Panasonic of North America 93312139 Color Monitor User Manual 53347
Panasonic Corporation of North America Color Monitor 53347
8
| Download: |  |
| Mirror Download [FCC.gov] | |
| Document ID | 53347 |
| Application ID | k487FGmqiCH79T5UB+TMww== |
| Document Description | 8 |
| Short Term Confidential | No |
| Permanent Confidential | No |
| Supercede | No |
| Document Type | User Manual |
| Display Format | Adobe Acrobat PDF - pdf |
| Filesize | 109.26kB (1365735 bits) |
| Date Submitted | 1999-08-11 00:00:00 |
| Date Available | 1999-09-27 00:00:00 |
| Creation Date | 2001-05-31 17:59:28 |
| Producing Software | Acrobat Distiller 4.0 for Windows |
| Document Lastmod | 2001-05-31 17:59:39 |
| Document Title | 53347.pdf |
| Document Author: | jsoscia |
13n- -4':-i' “1-5 nae |'
‘ FACTORY CONTROL N0. : FVD—SS-FOIZ —
FCC lD. : ACJ93312139
19.0“_TFT4L'CvD MONlTéfl ,
fiVO'p'erating'Instructions A
Mode d’e‘mplol
Manualde lnstrucciones
(Bediennngsanleitu'n
Istruzigni'd’uso, A
Please'read I'hese instruciions carefully before using '
-,,this product and save this manual for future use.
W,—
I ' In Europe you must use a cord set which“ us appropriate tor the recephds In your country.
: The card set is HAG—Certified, and the mark 1 HAR P will appear on the war bath, or on
__l'n|heUmd$‘nlesand CarndaflenfileplugsaNEMA5-15M(Fgum2)ws must-dam! csuabeued.
measwvid-ammumadmaduknrm wasVTursrracrdusrr-aybeuud qunis-«imu’ron
' {I you have my qu&m\s mmzming me proper pom-l
‘.
IMPORTANT NOTICE CONCERNING POWER CORD SELECTION
mmrwmseumm'sunirnasaeenmdmmmmmnedamwngmuemn-‘mygt \
desanaunnandmustbeusedtnpreventelamcwdclmmldlmwgmdflnfiflnrsmrymrewm
“Gig-MGM“! urtlmemrdsflsnmendmd. "‘
mkmale veceptzdeMMmrdsflMMCEE-nnqmmnsmdwilmlflmF-g-o1
.|
(5
For the United sales and Canida:
melnor, aniysrrxypewrflsets'mybemd Trucordslmnsxbesebededamdngmmmmudngm
yoururlir Please consultTabIe alarm ulecu'rm criteria 1nrpower cords usedinm Unitedsmann Canada.
mmwrdsetismarkodvdmIBCOMTm.)
Fm European Ccnntrl's:
the insulation 01 one of the‘ Inner condumrfs
have Nausea your um
Size 6! Conduanrs in Card A
18 we r,
o AC PLUG colic ( FOR um)
FOR YOUR SAFETY PLEASE READ THE FOLLOWING TEXT CAREFUU.
SHOULD BE CUT DET- RND DIS?OSED OF SAFELY.
THEEE IS A DflNGEH DF SEVERE ELECTRIQ 5mm IFTH’ CUT OF— PLUG IS NSEHTED INTO
llamvlagiswbefihipiease
Ilinanydmblpbmwxsmtaqmfified elecm'uan
‘WWARNINE: THIS APPLIANCE MUST BE EARTHED.°'_"‘"“"‘" "" , f" —‘-“~ ‘—.~.-r—-f~—
IMPORTANT The_wirasin this mains lead are coloumdin WING wit-me folkmingmde:
«memoumdmmsutmemmteauum-sappdamemammommmwmn‘fluumgs
iflenfifyw’ngmelenninalsinyunplug, p-uceeuasfdms: -. ,- ,_.
The wwe which 15 calmed GREEN fiND—YELLQW rufi be mngenefl in the mrminafin the plug which
is marked by the letter E by me Eam symbnl- ' or colourad G N m GRE-N~AN’D>YELLOW. --'
The me which rs coloured BLUE mus! be connected tame terminal |r| me flag which rs marked with
mum N urcuhured BLACK. » 7 _
The wire which Is colmlred BROWN must be connected in the lermirel in the plug Mir—his marked wim
thele‘lernrcnlnumd RED. » ,
CE Conformity
_ C This device complies with the requirements of the EEC directive 59 / BBS/EEC as amended
[73192131IEECand93l56IEECAn5withregardln‘Eledrontagneficcompa‘titflitf,and
73/23/EECasan-rended bysslGE/EECM13withregardto‘Satety‘.
“Remewsrndanfl/alue nmummwvm -
-a__-——
——“—
TRANSlEN'l‘1 F I 5
LINE HARMONtCS
: atsll-s sane-1115 with no problems rn perlormance and reliability
Eflects may appear temporarily on the screen bu‘l there will be no problem in reliah'dity.
er Thereistearaftheprodudhmldng um. . _ v
as
,,'
- " peripheral devices v
To asure conunued CE mmpliancethe user must use
handed tem'le cores atbofl'l ends ulthe able.
Handle mneaiy' in amnrdance with the instrum‘on
4 EM! ‘ .Ela:tmnflgrletic interference > E501Emrm1ic Discharge
' F I B: Fast Burst
_' Ths equipment has been tested and (oundto comply withlthe imitsfm' Obs B agar-1m,
“~‘ pursuantto Part 15 fli_ the FCC hits Thurs limrLs are dsignedtn provide reasonable prulection ~ 4 —
. against harmiulinterterewe rrr a “residential installatinanhis equipment genera-s, uses. andm- 2, ~ —
radiate radio hequenw energy and, it not installed ahd used rn amordance with the instrucu‘ons may " -, »
cause harmful interference to radio mmrmrrr'uzthrs. fl-lowever there s m guaranteetl'ut interference — .4 - ' -
will not occurr'n a particular installation. ll this equipment doa arise harmful interlerence to radio or '
television reception whid) an be determined by tuning the eqiu'prnent tiff and on, Iiie1ser' ls
. 5 — Reorient or relocate the. receiving antenna“
' inueasethesgpaxalhn behveenthe nqrfipmentandraceiver
I '-' Connectthe eqripment into an outlet on a airmail d’lllerent from thattn
connected. —
— Consultthe dealer or an emerrenced radio ITVtechn an (or help
kw
FCC Warning.
To assure cumin FCC cdfrnpiiarn: ' jihe p
card and shieided interface cable with bonded lenite cor-s Also, any unauthorized clung-s or
mod'rlioatiors to this monitor would void the users authority
As an E~=asv Shin“ partner Display Monitor Dimsion, AVC Company, Matsushita
Electric lndustn'al Co.. Ltd has determined that this product meets the ENERGY STAR”
guidefinfi for energy efficiency
NOTES: 1 ‘ 4- - ‘ , .' , f,
0 For ergonomic reaons, rt is recommended not to use blue characters on a dark background:
Doing so may produce insufficient cor-mat that could lead to eye strain. .
0 “Der Arhmsplatzbezogene Scnslldruckpegel nach DlN 45 535 betragt 70 dB (A) oder weniger.”
(The sound pressure level at the operators pnsiu‘un according ta ta: 704451952 ls equal or less
than 70 dB m.) , . __, . a;
NOtICE'
- This manitcr armor be used in the interlaced mode
‘ When the Apple Power Maeinieshc is used, use the "On‘l’he Fly' made. Please refer
(a the operation manuals of your computer and video cards far further details.
f Be informed that dark Spats (that do no! shine) and bright spotswxat remain iii) on the
panel are net regarded as failures. The dark spars and bright Spats can ccsur ai a
perceniage cf 0. 035 to an effective picture element.
(3) Themaflh'smnualmybednrvggd
phase mt! ynursals repvesentflfive.
(4) Pieas'e be aware in advance max In spite hi the
' respgnsible and will nut assume any lusses (in his fur financial loss matting from items—9: mused by
The product names are registered trademarks 01 their
respective companies.
- _ xPremufions.
, (AN , Feétures...
' ’ Dimensions
., j Names and Fundions _ _ '
a s ,. AC PowerCord. . ' J
m00nneclipns_ ‘
Connecfing U .B Devices
—Operation Procedure .
Adjustments .........
~- Power Managemem System
DisplayflModes Memory"
if Trouble Occurs : ......
Spediigratinns
' Preset Mode
,. Security Purl ..............
- Ariuid direct sunlight and heat mumsdflashuters. '
Hutudvusetyafiedstheahmetandttrepaflshepthepwerw
wdawaytmmhetsawees'taringtndnmeouiduusefireo
. lnslall' m a well vermlaled location
To prevent the temperature from rr‘s'ng irside the set there are
ventilation hoies in the ant-inn Make sure thatthey are not
obwuded. lnstalllhe unit at least 10m from walls. and do not ,
\ . install it in a book cabinet or lying on its side. which could biockithe
ventilation holes. Failure to ubsewe th's precaution could muse fire
or equipment breaomwn ’
- Do notinsallin a lomtion w'dh a great deal of moisture ordusl.
Avoid wet locations sum esa k'itxa‘ren dilihboard bathroom or . ,
washing machine also avoid lac-tiers with a great deal of steam. .
water vapov or drug. Failurelo observe thiswua ion amid cause '
fire, eiectn'e-l shock or equpmem breakdown. ‘ ' ‘
- Do not appiytoirxtothe liquid crystal panel bytouchi or
-—suratdlrlgitwithhardobjeds ‘
.2) Precautions in use “1
' Handiethe poweremd miefuliy.- "' ’
Do rulplaaeanylmvyabiecs ontopoithepaweruard. addiegsto
-ittielmotsinitorpull onthemrd when mpluggingtittfie power ”
.mrdisdamaged (Mennmleilthewirsaieexposed agrarian)”
thereisdangerulausing firemeiediinlshock.
Newerremoweorinsenthé wimyuutharrdsarewaTI-ismy
-Dorwtpiacganyll’ingontnpofth_e
Dnrwtpiacenriyhreignobiedsudr ‘ ‘
oranotherliqrid arasotve'iltmdmhscnhdhasglientoramtal
wiectsmhasapapegdip, mmmlttheduedsbudmd ‘
theliqridcanspinandmertheirltsihrotttyeumlzum
dediimlMpreqtdpmer-ithiealddwn.
uses a magnet ar' an obied sud: as a motor' '
generates a strong magnetic feldA The magnetism an dist-Bfl the
., ..— eolnrormuseteannguitheimageinthescrem ~ 4
- Avoid disrupting reaepn'an
Use 01 this unit near a television or other display unit can resutt in
both interfering withthe uther‘s reseafion. tux-mg at the images and-3? ‘
- noise. Keep them as far apart as possible
, - when mowing this unit, be awful not to apply shock to it Always“ "
unplug the power cord tram the outlet and disconnect all other
external mitts and lands Be especafly careful with the LCD monimr.
: 3) Care of this unit A
- Clean this unit win a soft. dry cloth.
it it 132mm very dirty, wipe it with a doth that has been soaked in
neutral detergent aimed with water and then wrung out thoroughly, .
then dry with a dry doth.
Use at a cherrizaliy treated doth or glass-pvnduu'ng cleaner can
damage the surface or cause the paint to some of]. ~ — . .
Do not rub the sur‘ece 01 the LCD manner with a hard obiect or 7
strike it with anything. Dcmg so an scratch it
Features
High+quali1y liquid crystal panel
-mwinmlflflmnpixelphchWanelandm-ghreharduafingMuslin/religion. ami-
srzflc highqmufiun and high-umha‘t chandenflm and equivalent 01 16.77 Mm allots display ‘
' (lull—color) us also possbla , _
,_ 4 Base-reflextypeslermspeakers (1 W4 1 W) a medlnrhassvepmduuiom
spedfiedbmedcu§95198
Any sell-powered modemat csnlnrmsm USE (Um/as! Saul Bus) ver 1 D an. be used_
Upmtmnussfimmfible devioes an easiiybemnnected. _‘
ummmmmnmmmmwmwmmmmsgw
:Use' 1s nol possible' m some uses, depending on the personal oompmer and 05 used.
More fienwfingmusethe USE, resume Opexafing [mm are“
anhzsahmmmequenqofsfi tofild-Szwemmlfrem may SDHzmTIHzmm
mannaficlolhwhgandamfimmresolm‘flnpfifaflimydmMasl-lzrdflednab) -
‘IhisunitismnpafiblewihbomlBM‘PCmmpMeunfis-ndkppleuaqw rue/19-
.21‘ Ma" aldlhe PowerMadersh‘flnthefiy'mde"). --‘
Usen1a'p1 mummoumdarmmmmmameme
mmmlfidfimmmnfidymdMafilm-ims ' ’ ' ' ,
POSITIDN’.‘ v. 90er and amuse.“ permedaumwlywfi meant-mm
3mm“ {motion is set.
Environmémally—friendly v -
The LCD mmitof pdwer consumption
than} umbrmstn the VESA‘ upmswmw
(emiss'ans, Wavingsaiety) hasheend'mined.
Dskspanembeusedefieaivelymehflu'zt an
When admsung the vex-cal a g'
tap otthc ma man- h e 2 hand and the barium with Heather Them
slawly move the ma ' to the des :red angle
De nat pram on th»: upper pan of the LCD as (ms may cause the unit is
fall clown.
447 mm (W) ‘x'450 71_"nim'(H)‘s'< 246. 5 mm (D) ’
Angle adjustment rang [0-30° vehicauy ~ _-
Names and Functions -
Front Operation Parts 4.1 ‘x.
Volume key
the sound volume {or the built-in
makers and the headphone terminais.
me "+' key
HSI‘IONB
1, keys are used for the _
-.Tums the bum: -xn spake 0m" why (BSD)
_and headprme temuna] whom and men _
seund ON and OFF. Press
fence to turn the sound OFF
and again lo turn the sound
back ON.
the rm " Higher, ,
the backmge Gem's ~
Lefleide cable cover Right-side cable cover
’ . A "5.33328?“ ,
— After the Signal we, Autin Cord Afler the Signal Cable and Audio mblesmd their . z
amigo Power cm have been Corfl have bémtonneued. me mrfipedive cable -~ -
cunnected, the leak-side cable cover left-side mule cover is used to .- , mnnectims' m the rear
is (1981-10 pretecfihese caries and protect these cam and their 3 M 01 (he mar-filer.
their rapedve able connedinrs. respecfive table connections '
I—6 A;
I - Always urns off the power supply of the computer and the
CO" nee“ OHS monitor before perfo ng the connection prccedures.
1: Connection Preparation
HSI'I‘ONE
' The "gm-side and left-side able mverizn be
- removed by grasping them firmby with your
To pruleci the surface 01 LCD panel from
being scratched, plan? a towel (or oghe'r A
flame) on a shiid, defh‘l surface.
Use the accessory Ac pa and, Signal abiéf’ana Audio cord
Wt
> 9 Position me'AC anfer Cord sighs! Cable A‘and the" "Audio C‘ord In
9 Pasitign the Signsl Cable 8 and he Audio Cord Bin Ciamper B. r ,
w m: v ' I ' '
' 6m A
. ”w ~ - ~ ,
signal-spies
Ofishtenflie screws securing the plug tightly to prevent it fram beaming
disconnecied, — -
0 00 net unplugs the USB hub power cord. When plugging it m, 5ng the
plug correctiy, using the arrow mark near the socket far reference, before
mugging it in.
n.
Cbnnections (Continued) A
3.’Connec_tio_n thg computér I V . ‘a ,.
ENGLISH
* O The shape of the taminal of your car'nputer may differ from that sham here‘ In
_- me, read the instruction manual for your computer and connect as indicated
‘ 0 Lower the volume if howl’ng occurs.
-. 0 trafimrortaufirpmelis amahedm membbcfingmesmkefsme sound
' manly andvalume wm be m.
~, 0 mmmmgonWMpmmmdmmmngow
, mvomesappmpr‘ate.
., Imexfereneemaywifme mmbha’edspeakaeblsaepasfiiamd closet:
‘ Mdisphymwflzwmmmmthespakeficrheadphonesmmem
awayfmm themenflur.
67
Connections (Continued)
1-‘10-
3. Attach the Cable covers ‘ ' , ._
Allgn the Rear Cable Cover With the top part
- at the monitor and press the pan pf the cover
shown m the diagrarn to fit the cover into
pdsrfion '|
--..-----..o.....--’----.-
'Carefuliy raise the‘ ace of the monitor to its
' cable through the channel 611
', borne: damage to the table when attempting to plug it in.
Q When attaching the cable covers, be surefhat cable has not become
caught between the cover and the camputer.
Note: 7
,_ CUseapcwerscm-cethafsuppfies Acww- 240VatSOl-lzlGaHz
~ - th thalise lasedwith the
Connectlng USB Devuces flfysuse eusscurd “5
(1) Prepare the aecessnry use curd provided. " ' > ; _ x
(2). Connect the USB connectnr (Sen-s A) in the mmpmer A or B.
(3) Connect the USB connector (Seris B) to the USB Upstream port cf the mam unit“
(4). Canned. the cord of the USB device being used to USB Downstream port onhe main unit.
ENGLISH
Series B
Connedcr
fl.--
0 Enumerate the USE hub ”USE device.
0 Install toe driver sam'arent the USB div-ice. "
Q Wheneverihe USE card has been upluggd'and than later plugged in. or when
_sfimhing the USE Upstream, check” make sure Mme emerafian routine ‘
has been successfully completed. Ifme enumemfian ran-line has rm executed
may, the ussaridl urine computer maynet function correctly.
" . ‘ “11V
Operation > f" If
Basic operation
HSI'IDNB
Adjtms the squad volume for the hu’ m
. speakers and the headphone terminals
_' To move cursorin métfu
To adjust level 0! selecled Hum
Pedomss the sséen display Ann: I
agfiwmaqd adiusfls the $1243.pr
) Press the E] key to retum to the menu screen -
, 2) This' Is motif-ed by pressing the “E" and '8" keys at thé from.
) Prss [Z keyto simm- the adjustment scre _
.oF’
'~ —mw%§§l
Prssxhe E or EjkiytfisfléctPOSl.
CLOCKfmm the menu screen. -
I—12
1|
Adjustments
' Direct Adjustment
Direct Acqus'trnent
item name
- - ‘ vThe hofizm-nal posmm adiustmenl. horizontal size mind
AUTO SIZE ' pesiiinn adiustnient, verticalsize adjustment veninzlfinead‘psi em
1—2 ‘
ys operate the unit after the co. pane: has safari,
- Pertarm the adjustm nt after the Windaws screen or other
similar screen is displays the entire screen
- Dc not use this function u en the VGASSD cde and DOS
prampi mode are u 5 because the tunm‘on - '
carrecuy. Perform tn diusu-nent menus”
- When some types of anal input (and l or
the AUTO adjust function may not wcrk carrewy. if this situation
occurs, make the necessary ad;ustmens by referring to P: - 15
in the Operating Instructizns.
- While the AUTO adjust rauti
device 15 usec, or H the screen is acti
program. the AUTO ezfiust function wull ncl t ark prop ' .
There‘are. make sure that the“ image 0 the screen mains sfiu
(does not change) and that me scrc "H not be a vexed or used
De AUTO adjustment“ [5 tafing piece.
SIGNAL ERéOR
and N0 SiGNAL
(Monitor Sélf— ' ‘ specified tangé_ _ ‘
7551) 2) H9“ 9 ‘5 My“ when the pewer sa mode is sei (This u re
, ' isnMydiSplayedinti-euflsiaxe)
3) Figure Bis d'splayed when (here Is no input signa < ~
Fur example, this occurs when the computer 15 not conneded or the
cumpu-ler power is nfl.
SIGNALEHROH
X — DDT
_fH' 98.4 kHz
fAdjuétmehts (Continued)
.'Adjustment Item Screen
”Adjust the screen contrast. Pressing the I (ey
BRlGHTNESS, fiAGKL GH7 ind GONTHAST
ma‘nmum let/E1 (1 on) le'fi‘be sét‘
...-......-...<.-.- -¢.‘-
v Minsnhe brig-mas (low gladafinn part: black lavel). Frau-lg ..
the I2! key mggles between com‘msr, aficxuem and
Bacsumssé
' Bilaékjev‘el)‘
“adjustmemscreen.34m
.--.--.------.--o
n' 15 pbmble to adjust lhe whiieness 1.11 the Image to sun personal
preierence. ‘ '
1) Se‘ect H (red), G (green), 9 (blue) wflh the E] key
2) Adjust the color to match peponal preference wflh ‘E‘ and
“E' keys ‘ .
Nme: Make a mule cf ma setting values before periurming the
adiusimem because the relzll operaliun annot be
performer; for the user solar ac‘iustmeni The inm'al value x5
set in normal calm
--.--...--.-.-
USER COLOR v
1-14 V
Adjustments (Continued)
Adjustment ltem Screen
ENGLISH
V. POSTTlON I PHASE adiuslmems.
o-qcouo' C'QGQQ-QC-ndn
_Vertical stripes may be chserved depending on [he dsldop
__patlerns cra pfifitions If this occurs, perform th following
~ adjustments -
.f Display ascr which has vertical stripes and align the right side
' of the screen hythe hm-iznntal posfiion adjustment then change
- to the venj stripe adjustment (DOT CLOCK) and perform the
....o.
change to the horizontal stripe armament PHASE)“ ans per!
"' the adilstme'rrt using the ‘B‘ nr “E" key '
Note) There are more than two nmimal points. One dot on the right or lefl may disappear
cape-11mg on the optimal point. If this occurs. shift to the ether animal point and
perferm the horizontal pesition adjustment and the DOT CLOCK admsmem again.
Thescreen cfisplay rancid putsignalescanbeadjlmd.
F l N E (High image quality mbde):
Input signal resolution 15 disalaye just as it is
(A microcomputer automatically selecs the display (solution
nlafile-size_15_fims,and2fimes.) .
' F u L L (Magnicymg 2 mode). --
lnpui signals ran be dspIayed on the entire panel M31
area. ‘
The video mpul signal level can be matched to (he campmer
hein'g used
1) Prss the 'E“or'E" keyto selefl 0.7 V/1. DV/AUTO. .
2) j wm be displayed at the bottom right- -hand side of me oni-
screen panel when AUTQpas been selected. Puss ihe @ key
an the front operation area to periurrrflhe AUTO adjustment
screen. Adjustment time is about 2 - 3 sec.
Nate) Forfl'fs function to operate correctly, a whim area about the size at the mouse
cursor is necessary. Correct armament rs not possible wifiraut such a white area.
"<5 _ VIDEO LEVEL
1—15
J|_ Q?
Adjustments (Continued)
Adjustment (tern Screen ‘
Ajustment
item name
HSI19N3
v 1)Whenthemlcy(Y5)ispresed, thesem
_the menu semen Mm. (Recall— - return
{ '(senings at time uflaclmy shipmem». -
2) When the El kgy (No) IS mused. the menu scree returns
wnhoutn‘le smngs being mulled. (The sewing: return to what
they. were mummy More the team)
flags (German, Frerd'i Elglish Italian or
Spanish) fo'rthe onscreen display. _
possible
@ o oposmon mama
' Seledthe
1-16
PE
Power Management System
This manila! uniforms to the VESA‘ DPMS‘“ standard.
, -This (unaion an supprss power consumption tonne display uniL ; '
The computer and video boa'rd being used must also conform to the VESA' DPMS‘“ standard.
Nate: Regarding nperetiun mtuse cement! the Operatipn Marinas (or the hardware being used
SUS?END | Blackout Yebw
OFFSTATE £13:an Yellow
Nntg- Nu use peripherals mrmeaed
um the monitnr off when it s nutto be usedfor glut-g time
ow to rehase the system 1mm the power management function.
. s' préet modes
-_ H the new itiuflment data differ 1mm any at the inhaling 4, they
reguuu‘tafinwdata ,.
' r. Huriznmdlrelquerwy Hamismpway',harwumflm Vmsyncipohrity-
>— l'nisnazsarymm ver the-"he hortzantatfxequemybesnkszoztd'tzth‘Zkt-tz “(Hg
' and that the diflerence m the manner at in! [iris be 14 gins r:
. e '» - The data that ten be registered are those' m the tntlowing tame
mum-term, '
Tmlmmerur
mus-m
Vflec s'gnatlevel
< How to register adjustment data
1) Input the cumputer signal tn be regfieéd to the Display uh
2) Setect the item tube adjusted tmmthe O_SD screen andthen acfiust
3) Whenthe [1 key 15 pressed, the adjusted valueis registere
If a hunt panel key 15 not operated for about 20 semnds, the ad‘wsttnent is registered 1
- There are 16 modesthat nun m preset by the user: it all 1"E¢rnod5'have already been registered,
when the one that ha been regsteredthe oldest is deleted a new mode can be reg'steredt , .
~ If the timing m the new‘ registration cftflers lime in frequency tram the previausiy rflg'stered timing "
and m addition the signal pnlzrxty‘ 15 the. same they war be judged to be the seam and the new
timing cannui be regstered
1—17
IfTroUble Occurs ~-L . , .v
(f pmblerns commue even aflerthe inspections described belnw are perfumed, aways remove the
power plug and nomad our dealer. u u a». , . .
W“
memus‘enrw. Fmaddh-emlsmks
Mradflenpmnmamee-
suingtma'nn eight 6“;
apemod. «mi: med.
the p36! LED will be rqm
, j 13-110; W2-zM“er-?
frequenu/ mime“ image mammal trauma/01 the“ we
mlmmmum sigmlmsetmevamdodfieqw-qma
te-el (135 «9:17 _ muwmmm ml mas and.“
HIS the PICTUHE‘I (ten) » '
A “NEWS!“ , T .
As the video Eve! currently
The outline: oltnrmve L an'justed? -
Sham» ls me tau-gm or
man: safes-m turned
dime way m7. ,
Has the Dyrum'c m Ener-
iainmem mm'e been sen
Mammwm1mfim
andaniusxix-‘nmemuaqeagm
The "5289 is M m SELF-TEsT‘iunaion
Frame Menu npemmn keysm duedflhe
sane-(screen ' ' ‘ > '
«smroneyfmenm-encum-elwmurw
Myedmmd’? g e ‘
' The in"! signal hem-earn] exam-mm range
of me semfity range aflh‘s uni:
Read me njmminn mnuzldme cor-enter
and range the days? mode.
sommne signal able maily. _
The image scams -
mmmmnsl ,
ngnal came
_ Lmama-ex,
I—1B.~
1 I:
mmeranu Selena mode waninmeum '
amino: opetall'ng range. (Forduafls nudma .
mama! of
A M4
somdiewelfimnmemmemsfia-d?
' Flam mmmoperummmmyn
hmreznutmts’rgbrmdefib
a; 53:19 my
EnumemudtfiepSB humus;
[mmmmmuimusa -
déwtanrmhmdemfing
(mm-ans Mmuusam
Specifiafions are subject In change without natice for the
purpose of improvement.
,|1saamnsnml4a3i=nmr
[ColorTFl’aziwenufisLfin’fifl Ctyshl‘
1200 1mm).
Fmfinns(typ.})5uhbleflmminrm .,
mud- sw- ur Dunn arm) u
D7Vpp—1DVp-p
09mm,” 2. mm Mmmmmnwmmw—“7—5 ,
Hleqflnle (TILE-tel) HIVMGTLIW) swoon-glee!
Verfiml Frequenq Rinse: 501) HzthDHz‘,‘
15 in miniD-Sub my (inmate pins)x2
aim-nmetermnfi-iiack
asmdamamw'ninimz
CEEzZvypespmmr ,
> CDNTRASI'. BRIGWNES. BQCKLIGHT. H. FDSTTlDN. Q'lea
Annqau. ammms—gmmm) M‘W ‘Vm
ENGLISH
vaowofa AUIO, | .<1. D. LIsz. vow-45+. _ MU'l—kzy
v, mamas,“ msmou, v.9mflnmmmm. (Mm-ml
uhv/SSOOKIQMKIMVWM)‘WDEDLEVflANm1V-wwjlfl’.
FREQ, uNGuasE, mm sxzz‘ 95m, 059 msmun. mas
Maximum pixel dad
135MHz(max.)
Maximumvvsofinim 1280MS(H)X1,D24fin5MI73HZ
Displayfl‘a Izvsxammmnzanxmzq
Speakers l1oqumzukHzm) . : - .
~ FWHZMY rm 119 w+ Q5 w (typ)
Opelafing mnflm‘wfificul “6's cow
Temperature: 0 m arc (32 to as- F)
Humldaty: 5 to saw. (Mr: cunde'nszfiun)
mm.“ we!
AC'mG— zanwso/sofiz) 4
chermnsumpn'nn
75 W (cm /< 3 w (mg power saving npelzzinn)
Dimensions: with x heighl x depm
447 xk‘758 -‘ ,
- 1,024x 7GB
- 1,024x 7GB "
1,024x 755.
, A serixflty pagan rié'ir'xfsianed m prebem theft the LCD monitor base
A wire. c’amé’fifidmmm by Kensinginn tin b;
For details, please refer to the Kensington instruction manuaL
< inquiries> ‘ I ‘ .- 7 .
Kensingion _ ‘ _. ”I ‘ = ' . ,
2855 Campus Drive ' _
San Mateo, CA USA 94403 ‘ . 71
8006354242, x3348 f ' . '
[ntrk 41557242700, x3348
Fax: 41 55728675
1—20»
4»
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.3 Linearized : Yes Create Date : 2001:05:31 17:59:28 Producer : Acrobat Distiller 4.0 for Windows Author : jsoscia Title : 53347.pdf Modify Date : 2001:05:31 17:59:39-04:00 Page Count : 22EXIF Metadata provided by EXIF.tools