Midea Kitchen Appliances M820NY Microwave Oven User Manual
Guangdong Midea Kitchen Appliances Manufacturi Microwave Oven Users Manual
Users Manual
Glidea‘” Microwave Oven INSTRUCTION MANUAL MODEL:M820NY Read these instructions carefully before using your microwave oven. And keep it carefully for future reference If you follow the instructions. your oven will provide you with many years of good service SAVE THESE INSTRUCTIONS CAREFULLY PRECAUTIONS TO AVOID POSSIBLE EXPOSURE TO EXCESSIVE MICROWAVE ENERGY la) 00 not attempt to operate this oven with the door open smcflhts can result m harmful exposure to rmcvowave energy." is Important not to defeat or tamper wllh the salely Interlocks (bl Do not place any oblect balm" tho oven Itont tace and ma door 0: allow soil or cleaner resume to accumulate on seallng surfaces. (c) be not opomo the oven It II I: damauod. It Is particularly Important that In. mun door close! properly and that than Is no damag- to the: (1) DOORIdmt) (2) HINGES AND LATCHEStbvoh-n or toounod) (3) DOOR SEALS AND SEALING SURFACE (d) ‘I’tu ovcn should not In adjust“ or rap-Ind by anyone except proporly quallflod torvlco personnel, SPECIFICATIONS Enema! mestons leWn'lt 20,3X152X130 mm M W 25115 t The over must be level. 2. The ”mole and lurnieble roller rest must be in the oven dining cooking Place the oookwae gently on ttn turntable and handle i caetulty to avoid possble vantage, 3r Incurred iseotbruniugdishnwyoeusatmmaolelobreak. 4‘ Uuontymespecifiedhaomwhmming DredAocesePopoom‘ 5. Theovmhasseverdml—nsaletymcheenoememmemrremdmofi when thouBopm,Donotlltwvmhmssosmo Sr Do not operate the mluuwave oven emptyr Opaatlnu the oven wih no food of bed that hemorneivlow nnto’serreoanoeusefte.oharringorsparldng, 7‘ Dorvtoookbaoondirewyenmehnmble Exousivelwoltnatiigotthemwlemy cause the Mntabh to break. I. Do not heat baby bottle- or baby food In the rnlcroneve even. Uneven heating may occur and could cauu physlcal Inlury. 0. no not heat ntrow-nedted cot-miners. such a: syn» bottles. 10. Do not enemy! to deep-try In your microwave oven, 11. Do not attempt home canning in this microwave oven as II is impossible to be sure all cements 01 the jar have reached boiling temperature 12. Do not use "it! microwave oven for commercial purpose This microwave oven is made for household use only 13. To prevent delayed eruptrve noilmq of hot liquids and beverages or scalding yoursell. stir liquid before placing the container in the oven and again halfway through cooking time Let stand in the oven for a short time and stir again hetore retrieving the container 14 {Pleasedonotioelhefood hthemicrowaveovenloavoidhurninu dueloexoessiva cooking Mien cooking lood l‘l it Important Safety Instructions WARN| NG_ YomlrnmkaliMMJhdncshock pom. a ”noun lo 0mm mlaowmo on onorqy when using your applianco, lollow ballc procautions. lncludlna lho lollowlnq. 1 Road al mun-mono beloro using m- in oxplodo and inorofou mould nor be appliance honed in this oven 2. Read and follow the specific" PflEcAU- 7 Use this appliance only for Is unenoed “OHS YOAVGD POSS!“ masons uses as dumbed in "no manual. Do 70 ExchlvE “WAVE ENERGY". noi use oorrosive chemicals or vapors in this appunoo This mm- is spoclflcaily 3, As Mb most cooking appllmoos.closo “signed lo hoot or cook load Ii is noi swam-ion lo nae-story lo roduoe ihn dulpnoo for Industrial or laboratory riskolafrernlnemencavlty usa ll mid,- hold- liioovon ipniil: B As with any appliance. close supervision 1 Keep me even don closed in nooeeury when used by children 2Tummecmnoljrfluurglm mm 9 Do nol ope-alums oven il It not a 3.0lsoonneci the power at me luse or mun danapod cord or plug. ll it Is no! working broelmr panel nroporly or II ll has boon damaged or Koophmhdihololmnhaialfinn: dropped lo. ‘l’hlo lpollmoo Md be unload |.Do mwormok land. WM" only by quolflod undo! udinlcllno. mph-loo when mama omer armis- Com-cl rho nuns! “Mud Nemuaplamdmmewmm oorviool'oollly lounrrinlioruooalr ruins melting or adamant. lbw-amenavenuviybrmmmpw- 11. Donoloovororblockanyvomsonun poses Do nd our: cart-noble ism su- oven manned. enclose. paper prodmts. ac l2 Do noi store or on this appliance mm In men ll m m mo power outdoors lho,lrroovenrrioyt|monb/Isel 13. Do no1 use inls oven near vraierjur lRarmw‘lrorwlu—liosandmoulhandos ounple. ma! 3 kitchen sink, n a war 00m panoramas Mos bolero basemni. near a smmmng pool. or [clamp than n the oval similar locallons. 4.1?monmmbewurfled0modmry 14. Donol immerse cordcr plug in war-r b M mm MM“- 15 Koop cord away from mm surface! IINGNSI'RIIZTW. ls Donollor cord hung over oops olmblo smorlooolomormuiyhaocordmos «courier. Milli" ham initiations world-d l7 When cieamnq door and men surlaues 5 Sam products such as what. use only mild. nonabrasive snaps or eggs. walor With all or lai. mltd doioruonts applied mm a sponge or comelners and closed glassjars an able so" clam SAVE TH“ INSTRUCTIONS w Lruuds. such as water. cofleel or lea are able lo be overheated Mom! (he bodlno I) 00 no! warn“! the In“. polmmmmappem-olobobomng Vlelblo II) sum-qwmrnrmma ham” bumbling or Imirra when the oomalnel is mm but“ It. removed tram ma "mow-v. mm Is not II) no nor an weight-dried contain-n always present. THIS COULD RESULT IN wlh mm necks. VERY HOT UOUIDS SUDDENLY BOILING lv) ”hr Inning. M m. mm b OVER WHEN THE CONTAINER I5 DIS— mmmmyovmnum TURBED OR ASPOON OR OTHER UT- "me bibl- removing Iho 001mm. ENSIL IS INSERTED INTO THE LIQUID v) the ulrlm. m mm lam a moIMMIIrmunm-m To Mice 1h. risk 01 Infilry In ml: Grounding Installation DANGE! mama-mum mammmfls mammmm mmmmm awhme WARNING Buckle stock Hull lnuoperuledlhewom mummmmoo “mammalian“ Wmnwoperly mulled amgromma Three-promos! (Omar-dine) Pl“! PE ”marvel-Mud moulded cum Utensils Tmmmuwowdod lumen-mamm- trlcal shod alarm wounding reduces the ma 01 shark: shockhyprmmmescapewrelalheelecvlcwm meplmlsmwodwimuoordmvmaaom mmmmaqrwndlmmr Trauma mtmbnplmedmlo an bullet mal Is properly Installed and grounded Coma! a malifad dowiu‘an or m it lhe wound- mmmuuenucanplmmmdoridouu ulstsasbvmahanheappfiamespmpalywourded "lamessary'ouseanexlanslmoordmseonwas- win ubnsion cord lhu has e 341000001 0mm plug. arrflazeuracaptaulamamlmptmaplug onlha audience 1, A shun power-supply cord ls provided lo reduce Ihe risks resume from Downing entangled m or firm em a law cord 2, Longer cord sets or oxlemlon cord ls provided In mine: the mks resume llom becoming mambo In or um mm a longer cord 1 II a long cord sets or extent-on curd ls used “The makod electrical raling ol the cord 901 or extensm mammarmugmamnmmum 0! IM appliance 2)Tne alderman card must be a grounding-type 3-wln cord. ma 3mm lama cord would be arranged to that I! wll not drape over the Mulopulablewp wherencanbeprledonlw Mon or tripped over mmenfimally sumnchhmnwmmmmnbyou cannula vaommalouwm In micro wan ovonfTh-n my be main mu: mails CAUTlON Mmmubwuulormiamn "hdouu. Pawn-llniuyfl Hand youcmmmnumsnhqummblwwm Tgm-doseduimsib puma“ New couldawbdefilosed conninemanopemdand ”urn“: mmw I. Flammmwm1wpuflmfl °°°‘““9' mammacmmmuhnsn mm. zeootmmnmmmvalmm. leudwylulthnuemil Wl'nuwtyuloneiiumm. dot-amino! niuowavecoukim ADondexu-Mmhuecookmflmn a you can use in microwave oven min-uh! shio inndyASm mwmvloe-uun uumomvm ' pun: dual umwwmm‘mhmmunbubmdmb mn-flmThHshuMbnmI-w1|ld|t15fln2uwgzhumovmmlh M" «It Foflcvw mmuhdlnv'u mmions The bwun d hwmg um- mun be at lea: 3116 Inch (Err-n) above he mable‘lmoned usage may mac mammmm Blur-mm Wave-ids my. Follow manhunt“ m‘ Donut use cracked u ' Gill's Gun].- Mmalnmemmmmmmwammmnm an 001 ha mum-d Mm“ chum Hul—mfinnmamg-mra only. Milka mm ii nonmalhc mm. 00 not we and” or chlggod Ms, Own cooling Folbw mnfladm‘: masons. Do on claw wilt Mal b‘o. Make ails 10 a! mumlowg Pwpldu UnhM-(mwofimmnlmodynonolI-Mumumwmh Mup- coding PM“. Usehowulmdhfmhnlmmdmm'mmmmmlmn ”Maximum, Fm? Eesamfiwmmfiifinnunmnpfimm EE’—_—_—.—. Fla-ac mmva-sate my Folawme mumslmucumssrnldbaumad ‘Mamve Sde‘ mmcmammmsmmdmueomm mev'mdfighwdoudphflicbmmldhom,wmduvmm mmnpr PI-lk-rv Mlavmcafomly,mobmfooddmmowmmhm Do maltowganicflbluumbnd. 1mm Mama-sate 11110593 and m [mm-0mm) Walnut Uuuamhmmmhuandmahnfime Materials to be avoided in microwave oven lilo-uh Alumimmigz Ma! cause arcing Transior iood Inlo mncrowavo-saie dish Food union with May cause arcing Tronsier icon mm microwave-ante dish mold hand. Mai or mohl- Mold meids the loo»! from microwave energy Medal lrim may cause nrcin May cause arcing and could cause a fire in Rho oven Plastic burl my mail or ocular-nah 1m quuld “Mn than “posed lo nigh ienveralule Wood Woe-Li MI dry oul when used in the microwave oven and may spill or wait Names of Oven Parts and Accessories Ramon in» oven and all main-is "om the canon Your oven corms with the lolowing accessories. Glam tray i Twmabie nng assembry i A Inumciion Manual 1 C B Aiconlrol penal Bfl’wniabie shun C)Turnlabie ring assembly DIGIaSs Iray EDbsefvaiion window Fl Door assembly Gisaifiy interlock system Smbmovmwmwwusomwwwowm" TURNTABLE INSTALLATION a Nsvwgflca "Emmy manna mammal“) mama-mama“ b smgassnymmmmmmmm Glasslray , t-. r f w Tumlable shan—- bwmw c Mlloodandcomamsulboaasamysmd ("how's/hm l d mmmmmmum a lgswyummmmfl/mamm wmaflmmm Turntable rlng assembly Installation Wsdmmflwm Exam-"n avonforanydamaotwas dmubvokmdou. Donut-Wilma» dmoad Counhflop com Remove any 91de llvn Bound Installation 1. Sahel a level surface the! provlda enough open space lot the: lnlnke and/or oulhl varls A mlnlmum clmnco 01 3.0 Inch (73cm) ll mun-d bum-on In. mn and ammmwdwmddnmuhom. on ma cabiml suriace mummnmmuam "m l: unwed to m. oven cavity In mailman-Inn. (1) Luv. 1 ninbnlln char-moot fl lnduJDcml m Ihl any; (1) Domnmonflnbmfmnma helium 0! lb: on". (3) Bucking In human/or outlet M can «image Ins oven. (“Plus lbs oven as lav away from miles and TV as possible Open-non of mumvoonn may cause um to your radio 01 TV “cannon, 2. Mmmmamurnmnm oulel. Be sun lhe voltage and ma Mum sum is "to voting: and m. l‘nquom on mo ram law WARDING: 00 ml Install men we! a "not coolaoo at war hulvoaldnq spoilancn, ll anglalod could be Garwood and ms warranly would be veld OPERATION lATo set cooking power by turning me powel knob Io desired level. Power 2.To set the time of cooking by turning the timer knob to desired time per your load cooking guide. 3AThe microwave oven will automatically siarl cooking alley Timer Power level and lime is set, 4.Afler the cooking time is up Aha unil will "Dong" Io slope Sill me unil IS 001 in use. always set lime lo "0' . Cook lmqh meet. sow sin soften me! u delrosl m— Miwmwwww m— R-uvfi-nm-m “_ Rahal boilvmlw woelabln dickonubavemqo Troubleshoot Checkyollpmblembyushgllmcharlbemandlryhesohmonslureachpvoblem lune miaowaveovensllldoes mlwukpvopem.oor|laotlhe neareslanmorlzedssvloeoefm. TROUBLE POSSIBLE CAUSE POSSIBLE REMEDY a. Elearical cord for Owen ‘e 3 Plug inlome outet Oven wil not slafl no! plugged m b Clou the doc: and lry b. Door Is open. aga'n c Wrong opuallon It sol. c. Check Woollen. amulet Io be avoided in e. Use mboweve-sele "new oven an used. oookvtae only. - - hhnwonilopaohedmn b Donolupaelewiln “m gmsm'l‘mg envty own mpty csflled loud remain In c. Clean cavlty wllh wel hmel. a Malenals lo be avolcled h 3. Use mbowavesale niuowave oven are used oookvae only. ' I: completely Most lood c. Coolung line. pcmer level c. Use cared cooking ls nol salable ll'ne. power level. d. Food is not lumed or efned. 0. Turn a slit lood. Overcookedl Is pecking lime. power level Use culled cooking ls nol sunahle tine. panel level. a. Us. microwave-9310 cookware only. arena-snamm. b. Comomolymosllood c. Check lo see lhal oven venti- hllon pom am not rescued 6 Use anneal cookilo lrne. power level. a Malenals lo be avolcled h 5 Use mnow' mule niaowave oven are med. oookwae only. lmplopel Manna b. Cooking lime. power level 0. Us. correct cooklno is not amiable lune. power level cFoodisnal-xnedorsmed c_Tumorslirlood. 10 Questions and Answers 0: Why is there noise coming horn the tumteble when the oven is turned on? A: This noise occurs when dirt or residue lood exists between the turntable roller rest and cavity bottom Frequent cleaning of these parts should eliminate orreduoe the nose. 0: Why is there noise coming item the oven when using a lower power level? A: When cooking with power other than 100i. the oven automatically turns on and ort to obtain lower power output. The clicking horse can be heard when iheovenswlchesonandotlmaisnormal, o: Whyislheresteamoomimorlollhee‘rexhauetvent? A: Steam is produced during cooking. The microwave oven has been made to vent this steun o: What is mono when the oven nail in! not glow? there may be several reasons why the oven light will not glow. The light bulb has burned out or timer limo hes not been rotated. Q: Why do eggs sometimes pop? A: The egg yolk may pop because oi steam build-up inside the membrane, Pierce the membrane with a toothpick before cooking it. Never microwave eggs In the ehell since they rn-y explode. 0: How are boil-overs avoided? A: Use a Ierger utensil than usual for cooking. Ii you open the oven door or brhg bedilo'O' lhelkner knob. the load will stop boiling. Cleanig Who the oven inside and (IMO with a sell cloth and a mild detergent solilion. Then rinse and who dry. This should be done on a weekly basis. more often it needed. Never use cleaning powders or rouwi pods. Excessive oil splatters on the inside top will be dill-w! to remove itlell lor merry days. Wipe soldiers wilh e wet paper towel. eepedaly eller cooking chicken or bacon. Renewable Perle (t) The glass trey may be cleaned a the sink. Be areluI not to chip or watch the edges as his may cause the glass tray to break daily use (2) The turntable ring essy should be cleaned requiem, Speciel Cue For best performance and solely. the inner door panel and the oven iron! irerne should be tree otiood , 11 NOTE |. Wmhwi-MMMWMI-q I“. 2. MMMmmmwmenw-‘hd on. I mmmnmmn—w-‘mn 4. mmummmmumnnnMwm-l umbnumufi-mnmbwm I. “hm“huflmwmlhbmfid “mun-nan“ wthhh—l’ubmfihlw—whe—v-‘w ”wl‘midl mhmwwu-M ”mehmw lMfi-M-mmmmmfll“ mummnMth‘u-un-m huh-unlWI-MGWD. unmannwxmnwnhmu hwfiwluwthbufl-i—t m-nhfln—‘h-mm-Q-m—n-l- nun—n- mun-wnumvmnnm van-n “quanta—"n— h‘mfiflllimlbmwfin~~mmn-hhm mlbmmwwm-mnamnmm “mum-mmm-mumnm—mm mmmnmnmmmno—mmihmdm hmdw-n‘nfiimml—fiu—m-n-“m- l-—h_~“-.m-#—fl-~_-h_h‘ q.- bhnuuMMQanmnn—mmmm-u nn-uu—nfl—hnmmun—‘u Imam-yaw". “unnuunun‘mnnnu—s“ FEDERAL COMMUNICATIONS COMMISSION RADIO FREQUENCY INTERFERENCE STATEMENT "MING: Mammal-1MBulwmqwmfllmmdmuumthMhh ummmnmnmumm. mam mmnmw|mom minim, nunmwnammmmwmmmumlwaumflaummmmwow-3c MlJAfianbMomnw-MWNflI-Mnnam hullllm mum'-mummmmmmmmummommvmmm "MwuwifiH-Nbfldhwhbmmfihmhdww mmhw mammmwlwmnucmhmmnmhyomwm «mug-n; -mmw:ummdndbuumm. -Rm|hmwmmmmmruw. dbv-Itnmvmmyfiunmm -mmmtm'mnmadMM-cwmmmmommmum-non Mir-mum HE umuncruwia It not yup-melt bum man or W rum-mum 01 uuwmomzmuouncmonnv- mien-um II sum-um ullhs uwlomlc! Ind! Mum,
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.3 Linearized : No Modify Date : 2005:02:05 17:08:59+08:00 Create Date : 2005:02:05 17:08:15+08:00 Page Count : 13 Creation Date : 2005:02:05 09:08:15Z Mod Date : 2005:02:05 09:08:15Z Producer : Acrobat Distiller 5.0 (Windows) Author : maggieh Metadata Date : 2005:02:05 09:08:15Z Creator : maggieh Page Mode : UseNone Tagged PDF : YesEXIF Metadata provided by EXIF.tools