G | User Guide
Playing a song
In the Home screen, touch the Applications tab and select Music.
Touch Songs.
Select the song you want to play.
Touch to pause the song.
Touch to skip to the next song.
Touch to go back to the beginning of the song. Touch twice to
return to the previous song.
To change the volume while listening to music, press the up and down
volume keys on the left-hand side of the phone.
Touch and hold any song in the list. It displays Play, Add to playlist, Use as
ringtone, Delete, Details, Share and Search as options.
NOTE: Music fi le copyrights may be protected by international treaties and
national copyright laws.
Therefore, it may be necessary to obtain permission or a licence to reproduce
or copy music.
In some countries, national laws prohibit private copying of copyrighted
material. Before downloading or copying the fi le, check the national laws of
the relevant country concerning the use of such material.
1.
2.
3.
4.
5.
6.
Transferring files using USB mass storage devices
To transfer files using USB devices
Connect the LGL35G to a PC using a USB cable.
USB Mass Storage mode screen will appear, and if you touch Tu r n o n
USB Storage button, your device connection would be recognized by PC.
Open the removable memory folder on your PC. You can view the mass
storage content on your PC and transfer the files.
Copy the files from your PC to the drive folder.
When you are finished, select “Charge only” option to disconnect the
phone.
How to transfer music/video files to your phone
Connect your phone to the PC using the USB cable.
USB Mass Storage mode screen will appear, and if you touch Tu r n o n
USB Storage button, your device connection would be recognized by PC.
Transfer music or video files from the PC to the phone's removable
storage.
You can copy or move files from your PC to your phone's removable
storage using a card reader.
If there is a video file with a subtitle file (*.srt file with the same name as
the video file), place it in the same folder to display subtitles automatically
when playing the video file.
1.
2.
3.
4.
5.
1.
2.
3.
•
•
LGL35G | User Guide
When downloading music or video files, copyrights must be secured. Note
that corrupted files or files with incorrect extensions may damage your
phone.
Sending data from your phone using Bluetooth
Sending data using Bluetooth You can use Bluetooth to send data by
running a corresponding application, not from the Bluetooth menu as on
most other mobile phones.
* Sending pictures: Run the Gallery application, then select Picture > Menu.
Click Share, then select Bluetooth. Check whether Bluetooth is turned on,
then select Scan for devices. Choose the device you want to send data to
from the list.
* Exporting contacts: Run the Contacts application. Touch the address
you want to export to. Touch the Menu key and select Share > Bluetooth.
Check whether Bluetooth is turned on, then select Scan for devices.
Choose the device you want to send data to from the list.
* Sending multi-selected contacts: Run the Contacts application. To select
more than one contact touch the Menu key and touch Share. Select the
contacts you want to send or touch Select all option from top > Select
Share > Bluetooth > Enable Bluetooth and select Scan for devices >
Choose the device you want to send data from the list.
* Connecting to FTP (only FTP server is supported on this handset):
Select Settings > Wireless & networks > Bluetooth settings. Select the
•
Discoverable box so you can search for your phone on other devices. Find
the FTP service and connect to the FTP server.
If you want to search for this phone from other devices, go to Settings >
Wireless & networks > Bluetooth settings. Select the Discoverable box.
The box is cleared after 120 seconds.
•

LGL35G | User Guide
Setting your alarm
In the Home screen, touch the Applications tab and select Clock.
If you want to add a new alarm, touch and select Add alarm.
Set the time to turn on the alarm. After you set the time, the LGL35G
lets you know how much time is left before the alarm will sound.
Set Repeat, Ringtone or Vibrate, then add a label to name the alarm.
Touch Done.
NOTE: to change alarm settings on alarm list screen, touch the Menu key and
select Settings. You can adjust the below options: Alarm in silent mode, Alarm
volume, Snooze duration and Side button behaviour.
Using your calculator
In the Home screen, touch the Applications tab and select Calculator.
Touch the number keys to enter numbers.
For simple calculations, touch the function you want (+, –, x or ÷) followed
by =.
For more complex calculations, touch the Menu key, touch the Advanced
panel, then choose sin, cos, tan, log and so on.
Adding an event to your calendar
In the Home screen, touch the Applications tab and select Calendar.
To check the event, touch the date. Touch and hold if you want to add a
new event. Touch New event.
1.
2.
3.
4.
1.
2.
3.
4.
1.
2.
Utilities

Touch What then enter the event name. Check the date and enter the
time you want your event to start and finish.
Also, touch Where then enter the location.
If you want to add a note to your event, touch Description and enter the
details.
If you want to repeat the alarm, set Repetition, and set Reminders, if
necessary.
Touch Done to save the event in the calendar. A coloured square in the
calendar marks all days that have saved events. An alarm sounds at the
event start time to help you stay organised.
Changing your calendar view
In the Home screen, touch the Applications tab and select Calendar.
Touch the Menu key.
Select the calendar view for a particular day, week or month.
Voice recorder
Use the voice recorder to record voice memos or other audio files.
Recording a sound or voice
In the Home screen, touch the Applications tab and select Voice
Recorder.
Touch to begin recording.
Touch to end the recording.
3.
4.
5.
6.
7.
1.
2.
1.
2.
3.

LGL35G | User Guide
Touch to listen to the recording.
NOTE: touch to access your album. You can listen to the saved recording.
Notice: the available recording time may differ from the real time.
Sending the voice recording
Once you have finished recording, you can send the audio clip by
touching Menu > Share.
Choose from Bluetooth, Gmail Messaging. When you select Gmail and
Messaging, the voice recording is added to the message, then you write
and send the message normally.
Polaris Viewer
Polaris Viewer is a professional mobile office solution that lets users
conveniently view various types of office documents, including Word, Excel
and PowerPoint files, anywhere, anytime, using their mobile devices.
Managing files
Polaris Viewer provides mobile users with convenient file management
features, including copying, pasting, renaming and deleting files and folders
right on the device.
Viewing files
Mobile users can now easily view a wide variety of file types, including
Microsoft Office documents and Adobe PDF, right on their mobile devices.
When viewing documents using Polaris Viewer, the objects and layout
remain the same as in their original documents.
4.
1.
2.
App Manager
You can manage your applications with App Manager. You can easily check
the number of currently running applications and shut down applications.
You can also uninstall the applications you have installed on your device.

LGL35G | User Guide
The Web
Browser
Browser gives you a fast, full-colour world of games, music, news, sport,
entertainment and much more, right on your mobile phone. Wherever you
are and whatever you enjoy.
NOTE: additional charges apply when connecting to these services and
downloading content. Check data charges with your network provider.
Using the web toolbar
Touch to go backwards one page.
Touch to go forwards one page to the one you connected to after the
current page. This is the opposite of what happens when you press the
Back key, which goes to the previous page.
Touch to show all your open windows.
Touch to add a new window
Add/show bookmark and show Most visited, Read it later and History.
Using options
Touch the Menu key to view options.
Read it later – Add the current web page in read it later.
Add RSS feed – Add the current web page to the RSS feed.
Share page – Allows you to share the web page with others.
Find on page – Allows you to find letters or words on the current web
page.

Select text – Allows you to copy any text from the web page.
More
Home page: Go to the Home page.
Set home page: Set the current web page as your Home page.
Add shortcut to home: Add the shortcut of the current web page to the
Home screen.
Page info: Displays the web page information.
Downloads: Displays your download history.
Settings: Change web browser settings.
TIP! To return to the previous web page, press the Back key.
•
•
•
•
•
•

LGL35G | User Guide
In the Home screen, touch the Applications tab then scroll to and touch
Settings.
Wireless & networks
Here, you can manage Wi-Fi and Bluetooth. You can also set up mobile
networks and switch to airplane mode.
Airplane mode – After switching to airplane mode, all wireless connections
are disabled.
Wi-Fi – Touch to select: This turns on Wi-Fi to connect to available Wi-Fi
networks.
Wi-Fi settings – Allows you to set up and manage wireless access points.
Set network notification, or add a Wi-Fi network. The advanced Wi-Fi
settings screen is accessed from the Wi-Fi settings screen. Touch the Menu
key and touch Advanced.
TIP! How to obtain the MAC address
To set up a connection in some wireless networks with MAC fi lters, you may
need to enter the MAC address of your LGL35G into the router.
You can fi nd the MAC address in the following user interface: Touch
Applications > Settings > Wireless & networks > Wi-Fi settings, and touch
the Menu key. Then select Advanced > MAC Address.
Bluetooth – Touch to select: This turns on Bluetooth to connect to
Bluetooth devices.
Settings
Bluetooth settings – Set device name & discoverable mode, scan for
other devices. Or, check a list of Bluetooth devices that you’ve previously
configured and those detected when the phone last scanned for Bluetooth
devices.
VPN settings – Displays the list of Virtual Private Networks (VPNs) that
you’ve previously configured. Allows you to add different types of VPN.
Mobile networks – Set options for data roaming, network mode &
operators, access point names (APNs) and so on.
Call settings
< Fixed dialing numbers >
Select Fixed dialing numbers to turn on and compile a list of numbers that
can be called from your phone. You’ll need your PIN2, which is available
from your operator. Only numbers within the fixed dial list can be called
from your phone.
< Voicemail >
Voicemail service – Allows you to select your carrier’s voicemail service.
Voicemail settings – If you are using your carrier’s voicemail service, this
option allows you to enter the phone number to use for listening to and
managing your voicemail.
LGL35G | User Guide
< Other call settings >
Excuse messages – When you want to reject a call, you can send a quick
message using this function. This is useful if you need to reject a call
during a meeting.
Call forwarding – Choose whether to divert all calls, when the line is busy,
when there is no answer or when you have no signal.
Call barring – Select when you would like calls to be barred. Enter the
call barring password. Please check with your network operator about this
service.
Call reject – Allows you to set the call reject function. Choose from Off,
Reject on list or Reject all calls.
Call costs – View the charges applied to your calls. (This service is network
dependent; some operators do not support this function)
Call duration – View the duration of calls including last call, all calls, dialled
calls and received calls.
Additional settings – This lets you change the following settings:
Caller ID: Choose whether to display your number on an outgoing call. (This
service is network dependent; some operators do not support this function)
Call waiting: If call waiting is activated, the handset will notify you of an
incoming call while you are on another call (depending on your network
provider).
Sound
< General >
Silent mode – Allows you to mute all sounds (including call and notification
ringtones) except the audio from music and videos and any alarms you
have set. You must mute media and alarm sounds in their own applications.
Vibrate – Allows you to set your phone to vibrate when you receive an
incoming call.
Volume – Allows you to set the volume for ringtones, media and alarms. If
you deselect the option to use the incoming call volume for notifications,
you can set the volume for incoming calls and notifications separately.
< Incoming calls >
Phone ringtone – Allows you to set your default incoming call ringtone.
< Notifications >
Notification ringtone – Allows you to set your default notification ringtone.
< Feedback >
Audible touch tones – Allows you to set the phone to play tones when
using the dialpad to dial numbers.
Audible selection – Allows you to set your phone to play a sound when you
touch buttons, icons and other onscreen items that react to your touch.
Screen lock sounds – Allows you to set your phone to play a sound when
locking and unlocking the screen.
LGL35G | User Guide
Display
Brightness – Adjust the screen brightness.
Auto-rotate screen – Set to switch orientation automatically when you
rotate the phone.
Animation – Set to display an animation.
Screen timeout – Set the time for screen timeout.
Location & security
Use wireless networks – If you select Use wireless networks, your phone
determines your approximate location using Wi-Fi and mobile networks.
When you select this option, you’re asked whether you consent to allowing
Google to use your location when providing these services.
Use GPS satellites – If you select Use GPS satellites, your phone
determines your location to street level accuracy.
Set up screen lock – Set an unlock pattern to secure your phone. Opens a
set of screens that guide you through drawing a screen unlock pattern. You
can set a PIN or password instead of a pattern or leave it as None.
When you turn on your phone or wake up the screen, you're asked to draw
your unlock pattern to unlock the screen.
Set up SIM card lock – Set up SIM card lock or change the SIM PIN.
Visible passwords – Select to show passwords as you type them or deselect
to hide passwords as you type them.
Select device administrators – Add one or more administrators.
Use secure credentials – Allows you to access secure certificates.
Install from SD card – Choose to install encrypted certificates from your SD
card.
Set password – Set or change the credential storage password.
Clear storage – Clear credentials for all content and reset password.
Applications
You can manage applications and set up quick launch shortcuts.
Unknown sources – Default setting to install non-Market applications.
Manage applications – Manage and remove installed applications.
Running services – Check services that are currently running.
Storage use – View storage used by applications.
Battery use – See what has been using the battery.
Development – Set options for application development.
Accounts & sync
< General sync settings >
Background data – Permits applications to synchronise data in the
background, whether or not you are actively working in them. Deselecting
this setting can save battery power and lowers (but does not eliminate) data
usage.
Auto-sync – Permits applications to synchronise, send and receive data to
their own schedule.
LGL35G | User Guide
< Manage accounts >
List of all Google accounts and other accounts you’ve added to your phone.
If you touch an account in this screen, its account screen opens.
Privacy
Change the settings for managing your settings and data.
Back up my data: Set to back up your settings and application data to the
Google server.
Automatic restore: Set to restore your settings and application data when
the applications are reinstalled on your device.
Factory data reset: Reset your settings to the factory default values and
delete all your data. If you reset the phone in this way, you are prompted
to reenter the same information as when you first started Android.
Storage
< Internal memory >
Check total available internal memory space. Touch Erase internal memory
if you want to delete all data from the internal memory.
< SD card >
Check total available SD card space. Touch Unmount SD card for safe
removal. Erase SD card if you want to delete all data from the SD card.
< System memory >
Checks the available space.
•
•
•
<USB connection mode>
Allows you to turn the Mass storage only mode.
Language & keyboard
Set local language and region as well as keyboard settings.
Voice input & output
< Voice input >
Voice recogniser settings – Use the Voice recogniser settings to configure
the Android voice input feature.
Language: Opens a screen where you can set the language you use for
speech to enter text.
SafeSearch: Opens a dialog where you can set whether you want the
Google SafeSearch filter to block some results.
Block offensive words: When deselected, Google voice recognition will
recognise and transcribe words many people consider offensive, when
you use speech to enter text. When selected, Google voice recognition
replaces those words in transcriptions with a placeholder comprised of
star symbols ( * ).
< Voice output >
Text-to-speech settings – Use the Text-to-speech settings to configure
the Android text-to-speech synthesiser for applications that can use this
feature.
•
•
•
LGL35G | User Guide
NOTE: if you don’t have speech synthesiser data installed, only the Install voice
data setting is available.
Listen to an example: Plays a brief sample of the speech synthesiser,
using your current settings.
Always use my settings: Tick to use the settings on this screen in place of
speech synthesiser settings available in other applications.
Default Engine: Opens a dialog where you can set the text-to-speech
application you want to use, if you have more than one installed.
Install voice data: If your phone does not have speech synthesiser data
installed, this connects to Android Market and guides you through
the process of downloading and installing the data. This setting is not
available if the data is already installed.
Speech rate: Opens a dialog where you can select how quickly you want
the synthesiser to speak.
Language: Opens a dialog where you can select the language of the text
you want the synthesiser to read. This is particularly useful in combination
with Always use my settings to ensure that text is spoken correctly in a
variety of applications.
Pico TTS: Configure the Pico TTS settings.
Accessibility
Use the Accessibility settings to configure accessibility plug-ins you have
installed on your phone.
NOTE: requires additional plug-ins.
•
•
•
•
•
•
•
Date & time
Use Date & time settings to set your preference for how dates are
displayed. You can also use these settings to set your own time and time
zone rather than obtaining the current time from the mobile network.
About phone
View legal information and check phone status and software version.