Motorola Solutions 89FT4892 BLUETOOTH TRANSMITTER User Manual USER GUIDE
Motorola Solutions, Inc. BLUETOOTH TRANSMITTER USER GUIDE
Contents
- 1. USER GUIDE
- 2. USERS MANUAL
- 3. User Manual
USER GUIDE
![](/img.php?id=1415131&img=bg1.png)
APX™ Two-Way Radios
APX 6000
User Guide
Model 1
![](/img.php?id=1415131&img=bg3.png)
English
m
ASTRO® APX™ 6000 Series
Digital Portable Radios
Quick Reference Card
Product Safety and RF Exposure Compliance
ATTENTION
This radio is restricted to occupational use only to satisfy FCC RF
energy exposure requirements. Before using this product, read
the RF energy awareness information and operating instructions
in the Product Safety and RF Exposure booklet enclosed with
your radio (Motorola Publication part number 6881095C98) to
ensure compliance with RF energy exposure limits.
Radio Controls
Radio On/Off
Zones and Channels
Receiving and Transmitting
Sending an Emergency Alarm
To exit emergency at any time, press and hold
the Emergency button.
Before using this product, read the operating instructions
for safe usage contained in the Product Safety and RF
Exposure booklet enclosed with your radio.
!
2-Position
Concentric
Switch
__________
Microphone
Accessory
Connector
•On – On/Off/Volume knob clockwise.
•Off – On/Off/Volume knob counterclockwise.
•Zone – Zone switch to desired zone.
•Channel – Channel switch to desired channel.
Top
Display
Bluetoo h
Pairing
Indicator
Main
Speaker
Microphone
Battery
Side Button 2
__________
16-Position
Select Knob
__________
On/Off/Volume
Control Knob
Side Button 1
__________
PTT Button
Top Side
(Select)
Button
__________
Antenna
1Select zone/channel.
2Listen for a transmission.
OR
Press and hold Volume Set button.
OR
Press Monitor button and listen for activity.
3Adjust volume, if necessary.
4Press the PTT button to transmit; release to
receive.
1Press the Emergency button.
2The display shows EMERGNCY and the
current zone/channel. A short, medium-
pitched tone sounds, and the LED rapidly
blinks red.
3When acknowledgment is received, you hear
four beeps; alarm ends; and radio exits
emergency.
*PMLN5715A*
PMLN5715A
© 2010 by Motorola, Inc. All Rights Reserved. 12/10
1301 E. Algonquin Rd., Schaumburg,
IL 60196-1078, U.S.A.
Top (Orange)
Button
__________
3-Position A/B/C
Switch
__________
![](/img.php?id=1415131&img=bg4.png)
English
Sending an Emergency Call
To exit emergency at any time, press and hold
the Emergency button.
Sending a Silent Emergency Call
To exit emergency at any time, press and hold
the Emergency button.
Display Status Icons
1Press the Emergency button.
2Press and hold the PTT button. Speak clearly
into the microphone.
3Release the PTT button to end call.
4Press and hold Emergency button to exit
emergency.
1Press the Emergency button.
2The display does not change; the LED does
not light up, and there is no tone.
3Silent emergency continues until you:
Press and hold the Emergency button to exit
emergency state.
OR
Press and release the PTT button to exit the
Silent Emergency Alarm mode and enter
regular dispatch or Emergency Call mode.
Blinks when the battery is low.
The more stripes, the stronger the
signal strength for the current site
(trunking only).
Direct radio to radio communication or
connected through a repeater.
On = Direct
Off = Repeater
This channel is being monitored.
L = Radio is set at Low power.
H = Radio is set at High power.
Scanning a scan list.
Blinking dot = Detects activity on the
Priority-One Channel
during scan.
Steady dot = Detects activity on the
Priority-Two Channel
during scan.
The vote scan feature is enabled.
On = Secure operation.
Off = Clear operation.
Blinking = Receiving an encrypted
voice call.
On steady = View mode
Blinking = Program mode
U
V
O
M
HOR L
i
j
k
m
Basic Zone Bank 1
A = Radio is in Zone 1.
B = Radio is in Zone 2.
C = Radio is in Zone 3.
Basic Zone Bank 2
D = Radio is in Zone 4.
E = Radio is in Zone 5.
F = Radio is in Zone 6.
Enhanced Zone Bank
A= Contains Zone 1, Zone 2 and Zone
3,
B= Contains Zone 4, Zone 5 and Zone
6,
C= Contains Zone 7, Zone 8 and Zone
9,
.
.
.
X= Contains Zone 70, Zone 71 and
Zone 72,
Y = Contains Zone 73, Zone 74 and
Zone 75.
Bluetooth is ready.
Bluetooth is connected to the device.
Aor
Bor
C
Dor
Eor
F
A,B,
C... ...
x or
y
b
a
![](/img.php?id=1415131&img=bg5.png)
Declaration of Conformity
English
i
Declaration of Conformity
This declaration is applicable to your radio only if your radio is labeled with the FCC logo shown below.
DECLARATION OF CONFORMITY
Per FCC CFR 47 Part 2 Section 2.1077(a)
Responsible Party
Name: Motorola, Inc.
Address: 1301 East Algonquin Road, Schaumburg, IL 60196-1078, U.S.A.
Phone Number: 1-800-927-2744
Hereby declares that the product:
Model Name: APX 6000
conforms to the following regulations:
FCC Part 15, subpart B, section 15.107(a), 15.107(d) and section 15.109(a)
Class B Digital Device
As a personal computer peripheral, this device complies with Part 15 of the FCC Rules. Operation is subject to the
following two conditions:
1. This device may not cause harmful interference, and
2. This device must accept any interference received, including interference that may cause undesired operation.
![](/img.php?id=1415131&img=bg6.png)
Declaration of Conformity
English
ii
Note: This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to part
15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a
residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not
installed and used in accordance with the instructions, may cause harmful interference to radio communications.
However, there is no guarantee that interference will not occur in a particular installation.
If this equipment does cause harmful interference to radio or television reception, which can be determined by
turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the
following measures:
•Reorient or relocate the receiving antenna.
•Increase the separation between the equipment and receiver.
•Connect the equipment into an outlet on a circuit different from that to which the receiver is connected.
•Consult the dealer or an experienced radio/TV technician for help.
![](/img.php?id=1415131&img=bg7.png)
Contents
English
iii
Contents
This User Guide contains all the information you need
to use the APX™ 6000 Series Digital Portable Radios.
Declaration of Conformity . . . . . . . . . . . . . . . . . .i
Important Safety Information . . . . . . . . . . . . . vii
Product Safety and RF Exposure Compliance . . . . vii
Software Version . . . . . . . . . . . . . . . . . . . . . . . vii
Computer Software Copyrights . . . . . . . . . . .viii
Documentation Copyrights . . . . . . . . . . . . . . .viii
Disclaimer . . . . . . . . . . . . . . . . . . . . . . . . . . . . .viii
Getting Started . . . . . . . . . . . . . . . . . . . . . . . . . . 1
How to Use This Guide . . . . . . . . . . . . . . . . . . . . . . . 1
Notations Used in This Manual . . . . . . . . . . . . . . . . . 1
Additional Performance Enhancement . . . . . . . . . . . 2
Dynamic System Resilience (DSR) . . . . . . . . . . . . . .2
CrossTalk Prevention . . . . . . . . . . . . . . . . . . . . . . . .2
Encrypted Integrated Data (EID) . . . . . . . . . . . . . . . 2
SecureNet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2
What Your Dealer/System Administrator
Can Tell You . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Preparing Your Radio for Use . . . . . . . . . . . . . .3
Charging the Battery . . . . . . . . . . . . . . . . . . . . . . . . . 4
Battery Charger . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Attaching the Battery . . . . . . . . . . . . . . . . . . . . . . . . . 4
Attaching the Antenna . . . . . . . . . . . . . . . . . . . . . . . . 5
Attaching the Accessory Connector Cover . . . . . . . . 6
Attaching the Belt Clip . . . . . . . . . . . . . . . . . . . . . . . . 6
Turning On the Radio . . . . . . . . . . . . . . . . . . . . . . . . 7
Adjusting the Volume . . . . . . . . . . . . . . . . . . . . . . . . 8
Identifying Radio Controls . . . . . . . . . . . . . . . . .8
Radio Parts and Controls . . . . . . . . . . . . . . . . . . . . . 9
Programmable Features . . . . . . . . . . . . . . . . . . . . . 10
Assignable Radio Functions . . . . . . . . . . . . . . . . . 10
Assignable Settings or Utility Functions . . . . . . . . . 11
Accessing the Preprogrammed Functions . . . . . . . 11
Push-To-Talk (PTT) Button . . . . . . . . . . . . . . . . . . . 12
![](/img.php?id=1415131&img=bg8.png)
Contents
English
iv
Identifying Status Indicators . . . . . . . . . . . . . .12
Status Icons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
LED Indicator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14
Intelligent Lighting Indicators . . . . . . . . . . . . . . . . . 15
Alert Tones . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16
General Radio Operation . . . . . . . . . . . . . . . . .19
Selecting a Zone . . . . . . . . . . . . . . . . . . . . . . . . . . 19
Selecting a Radio Channel . . . . . . . . . . . . . . . . . . . 20
Receiving and Responding to a Radio Call . . . . . . 20
Receiving and Responding to a Talkgroup Call . . . 21
Receiving and Responding to a Private Call
(Trunking Only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Receiving and Responding to a Telephone Call
(Trunking Only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22
Making a Radio Call . . . . . . . . . . . . . . . . . . . . . . . . 23
Making a Talkgroup Call . . . . . . . . . . . . . . . . . . . . . 23
Repeater or Direct Operation . . . . . . . . . . . . . . . . . 23
Monitoring Features . . . . . . . . . . . . . . . . . . . . . . . . 24
Monitoring a Channel . . . . . . . . . . . . . . . . . . . . . . . 24
Conventional Mode Operation . . . . . . . . . . . . . . . . 24
Advanced Features . . . . . . . . . . . . . . . . . . . . . 25
Advanced Call Features . . . . . . . . . . . . . . . . . . . . . 25
Receiving and Responding to a Selective Call
(ASTRO Conventional Only) . . . . . . . . . . . . . . . . . .25
Using the Dynamic Regrouping Feature
(Trunking Only) . . . . . . . . . . . . . . . . . . . . . . . . . . . .26
Requesting a Reprogram (Trunking Only) . . . . . . .26
Classifying Regrouped Radios . . . . . . . . . . . . . . . .27
Scan Lists . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27
Viewing a Scan List . . . . . . . . . . . . . . . . . . . . . . . . .27
Viewing and Changing the Priority Status . . . . . . . .28
Scan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28
Turning Scan On or Off . . . . . . . . . . . . . . . . . . . . . .28
Making a Dynamic Priority Change (Conventional
Scan Only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .29
Deleting a Nuisance Channel . . . . . . . . . . . . . . . . .29
Restoring a Nuisance Channel . . . . . . . . . . . . . . . .29
Call Alert Paging . . . . . . . . . . . . . . . . . . . . . . . . . . 30
Receiving a Call Alert Page . . . . . . . . . . . . . . . . . .30
Emergency Operation . . . . . . . . . . . . . . . . . . . . . . 30
Sending an Emergency Alarm . . . . . . . . . . . . . . . .31
Sending an Emergency Call (Trunking Only) . . . . .31
Sending an Emergency Alarm with
Emergency Call . . . . . . . . . . . . . . . . . . . . . . . . . . . .32
Sending a Silent Emergency Alarm . . . . . . . . . . . .33
![](/img.php?id=1415131&img=bg9.png)
Contents
English
v
Using the Emergency Keep-Alive Feature . . . . . . .33
Secure Operations . . . . . . . . . . . . . . . . . . . . . . . . . 34
Selecting Secure Transmissions . . . . . . . . . . . . . . .34
Selecting Clear Transmissions . . . . . . . . . . . . . . . .34
Managing Encryption . . . . . . . . . . . . . . . . . . . . . . .35
Loading an Encryption Key . . . . . . . . . . . . . . . . . .35
Using the Multikey Feature . . . . . . . . . . . . . . . . . .35
Erasing the Selected Encryption Keys . . . . . . . . . . 36
Requesting an Over-the-Air Rekey (ASTRO
Conventional Only) . . . . . . . . . . . . . . . . . . . . . . . .36
MDC Over-the-Air Rekeying (OTAR) Page . . . . . .37
Hear Clear . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37
Trunking System Controls . . . . . . . . . . . . . . . . . . . . 38
Using the Failsoft System . . . . . . . . . . . . . . . . . . . .38
Going Out of Range . . . . . . . . . . . . . . . . . . . . . . . .38
Using the Site Trunking Feature . . . . . . . . . . . . . . .39
Locking and Unlocking a Site . . . . . . . . . . . . . . . . .39
Viewing and Changing a Site . . . . . . . . . . . . . . . . .39
Viewing the Current Site . . . . . . . . . . . . . . . . . . . .39
Changing the Current Site . . . . . . . . . . . . . . . . . . .39
Mission Critical Wireless
- Bluetooth - . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40
Turning On Bluetooth . . . . . . . . . . . . . . . . . . . . . . .40
Turning Off Bluetooth . . . . . . . . . . . . . . . . . . . . . . .40
Re-Pair Timer . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40
Bluetooth Drop Timer . . . . . . . . . . . . . . . . . . . . . . .41
Pairing Bluetooth Device with the Radio . . . . . . . . 42
Indicating Bluetooth Connection is Lost . . . . . . . . . 43
Turning On the Bluetooth Audio (Routing the Audio
from the Radio to the Headset) . . . . . . . . . . . . . . . 43
Turning Off the Bluetooth Audio (Routing the Audio
from the Headset to the Radio) . . . . . . . . . . . . . . . 43
Adjusting the Volume of the Radio from Bluetooth
Audio Device . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44
Utilities . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44
Using the Flip Display . . . . . . . . . . . . . . . . . . . . . . 44
Selecting a Basic Zone Bank . . . . . . . . . . . . . . . . . 44
Selecting an Enhanced Zone Bank . . . . . . . . . . . . 45
Selecting the Power Level . . . . . . . . . . . . . . . . . . . 46
Controlling the Display Backlight . . . . . . . . . . . . . . 46
Turning Voice Mute On or Off . . . . . . . . . . . . . . . . 47
Using the Time-Out Timer . . . . . . . . . . . . . . . . . . . 47
Using the Conventional Squelch Operation
Features . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48
Analog Options . . . . . . . . . . . . . . . . . . . . . . . . . . . 48
Digital Options . . . . . . . . . . . . . . . . . . . . . . . . . . . 48
Using the PL Defeat Feature . . . . . . . . . . . . . . . . . 49
Using the Digital PTT ID Feature . . . . . . . . . . . . . . 49
Using the Smart PTT Feature (Conventional Only) 49
Voice Announcement . . . . . . . . . . . . . . . . . . . . . . . 50
![](/img.php?id=1415131&img=bga.png)
Contents
English
vi
Helpful Tips . . . . . . . . . . . . . . . . . . . . . . . . . . . .52
Caring for Your Radio . . . . . . . . . . . . . . . . . . . . . . . 52
Cleaning Your Radio . . . . . . . . . . . . . . . . . . . . . . . 53
Handling Your Radio . . . . . . . . . . . . . . . . . . . . . . . 53
Servicing Your Radio . . . . . . . . . . . . . . . . . . . . . . . 54
Taking Care of the Battery . . . . . . . . . . . . . . . . . . . 54
Checking the Battery Charge Status . . . . . . . . . . . 54
LED and Sounds . . . . . . . . . . . . . . . . . . . . . . . . . . 54
Fuel Gauge Icon . . . . . . . . . . . . . . . . . . . . . . . . . . 54
Battery Recycling and Disposal . . . . . . . . . . . . . . . 55
Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . .56
Appendix: Maritime Radio Use in the VHF
Frequency Range . . . . . . . . . . . . . . . . . . . . . . 57
Special Channel Assignments . . . . . . . . . . . . . . . . 57
Emergency Channel . . . . . . . . . . . . . . . . . . . . . . . .57
Non-Commercial Call Channel . . . . . . . . . . . . . . . .57
Operating Frequency Requirements . . . . . . . . . . . 58
Glossary . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60
Commercial Warranty . . . . . . . . . . . . . . . . . . . 64
![](/img.php?id=1415131&img=bgb.png)
Important Safety Information
English
vii
Important Safety Information
Product Safety and RF Exposure Compliance
ATTENTION!
This radio is restricted to occupational use only to
satisfy FCC RF energy exposure requirements.
Before using this product, read the RF energy awareness
information and operating instructions in the Product
Safety and RF Exposure booklet enclosed with your radio
(Motorola Publication part number 6881095C98) to
ensure compliance with RF energy exposure limits.
For a list of Motorola-approved antennas, batteries, and
other accessories, visit the following website:
http://www.motorola.com/governmentandenterprise
Software Version
All the features described in the following sections are
supported by the radio's software version R05.00.00 or
later.
Check with your dealer or system administrator
for more details of all the features supported.
Before using this product, read the operating
instructions for safe usage contained in the
Product Safety and RF Exposure booklet
enclosed with your radio.
!
)&&DQG,QGXVWU\&DQDGD1RWLFHWR8VHUV
7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&&
UXOHVDQG566RIWKH,QGXVWU\&DQDGDUXOHV
SHUWKHFRQGLWLRQVOLVWHGEHORZ
7KLVGHYLFHPD\QRWFDXVHKDUPIXOLQWHUIHUHQFH
7KLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHG
LQFOXGLQJLQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHG
RSHUDWLRQ
&KDQJHVRUPRGLILFDWLRQVPDGHWRWKLVGHYLFHQRW
H[SUHVVO\DSSURYHGE\0RWRURODFRXOG
YRLGWKHXVHUVDXWKRULW\WRRSHUDWHWKLVHTXLSPHQW
![](/img.php?id=1415131&img=bgc.png)
Computer Software Copyrights
English
viii
Computer Software Copyrights
The Motorola products described in this manual may
include copyrighted Motorola computer programs stored
in semiconductor memories or other media. Laws in the
United States and other countries preserve for Motorola
certain exclusive rights for copyrighted computer
programs, including, but not limited to, the exclusive right
to copy or reproduce in any form the copyrighted
computer program. Accordingly, any copyrighted
Motorola computer programs contained in the Motorola
products described in this manual may not be copied,
reproduced, modified, reverse-engineered, or distributed
in any manner without the express written permission of
Motorola. Furthermore, the purchase of Motorola
products shall not be deemed to grant either directly or by
implication, estoppel, or otherwise, any license under the
copyrights, patents or patent applications of Motorola,
except for the normal non-exclusive license to use that
arises by operation of law in the sale of a product.
Documentation Copyrights
No duplication or distribution of this document or any
portion thereof shall take place without the express
written permission of Motorola. No part of this manual
may be reproduced, distributed, or transmitted in any
form or by any means, electronic or mechanical, for any
purpose without the express written permission of
Motorola.
Disclaimer
The information in this document is carefully examined,
and is believed to be entirely reliable. However, no
responsibility is assumed for inaccuracies. Furthermore,
Motorola reserves the right to make changes to any
products herein to improve readability, function, or
design. Motorola does not assume any liability arising out
of the applications or use of any product or circuit
described herein; nor does it cover any license under its
patent rights, nor the rights of others.
![](/img.php?id=1415131&img=bgd.png)
Getting Started
English
1
Getting Started
Take a moment to review the following:
How to Use This Guide . . . . . . . . . . . . . . . . . . . . . . . . . page 1
Notations Used in This Manual . . . . . . . . . . . . . . . . . . . page 1
Additional Performance Enhancement . . . . . . . . . . . . . page 2
What Your Dealer/System Administrator
Can Tell You. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 3
How to Use This Guide
This User Guide covers the basic operation of the APX™ 6000
Portables.
However, your dealer or system administrator may have
customized your radio for your specific needs. Check with your
dealer or system administrator for more information.
Notations Used in This Manual
Throughout the text in this publication, you will notice the use of
WARNING,Caution, and Note. These notations are used to
emphasize that safety hazards exist, and the care that must be
taken or observed.
An operational procedure, practice, or condition,
etc., which may result in injury or death if not
carefully observed.
An operational procedure, practice, or
condition, etc., which may result in damage
to the equipment if not carefully observed.
Note: An operational procedure, practice, or condition,
etc., which is essential to emphasize.
!!
!
![](/img.php?id=1415131&img=bge.png)
Getting Started
English
2
Additional Performance Enhancement
The following are some of the latest creations designed to
enhance the security, quality and efficiency of APX radios.
Dynamic System Resilience (DSR)
DSR ensures the radio system is seamlessly switched to a
backup master site dynamically in case of system failure.
DSR also provides additional indication e.g. failure detection,
fault recovery, and redundancy within the system to address to
the user in need. Mechanisms related to the Integrated Voice
and Data (IV & D) or data centric are all supported by DSR.
CrossTalk Prevention
This feature prevents crosstalk scenario from happening,
especially when a wideband antenna is used. This feature
allows the adjustment of the Trident Transmitting SSI clock rate
in the radio to be varied from the Receiving Frequency. This
subsequently reduced the possibilities of radio frequency
interfering spurs and prevents the issues of crosstalk.
Encrypted Integrated Data (EID)
EID provides security encryption and authentication of IV & D
data bearer service communication between the radio and the
Customer Enterprise Network.
SecureNet
SecureNet allows user to perform secured communications on
an Analog or Motorola Data Communication (MDC) channel.
The MDC OTAR feature will allow users to perform OTAR
activities on an MDC channel.
![](/img.php?id=1415131&img=bgf.png)
Preparing Your Radio for Use
English
3
What Your Dealer/System Administrator
Can Tell You
Check with your dealer or system administrator, if the radio is to
be operated in extremely cold temperatures (less than -20 °C),
for the correct radio settings to ensure proper top display
operation.
You can also consult your dealer or system administrator about
the following:
•Is your radio preprogrammed with any preset conventional
channels?
•Which buttons have been preprogrammed to access other
features?
•What optional accessories may suit your needs?
Preparing Your Radio for Use
Assemble your radio by following these steps:
Charging the Battery . . . . . . . . . . . . . . . . . . . . . . . . . . .page 4
Battery Charger . . . . . . . . . . . . . . . . . . . . . . . . . . . . .page 4
Attaching the Battery . . . . . . . . . . . . . . . . . . . . . . . . . . .page 4
Attaching the Antenna . . . . . . . . . . . . . . . . . . . . . . . . . .page 5
Attaching the Belt Clip . . . . . . . . . . . . . . . . . . . . . . . . . . page 6
Attaching the Accessory Connector Cover . . . . . . . . . .page 6
Turning On the Radio. . . . . . . . . . . . . . . . . . . . . . . . . . .page 7
Adjusting the Volume . . . . . . . . . . . . . . . . . . . . . . . . . . .page 8
![](/img.php?id=1415131&img=bg10.png)
Preparing Your Radio for Use
English
4
Charging the Battery
The Motorola-approved battery shipped with your radio is
uncharged. Prior to using a new battery, charge it for a minimum
of 16 hours to ensure optimum capacity and performance.
For a list of Motorola-authorized batteries available for use
with your radio, see Accessories on page 56.
Note: When charging a battery attached to a radio, turn the
radio off to ensure a full charge.
Battery Charger
To charge the battery, place the battery, with or without the
radio, in a Motorola-approved charger. The charger’s LED
indicates the charging progress; see your charger’s user guide.
For a list of chargers, see Accessories on page 56.
Attaching the Battery
With the radio turned off, slide the battery into the radio’s frame
until side latches click into place.
To avoid a possible explosion:
•DO NOT replace the battery in any area
labeled “hazardous atmosphere”.
•DO NOT discard batteries in a fire.
!!
![](/img.php?id=1415131&img=bg11.png)
Preparing Your Radio for Use
English
5
To remove the battery,
turn the radio off. Squeeze
the release latches on the
bottom of the battery until
the battery releases from
the radio. Remove the
battery from the radio.
Note: If your radio is
preprogrammed
with volatile-key
retention, the
encryption keys
are retained for
approximately 30
seconds after
battery removal.
Check with your
dealer or system
administrator for
more information.
Attaching the Antenna
With the radio turned off, set the antenna in its receptacle and
turn clockwise to attach it to the radio.
To remove the antenna, turn the antenna counterclockwise.
Make sure you turn off the radio first.
Battery
Latch
![](/img.php?id=1415131&img=bg12.png)
Preparing Your Radio for Use
English
6
Attaching the Accessory Connector
Cover
The accessory connector is located on the antenna side of the
radio. It is used to connect accessories to the radio.
Note: To prevent damage to the connector, shield it with the
connector cover when not in use.
Insert the hooked
end of the cover
into the slot above
the connector.
Press downward on
the cover’s top to
seat it in the slot.
Once in place, rotate
the thumbscrew
clockwise by hand
until tight.
To remove the accessory connector cover, rotate the
thumbscrew counterclockwise until it disengages from the radio.
If the thumbscrew is too tight, use an Allen wrench to loosen
it first.
Rotate and lift the connector cover to disengage it from
the radio.
Attaching the Belt Clip
Align the grooves of the
belt clip with those of the
radio and press upward
until you hear a click.
To remove the clip, use a
flat-bladed object to press
the belt clip tab away from
the radio. Then, slide the
clip downward and away
from the radio.
Hooked End
Thumbscrew
Hex Socket ead
![](/img.php?id=1415131&img=bg13.png)
Preparing Your Radio for Use
English
7
Turning On the Radio
Rotate the On/Off/Volume Control Knob clockwise until you
hear a click.
If the power-up test is successful, you see SELFTEST on the
radio’s display momentarily, followed by the Home screen.
Note: If the power-up test is unsuccessful, you see ERROR
XX/YY (XX/YY is an alphanumeric code).
Turn off the radio, check the battery, and turn the
radio back on. If the radio fails the power-up test
again, record the ERROR XX/YY code and contact
your dealer.
To turn off the radio, rotate the On/Off/Volume Control Knob
counterclockwise until you hear a click.
![](/img.php?id=1415131&img=bg14.png)
Identifying Radio Controls
English
8
Adjusting the Volume
To increase the volume, turn the On/Off/Volume Control Knob
clockwise.
To decrease the volume, turn this knob counterclockwise.
Note: Ensure that the main speaker is pointed towards you
for increased loudness and intelligibility, especially in
areas with loud background noises.
Identifying Radio Controls
Take a moment to review the following:
Radio Parts and Controls. . . . . . . . . . . . . . . . . . . . . . . . page 9
Programmable Features . . . . . . . . . . . . . . . . . . . . . . . page 10
Assignable Radio Functions. . . . . . . . . . . . . . . . . . . page 10
Assignable Settings or Utility Functions . . . . . . . . . . page 11
Accessing the Preprogrammed Functions. . . . . . . . . . page 11
Push-To-Talk (PTT) Button . . . . . . . . . . . . . . . . . . . . . page 12
Main
Speaker
![](/img.php?id=1415131&img=bg15.png)
Identifying Radio Controls
English
9
Radio Parts and Controls
* These radio controls/buttons are programmable.
Antenna
1
LED
8
Accessory
Connector
4
Microphone
3
Top (Orange)
Button*
2
Battery Latch
5
2-Position Concentric
Switch*
3-Position A/B/C
Switch*
On/Off/Volume
Control Knob
10
Side Button 2*
14
Side Button 1*
13
12 Push-to-Talk
(PTT) Button
11 Top Side (Select)
Button*
Battery
15
16-Position
Select Knob* 19 Top
Display
16 Main
Speaker
Microphone
18
17 Bluetooth
Pairing
Indicator
6
7
9
![](/img.php?id=1415131&img=bg16.png)
Identifying Radio Controls
English
10
Programmable Features
Any reference in this manual to controls that are
“preprogrammed” means that a qualified radio technician must
use the radio’s programming software to assign a feature to a
control.
Your dealer can program the programmable buttons as
shortcuts to radio functions or preset channels/groups
depending on the duration of a button press:
•Press –Pressing and releasing rapidly.
•Long press –Pressing and holding for the preprogrammed
duration (between 0.25 seconds and 3.75 seconds).
•Hold down –Keeping the button pressed.
Assignable Radio Functions
Bluetooth On/Off –Allows you to turn on/off the Bluetooth.
Bluetooth Audio Reroute –Allows you to toggle the audio
route between radio speaker or Remote Speaker Microphone
and Bluetooth headset.
Bluetooth Headset PTT –Function like a PTT button, but is
used to keyup the Bluetooth Headset's microphone.
Bluetooth Clear All Pairing –Allows you to clear all pairing
info for Bluetooth.
Call Response –Allows you to answer a private call.
Dynamic Priority (Conventional Only) –Allows any channel
in a scan list (except for the Priority-One channel) to temporarily
replace the Priority-Two channel.
Emergency –Depending on the programming, initiates or
cancels an emergency alarm or call.
Internet Protocol –Displays the Internet Protocol (IP) address,
device name and status of the radio.
Monitor (Conventional Only) –Monitors a selected channel
for all radio traffic until function is disabled.
Nuisance Delete –Temporarily removes an unwanted channel,
except for priority channels or the designated transmit channel,
from the scan list.
One Touch 1 – 4 – Launches a specific feature with one single
button-press. You can setup as much as four separately
programmed buttons for four different features.
Private Line Defeat (Conventional Only) –Overrides any
coded squelch (DPL or PL) that is preprogrammed to a channel.
Rekey Request –Notifies the dispatcher that you require a new
encryption key.
Repeater Access Button (RAB) (Conventional Only) –
Allows to manually send a repeater access codeword.
Reprogram Request (Trunking Only) –Notifies the dispatcher
that you want a new dynamic regrouping assignment.
![](/img.php?id=1415131&img=bg17.png)
Identifying Radio Controls
English
11
Request-To-Talk (Conventional Only) – Notifies the
dispatcher that you want to send a voice call.
Scan –Toggles scan on or off.
Scan List Programming –Selects the scan list for editing.
Secure/Clear –Toggles secure operation on or off.
Site Display (Trunking Only) –Displays the current site ID and
RSSI value.
Site Lock/Unlock (Trunking Only) –Locks onto a specific site.
Site Search (Trunking Only) –Performs site search for AMSS
(Automatic Multiple Site Select) or SmartZone operation.
Talkaround/Direct (Conventional Only) –Toggles between
using a repeater and communicating directly with another radio.
Basic Zone Bank –Allows selection from a larger list of zones.
Enhanced Zone Bank –Allows selection from a list of banks
with three different zones in each bank.
Assignable Settings or Utility Functions
Flip –Flips the content of the top display.
Light –Toggles display backlight on or off.
TX Power Level –Toggles transmit power level between high
and low.
Voice Announcement –Audibly indicates the current feature
mode, Zone or Channel the user has just assigned.
Voice Mute –Toggles voice mute on or off.
Volume Set –Sets the volume set tone.
Accessing the Preprogrammed Functions
You can access various radio functions through a short or long
press of the relevant programmable buttons.
![](/img.php?id=1415131&img=bg18.png)
Identifying Status Indicators
English
12
Push-To-Talk (PTT) Button
The PTT button on the side
of the radio serves two basic
purposes:
•While a call is in progress,
the PTT button allows the
radio to transmit to other
radios in the call.
Press and hold down PTT
button to talk. Release the
PTT button to listen.
The microphone is
activated when the PTT
button is pressed.
•While a call is not in
progress, the PTT button
is used to make a new
call. See Making a Radio
Call on page 23 for more
information.
Identifying Status Indicators
Your radio indicates its operational status through the following:
Status Icons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 12
LED Indicator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 14
Intelligent Lighting Indicators . . . . . . . . . . . . . . . . . . . . page 15
Alert Tones. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 16
Status Icons
The 112 x 32 pixel top monochrome display screen of your radio
shows the radio status and operating conditions.
PTT
Button
Battery
The icon shown indicates the charge remaining in
the battery. Blinks when the battery is low.
Received Signal Strength Indicator (RSSI)
The number of bars displayed represents the
received signal strength for the current site, for
trunking only. The more stripes in the icon, the
stronger the signal.
U
V
![](/img.php?id=1415131&img=bg19.png)
Identifying Status Indicators
English
13
Direct
•On = Radio is currently configured for direct
radio to radio communication (during
conventional operation only).
•Off = Radio is connected with other radios
through a repeater.
Monitor (Carrier Squelch)
Selected channel is being monitored (during
conventional operation only).
Power Level
•L = Radio is set at Low power.
•H = Radio is set at High power.
Scan
Radio is scanning a scan list.
Priority Channel Scan
•Blinking dot = Radio detects activity on
channel designated as Priority-
One.
•Steady dot = Radio detects activity on channel
designated as Priority-Two.
N
M
Hor L
J
j
Vote Scan Enabled
The vote scan feature is enabled.
View/Program Mode
Radio is in the view or program mode.
•On steady = View mode
•Blinking = Program mode
Basic Zone Bank 1
•A = Radio is in Zone 1.
•B = Radio is in Zone 2.
•C = Radio is in Zone 3.
Basic Zone Bank 2
•D = Radio is in Zone 4.
•E = Radio is in Zone 5.
•F = Radio is in Zone 6.
I
Top Display
Aor B
or C
Dor E
or F
![](/img.php?id=1415131&img=bg1a.png)
Identifying Status Indicators
English
14
LED Indicator
The LED indicator shows the
operational status of your radio.
Solid red –Radio is
transmitting.
Blinking red –Radio is
transmitting at low battery
condition.
Rapidly blinking red –Radio
has failed the self test upon
powering up or encountered a
fatal error.
Solid yellow –Channel is busy.
Blinking yellow –Radio is receiving a secured transmission.
Solid green –Radio is powering up, or is on a non-priority
channel while in the Scan List Programming mode.
Blinking green –Radio is receiving an individual or telephone
call, or is on a Priority-Two channel while in the Scan List
Programming mode.
Rapidly blinking green –Radio is on a Priority-One channel
while in the Scan List Programming mode.
Enhanced Zone Bank
A= Contains Zone 1, Zone 2 and Zone 3,
B= Contains Zone 4, Zone 5 and Zone 6,
C = Contains Zone 7, Zone 8 and Zone 9,
.
.
.
X= Contains Zone 70, Zone 71 and Zone 72,
Y= Contains Zone 73, Zone 74 and Zone 75.
Secure Operation
•On = Secure operation.
•Off = Clear operation.
•Blinking = Receiving an encrypted voice call.
Bluetooth On
Bluetooth is on and ready for bluetooth
connection.
Bluetooth Connected
Bluetooth is currently connected to the external
bluetooth device.
A,B,
C... ...
x or y
G
b
a
LED Indicator
![](/img.php?id=1415131&img=bg1b.png)
Identifying Status Indicators
English
15
Intelligent Lighting Indicators
This feature temporary changes the backlight of the top display screen to help signal that a radio event has occurred.
Note: This feature must be preprogrammed by a qualified radio technician.
Backlight Notification When
Orange Emergency Alerts The radio initiates an emergency alarm or call.
The radio receives an emergency alarm or call.
Red Critical Alerts
The radio battery is low.
The radio is out of range.
The radio enters failsoft mode.
The radio is unable to establish a full connection with the system.
The radio is unable to authenticate or register with the system.
Green Call Alerts
The radio receives a private call.
The radio receives a phone call.
The radio receives a call alert.
The radio receives a selective call.
![](/img.php?id=1415131&img=bg1c.png)
Identifying Status Indicators
English
16
Alert Tones
An alert tone is a sound or group of sounds. Your radio uses alert tones to inform you of your radio’s conditions. The following table
lists these tones and when they occur.
You Hear Tone Name Heard
Short,
Low-Pitched
Tone
Radio Self Test Fail When radio fails its power-up self test.
Reject When unauthorized request is made.
Time-Out Timer Warning Four seconds before time out.
No ACK Received When radio fails to receive an acknowledgment.
Individual Call
Warning Tone When radio is in an individual call for greater than 6 seconds without any activity.
Long,
Low-Pitched
Tone
Time-Out Timer
Timed Out After time out.
Talk Prohibit/PTT Inhibit (When PTT button is pressed) transmissions are not allowed.
Out of Range (When PTT button is pressed) the radio is out of range of the system.
Invalid Mode When radio is on an unpreprogrammed channel.
A Group of
Low-Pitched
Tones
Busy When the system is busy.
![](/img.php?id=1415131&img=bg1d.png)
Identifying Status Indicators
English
17
Short,
Medium-Pitched
Tone
Valid Key-Press When correct key is pressed.
Radio Self Test Pass When radio passes its power-up self test.
Clear Voice At beginning of a non-coded communication.
Priority Channel
Received When activity on a priority channel is received.
Emergency Alarm Entry When entering the emergency state.
Central Echo When central controller has received a request from a radio.
Long,
Medium-Pitched
Tone
Volume Set When volume is changed on a quiet channel.
Emergency Exit When exiting the emergency state.
A Group of
Medium-Pitched
Tones
Failsoft When the trunking system fails.
Automatic Call Back When voice channel is available from previous request.
Talk Permit (When PTT button is pressed) verifying system accepting transmissions.
Keyfail When encryption key has been lost.
Console Acknowledge When emergency alarm, or reprogram request ACK is received.
Received Individual Call When Call Alert or Private Call is received.
Site Trunking When a SmartZone trunking system fails.
You Hear Tone Name Heard
![](/img.php?id=1415131&img=bg1e.png)
Identifying Status Indicators
English
18
Short,
High-Pitched
Tone (Chirp)
Low-Battery Chirp When battery is below preset threshold value.
Ringing
Fast Ringing When system is searching for target of Private Call.
Enhanced Call Sent When waiting for target of Private Call to answer the call.
Phone Call Received When a land-to-mobile phone call is received.
Gurgle Dynamic Regrouping (When the PTT button is pressed) a dynamic ID has been received.
Unique,
Low-Pitched
Chirp
New Message When a new message is received.
Unique,
High-Pitched
Chirp
Priority Status When a priority message is received.
Incremental-
Pitched Tone
Bluetooth Paired Tone When Bluetooth accessory is paired with the radio.
Bluetooth Connected Tone When Bluetooth accessory is connected to the radio.
Decremental-
Pitched Tone
Bluetooth Unpaired Tone When Bluetooth accessory is unpaired from the radio.
Bluetooth Disconnected
Tone When Bluetooth accessory is disconnected from the radio.
You Hear Tone Name Heard
![](/img.php?id=1415131&img=bg1f.png)
General Radio Operation
English
19
General Radio Operation
Once you understand how your APX 6000 Portable is
configured, you are ready to use your radio.
Use this navigation guide to familiarize yourself with the basic
Call features:
Selecting a Zone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 19
Selecting a Radio Channel . . . . . . . . . . . . . . . . . . . . . page 20
Receiving and Responding to a Radio Call. . . . . . . . . page 20
Making a Radio Call . . . . . . . . . . . . . . . . . . . . . . . . . . page 23
Repeater or Direct Operation . . . . . . . . . . . . . . . . . . . page 23
Monitoring Features. . . . . . . . . . . . . . . . . . . . . . . . . . . page 24
Selecting a Zone
A zone is a group of channels.
Use the following procedure to select a zone.
Note: Your radio must be preprogrammed to allow you to use
this feature.
Procedure:
1Move the preprogrammed Zone (3-Position A/B/C) switch
to the position of the required zone.
2Press the PTT button to transmit on the displayed zone
channel.
3-Position
A/B/C Switch
![](/img.php?id=1415131&img=bg20.png)
General Radio Operation
English
20
Selecting a Radio Channel
A channel is a group of radio characteristics, such as transmit/
receive frequency pairs.
Use the following procedure to select a channel.
Note: Your radio must be preprogrammed to allow you to use
this feature. If you select a channel that is not within the
preprogrammed band, the radio indicates that it is on
an unsupported frequency with an audio warning.
Procedure:
1Turn the preprogrammed 16-Position Select knob to the
desired channel.
2Press the PTT button to transmit on the displayed zone
channel.
Receiving and Responding to a Radio Call
Once you have selected the required channel and/or zone, you
can proceed to receive and respond to calls.
The LED lights up solid red while the radio is transmitting, and
solid yellow when the radio is receiving a transmission
(conventional mode only). There is no LED indication when the
radio receives a transmission in trunking mode.
If the radio is receiving a secure transmission, the LED blinks
yellow.
LED Indicator
![](/img.php?id=1415131&img=bg21.png)
General Radio Operation
English
21
Receiving and Responding to a Talkgroup Call
To receive a call from a group of users, your radio must be
configured as part of that talkgroup.
Procedure:
When you receive a talkgroup call (while on the Home screen),
depending on how your radio is preprogrammed:
1ASTRO Conventional Only:
The LED lights up solid yellow.
OR
Trunking Only:
The display shows the caller alias or ID.
2Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from
your mouth.
3Press the PTT button to respond to the call. The LED lights
up solid red.
4Release the PTT button to listen.
See Making a Talkgroup Call on page 23 for details on making
a Talkgroup Call.
Receiving and Responding to a Private Call
(Trunking Only)
A Private Call is a call from an individual radio to another
individual radio.
These one-to-one calls between two radios are not heard by
others in the current talkgroup. The calling radio automatically
verifies that the receiving radio is active on the system and can
display the caller’s ID.
Note: The radio automatically exits the feature, if the feature
inactivity timer is enabled, when the radio is left idle
and the timer expires. You will hear the Inactive Exit
Tone upon feature exit.
Procedure:
When you receive a Private Call:
1You hear two alert tones and the LED blinks green. The
backlight of the screen turns green and the display shows
CALL RCV, alternating with the caller alias (name) or ID
(number).
![](/img.php?id=1415131&img=bg22.png)
General Radio Operation
English
22
2Press the Call Response button within 20 seconds after the
call indicators begin.
3Press and hold the PTT button to talk. Release the PTT
button to listen.
4Press the Call Response button to hang up and return to
the Home screen.
You cannot initiate a Private Call.
Receiving and Responding to a Telephone Call
(Trunking Only)
This feature allows you to receive calls similar to standard
phone calls from a landline phone.
Note: The radio automatically exits the feature, if the feature
inactivity timer is enabled, when the radio is left idle
and the timer expires. You will hear the Inactive Exit
Tone upon feature exit.
Procedure:
When you receive a Telephone Call:
1You hear a telephone-type ringing and the LED blinks green.
The backlight of the screen turns green and the display
shows PHN CALL.
2Press the Call Response button within 20 seconds after the
call indicators begin.
3Press and hold the PTT button to talk. Release the PTT
button to listen.
4Press the Call Response button to hang up and return to
the Home screen.
You cannot initiate a Telephone Call.
![](/img.php?id=1415131&img=bg23.png)
General Radio Operation
English
23
Making a Radio Call
You can select a zone, channel, or talkgroup by using:
•The preprogrammed Zone switch
•The Channel Selector Knob
Making a Talkgroup Call
To make a call to a group of users, your radio must be
configured as part of that talkgroup.
Procedure:
1Turn the Channel Selector Knob to select the channel with
the desired talkgroup.
2Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from
your mouth.
3Press the PTT button to make the call.
4ASTRO Conventional Only:
The LED lights up solid red. The display shows the
talkgroup alias or ID.
OR
Trunking Only:
The LED lights up solid red.
5Speak clearly into the microphone.
6Release the PTT button to listen.
Repeater or Direct Operation
The REPEATER operation increases the radio’s range by
connecting with other radios through a repeater. The transmit
and receive frequencies are different.
The DIRECT or “talkaround operation” allows you to bypass the
repeater and connect directly to another radio. The transmit and
receive frequencies are the same.
Procedure:
1Press the preprogrammed Repeater/Direct switch to toggle
between talkaround and repeater modes.
2The display shows RPTR MOD if the radio is currently in
Repeater mode.
OR
The display shows DIR MODE and the Talkaround icon if the
radio is currently in Direct mode (during conventional
operation only).
![](/img.php?id=1415131&img=bg24.png)
General Radio Operation
English
24
Monitoring Features
Radio users who switch from analog to digital radios often
assume that the lack of static on a digital channel is an
indication that the radio is not working properly. This is not the
case. Digital technology quiets the transmission by removing
the “noise” from the signal and allowing only the clear voice or
data information to be heard.
Use the Monitor feature to make sure a channel is clear before
transmitting.
Monitoring a Channel
Procedure:
1Press the preprogrammed Monitor button.
2Press and hold the Volume Set button to hear the volume
set tone.
3Adjust the Volume Control knob if necessary.
4Release the Volume Set button.
5Press and hold the PTT button to transmit. The LED lights
up solid red.
6Release the PTT button to receive (listen).
The Carrier Squelch indicator appears on the display when you
monitor a channel via the preprogrammed Monitor button.
Conventional Mode Operation
Your radio may be preprogrammed to receive Private-Line®
(PL) calls.
Procedure:
1Momentarily press the Monitor button to listen for activity.
The Carrier Squelch indicator appears on the display.
2Press and hold the Monitor button to set continuous
monitor operation. The duration of the button press is
programmable.
3Press the Monitor button again, or the PTT button, to return
to the original squelch setting.
If you try to transmit on a receive-only channel, you hear an
invalid tone until you release the PTT button.
![](/img.php?id=1415131&img=bg25.png)
Advanced Features
English
25
Advanced Features
Use this navigation guide to learn more about advanced
features available with your radio:
Advanced Call Features . . . . . . . . . . . . . . . . . . . . . . . page 25
Scan Lists . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 27
Scan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 28
Call Alert Paging . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 30
Emergency Operation . . . . . . . . . . . . . . . . . . . . . . . . . page 30
Secure Operations. . . . . . . . . . . . . . . . . . . . . . . . . . . . page 34
Trunking System Controls . . . . . . . . . . . . . . . . . . . . . . page 38
Mission Critical Wireless - Bluetooth - . . . . . . . . . . . . . page 40
Utilities. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 44
Advanced Call Features
Receiving and Responding to a Selective Call
(ASTRO Conventional Only)
This feature allows you to receive a call from or to call a specific
individual. It is intended to provide privacy and to eliminate the
annoyance of having to listen to conversations that are of no
interest to you.
Procedure:
1When you receive a Selective Call, you hear two alert tones
and the LED lights up solid yellow. The backlight of the
screen momentarily turns green and the display briefly
shows CALL RCV.
2The speaker unmutes.
3Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from
your mouth.
4Press and hold the PTT button to talk. Release the PTT
button to listen.
You cannot initiate a Selective Call.
![](/img.php?id=1415131&img=bg26.png)
Advanced Features
English
26
Using the Dynamic Regrouping Feature (Trunking
Only)
This feature allows the dispatcher to temporarily reassign
selected radios to a single special channel so they can
communicate with each other. This feature is typically used
during special operations and is enabled by a qualified radio
technician.
You will not notice whether your radio has this feature enabled
until a dynamic regrouping command is sent by the dispatcher.
Note: If you try to access a zone or channel that has been
reserved by the dispatcher as a dynamically regrouped
mode for other users, an invalid tone sounds.
Procedure:
1When your radio is dynamically regrouped, it automatically
switches to the dynamically regrouped channel. A “gurgle”
tone sounds and the display shows the dynamically
regrouped channel’s name.
2Press the PTT button to talk. Release PTT button to listen.
When the dispatcher cancels dynamic regrouping, the radio
automatically returns to the zone and channel that you were
using before the radio was dynamically regrouped.
Requesting a Reprogram (Trunking Only)
This feature lets you notify the dispatcher that you want a new
dynamic regrouping assignment.
Procedure:
1Press the preprogrammed Reprogram Request button to
send reprogram request to the dispatcher.
2The display alternates between RPGM and PLS WAIT.
3If you hear five beeps, the dispatcher has acknowledged the
reprogram request. The display shows ACK RCVD and the
radio returns to the Home screen.
OR
If the dispatcher does not acknowledge the reprogram
request within six seconds, a low-pitched alert tone sounds
and the display shows NO ACK. The radio returns to the
Home screen.
![](/img.php?id=1415131&img=bg27.png)
Advanced Features
English
27
Classifying Regrouped Radios
The dispatcher can classify regrouped radios into either of two
categories: Select Enabled or Select Disabled.
•Select-enabled radios are free to change to any available
channel, including the dynamic-regrouping channel, once the
user has selected the dynamic-regrouping position.
•Select-disabled radios cannot change channels while
dynamically regrouped. The dispatcher has forced the radio
to remain on the dynamic-regrouping channel.
The Scan or Private Call feature cannot be selected while your
radio is Select Disabled.
Scan Lists
Scan lists are created and assigned to individual channels/
groups. Your radio scans for voice activity by cycling through
the channel/group sequence specified in the scan list for the
current channel/group.
Your radio supports different types of Scan Lists:
•Trunking Priority Monitor Scan List
•Conventional Scan List
•Talkgroup Scan List
A maximum of 200 Scan Lists can be programmed in your
radio. These lists must be preprogrammed by a qualified radio
technician.
Viewing a Scan List
Procedure:
Turn the 16-Position Select knob to view the members on the
list.
![](/img.php?id=1415131&img=bg28.png)
Advanced Features
English
28
Viewing and Changing the Priority Status
Procedure:
1Press the Top Side (Select) button to change the priority
status of the currently displayed channel or the scan list
status icon of the currently displayed channel.
2A Scan icon indicates that the current channel is in the scan
list as a non-priority channel. The LED lights up solid green.
OR
A Priority-Two Channel Scan icon indicates that the current
channel is in the scan list as the Priority-Two channel. The
LED blinks green.
OR
A Priority-One Channel Scan icon indicates that the current
channel is in the scan list as the Priority-One channel. The
LED rapidly blinks green. You hear all traffic on the Priority-
One channel, regardless of traffic on non-priority channels.
OR
No icon indicates that the current channel is deleted from
the scan list.
Scan
This feature allows you to monitor traffic on different channels
by scanning a preprogrammed list of channels.
Turning Scan On or Off
Procedure:
1Press the preprogrammed Scan button, or turn the
preprogrammed Scan switch to the Scan on or Scan off
position.
2The display shows SCAN ON and the scan icon, indicating
that scan is enabled.
OR
The display shows SCAN OFF, indicating that scan is
disabled.
![](/img.php?id=1415131&img=bg29.png)
Advanced Features
English
29
Making a Dynamic Priority Change (Conventional
Scan Only)
While the radio is scanning, the dynamic priority change feature
allows you to temporarily assign any channel in a scan list
(except for the Priority-One channel) as the Priority-Two
channel.
This change remains in effect until scan is turned off. Scan then
reverts to the preprogrammed (original) setting.
Procedure:
1When the radio locks onto the channel designated as the
new Priority-Two channel, press the preprogrammed
Dynamic Priority button.
2The radio continues scanning the remaining channels in the
list.
Deleting a Nuisance Channel
If a channel continually generates unwanted calls or noise
(termed a “nuisance” channel), you can temporarily remove the
unwanted channel from the scan list.
This capability does not apply to priority channels or the
designated transmit channel.
Note: Deleting a “nuisance” channel is only possible through
the preprogrammed Nuisance Channel Delete
button.
Procedure:
1When the radio is locked onto the channel to be deleted,
press the preprogrammed Nuisance Delete button.
2The radio continues scanning the remaining channels in the
list.
Restoring a Nuisance Channel
Procedure:
To restore the deleted nuisance channel, do one of the
following:
•Turn the radio off and then turning it on again.
OR
•Stop and restart a scan via the preprogrammed Scan button.
OR
•Change the channel via the 16-Position Select knob.
![](/img.php?id=1415131&img=bg2a.png)
Advanced Features
English
30
Call Alert Paging
This feature allows your radio to work like a pager.
Note: This feature must be preprogrammed by a qualified
radio technician.
Receiving a Call Alert Page
Procedure:
1When you receive a Call Alert page, you hear four repeating
alert tones and the LED blinks green.
2The backlight of the screen turns green and the display
briefly shows PAGE RCV.
You cannot send a Call Alert page.
Emergency Operation
The Emergency feature is used to indicate a critical situation.
If the Top (Orange) button is preprogrammed to send an
emergency signal, this signal overrides any other
communication over the selected channel.
Your radio supports the following Emergency modes:
•Emergency Alarm
•Emergency Call (Trunking Only)
•Emergency Alarm with Emergency Call
•Silent Emergency Alarm
Check with your dealer or system administrator for more
information on the programming of this feature.
Only one of the Emergency modes above can be assigned to
the preprogrammed Emergency button.
Note: To exit emergency at any time, press and hold the
preprogrammed Emergency button for about a
second.
![](/img.php?id=1415131&img=bg2b.png)
Advanced Features
English
31
Sending an Emergency Alarm
This feature allows you to send a data transmission, which
identifies the radio sending the emergency, to the dispatcher.
Procedure:
1Press the preprogrammed Emergency button.
2The display shows EMERGNCY and the current zone or
channel. A short, medium-pitched tone sounds and the
LED rapidly blinks red.
OR
An invalid tone sounds, if the selected channel does not
support emergency.
3When you receive the dispatcher’s acknowledgment, the
display shows ACK RCVD. Four tones sound, the alarm
ends, and the radio exits the Emergency Alarm mode.
OR
If no acknowledgement is received, the display shows
NO ACK. The alarm ends and the radio exits the Emergency
Alarm mode.
Sending an Emergency Call (Trunking Only)
This feature gives your radio priority access on a channel.
Note: The radio operates in the normal dispatch manner
while in Emergency Call, except, if enabled, it returns
to one of the following:
•Tactical/Non-Revert – You talk on the channel you
selected before you entered the emergency state.
•Non-Tactical/Revert – You talk on a
preprogrammed emergency channel. The
emergency alarm is sent on this same channel.
Procedure:
1Press the preprogrammed Emergency button.
2The display shows EMERGNCY and the current zone or
channel. A short, medium-pitched tone sounds and the
LED rapidly blinks red.
OR
An invalid tone sounds, if the selected channel does not
support emergency.
![](/img.php?id=1415131&img=bg2c.png)
Advanced Features
English
32
3Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from
your mouth.
4Press and hold the PTT button. Speak clearly into the
microphone.
5Release the PTT button to end the transmission and wait for
a response from the dispatcher.
6Press and hold the preprogrammed Emergency button for
about a second to exit the Emergency Call mode.
Sending an Emergency Alarm with Emergency
Call
Procedure:
1Press the preprogrammed Emergency button.
2The display shows EMERGNCY and the current zone or
channel. A short, medium-pitched tone sounds and the
LED rapidly blinks red.
OR
An invalid tone sounds, if the selected channel does not
support emergency.
3The radio enters the Emergency Call state when:
You receive the dispatcher’s acknowledgment. The display
shows ACK RCVD.
OR
You receive no acknowledgement. The display shows
NO ACK.
OR
You press the PTT button while in the Emergency Alarm
mode.
4Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from
your mouth.
5Press and hold the PTT button. Speak clearly into the
microphone.
6Release the PTT button to end the transmission and wait for
a response from the dispatcher.
7Press and hold the preprogrammed Emergency button for
about a second to exit the Emergency Call mode.
![](/img.php?id=1415131&img=bg2d.png)
Advanced Features
English
33
Sending a Silent Emergency Alarm
This feature allows you to send an Emergency Alarm to another
radio without any audio or visual indicators.
Procedure:
1Press the preprogrammed Emergency button.
2The display shows no changes, the LED does not light up,
and you hear no tones.
3The silent emergency state continues until you:
Press and hold the preprogrammed Emergency button for
about a second to exit the Silent Emergency Alarm mode.
OR
Press and release the PTT button to exit the Silent
Emergency Alarm mode and enter regular dispatch or
Emergency Call mode.
Note: For ALL Emergency signals, when changing channels:
•If the new channel is also preprogrammed for
Emergency, you can change channels while in
Emergency operation. The emergency alarm or call
continues on the new channel.
•If the new channel is NOT preprogrammed for
Emergency, the display shows NO EMERG, and you
hear an invalid tone until you exit the Emergency
state or change to a channel preprogrammed for
Emergency.
Using the Emergency Keep-Alive Feature
This feature, when enabled, prevents the radio from being
turned off via the On/Off Control knob when the radio is in the
Emergency state.
Note: The radio only exits the Emergency state using one of
the ways mentioned in the previous sections.
See Sending an Emergency Alarm on page 31,
Sending an Emergency Call (Trunking Only) on
page 31, Sending an Emergency Alarm with
Emergency Call on page 32, or Sending a Silent
Emergency Alarm on page 33.
![](/img.php?id=1415131&img=bg2e.png)
Advanced Features
English
34
Secure Operations
Secure radio operation provides the highest commercially
available level of voice security on both trunked and
conventional channels.
Unlike other forms of security, Motorola digital encryption
provides signaling that makes it virtually impossible for others to
decode any part of an encrypted message.
Selecting Secure Transmissions
Procedure:
Turn the preprogrammed Secure/Clear switch to the secure
position.
Note: If the selected channel is preprogrammed for clear-only
operation – when you press the PTT button, an invalid
mode tone sounds and the display shows CLR TX.
The radio will not transmit until you set the Secure/
Clear switch to the clear position.
Selecting Clear Transmissions
Procedure:
Turn the preprogrammed Secure/Clear switch to the clear
position.
Note: If the selected channel is preprogrammed for secure-
only operation – when you press the PTT button, an
invalid mode tone sounds and the display shows SEC
TX.
The radio will not transmit until you set the Secure/
Clear switch to the secure position.
![](/img.php?id=1415131&img=bg2f.png)
Advanced Features
English
35
Managing Encryption
Loading an Encryption Key
Note: Refer to the key-variable loader (KVL) manual for
equipment connections and setup.
Procedure:
1Attach the KVL to your radio.
2The display shows KEYLOAD, and all other radio functions,
except for power down, backlight, and volume, are locked
out.
3Select the required keys and press the Menu Select button
directly below LOAD on the KVL. This loads the encryption
keys into your radio.
4When the key has been loaded successfully, the radio
sounds a short tone for single-key radios.
OR
When the key has been loaded successfully, the radio
sounds an alternating tone for multikey radios.
Using the Multikey Feature
This feature allows the radio to be equipped with different
encryption keys and supports the DES-OFB algorithm.
There are two types:
•Conventional Multikey – The encryption keys can be tied
(strapped), on a one-per-channel basis, through Customer
Programming Software. In addition, you can have operator-
selectable keys, operator-selectable keysets, and operator-
selectable key erasure. If talkgroups are enabled in
conventional, then the encryption keys are strapped to the
talkgroups.
•Trunked Multikey – If you use your radio for both
conventional and trunked applications, you have to strap your
encryption keys for trunking on a per-talkgroup or
announcement-group basis. In addition, you may strap a
different key to other features, such as dynamic regrouping,
failsoft, or emergency talkgroup. You can have operator-
selectable key erasure.
![](/img.php?id=1415131&img=bg30.png)
Advanced Features
English
36
Erasing the Selected Encryption Keys
This feature allows you to erase all or selected encryption keys.
Procedure:
Use the preprogrammed Top Side (Select) button and Top
(Orange) button to erase the single key in radios with the
single-key option, and to erase all keys in radios with the
multikey option.
1Press and hold the Top Side (Select) button.
2While holding Top Side (Select) button down, press the Top
(Orange) button.
3The display shows PLS WAIT.
4When all the encryption keys have been erased, the display
shows ALL ERASED.
Note: DO NOT press the Top (Orange) button before
pressing the Top Side (Select) button, unless you are
in an emergency situation as this sends an emergency
alarm.
Requesting an Over-the-Air Rekey (ASTRO
Conventional Only)
This feature, also known as OTAR, allows the dispatcher to
reprogram the encryption keys in the radio remotely. The
dispatcher performs the rekey operation upon receiving a rekey
request from the user.
Procedure:
1Press and hold the preprogrammed Rekey Request button
to send the rekey request.
2If the rekey operation fails, a bad-key tone sounds and the
display shows RKY FAIL.
Note: The rekey operation failure indicates that your radio
does not contain the Unique Shadow Key (USK). This
key must be loaded into the radio with the key-variable
loader (KVL) before the rekey request can be sent.
Refer to your local key management supervisor for
more information.
![](/img.php?id=1415131&img=bg31.png)
Advanced Features
English
37
MDC Over-the-Air Rekeying (OTAR) Page
This feature allows to view or define MDC Over-the-Air
Rekeying (OTAR) features.It is applied only when operating in
secure encrypted mode and only for conventional
communications. In additional to Rekey Requests, OTAR
transmissions include Delayed Acknowledgements, and Power-
up Acknowledgements.
Some of the options selected may also need to be set up at the
Key Management Controller (KMC) site to work properly.
Note: This feature must be preprogrammed by a qualified
radio technician. Check with your dealer or system
administrator for more information.
Hear Clear
There are two components of Hear Clear.
1Companding:
Reduces the channel noise, e.g. OTA transmission, that is
predominantly present in UHF2 and 900 MHz channel with
the following features.
•Compressor – reduces the background noise flow and the
speech signal at transmitting radio.
•Expander – expands the speech while the noise flow
remains the same at receiving radio.
2Random FM Noise Canceller (Flutter Fighter):
Reduces the unwanted effects of random FM noise pulses
caused by channel fading under high Signal-to-Noise (S/N)
conditions such as in a moving in a transportation. The fading
effects, heard as audio pops and clicks, are cancelled without
affecting the desired audio signal.
The Random FM Noise Canceller operates only in receive
mode.
Note: This feature must be preprogrammed by a qualified
radio technician. Check with your dealer or system
administrator for more information.
![](/img.php?id=1415131&img=bg32.png)
Advanced Features
English
38
Trunking System Controls
Using the Failsoft System
The failsoft system ensures continuous radio communications
during a trunked system failure. If a trunking system fails
completely, the radio goes into failsoft operation and
automatically switches to its failsoft channel.
Procedure:
1During failsoft operation, your radio transmits and receives
in conventional operation on a predetermined frequency.
2A medium-pitched tone sounds every 10 seconds and the
display shows FAILSOFT.
When the trunking system returns to normal operation, your
radio automatically leaves failsoft operation and returns to
trunked operation.
Going Out of Range
When your radio goes out of the range of the system, it can no
longer lock onto a control channel.
Procedure:
1A low-pitched tone sounds.
AND/OR
The display shows the currently selected zone/channel
combination and OUT RNG.
2Your radio remains in this out-of-range condition until:
It locks onto a control channel.
OR
It locks onto a failsoft channel.
OR
It is turned off.
![](/img.php?id=1415131&img=bg33.png)
Advanced Features
English
39
Using the Site Trunking Feature
If the zone controller loses communication with any site, that
site reverts to site trunking.
The display shows the currently selected zone/channel
combination and STE TRNK.
Note: When this occurs, you can communicate only with
other radios within your trunking site.
Locking and Unlocking a Site
This feature allows your radio to lock onto a specific site and not
roam among wide-area talkgroup sites. This feature should be
used with caution, since it inhibits roaming to another site in a
wide-area system.
Procedure:
1Use the preprogrammed Site Lock/Unlock button to toggle
the lock state between locked and unlocked.
2The radio saves the new site lock state and returns to the
Home screen.
Viewing and Changing a Site
This feature allows you to view the number of the current site or
force your radio to change to a new one.
Viewing the Current Site
Procedure:
1Press the preprogrammed Site Search button.
2The display momentarily shows the name of the current
site and its corresponding received signal strength indicator
(RSSI).
Changing the Current Site
Procedure:
1Press and hold down the preprogrammed Site Search
button.
2A tone sounds and the display momentarily shows
SCANNING.
3When the radio finds a new site, it returns to the Home
screen.
![](/img.php?id=1415131&img=bg34.png)
Advanced Features
English
40
Mission Critical Wireless
- Bluetooth -
Note: The use of this feature requires the "Full Feature"
expansion board and the purchase of the Bluetooth
Software.
This feature allows the Radio to extend its functionality by
connecting to external proprietary Motorola Accessories.
The default setting for enabled Bluetooth is Bluetooth ON. See
Turning Off Bluetooth on page 40 to turn the Bluetooth OFF.
Note: Your radio must be preprogrammed to allow you to use
this feature.
Turning On Bluetooth
Procedure:
1Press the preprogrammed button to turn on the Bluetooth.
2A short, medium-pitched tone sounds. The display shows
momentary BT ON, and b appears.
OR
The display shows BT ON FL to indicate Bluetooth fails to
launch.
Turning Off Bluetooth
Procedure:
1Press the preprogrammed button to turn off the Bluetooth.
2A short, medium-pitched tone sounds. The display shows
momentary BT OFF, and b disappears.
Re-Pair Timer
There are two options for configuring the Bluetooth pairing type
on the radios. The type defines the duration the radio and the
accessory retain the pairing information.
•Immediate – When the radio and/or device is turned off after
pairing, the keys are lost. When the radio and the device are
turned back on, they cannot re-connect as the pairing keys
are lost. The user must re-pair the devices to re-establish a
new set of pairing keys. See Pairing Bluetooth Device with
the Radio on page 42.
•Infinite – When the radio and/or device are turned off after
pairing, keys are NOT lost. When the radio and the device are
turned back on, they can resume the Bluetooth connection
without user intervention.
![](/img.php?id=1415131&img=bg35.png)
Advanced Features
English
41
Bluetooth Drop Timer
The Bluetooth Drop Timer has two different settings and
functions, depending upon the selection of the Re-Pair Timer.
Check with your dealer or system administrator for more
information about these timers.
See Pairing Bluetooth Device with the Radio on page 42 to
establish the Bluetooth Connection.
Re-Pair Timer
Options Re-Pair Timer Scenarios
Immediate
•When the radio is powered OFF, pairing
key is lost immediately, and accessory
attempts to pair again. If pairing is
unsuccessful within the Drop Timer value,
the accessory automatically powers OFF.
•When the accessory is powered OFF, all
keys are lost immediately, and the user
must re-pair the devices.
•When the devices lose Bluetooth
connection, the devices will attempt to re-
establish Bluetooth Connection within the
Drop Timer value.
Infinite
•When the radio is powered OFF, the
accessory attempts to re-establish the
Bluetooth Connection for a period of time
depending upon the Drop Timer value. If
the devices fails to reconnect within the
period, the accessory then powers OFF.
Re-Pair Timer
Options Drop Timer Options
Immediate
•0 – 15 minutes buffer time to re-establish
Bluetooth Connection when the
bluetooth signal is out of range; or when
the devices are powered on/off.
Infinite
•0 – 15 minutes buffer time to re-establish
Bluetooth Connection when the
bluetooth signal is out of range; or when
the devices are powered on/off.
•2 hours, 4 hours or 8 hours period for the
devices keeping the pairing keys even
though they are disconnected or
powered off. So when they detects the
presence of each other they can
automatically re-establish the Bluetooth
Connection within this period.
![](/img.php?id=1415131&img=bg36.png)
Advanced Features
English
42
Pairing Bluetooth Device with the Radio
Note: Bluetooth range of operation is 10 meters line of sight.
This is an unobstructed path between the location of
the signal transmitter and the location of the receiver
(the Radio and the Accessory).
Obstacles that can cause an obstruction in the line of
sight include trees, buildings, mountains, cars and etc.
It is NOT recommended that the User leave their radio
behind and expect that the Accessory to work with a
high degree of reliability when they are separated.
At the fringe areas of reception both voice and tone
quality will start to sound "garbled" or "broken". To
correct this problem, simply position the Accessory and
Radio closer to each other (within the 10 meter defined
range) to re-establish clear audio reception.
Procedure:
With your radio’s Bluetooth feature ON:
1Turn on the accessory, then place it close to the radio using
the Blue dot-pairing indicator on the radio and the
accessory.
2If the pairing process is successful, the radio sounds an
incremental-pitched tone to indicate paired.
OR
If the pairing process fails, the radio sounds a short, low-
pitched tone. The display shows PAIRFAIL. Repeat step 1
again.
3The radio continues to connect to the device.
If the connecting process is successful, the radio sounds an
incremental-pitched tone. The display shows <Device
Type> CONNCTED, and aturns solid.
OR
If the connecting process fails, the radio sounds a short,
low-pitched tone. The display shows <Device Type> CON
FAIL. Repeat step 2 to reconnect the bluetooth.
OR
If the connecting process fails, the radio sounds a short,
low-pitched tone. The display shows <Device Type> CON
FAIL. After Bluetooth Drop Timer expires, if the device is still
not re-connecting with the radio, the radio sounds a
decremental-pitched tone to indicate unpaired. The display
shows <Device Type> UNPAIRED.
Bluetooth
Pairing
Indicator
![](/img.php?id=1415131&img=bg37.png)
Advanced Features
English
43
Indicating Bluetooth Connection is Lost
The radio shows solid a when the devices have a Bluetooth
connection. Below is the scenario and radio indications when
the connection is interrupted.
Procedure:
1The Bluetooth icon starts blinking for 10 seconds. The radio
sounds an decremental-pitched tone and the display shows
<Device Type> alternates with CON LOST.
2If the Bluetooth device successfully re-connects before the
Bluetooth Drop Timer expires, the display shows momentary
<Device Type> CONNCTED, and aturns solid.
OR
If reconnecting is unsuccessful after the 10 seconds blinking
timer expires, the b becomes solid.
Turning On the Bluetooth Audio (Routing the
Audio from the Radio to the Headset)
Procedure:
1Press the preprogrammed button to route the audio from the
radio to the headset.
2A short, medium-pitched tone sounds. The display shows
HDSET ON.
Turning Off the Bluetooth Audio (Routing the
Audio from the Headset to the Radio)
Procedure:
1Press the preprogrammed button to route the audio from the
headset to the radio.
2A short, medium-pitched tone sounds. The display shows
SPKR ON.
![](/img.php?id=1415131&img=bg38.png)
Advanced Features
English
44
Adjusting the Volume of the Radio from Bluetooth
Audio Device
Procedure:
With the Bluetooth audio device connected to the radio:
1Adjust volume up/down on the bluetooth audio device.
2The radio display shows VOL XX and sounds a short,
medium-pitched tone.
Clearing All Pairing Information
1Long press the preprogrammed Bluetooth On/Off button. A
short, medium-pitched tone sounds.
2The display shows PLS WAIT to indicate clearing is in
progress.
3The display shows ALL CLR to indicate clearing is
successful.
OR
The radio sounds a short, low-pitched tone. The display
shows CLR FAIL to indicate clearing has failed.
Note: If Re-Pair Timer is set to infinite and you clear keys on
the radio, you must clear keys on all previously paired
devices as well. (Please see your accessories manual
for further details.)
Utilities
Using the Flip Display
This feature allows you to flip the content of the top display
upside down. It is particularly useful when you would like to read
the top display while the radio is still in the attached to your belt.
Procedure:
Press and hold the preprogrammed Light button to flip the
display.
Selecting a Basic Zone Bank
This feature allows twice as many zones to be accessed from a
switch, doubling the amount of switch positions.
Note: The Zone Select feature must to be preprogrammed to
the 3-position A-B-C switch, while the Basic Zone Bank
feature must be preprogrammed to any side button or
Top (Orange) button before you can use this feature.
![](/img.php?id=1415131&img=bg39.png)
Advanced Features
English
45
Procedure:
1Use the preprogrammed Basic Zone Bank button to toggle
the position between Bank 1 and Bank 2.
2The top display shows the status icons (A,B,C,D,E or F) or
the zone name based on the bank and switch position
selected.
See Basic Zone Bank 1 and Basic Zone Bank 2 on page 13
for more information on the status icons.
Selecting an Enhanced Zone Bank
This feature is created in order to allow users to communicate in
more zones. An Enhanced Zone Bank (EZB) consists of three
zones. This also means each icon A,B,C, ... or Y consist of
three zones. You can use the preprogrammed 3-position A-B-C
switch to select the first, second or third zone in an EZB.
This feature allows user to navigate from up to 75 zones in 25
EZBs.
Note: The Enhanced Zone Bank Select feature must to be
preprogrammed to the 3-position A-B-C switch, while
the Enhanced Zone Bank feature must be
preprogrammed to any side button or Top (Orange)
button before you can use this feature.
Procedure:
1Press the preprogrammed EZB Up or EZB Down button to
scroll the EZB up or down.
OR
Press and hold the preprogrammed EZB Up or EZB Down
button to fast scroll the EZB up or down.
2Turn the 3-Position A/B/C Switch to select the first, second
or third zone in the selected EZB.
![](/img.php?id=1415131&img=bg3a.png)
Advanced Features
English
46
Selecting the Power Level
You can select the power level at which your radio transmits.
The radio always turns on to the default setting.
Note: This feature must be preprogrammed by a qualified
radio technician.
Settings:
•Select Low for a shorter transmitting distance and to
conserve power.
•Select High for a longer transmitting distance.
Procedure:
1Press the preprogrammed Transmit Power Level Switch
to toggle the power level between low and high power.
2The display shows LOW PWR and the low power icon.
OR
The display shows HIGH PWR and the high power icon.
Controlling the Display Backlight
You can enable or disable the radio’s display backlight as
needed, if poor light conditions make the display difficult to read.
Procedure:
Press the preprogrammed Light button to toggle the backlight
on or off.
OR
Press any programmable radio controls or buttons to turn the
backlight on.
Note: The backlight remains on for a preprogrammed time
before it automatically turns off completely or returns to
the minimum backlight level.
![](/img.php?id=1415131&img=bg3b.png)
Advanced Features
English
47
Turning Voice Mute On or Off
You can enable and disable voice transmission, if needed.
Procedure:
1Press the preprogrammed Voice Mute button to turn the
feature off or on.
2The display momentarily shows VMUT OFF, and a short tone
sounds, indicating that the feature is disabled.
OR
The display momentarily shows VMUT ON, and a short tone
sounds, indicating that the feature is enabled.
Using the Time-Out Timer
This feature turns off your radio’s transmitter. You cannot
transmit longer than the preset timer setting.
If you attempt to do so, the radio automatically stops your
transmission, and you hear a talk-prohibit tone.
The timer is defaulted at 60 seconds, but it can be
preprogrammed from 3 to 120 seconds, in 15-second intervals,
or it can be disabled entirely for each radio mode, by a qualified
radio technician.
Note: You will hear a brief, low-pitched, warning tone four
seconds before the transmission times out.
Procedure:
1Hold down the PTT button longer than the preprogrammed
time. You hear a short, low-pitched warning tone, the
transmission is cut-off, and the LED goes out until you
release the PTT button.
2Release the PTT button. The timer resets.
3Press the PTT button to re-transmit. The time-out timer
restarts and the LED lights up solid red.
![](/img.php?id=1415131&img=bg3c.png)
Advanced Features
English
48
Using the Conventional Squelch Operation
Features
This feature filters out unwanted calls with low signal strength or
channels that have a higher than normal background noise.
Analog Options
Tone Private Line (PL), Digital Private-Line (DPL), and carrier
squelch can be available (preprogrammed) per channel.
Digital Options
One or more of the following options may be preprogrammed in
your radio. Check with your dealer or system administrator for
more information.
Mode Result
Carrier squelch (C) You hear all traffic on a channel.
PL or DPL The radio responds only to your
messages.
Option Result
Digital Carrier-Operated
Squelch (COS) You hear any digital traffic.
Normal Squelch You hear any digital traffic having
the correct network access code.
Selective Switch
You hear any digital traffic having
the correct network access code
and correct talkgroup.
![](/img.php?id=1415131&img=bg3d.png)
Advanced Features
English
49
Using the PL Defeat Feature
This feature allows you to override any coded squelch (DPL or
PL) that might be preprogrammed to a channel. The radio will
also unmute to any digital activity on a digital channel.
Procedure:
Place the preprogrammed PL Defeat switch in the PL Defeat
position. You hear any activity on the channel.
OR
The radio is muted if no activity is present.
Note: When this feature is active, the Carrier Squelch status
indicator is displayed.
Using the Digital PTT ID Feature
This feature allows you to see the radio ID (number) of the radio
from whom you are currently receiving a transmission. This ID,
consisting up to a maximum of eight characters, can be viewed
by both the receiving radio and the dispatcher.
Your radio’s ID number is also automatically sent every time the
PTT button is pressed. This is a per-channel feature. For digital
voice transmissions, your radio’s ID is sent continuously during
the voice message.
Using the Smart PTT Feature (Conventional Only)
Smart PTT is a per-personality, programmable feature used in
conventional radio systems to keep radio users from talking
over other radio conversations.
When smart PTT is enabled in your radio, you cannot transmit
on an active channel.
![](/img.php?id=1415131&img=bg3e.png)
Advanced Features
English
50
If you try to transmit on an active smart-PTT channel, you hear
an alert tone, and the transmission is inhibited. The LED lights
up solid yellow to indicate that the channel is busy.
Three variations of smart PTT are available:
Voice Announcement
This feature enables the radio to audibly indicate the current
feature mode, Zone or Channel the user has just assigned. This
audio indicator can be customized per customer requirements.
This is typically useful when the user is in a difficult condition to
read the content shown on the display.
Each voice announcement is within a limit of three seconds
maximum. The sum total duration for all voice announcements
in a radio shall be no more than 1000 seconds.
Note: This feature must be preprogrammed by a qualified
radio technician.
The features which Voice Announcement supports are:
•Zone
•Channel
•Scan
•PL Disabled
•Talkaround/Direct
•Tx Inhibit
Note: Voice announcements support certain number of zone-
channel, but not all.
Seek advice from your dealer or qualified technician for
the best selections for this feature.
Transmit Inhibit
on Busy Channel
with Carrier
You cannot transmit if any traffic is
detected on the channel.
Transmit Inhibit
on Busy Channel
with Wrong
Squelch Code
You cannot transmit on an active
channel with a squelch code or
(if secure-equipped) encryption key
other than your own. If the PL code is
the same as yours, the transmission is
not prevented.
Quick-Key
Override
This feature can work in conjunction
with either of the two above variations.
You can override the transmit-inhibit
state by quick-keying the radio. In other
words, two PTT button presses within
the preprogrammed time limit.
![](/img.php?id=1415131&img=bg3f.png)
Advanced Features
English
51
The two options of priority for the Voice Announcement
available are:
•High – enables the voice of the feature to announce even
when the radio is receiving calls.
•Low – disables the voice of the feature from announcing
when the radio is receiving calls.
Procedure:
You hear a voice announcement when the features below are
preprogrammed in the radio.
•The radio powers up. The radio announces the current zone
and channel it is transmitting.
•Press the preprogrammed voice announcement button
(which specifically programmed to playback the current zone
and channel). The radio announces the current zone and
channel it is transmitting.
Note: Pressing this preprogrammed playback button will
always enable the voice feature to announce in High
priority.
All the three programmable buttons at the side of the
radio support this feature.
•Change to a new zone. The radio announces the current
zone and channel it is transmitting.
•Change to a new channel remaining within the current zone.
The radio announces the current channel.
•Press either the preprogrammed button or switch of the radio
to launch or terminate Scan, PL Disabled, Talkaround/Direct
or Transmit Inhibit. The radio announces the corresponding
feature activation.
![](/img.php?id=1415131&img=bg40.png)
Helpful Tips
English
52
Helpful Tips
Take a moment to review the following:
Caring for Your Radio . . . . . . . . . . . . . . . . . . . . . . . . . page 52
Cleaning Your Radio . . . . . . . . . . . . . . . . . . . . . . . . page 53
Handling Your Radio . . . . . . . . . . . . . . . . . . . . . . . . page 53
Servicing Your Radio . . . . . . . . . . . . . . . . . . . . . . . . page 54
Taking Care of the Battery. . . . . . . . . . . . . . . . . . . . . . page 54
Checking the Battery Charge Status . . . . . . . . . . . . page 54
Battery Recycling and Disposal. . . . . . . . . . . . . . . . page 55
Caring for Your Radio
•The APX 6000 radio
casting has a vent
port that allows for
pressure equalization
in the radio. Never
poke this vent with
any objects, such as
needles, tweezers, or
screwdrivers. This
could create leak
paths into the radio
and the radio’s
submergibility will be
lost.
•(For APX 6000 R
Radios Only)
The APX 6000 R
radio is designed to be submerged to a
maximum depth of 6 feet, with a maximum
submersion time of 2 hours. Exceeding either
maximum limit may result in damage to the
radio.
!
Vent
Port
![](/img.php?id=1415131&img=bg41.png)
Helpful Tips
English
53
Cleaning Your Radio
To clean the external surfaces of your radio:
1Combine one teaspoon of mild dishwashing detergent to
one gallon of water (0.5% solution).
2Apply the solution sparingly with a stiff, non-metallic, short-
bristled brush, making sure excess detergent does not get
entrapped near the connectors, controls or crevices. Dry the
radio thoroughly with a soft, lint-free cloth.
3Clean battery contacts with a lint-free cloth to remove dirt or
grease.
Handling Your Radio
•Do not pound, drop, or throw the radio unnecessarily. Never
carry the radio by the antenna.
•Avoid subjecting the radio to an excess of liquids. Do not
submerge the radio unless it is a ruggedized, APX 6000 R
model.
•(For APX 6000 R Radios Only)
Elastomer technology materials used for seals
in rugged portable radios can age with time and
environmental exposure. Therefore, Motorola
recommends that rugged radios be checked
annually as a preventive measure in order to
assure the watertight integrity of the radio.
Motorola details the disassembly, test, and
reassembly procedures along with necessary
test equipment needed to inspect, maintain and
troubleshoot radio seals in the radio’s service
manual.
•If the radio battery contact area has been
submerged in water, dry and clean the radio
battery contacts before attaching a battery to the
radio. Otherwise, the water could short-circuit
the radio.
•If the radio has been submerged in water, shake
the radio well so that any water that may be
trapped inside the speaker grille and
microphone port can be removed. Otherwise,
the water will decrease the audio quality of the
radio.
•Do not disassemble the radio. This could
damage radio seals and result in leak paths into
the radio. Any radio maintenance should be
performed only by a qualified radio technician.
!
Do not use solvents to clean your radio. Spirits
may permanently damage the radio housing.
Do not submerge the radio in the detergent
solution.
!
![](/img.php?id=1415131&img=bg42.png)
Helpful Tips
English
54
•Avoid subjecting the radio to corrosives, solvents or spirits.
•Do not disassemble the radio.
•Keep the accessory-connector cover in place until ready to
use the connector. Replace the cover immediately once the
accessory has been disconnected.
Servicing Your Radio
Proper repair and maintenance procedures will assure efficient
operation and long life for this product. A Motorola maintenance
agreement will provide expert service to keep this and all other
communication equipment in perfect operating condition. A
nationwide service organization is provided by Motorola to
support maintenance services. Through its maintenance and
installation program, Motorola makes available the finest
service to those desiring reliable, continuous communications
on a contract basis. For a contract service agreement, please
contact your nearest Motorola service or sales representative,
or an authorized Motorola dealer.
Express Service Plus (ESP) is an optional extended service
coverage plan, which provides for the repair of this product for
an additional period of either one or two years beyond the
normal expiration date of the standard warranty. For more
information about ESP, contact the Motorola Radio Support
Center at 3761 South Central Avenue, Rockford, IL 61102 (800)
227-6772 / (847)725-4200.
Taking Care of the Battery
Checking the Battery Charge Status
Your radio can indicate the battery’s charge status through:
•the LED and sounds.
•the fuel gauge icon on the display.
LED and Sounds
When your battery is low:
•the LED blinks red when the PTT button is pressed.
•you hear a low-battery “chirp” (short, high-pitched tone).
Fuel Gauge Icon
A blinking fuel gauge icon ( ) is displayed only when the
battery voltage drops to low level. In this case, replace the
battery with a fully charged one.
0
![](/img.php?id=1415131&img=bg43.png)
Helpful Tips
English
55
Battery Recycling and Disposal
In the U.S. and Canada, Motorola participates in the nationwide
Rechargeable Battery Recycling Corporation (RBRC) program
for NiCd battery collection and recycling. Many retailers and
dealers participate in this program.
For the location of the drop-off facility closest to you, access
RBRC's Internet web site at www.rbrc.com or call 1-800-8-
BATTERY. This internet site and telephone number also provide
other useful information concerning recycling options for
consumers, businesses, and governmental agencies.
Gauge Battery Charge
76% to 100% full
51% to 75%
26% to 50%
11% to 25%
10% or less (at 10%, the gauge begins blinking)
U
T
S
R
Q
![](/img.php?id=1415131&img=bg44.png)
Accessories
English
56
Accessories
For a list of Motorola-approved antennas and other accessories,
visit the following website:
http://www.motorola.com/governmentandenterprise
On the website, search for APX 6000 Portable Radio. You will
see the accessories information besides the specifications of
the radio. You can also contact your dealer for details. Contact
your dealer for details.
The certifications for the accessories are as below.
VHF Band (FCC ID: AZ489FT3824)
UHF Band (FCC ID: AZ489FT4899)
700/800 MHz Band (FCC ID: AZ489FT5859)
Bluetooth Enabled Models:
VHF Band (FCC ID: AZ489FT3829)
UHF Band (FCC ID: AZ489FT4892)
700/800 MHz Band (FCC ID: AZ489FT5863)
![](/img.php?id=1415131&img=bg45.png)
Appendix: Maritime Radio Use in the VHF Frequency Range
English
57
Appendix: Maritime Radio Use in the
VHF Frequency Range
Take a moment to review the following:
Special Channel Assignments . . . . . . . . . . . . . . . . . . . page 57
Operating Frequency Requirements . . . . . . . . . . . . . . page 58
Special Channel Assignments
Emergency Channel
If you are in imminent and grave danger at sea and require
emergency assistance, use VHF Channel 16 to send a distress
call to nearby vessels and the United States Coast Guard.
Transmit the following information, in this order:
1“MAYDAY, MAYDAY, MAYDAY.”
2“THIS IS _____________________, CALL SIGN
__________.”
State the name of the vessel in distress 3 times, followed
by the call sign or other identification of the vessel, stated 3
times.
3Repeat “MAYDAY” and the name of the vessel.
4“WE ARE LOCATED AT _______________________.”
State the position of the vessel in distress, using any
information that will help responders to locate you, e.g.:
• latitude and longitude
• bearing (state whether you are using true or magnetic
north)
• distance to a well-known landmark
• vessel course, speed or destination
5State the nature of the distress.
6Specify what kind of assistance you need.
7State the number of persons on board and the number
needing medical attention, if any.
8Mention any other information that would be helpful to
responders, such as type of vessel, vessel length and/or
tonnage, hull color, etc.
9“OVER.”
10 Wait for a response.
11 If you do not receive an immediate response, remain by the
radio and repeat the transmission at intervals until you
receive a response. Be prepared to follow any instructions
given to you.
Non-Commercial Call Channel
For non-commercial transmissions, such as fishing reports,
rendezvous arrangements, repair scheduling, or berthing
information, use VHF Channel 9.
![](/img.php?id=1415131&img=bg46.png)
Appendix: Maritime Radio Use in the VHF Frequency Range
English
58
Operating Frequency Requirements
A radio designated for shipboard use must comply with Federal
Communications Commission Rule Part 80 as follows:
• on ships subject to Part II of Title III of the Communications
Act, the radio must be capable of operating on the 156.800
MHz frequency
• on ships subject to the Safety Convention, the radio must be
capable of operating:
• in the simplex mode on the ship station transmitting
frequencies specified in the 156.025 – 157.425 MHz
frequency band, and
• in the semiduplex mode on the two frequency channels
specified in the table below.
Note: Simplex channels 3, 21, 23, 61, 64, 81, 82, and 83
cannot be lawfully used by the general public in US
waters.
Additional information about operating requirements in the
Maritime Services can be obtained from the full text of FCC
Rule Part 80 and from the US Coast Guard.
Table A-1: VHF Marine Channel List
Channel
Number
Frequency (MHz)
Transmit Receive
1 156.050 160.650
2 156.100 160.700
* 156.150 160.750
4 156.200 160.800
5 156.250 160.850
6 156.300 –
7 156.350 160.950
8 156.400 –
9 156.450 156.450
10 156.500 156.500
11 156.550 156.550
12 156.600 156.600
13** 156.650 156.650
14 156.700 156.700
15** 156.750 156.750
16 156.800 156.800
17** 156.850 156.850
18 156.900 161.500
19 156.950 161.550
20 157.000 161.600
* 157.050 161.650
22 157.100 161.700
Table A-1: VHF Marine Channel List (Continued)
Channel
Number
Frequency (MHz)
Transmit Receive
![](/img.php?id=1415131&img=bg47.png)
Appendix: Maritime Radio Use in the VHF Frequency Range
English
59
* Simplex channels 3, 21, 23, 61, 64, 81, 82, and 83 cannot be
lawfully used by the general public in US waters.
** Low power (1 W) only
*** Guard band
Note: A – in the Receive column indicates that the channel is
transmit only.
* 157.150 161.750
24 157.200 161.800
25 157.250 161.850
26 157.300 161.900
27 157.350 161.950
28 157.400 162.000
60 156.025 160.625
* 156.075 160.675
62 156.125 160.725
63 156.175 160.775
* 156.225 160.825
65 156.275 160.875
66 156.325 160.925
67** 156.375 156.375
68 156.425 156.425
69 156.475 156.475
71 156.575 156.575
72 156.625 –
73 156.675 156.675
74 156.725 156.725
Table A-1: VHF Marine Channel List (Continued)
Channel
Number
Frequency (MHz)
Transmit Receive
75 *** ***
76 *** ***
77** 156.875 –
78 156.925 161.525
79 156.975 161.575
80 157.025 161.625
* 157.075 161.675
* 157.125 161.725
* 157.175 161.775
84 157.225 161.825
85 157.275 161.875
86 157.325 161.925
87 157.375 161.975
88 157.425 162.025
Table A-1: VHF Marine Channel List (Continued)
Channel
Number
Frequency (MHz)
Transmit Receive
![](/img.php?id=1415131&img=bg48.png)
Glossary
English
60
Glossary
This glossary is a list of specialized terms used in this manual.
Term Definition
ACK Acknowledgment of communication.
Active Channel A channel that has traffic on it.
Analog Signal An RF signal that has a continuous nature
rather than a pulsed or discrete nature.
ARS Automatic Registration Service
ASTRO 25
Trunking
Motorola standard for wireless digital
trunked communications.
ASTRO
Conventional
Motorola standard for wireless digital
conventional communications.
Autoscan
A feature that allows the radio to
automatically scan the members of a scan
list.
Bluetooth
Bluetooth is an open wireless technology
standard for exchanging data over short
distances from fixed and mobile devices
with high levels of security.
Bluetooth
Pairing
Bluetooth pairing occurs when two
bluetooth devices exchanged a passkey to
form a paired Bluetooth wireless
connection.
Call Alert Privately page an individual by sending an
audible tone.
Carrier Squelch
Feature that responds to the presence of
an RF carrier by opening or unmuting
(turning on) a receiver’s audio circuit. A
squelch circuit silences the radio when no
signal is being received so that the user
does not have to listen to “noise”.
Central
Controller
A software-controlled, computer-driven
device that receives and generates data for
the trunked radios assigned to it. It
monitors and directs the operations of the
trunked repeaters.
Channel
A group of characteristics such as transmit/
receive frequency pairs, radio parameters,
and encryption encoding.
Control Channel
In a trunking system, one of the channels
that is used to provide a continuous, two-
way/data communications path between
the central controller and all radios on the
system.
Term Definition
![](/img.php?id=1415131&img=bg49.png)
Glossary
English
61
Conventional
Typically refers to radio-to-radio
communications, sometimes through a
repeater (see Trunking).
Conventional
Scan List
A scan list that includes only conventional
channels.
Deadlock
Displayed by the radio after three failed
attempts to unlock the radio.The radio must
be powered off and on prior to another
attempt.
Digital Private
Line (DPL)
A type of coded squelch using data bursts.
Similar to PL except a digital code is used
instead of a tone.
Digital Signal An RF signal that has a pulsed, or discrete,
nature, rather than a continuous nature.
Dispatcher An individual who has radio system
management duties.
Dynamic
Regrouping
A feature that allows the dispatcher to
temporarily reassign selected radios to a
single special channel so they can
communicate with each other.
Term Definition
Failsoft
A feature that allows communications to
take place even though the central
controller has failed. Each trunked repeater
in the system transmits a data word
informing every radio that the system has
gone into failsoft.
FCC Federal Communications Commission.
FM Frequency Modulation
Hang Up Disconnect.
Home screen The first display information after the radio
completes its self test.
KVL Key-variable loader: A device for loading
encryption keys into the radio.
LCD Liquid crystal display.
LED Light-emitting diode.
Monitor
Check channel activity by pressing the
Monitor button. If the channel is clear, you
hear static. If the channel is in use, you
hear conversation. It also serves as a way
to check the volume level of the radio,
since the radio “opens the squelch” when
the monitor button is pressed.
Term Definition
![](/img.php?id=1415131&img=bg4a.png)
Glossary
English
62
Multi-System
Talkgroup Scan
List
A scan list that can include both talkgroups
(trunked) and channels (conventional).
Network Access
Code
Network Access Code (NAC) operates on
digital channels to reduce voice channel
interference between adjacent systems
and sites.
NiCd Nickel-cadmium
NiMH Nickel-metal-hydride.
Non-Tactical/
Revert
The user talks on a preprogrammed
emergency channel. The emergency alarm
is sent out on this same channel.
OTAR Over-the-air rekeying.
Page A one-way alert, with audio and/or display
messages.
Personality A set of unique features specific to a radio.
Preprogrammed Refers to a software feature that has been
activated by a qualified radio technician.
Private Line
(PL)
A sub-audible tone that is transmitted such
that only receivers decoding the tone
receives it.
Term Definition
Programmable Refers to a radio control that can have a
radio feature assigned to it.
PTT
Push-To-Talk – the PTT button engages
the transmitter and puts the radio in
transmit (send) operation when pressed.
Radio
Frequency (RF)
The part of the general frequency spectrum
between the audio and infrared light
regions (about 10 kHz to 10,000,000 MHz).
Repeater
A conventional radio feature, where you
talk through a receive/transmit facility that
re-transmits received signals, in order to
improve communications range and
coverage.
Selective Switch
Any digital P25 traffic having the correct
Network Access Code and the correct
talkgroup.
Squelch
Special electronic circuitry, added to the
receiver of a radio, that reduces, or cuts off,
unwanted signals before they are heard in
the speaker.
Standby
An operating condition whereby the radio’s
speaker is muted but still continues to
receive data.
Term Definition
![](/img.php?id=1415131&img=bg4b.png)
Glossary
English
63
Status Calls
Pre-defined text messages that allow the
user to send a conditional message without
talking.
Tactical/
Non-Revert
The user talks on the channel that was
selected before the radio entered the
emergency state.
Talkaround
Bypass a repeater and talk directly to
another unit for easy local unit-to-unit
communications.
Talkgroup
An organization or group of radio users
who communicate with each other using
the same communication path.
Term Definition
Trunking
The automatic sharing of communications
paths between a large number of users
(see Conventional).
Trunking
Priority Monitor
Scan List
A scan list that includes talkgroups that are
all from the same trunking system.
USK Unique Shadow Key.
Zone A grouping of channels.
Term Definition
![](/img.php?id=1415131&img=bg4c.png)
Commercial Warranty
English
64
Commercial Warranty
Limited Warranty
MOTOROLA COMMUNICATION PRODUCTS
I. WHAT THIS WARRANTY COVERS AND FOR HOW
LONG:
MOTOROLA INC. (“MOTOROLA”) warrants the MOTOROLA
manufactured Communication Products listed below (“Product”)
against defects in material and workmanship under normal use and
service for a period of time from the date of purchase as scheduled
below:
MOTOROLA, at its option, will at no charge either repair the
Product (with new or reconditioned parts), replace it (with a new or
reconditioned Product), or refund the purchase price of the Product
during the warranty period provided it is returned in accordance
with the terms of this warranty. Replaced parts or boards are
warranted for the balance of the original applicable warranty period.
All replaced parts of Product shall become the property of
MOTOROLA.
This express limited warranty is extended by MOTOROLA to the
original end user purchaser only and is not assignable or
transferable to any other party. This is the complete warranty for the
Product manufactured by MOTOROLA. MOTOROLA assumes no
obligations or liability for additions or modifications to this warranty
unless made in writing and signed by an officer of MOTOROLA.
Unless made in a separate agreement between MOTOROLA and
the original end user purchaser, MOTOROLA does not warrant the
installation, maintenance or service of the Product.
MOTOROLA cannot be responsible in any way for any ancillary
equipment not furnished by MOTOROLA which is attached to or
used in connection with the Product, or for operation of the Product
with any ancillary equipment, and all such equipment is expressly
excluded from this warranty. Because each system which may use
the Product is unique, MOTOROLA disclaims liability for range,
coverage, or operation of the system as a whole under this
warranty.
II. GENERAL PROVISIONS:
This warranty sets forth the full extent of MOTOROLA'S
responsibilities regarding the Product. Repair, replacement or
refund of the purchase price, at MOTOROLA’s option, is the
exclusive remedy. THIS WARRANTY IS GIVEN IN LIEU OF ALL
OTHER EXPRESS WARRANTIES. IMPLIED WARRANTIES,
INCLUDING WITHOUT LIMITATION, IMPLIED WARRANTIES OF
MERCHANTABILITY AND FITNESS FOR A PARTICULAR
PURPOSE, ARE LIMITED TO THE DURATION OF THIS LIMITED
WARRANTY. IN NO EVENT SHALL MOTOROLA BE LIABLE FOR
DAMAGES IN EXCESS OF THE PURCHASE PRICE OF THE
PRODUCT, FOR ANY LOSS OF USE, LOSS OF TIME,
INCONVENIENCE, COMMERCIAL LOSS, LOST PROFITS OR
SAVINGS OR OTHER INCIDENTAL, SPECIAL OR
CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR
ASTRO APX 6000 Portable Units One (1) Year
Product Accessories One (1) Year
![](/img.php?id=1415131&img=bg4d.png)
Commercial Warranty
English
65
INABILITY TO USE SUCH PRODUCT, TO THE FULL EXTENT
SUCH MAY BE DISCLAIMED BY LAW.
III. STATE LAW RIGHTS:
SOME STATES DO NOT ALLOW THE EXCLUSION OR
LIMITATION OF INCIDENTAL OR CONSEQUENTIAL DAMAGES
OR LIMITATION ON HOW LONG AN IMPLIED WARRANTY
LASTS, SO THE ABOVE LIMITATION OR EXCLUSIONS MAY
NOT APPLY.
This warranty gives specific legal rights, and there may be other
rights which may vary from state to state.
IV. HOW TO GET WARRANTY SERVICE:
You must provide proof of purchase (bearing the date of purchase
and Product item serial number) in order to receive warranty
service and, also, deliver or send the Product item, transportation
and insurance prepaid, to an authorized warranty service location.
Warranty service will be provided by MOTOROLA through one of its
authorized warranty service locations. If you first contact the
company which sold you the Product (e.g., dealer or
communication service provider), it can facilitate your obtaining
warranty service. You can also call MOTOROLA at 1-800-927-2744
US/Canada.
V. WHAT THIS WARRANTY DOES NOT COVER:
A) Defects or damage resulting from use of the Product in other
than its normal and customary manner.
B) Defects or damage from misuse, accident, water, or neglect.
C)Defects or damage from improper testing, operation,
maintenance, installation, alteration, modification, or adjustment.
D)Breakage or damage to antennas unless caused directly by
defects in material workmanship.
E) A Product subjected to unauthorized Product modifications,
disassembles or repairs (including, without limitation, the addition
to the Product of non-MOTOROLA supplied equipment) which
adversely affect performance of the Product or interfere with
MOTOROLA's normal warranty inspection and testing of the
Product to verify any warranty claim.
F) Product which has had the serial number removed or made
illegible.
G)Rechargeable batteries if:
(1) any of the seals on the battery enclosure of cells are broken
or show evidence of tampering.
(2) the damage or defect is caused by charging or using the
battery in equipment or service other than the Product for which it
is specified.
H)Freight costs to the repair depot.
I) A Product which, due to illegal or unauthorized alteration of the
software/firmware in the Product, does not function in
accordance with MOTOROLA’s published specifications or the
FCC certification labeling in effect for the Product at the time the
Product was initially distributed from MOTOROLA.
J) Scratches or other cosmetic damage to Product surfaces that
does not affect the operation of the Product.
K) Normal and customary wear and tear.
![](/img.php?id=1415131&img=bg4e.png)
Commercial Warranty
English
66
VI. PATENT AND SOFTWARE PROVISIONS:
MOTOROLA will defend, at its own expense, any suit brought
against the end user purchaser to the extent that it is based on a
claim that the Product or parts infringe a United States patent, and
MOTOROLA will pay those costs and damages finally awarded
against the end user purchaser in any such suit which are
attributable to any such claim, but such defense and payments are
conditioned on the following:
A) that MOTOROLA will be notified promptly in writing by such
purchaser of any notice of such claim;
B) that MOTOROLA will have sole control of the defense of such
suit and all negotiations for its settlement or compromise; and
C)should the Product or parts become, or in MOTOROLA’s opinion
be likely to become, the subject of a claim of infringement of a
United States patent, that such purchaser will permit
MOTOROLA, at its option and expense, either to procure for
such purchaser the right to continue using the Product or parts or
to replace or modify the same so that it becomes non-infringing
or to grant such purchaser a credit for the Product or parts as
depreciated and accept its return. The depreciation will be an
equal amount per year over the lifetime of the Product or parts as
established by MOTOROLA.
MOTOROLA will have no liability with respect to any claim of patent
infringement which is based upon the combination of the Product or
parts furnished hereunder with software, apparatus or devices not
furnished by MOTOROLA, nor will MOTOROLA have any liability
for the use of ancillary equipment or software not furnished by
MOTOROLA which is attached to or used in connection with the
Product. The foregoing states the entire liability of MOTOROLA
with respect to infringement of patents by the Product or any parts
thereof.
Laws in the United States and other countries preserve for
MOTOROLA certain exclusive rights for copyrighted MOTOROLA
software such as the exclusive rights to reproduce in copies and
distribute copies of such MOTOROLA software. MOTOROLA
software may be used in only the Product in which the software was
originally embodied and such software in such Product may not be
replaced, copied, distributed, modified in any way, or used to
produce any derivative thereof. No other use including, without
limitation, alteration, modification, reproduction, distribution, or
reverse engineering of such MOTOROLA software or exercise of
rights in such MOTOROLA software is permitted. No license is
granted by implication, estoppel or otherwise under MOTOROLA
patent rights or copyrights.
VII. GOVERNING LAW:
This Warranty is governed by the laws of the State of Illinois, U.S.A.
![](/img.php?id=1415131&img=bg50.png)
68012001081-B
*68012001081*
Motorola, Inc.
1301, E. Algonquin Rd.
Schaumburg, IL 60196-1078, U.S.A.
MOTOROLA and the Stylized M Logo are
registered in the U.S. Patent and Trademark Office.
All other product or service names are the property
of their respective owners.
© 2010 Motorola, Inc.
All rights reserved.
December 2010.