Midea Kitchen Appliances E1028NX-Y Microwave Oven User Manual
Guangdong Midea Kitchen Appliances Manufacturing Co.,Ltd. Microwave Oven Users Manual
Users Manual
Glidea” Microwave Oven INSTRUCTION MANUAL MODEL:E1028NX-Y Read these instructions carefully before using your microwave oven, And keep it carefully for future reference. If you follow the instructions, your oven will provide you with many years of good service. SAVE THESE INSTRUCTIONS CAREFULLY PRECAUTIONS TO AVOID POSSIBLE EXPOSURE TO EXCESSIVE MICROWAVE ENERGY (a) 00 nm attempt to operate this oven with the door open slnce this can resull In hannlul exposure to mlcrowava eneroyrll Is unponanl no! to break or larnpar wllh [he salely Inlerlocks. (b) On nol place any objecl belween Ihe oven lronl lace and the door or allow soul or cleaner residue to accumulate un sealing sur'aces (c) Do not upon“ nu ovon II I! II damn“. I! I; particularly Import-n! that mo ovon door clolu proporly and that m". I: no dimly. Io Inc: (I) DOORNQHI) (2) HINGES AND LATCHEMbrokon or loosened) (3) DOOR SEALS AND SEALING SURFACE (1.1) “I’m man should no! he “muted or ropalnd by nnyonc “up! proporly quallflnd unlu pomonnol. SPECIFICATIONS _lm_ [WW—_ 1 The oven mun be on 5 stbd suites 2 Tummwmmwumummbmmmwmmw. Placomt cunkwamqelflymmfimlnleandhmdlencavdulywavod passiblebeakaoe 3 insurer-1 mu! Mommas-may mmlhe tunable lo break 4, Use only lhe specified hag sue when who Died Access Phenom 5 The oven has several but-h “My witches lo mum lhal the power remain on when memmpm DomumwmmmMcm, 6 Dondapuflnthnmlcfmavawmm. Operallngtmmnwlhnnhodnrlnodmfl Ismrsmwlow mmflmnunmumAwnmasm, 7 Dommnacmmmm-lmm. Boomwbcdhlmuollholunllbb may cause molunubblo bad I. Donuhmbnbymovhbyloodmnnmlmmflnm Molina Innocent-ml not“ umphyuedlnfly. I. Domino-Imus“ Wm ludiuqmphoflln 10. 00 not 011mm Io duo-Ivy In you! WW won 11. Domnemmmmmmhmismmnwmmflismhlobeunaal comemsolmejuhau reached boilnqtenwfiure 12. Donumnmhniawawovm hrcammu‘dpurpou TIisquowavac-venism hhwsehdd useonly 13. To wavml dehyfid «upm- bolllno n! hul lqult and may“ a scam-g yours-I1. filmdbelomplflngmeeomamhmewmmdagamhalmmughcmv mu. Lu mm In In. ovm tor a m lint and a: noun bolon mnwm 1h. mnlalnw. 141mammmmmmmmwmmmdhwmdmwum cookInq whon cooking loco mi. 151 Mm (he wall-m It moral-d In rho cannula" mom. uhIIdnn should only nu ma wan under adult swan/Isiah cu- tome I-mpaaluru oenuabd 16. Foilun Io muslin ma oven In a den oond'tion cow Ind lo mum 0! me who: Ihfl could amuse” HM the lift 0! the awianca and [Jo-um rerun in a hazard“ “union. Important Safety Instructions WARN|NG_ Toredwelher'skotthetlre.eledrlcshook irriuryio perm. or exposure to massive "mt/G oven energy when using your appliance. lollow basic precautions. including the tollowlng. 1. Read all instructions betore using the eppienoe 2. Read and folw the specific" PRECAU- ‘I'DNS YOAVGD POSS“ EXPOSURE TO EXCESS“! MCRONAVE ENERGW‘ 3. As with most cooking appliancesetose umervision isneoeesery to reduce the riskotslheintneovencavny "mush holds them Ignite: 1 Keep the oven door dosed 2Tumtireovenotlandmpbgthaawfime JDisconneuthepomrachneorciM breakermnel Keeptnnlndthehlrniunlselditme: IDOnclweroodtbod. Carehliyahrdme mmeapbh‘oordhamm wenlmfiphadudelhewmlo mm" coding lOornmethemencwilybstxegepu- prses Domain-smears“- washedmosspaoerproamnc. Insidemeoven Itmwsvikesmpomr Melina/enmeytunonhylseif 3.Removewtetwfl-iiesmd meialmndls imrnpsosrorptuiccomhsrs/beosodore piecinomemhthecmn immnnflbemllbd.cmredcfiy bwopetywnmdedormet Seem EIGNTRIM'IW. 5 knell or Melissa/snotty in mm mmnmmmbmpwm 6, Some products such as whole egos. water with oil or let. sealed containers and closed glass pars are wle to explode and theretore should not be heated in this even 7 Use this appliance only lo! ls intended uses as described in the manual. Do not use corrosive chemicals or vapors in thrs applance The oven 5 speafioaliy designed to heat or cook food, It is not designed tor industrial or laboratory use a As with any appliance dose supervision is necessary when used by children 9. Do not operate this man il It has a canned cord or plug. If it is not working properly or it rt has been damaged or dropped. 10. This ”Mm should be serviced only by warm-4 mm tedrnlclans. Corn-ct the new“ authorized service tacllly lor enmin-loruwdr or equetrnent. 11, Do not cover or block any vents on the oven . Do not store or use this appliance outdoors. Do not use if“ oven near matador erranple. near a kndren sink. n a we! basement. near I summing pool. or similar locations Do not immerse cord or plug in water Keep cord away trorn heated surfaces 00 not is! com hung over edge oi labia or counter. . When cleaning door end oven surfaces use only mild, nomhrestve soaps or detergents applied with a sponge or toll cloth. 14 15 16 SAVE THESE INSTRUCTIONS Ia‘Liqulds. such as water. calfee, or tee are ablnnhowmuedbeyondmemeo ll Minimum-twinned. Mmmwmulobeboifing Vebl- I) sum-o lquld m Men-ml My manna of boiling M the comma us through mm It. removed from the Inimave oven is mt II) 00 mt uu might-sided cont-hm Ways present THIS COULD RESULT IN wlh 7mm nod“. VERY HOT UOUIDS SUDOENLY BOILING N) Mot honing. elect the cumin" to OVER WHEN THE CONTAINER IS DIS- Mhflnmbmovmfwem TURBED OR A SPOON OR OTHER UT~ tine Mon mm“ the com-her. ENSIL ls INSERTED INTO THE LIQUID v) Datum. cln when hurting a mammmmmnm To mduunnmlnflnhvyte perm: Groundlng Installatlon DANGER mmmmum mummwnww MWWMM ammonumu whine WARNING ammum mwmdmumw mnmlmeledrtmoo mmmmmmfl wince Is WM hflded and grounded Tune-amend (em-elm) M g. Q] Prop-mm“ grounded m Utensils Thisaophemelmslbegum‘ed Inlheeveclo'anelec— ulcal um cam-1 aroumm moms me m a! sham mockby Mnomesmpewielbflmeledmunml TNswpfience‘sequhpedvanecordhuwveww-dhg Mreuhaomumm Thu-tug "ml buduualdno an oullel that as 910wa mulled and wounded Cmsuteqmfiedebcmdmummmnmwwnd- mmwmaenoImpuwmmmuudw eulstsas In whether the appiancelspmpeny gunned, Nismssevylomanulmmwd, uoeonIynS- wire mason warm has 3-an wounding plug. nudes-alarmemadematmlaocepllhephnonme I A that pom-supply cord ls provided In reduce m- flsks resulting 1mm Mug mmbd in CI ulppmg ever a law card 2‘ Longer 00rd sale or extension com is provided to reduce the risks reemmg from became evlnnubfl huumov-almuevm. 1 II a long can] ms or exlmsion cord 5 used: “The matted electrical raw at I». cord so! or extension deIdbou Nascent ulhedoaflcalrflnu ol the aoplunce 2)TM end-moon com man be a mmnflno—type J—wie cud md 3)The longer curd shouldbememedsathmilwfllmlfiepewetme coumer [up or tabletop where l cm be pulled on by Mm or "oped M mlmemomly. mmmmmmm-Mumwu anm-lnmwmuwuawmlnmo wmwvnTMemyhoeMmmmllcmmfls CAUTION Mnmnduhlnmehmlmmaving Ilhdnuu, Pmmumyum voucmlmmwhnulmqummm- Tightly-dosed ("Hails proud" below WWW“ mun-mm: mmmw 1. Flt-mluwwe-sdecommuwifinupdcold m' m1m-xnamummmmihmm. lmmmlflmmhlm, namwmum‘nmmwhm. soc-museum mlcmwavecoomlg LDonolexcaodlmlmncoonthn Material- you can an In mlcrmnvo ovon Una-lo Mum Inger” Mme-l unedmcweflhnpnm mam crponlrylopvwcmwmwohu Mmmrflbflhwduoh mw‘mmumubeulewhmmlhm tantalum-nus Emai- mmawslm.memndbrmringdlmnwbom lean walru- (5mm) above the unable knot-ed wage my case lb- mbh lo trot Dill-Nun “confide my, Follow mmfm'ar‘s mutton; Do nu me am or mlpped dies, Gin-jun Nmrumovalid Lhaonlyhoheauuodmfllwwm‘mdmm mndhaelrcsislanmdmg‘break Gian- Hes-feds!“ wen was only Mae sure men us nomel‘allc mm 00 nd us- uacksd “WEE dims. Menuhin Folmrmmnhm‘s um. Donn clou within-fine. Mam filth h!- m sum to asap. Poor pm Use 101 M 4am anathema-inn only Do nut lean wen manor-fled We Mean manna Pmrbwdt Unmcnv-bodbrnhoaimudmfimht Unfinflwfimhu Mism- M om Paul-um Unuambwwmldmwswapbflaamm W'— PIS!“ Wave-ado my Felon Ihe "Walls“ Inl'mdm MIG be new ‘Muonnwsafle' mmaficmmmnamwmmmm ‘Bcl'lngbaul‘md Hgmydmodpladicbawmbulimlmdormhd udmdadbypnm‘ Pink“ Mammal-mu Unluawvrfooddu'rvmmmhmmon ndflongaflicmhmlwd mm "mm“- M gmefl n! car-11mg. Nuna- Useaambwmlwmwmdnnwure Materials to be avoided in microwave oven Ulenele Remake Aluminumlrfl Mal cause arcm! Trane'ev (nod mlo mlcvowava-sale dish Feed cello!- with May cause nrclnq Transler mm! mm mlcvowavaanla duh MM!— Ilenl 07 Ml- Muta! molds the food fvum meta-rave energy Mela! mm may cause mm men-Ill wag Ila-lull"! May cause ammo; and coma cause a live In the oven P. of be e Ma cause a five In the ovun HM: lean Plains ham may men or comammsle lhe llama name when exposed 10 high lempamlure Wood Wood will! dry on when used m the Newman uven and may tplll or cvack Names of Oven Parts and Accessories Remove the oven and a! malevlds from the canon. You oven comes mm the lamina accessories Glass key | A Tumlabu mg assemNy I Infludlon Mama | G Abcomlni pamu BWumiabie 5mm Cflumlaue ring assembly mass: may momentum window F) Dow assembn G)Saraly unulocl system snulsoflovon powfldnovisopsned dumopsralion TURNTABLE INSTALLATION a Mannequin/mm“: “Walkman-ennui h amgamnymurmbmmmmm mama-maxim c All 1000 and commute 01 lood I. always placed mmmmhm amgasva/rmmamsarunu e "WWUMMWMUMW Huhlundefslde) Glass tray —”'\‘ - D " {IN Turntable shall—- mmmmwfi Tunable rlng asembly Installation Remove al paclmg masrial md movies Exnmma the oven lor any danaoe such as dsnborbmltmdmr. Datum ifavnnis damaged Countenop Cahlnal: Rmve any molecule flm lound Installation 1. Salecl a level surface (ha! pmvlde enough open space lof lhe Inlake mdlov outlet venls. A ninlmum clearance of 3.0 hch (7.5cm) ls mind Mean lin- oven-d any “can! MOM ald- muu be open on me minst surface Do not remov- lha llfln him Iloa nova! "m I. amend lo the oven cavlty to voted m- mu (1) Lame l mflmum elm 0112 Indllsncm) above the oven. (2) Do not "move on no; "om m- bolbm of the oven. (3) Gleam lhe nah. and/a «Mop-films can dam. the oven (4)Place the oven as lav away lrom radios and TV as possuble Opaauofl of mmm man may also ill-1m lo you radlo or TV ream-on, 2. Pluoyouonnmaswmhmmhold ouuet Begun-nono- and me fiemancyislhesaneasllfivolaoemd I’lelrequemyonlhorahnglabel WARllllG: Do not mun oven on! a fence coolaop 01 other noel-woman appliance ll Installed could be mood and the mummy mead be volfl 1. Pmr Luv-l Tan puns levels as available Remarks: When a power between level 108 u choc-ch ma man Iovol mulcalov ls lumen and l wlll flash ncparauon. When a power belwsen level 7-1 ls choown, the low level ndlcalnf ls lghlsd and It will (lath nonunion 2. Operation and Function 1)‘ Clock smug Wm mo mumm- men as Woo-d mo an outlet. the own wll dlsplay 1100 mm“ ‘M' LCD ml display 00 00, clock mdlcaov MI be llulled The hcu llguas will flash, ' ' am "0' WI! be lohled - l2l Press the nmnenml pads to lnpul mom hut, mm the lm hour wul b. flashing. Press me nu'nencal pads lo lnpul lower now. than the highs! mlmnes will be flashing Press the hummus! pads to Input who! nlmulos. lmn mo loom mum-s will ht flashing Pless Illa numencd pads lo lruul lone mlnulas (3) Puss ’-“locllooso AM 01 PM AM or PM ml by ulsclod m “In byuesunu mo hullon nl ‘AMIPM‘ continuously and ‘A" of 'F" M! be displayed In tum (4) Press ‘M'Wolmlsh M 50mm, and mo claw lndlcaov ml! 00 out ”“ well be flashing md Illa clock will be llglllad l5l I1 mo nunbars npul u. ml mm" m- rano- of 1'00—l2 59, In selling wlll bu malld unlll valld nunbers are input Note“ Inlho pmassoldock “mug lulu-“n" mm unless-d u firm-ism npetatlnn wllhln 1 mlnme‘ the oven ml go back lo an (my selling aulcmallcaly 2). On: Pow Cooklnn “map on gum '-' lo woos. mam/av. power The mamas for "MICRO' and TOWER' wl be bghled toughen 12) Press nunulul pads to Input lhe cooking tine. the maximum making [me In 99 minutes and 99 seconds 43» Press "m lo nan making and lbs remamed cnoklng mne will be displayed ' ' and the Indicators lot MlCRO' 'POWER' will be flashing 3). Two Slag. Cooking (1)Kuponpvesshg'—' lochooumpownrbvellulhofimwokhgum. indizdms lcl ‘MICRO‘ and “POWER" Ml be lighted togdha (2)Pressnuneiulpedshi|punhsllmhrlhefimamfing Thenuxinmcoddngium isQanutesmdggseeon-is (3) Keep on plasma '-' to choose mine! 2, “MDCRO' and "POWER‘wl be Ilghladloqamer, (4) Press nmlelral pads to npul he would mokirv fine. lhe maximum nookhg time Is 99mlmnesand99seemds (5)Press'-“|onanoooum.wummmmmmwwrr and Imlcltas kl MCRO'. 'POWER' wll be Hashim, (6)()e'bsep"wlllbem|dmn “Wm“,ammlhflmdmfl boon, "Insulating ("Inwalmgfiadejnsmoodtiualtooqepowetlevelunbefiafladbysebulnua cookhgmntran onuo rm mnutos mummespmdlno immanent pad. Puss '-'lomeaseIneoookhoumJMmumunooounonmvlswm-mnnm ODmrus (2)Inwaitmnum4ms'ancooklual10096mbvolwlh30uwws'ooouwlman mamwM'-' Eschwmonmwbunmwflmmwohw umbywuconds mummmnwmmmwm None:smumm"owSEC"mmsasen-amokmnywmmhmmum Mommas-sot“; However fianperalnnwillndmku'dsi'mbdrmropam 5). man; By mm Function (1) Press '_1 LCD w-n May mew, man 31th am: - lino hamlets In! “MICRO“. 'DEFROST' MI be thlsd (2) Press nml pads to i1pul melon in be ddmsiad, 'Ot' Infield! wi he HM. input m. mm rmaod human 440001 (3) It the new“ Crow! u no! wmm 4-100. mo mom will ho Imam No “beep" ml b. sound and m. mm wll no! wort until mid numb." at max (4)Prass'_”loslm defifimwmeralmdmoklnqmflbedispla'yedv "' and MIG-tots hr MCRO' and ”DEFROSTING' wil be flashing Md mo 'Ol" mm M! 90 ca C). Dimming By Tim. Function (1) Press --.— LCD v.- display 15:21” me same - ml indicators for Wile”. ‘DEFROSV wil be horned (2) Pros mini pads in npui detracting time The mam limo rang. Is 0001-0099 (3)I1iha l'lne firm! is nol within 00.D|~99‘99, m ‘beep' will be Gould and Illa oven wil nol work until valid numb-r: lro Inoui. (I) The default nicrmvo power is power level 3 "you wan wcnanpeihepowar level. press "_" ml and the LCD will display ‘PL 31 men press the numerical pod oi the power lovol warned (5) Press '-" to nan mum The remained cooking time will be disphyedv and indicators for "MICRO' and ‘DEFROSTING" will be Hashim. 7). Auto Menu Cooking (I) Press matdilng billion in dioceeAmoMenu subject, sndai lhe sumei'lm ‘AUTO 000K" md indicalorfor ‘MICRO‘ will b. lighlod Keep on pulsing (he "Inching bmon lo anon mo mom or “may. “01“ or "mad indicators m be Imod lemma. (2) Plats ‘-" to 51:1 cooking, and lhfi mma'l'ied cookiiq hm Iii be displayed. ‘AUTO COOK' and 'MICRO" indicators will be flashing WM B).MomoryFundion (|)Press'_"lnroneiofrvelimeslocnoosememoryiiomemorys ‘1'io'5" nmdsumd. (2) Sela cooking program and press ‘-" in shame cooking or press "_" iosaveihe‘_'setfmg Two slaoapowaroooiunqprooramcanusobaw linsamway Wun'_'upmsndihnmmwlltunmm|tnwaiiw filament pregamsavodmllbnopcmodamen bypassing '-'A Note Memycuokimcmbeusedascooiung programs In preset cooking. Iilnine proacsoiprocetmg,mycomnpmoramssmalmmnmtorwoooklno pmgremem bereoemeuamrhe pro-set lime will nni be recorded 0). Pro-“t Funclion (”Sou cookimorogramwum. (2) Press '_“ to display the outer! clock. "clock" lmter n be Behind and me "gnu hour Indicator wil be flashing. ‘z‘ and oihcr "0' ‘3 will be nomad, (3) Pros me numerical path to Inpui higher how. and iha Irma now will be Hashim, (1) Press the numerical pads lo inpui lower how. and the highs minum we! be Hashim: (6) Puss in. numomal pads to input higher iii-misc and in. law-r minus. will b. fluling 10 (6) Press the funnel pads lo lmullowar mlmln, and pm: "-' In confirm inn pin-u! cooking Tho oven will in." mm m to in dock tallying mic. ammo clock indiumand"wiiibonasm, mwriuilmiarmutmunacnod, twohanllbeswnddonmiMboolnnmol inemoking, Nola: Thaclockmusibosdbfioreim wmoookinq "Mocoohng manhunt banalmomypro-ullirmhashoonpvoomwndJlnov'nmonlybtuudasan alarmclockandllve'beep'vdlbesoundmmihapvs-utllmelsmadied 10). lnqulrlng Funcflon (1) In dock M0. wm'_' lo display "A' or 'P‘ In! 3 mum. (2) In cooking state. was; "-'. the LCD Mil dsplay dock lot three moms and “A" a‘VvdlbedspluyedfaundI-erilseeonds (3) In mm m. LCD will display In. clodz and m. seconds Mi in ihshing ll m. samt lino. Press '-‘ and "A" or "P" will be displayed for 3 seconds Then press "-" b inquiro lilo pro-u! limo rm pro-u! limo will ho lint-no lot 3 seconds. lhon'A‘or'P"wilbeflhplayedkramMSseooim,Ma|Mngovmwilltwn Didi lo the dock ital. (4) In "none powereooking sue, press"_' in Inquiie niuowavo power level, and mo alum micron/av. pow-l will be display“ M0! thin «coma, lho oven Mil Illn back lo the ptvvious ml (5) Inlheiwosiaoepawercooimgslae. itanulmwayanbeéonelflmesanewayas Mt 11). Lock-out chflon lot Chldron Lock: In waiting slain. press '-' for 3 seconds, there up! be a long "been“ denotlnq entering lmo me diluen lock-om sine and LCD will display ‘ ' Unlock: In locked Eda. press'-' lor 3 wounds‘ Mwlll baa Iong'boeo' denoting Mlholodiisnbmd. 12). Fan Pro-long“! Probation Fundlon ii m- oaoking rim. is oqual lo a abu- 5 minutes, lot lb. int 15 "was. in. mm cooling WI In slowed madly and only the lan Will be still cooking 11 13). Mum-Ill: Oolng om Funcllon Whon IM 6001 a mi oven. Ibo oven light will be on and will go on womanly wilt-out any operation 101 10 minus: 14). coolung End Romlndlng Function When cooking am. more will be 5 'boop‘ amid. a nmlnamg m0 compioinon of cooking 15). Dllplly Spoclfiuflon iii In walling stats . LCD will dspiay dock and "' wfl noiilash (2) In finale" who am. LCD ml tfisphy the “land noting (3) In lino ooomion and suspondinq suit LCD wil display iin venous! cooking ml (4) In (In ovulation ov suspending sale 01 man the door ls coon. tru flashing ‘Mmd' Ind-lie! will be lighted and [M Infill wil be hiring when he oven Is mad, 12 Trouble shooting Radm and TV recepllon may be lnterlered when Microwave oven lnlerlering microwave oven |s operauon It is similar to the TV reception inlerlefence of small electrical appllances , like ITIXBT . vacuum cleanerand eleclnc lan ll IS novmal Dlm we" light In low powev mlcrowave cocking . oven bght may become dim Il vs mfmal In cookmg , seam may come out 01 low Most wtll come out from vents But some may accumulate on cool place |IK9 oven [1001 It IS normal Oven started acmdemalry It does no damage to oven I! It operates empty for wnn no load ln mute short (me But I! should be avolded Steam accumulating on raw, not an out of vents dwwmm Gum mom-ma "thumb-M ”Mr-mi m (5) alumna-n” 09.“ “I: mmmmnfimhmmwu lash-Hyman.” Mbm-tumd‘ymm muwmmwm 13 NOTE 1. ”manhuummwhw In". 1. Mmbmwflhwwmflhwufid an I. mmmmmmmwnmm l. mmdwhfi-flflquh—hhflwhfl fimlhwa-Mhuflhflm l Mhmflhmmhmimbflmd mama-nun“. mtlhmhmmwleG-lhmul" mummmnmdnwm ”magnum-mm zwumuuuwfluwnm mummumnmuubmum nanmnwmm-uwm lll’hmmiwjmdhwbynmw luau-HI uMWmhmIM-m l ”lulu-H. mum“. 4mm” v- H v, Nun.” [In llhllulw -1\w4\||"| ' u mllv' -HI ul‘ In.1|\nu|u-|m - 1. x1 I'l‘“ ,.|,_ m. nu w -v-'. ,. W q. my, w wu‘ m. m nun-“mmflu-wmwm-wnm- mn-unbmnn-«t-u-w-nnm in “awn-squi- hfl—h—II-ullmw~h~——mfl-Mln uihflm mum-manna...“- “Mum-mflmnflhuhnv— M“Mh~l’~fl-Mhmmhbhm‘m “ma—w—flhwme-u-b-nuwv-‘uh M. l—unfln-mnfi-n-nu—unm-n “— uhmflnnu-~mnmmmmmmqm ln~--—-~nmuuum—fllh—|n~nw|_flm Mann—unmn‘mnnnunfl 14 FEDERAL COMMUNICATIONS COMMISSION RADIO FREQUENCY INTERFERENCE STATEMENT WAKING: Malemmwllmmqmulmmd-dunfl puerfihh nmmmnmnwuummmwcm mmbmm|mom mph-l. nunmwwammmmwmmmwmlwiqummwmmmmuowcc “mm-nmbpwidal—Mp-MWNdImh-mnaw mun-1m M4Mhmmmmmmmmflilnflwwmnmmumm wuwmmmnmbuwmmhmmdmw tumult-cum“ acummmriwmnhcmmmmnmnyommman din-m -mwmmanmuuum mmmmmmnmmmmuuw, ~Mwlhnmwmm1hunnum ~mmmmomnmnflmmfiflmnflmmmmmflmum-con Mud-cm "Q umuncmfizn h It! mun-whit bun, Mb or TV Mlflmm by UWTNORIZENWAYIONhlI-mm'm n-mwmdwmmmm wchnufiunu
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.3 Linearized : No Page Count : 16 Page Mode : UseNone XMP Toolkit : XMP toolkit 2.9.1-13, framework 1.6 About : uuid:32e1f2a4-76b1-45c9-b66d-5511509380d3 Producer : Acrobat Distiller 5.0 (Windows) Create Date : 2004:12:30 09:15:14+08:00 Modify Date : 2004:12:30 16:10:34-08:00 Metadata Date : 2004:12:30 16:10:34-08:00 Creator Tool : Acrobat PDFMaker 5.0 for Word Document ID : uuid:ecb7271e-592e-421b-b16e-c24dc17e879f Format : application/pdf Creator : maggieh Tagged PDF : Yes Author : maggiehEXIF Metadata provided by EXIF.tools