Panasonic MINAS A5 User Manual To The E580ff51 84f3 4530 B03d Eee2c1cff23b
User Manual: Panasonic MINAS A5 to the manual
Open the PDF directly: View PDF .
Page Count: 478
Download | |
Open PDF In Browser | View PDF |
Operating Instructions (Overall) AC Servo Motor & Driver MINAS A5-series * This product image is 200W type of A5-series. Thank you for purchasing this Panasonic product. Before operating this product, please read the instructions carefully, and save this manual for future use. Thank you for purchasing Digital AC Servo Motor & Driver, MINAS A5-series. This instruction manual contains information necessary to correctly and safely use the MINAS A5-series motor and driver. By reading this instruction manual, you will learn how to identify the model of the motor and driver that will be best suitable your application, how to wire and set up them, how to set parameters, and how to locate possible cause of symptom and to take corrective action. This is the original instruction. Caution 2 1) Any part or whole of this document shall not be reproduced without written permission from us. 2) Contents of this document are subject to change without notice. Organization of this manual 1 Before Using the Products 1. Before Using the Products Check of the Driver Model ... Installation 2. Preparation 2 Preparation Describes how to identify and select the desired product and components, how to UHDGWKHVSHFLÀFDWLRQVDQGKRZWRLQVWDOOWKHHTXLSPHQW Operating requirements and procedure Shows the timing chart and the list of parameters, and describes how to make wiring and to use the front panel. 3 Connection 3. Connection Wiring ... I/O settings Shows block diagrams for each control mode and connection diagrams to the host controllor, I/O settings. Setup 4. Setup 4 Describes parameters ... JOG running Shows describes parameters and procedure of test operation. 5 Adjustment 5. Adjustment Gain adjustment ... Auto tuning Describes various adjusting method including auto tuning and manual gain tuning. 6 6. When in Trouble When in Trouble Read this section when you encounter trouble or error. 7. Supplement Contains S-T characteristic diagram, dimensional outline drawing, supplemental description on communications and operation. 7 Supplement 3 Contents page Organization of this manual ............................................................................................ 3 Safety Precautions ............................................................................................................. 6 Conformance to international standards ................................................................... 10 Maintenance and Inspections ....................................................................................... 11 1. Before Using the Products ................................................................... 1-1 1. Introduction ............................................................................................................... 1-2 2. Driver ........................................................................................................................ 1-3 3. Motor ....................................................................................................................... 1-21 4. Check of the Combination of the Driver and the Motor ........................................... 1-23 6. Installation ............................................................................................................... 1-28 7. Permissible Load at Output Shaft ........................................................................... 1-35 2. Preparation ......................................................................................................... 2-1 1. Conformance to international standards ................................................................... 2-2 6\VWHP&RQÀJXUDWLRQDQG:LULQJ ........................................................................... 2-10 3. Wiring to the Connector, X1 .................................................................................... 2-51 4. Wiring to the Connector, X2 .................................................................................... 2-51 5. Wiring to the Connector, X3 .................................................................................... 2-53 6. Wiring to the Connector, X4 .................................................................................... 2-54 7. Wiring to the Connector, X5 .................................................................................... 2-55 8. Wiring to the Connector, X6 .................................................................................... 2-57 9. Wiring to the Connector, X7 .................................................................................... 2-60 10. Timing Chart .......................................................................................................... 2-61 11. Built-in Holding Brake ............................................................................................ 2-65 12. Dynamic Brake....................................................................................................... 2-67 13. Setup of Parameter and Mode .............................................................................. 2-72 14. Setup of command division and multiplication ratio (electronic gear ratio) ........... 2-84 15. How to Use the Front Panel .................................................................................. 2-86 3. Connection ......................................................................................................... 3-1 1. Outline of mode ......................................................................................................... 3-2 2. Control Block Diagram ............................................................................................ 3-14 3. Wiring to the Connector, X4 .................................................................................... 3-18 4. Inputs and outputs on connector X4 ....................................................................... 3-30 5. IF Monitor Settings .................................................................................................. 3-50 4 1 4. Setup ........................................................................................................................ 4-1 1. Describes parameters ............................................................................................... 4-2 2. JOG running ............................................................................................................ 4-59 1. Gain Adjustment ........................................................................................................ 5-2 2 Preparation 5. Adjustment .......................................................................................................... 5-1 Before Using the Products page 2. Real-Time Auto-Gain Tuning ..................................................................................... 5-4 3. Adaptive Filter ......................................................................................................... 5-10 4. Manual Auto-Gain Tuning (Basic) ............................................................................ 5-13 3 5. Manual Auto-Gain Tuning (Application) ................................................................... 5-24 6. When in Trouble Connection 6. About Homing Operation ......................................................................................... 5-39 ............................................................................................. 6-1 1. When in Trouble ........................................................................................................ 6-2 4 2. Setup of gain pre-adjustment protection ................................................................. 6-18 7. Supplement Setup 3. Troubleshooting ...................................................................................................... 6-21 ........................................................................................................ 7-1 1. Safety function ..........................................................................................................7-2 2. Absolute System ..................................................................................................... 7-10 5 3. Setup Support Software, PANATERM ..................................................................... 7-26 5. Motor Characteristics (S-T Characteristics) ............................................................ 7-55 Adjustment 4. Communication ....................................................................................................... 7-27 6. Dimensions ............................................................................................................. 7-73 7. Options .................................................................................................................... 7-92 6 Cautions for Proper Use ................................................................................................... 7-127 After-Sale Service .................................................................................................... Back cover When in Trouble Warranty ........................................................................................................................... 7-126 7 Supplement 5 Safety Precautions Please observe safety precautions fully. The following explanations are for things that must be observed in order to prevent harm to people and damage to property. 0LVXVHVWKDWFRXOGUHVXOWLQKDUPRUGDPDJHDUHVKRZQDVIROORZVFODVVLÀHGDFFRUGLQJWRWKH degree of potential harm or damage. Danger Indicates great possibility of death or serious injury. Caution Indicates the possibility of injury or property damage. 7KHIROORZLQJLQGLFDWLRQVVKRZWKLQJVWKDWPXVWEHREVHUYHG Indicates something that must not be done. Indicates something that must be done. Danger Do not subject the Product to water, corrosive or ÁDPPDEOHJDVHVDQGFRPEXVWLEOHV Do not place combustibles near by the motor, driverd regenerative resistor and dynamic brake resister.. Don't use the motor in a place subject to excessive vibration or shock. Failure to observe this instruction could result in electrical VKRFNLQMXU\RUÀUH Don't use cables soaked in water or oil. Failure to observe this instruction could result in electrical shocks, damages and breakdowns. The installation area should be away from heat generating objects such as a heater and a large wire wound resistor. Never connect the motor directly to the commercial power supply. 6 Failure to observe this instrucWLRQFRXOGUHVXOWLQÀUHHOHFWULFDO shocks, damages and breakdowns. Failure to observe this instrucWLRQFRXOGUHVXOWLQÀUHDQG breakdowns. Don't attempt to carry out wiring or manual operation with wet hand. Failure to observe this instruction could result in electrical VKRFNLQMXU\RUÀUH Do not put your hands in the servo driver. Failure to observe this instruction could result in burn and electrical shocks. 1 Installation area should be free from excessive dust, and from splashing water and oil. Mount the motor, driver and peripheral equipments on incombustible material such as metal. Correctly run and arrange wiring. 3 4 5 )DLOXUHWRKHHGWKLVUHTXLUHPHQW will result in electric shock, perVRQDOLQMXU\ÀUHPDOIXQFWLRQRU damage. )DLOXUHWRKHHGWKHVHUHTXLUHments will result in electric VKRFNSHUVRQDOLQMXU\RUÀUH 6 When in Trouble 7 Supplement Ground the earth terminal of the motor and driver without fail. Install and mount the Product and machinery VHFXUHO\WRSUHYHQWDQ\SRVVLEOHÀUHRUDFFLGHQWV incurred by earthquake. Install an emergency stop circuit externally so that you can stop the operation and shut off the power immediately. Install an overcurrent protection, earth leakage breaker, over-temperature protection and emergency stop apparatus without fail. &KHFNDQGFRQÀUPWKHVDIHW\RIWKHRSHUDWLRQ after the earthquake. Before transporting, wiring and inspecting the driver, turn off power and wait for a time longer WKDQWKDWVSHFLÀHGRQWKHQDPHSODWHRQWKHVLGH panel of the product; and make sure that there is no risk of electrical shock. Failure to observe this instrucWLRQFRXOGUHVXOWLQÀUH Failure to observe this instruction could result in electrical shocks, damages and breakdowns. Failure to heed this precaution will result in electric shock, perVRQDOLQMXU\ÀUHPDOIXQFWLRQRU damage. ,QVWDOODWLRQRQDÁDPPDEOHPDWHULDOPD\FDXVHÀUH Allowing a person with no expertise to carry out wiring will result in electrical shocks. Incorrect wiring will result in short circuit, electric shock, personal injury, etc. Incorrect wiring will result short FLUFXLWHOHFWULFVKRFNÀUHRU malfunction. Floating ground circuit will cause electric shock. Adjustment After correctly connecting cables, insulate the live parts with insulator. Failure to observe this instruction could result in burns. Setup :LULQJKDVWREHFDUULHGRXWE\WKHTXDOLÀHGDQG authorized specialist. 2 Connection Do not subject the cables to excessive force, heavy object, or pinching force, nor damage the cables. Failure to observe this instruction could result in personal injury. Preparation Do not drive the motor with external power. Before Using the Products In the case of the motor with shaft end keyway, do not touch the keyway with bare hands. Do not touch the rotating portion of the motor while it is running. Failure to observe this instruction could result in damages and breakdowns. Do not touch the motor, servo driver, heat sink, regenerative resistor and dynamic brake resister, since they become very hot. Energized circuit will cause electric shock. 7 Safety Precautions Please observe safety precautions fully. Caution Do not hold the motor cable or motor shaft during the transportation. Failure to observe this instruction could result in injuries. Don't drop or cause topple over of something during transportation or installation. Failure to observe this instruction could result in injuries and breakdowns. Do not step on the Product nor place the heavy object on them. Failure to observe this instruction could result in electrical shocks, injuries, breakdowns and damages. Don't use the equipment under direct sunshine. Failure to heed these instructions will cause personal injury RUÀUH Do not block the heat dissipating holes or put the foreign particles into them. Failure to observe this instruction could result in electrical VKRFNVDQGÀUH Do not give strong impact shock to the Product. Failure to observe this instruction could result in breakdowns. Do not give strong impact shock to the motor shaft. Failure to observe this instruction could result in a failure of the detector etc. Do not turn on and off the main power of the driver repeatedly. Never run or stop the motor with the electro-magnetic contactor installed in the main power side. 8 Failure to observe this instruction could result in breakdowns. Do not make an extreme gain adjustment or change of the drive. Do not keep the machine running/operating unstably. Failure to observe this instruction could result in injuries. Do not use the built-in brake as a "Braking" to stop the moving load. Failure to observe this instruction could result in injuries and breakdowns. Do not approach to the machine since it may suddenly restart after the power resumption. Design the machine to secure the safety for the operator even at a sudden restart. Failure to observe this instruction could result in injuries. 1HYHUDWWHPSWWRSHUIRUPPRGLÀFDWLRQGLVPDQWOH or repair. Failure to heed this instruction ZLOOUHVXOWLQÀUHHOHFWULFVKRFN personal injury or malfunction. 1 2EVHUYHWKHVSHFLÀHGPRXQWLQJPHWKRGDQGGLrection. )DLOXUHWRKHHGWKHVHUHTXLUHments will result in personal injury or malfunction. Using it for transportation of the machine will cause personal injury or malfunction. Don't place any obstacle object around the motor and peripheral, which blocks air passage. Temperature rise will cause EXUQLQMXU\RUÀUH 3 )DLOXUHWRKHHGWKHVHUHTXLUHments will result in personal injury or malfunction. Provide protection device against idling of electromagnetic brake or gear head, or grease leakage from gear head. No protection will cause personal injury, damage, pollution RUÀUH 8VHWKHPRWRUDQGWKHGULYHULQWKHVSHFLÀHGFRPbination. Not using the motor and the GULYHULQWKHVSHFLÀHGFRPELQDWLRQZLOOUHVXOWLQÀUH 7HVWUXQWKHVHFXUHO\À[HGPRWRUZLWKRXWORDGLQJ to verify normal operation, and then connect it to the mechanical system. Operation using a wrong model or wrong wiring connection will result in personal injury. When any error occurs, remove the cause and release the error after securing the safety, then restart. Not removing the cause of the error will result in personal injury. If the driver fails, shut off the power on the power supply side of the driver. Allowing a large current to conWLQXHWRSDVVZLOOUHVXOWLQÀUH Maintenance must be performed by an experienced personnel. Wrong wiring will cause personal injury or electric shock. Always keep power disconnected when the power is not necessary for a long time. Improper operation will cause personal injury. 5 6 When in Trouble Missing of one of these devices will result in personal injury or malfunction. Adjustment Connect the brake control relay to the relay which is to shut off at emergency stop in series. 4 Setup 2EVHUYHWKHVSHFLÀHGYROWDJH Operation from a voltage outside the rated voltage will cause electric shock, personal injury RUÀUH Connection &UHDWHWKHVSHFLÀHGFOHDUDQFHEHWZHHQWKHGULYHU and the control panel inner surface or other devices. 2 Preparation Use the eye bolt of the motor for transportation of the motor only, and never use this for transportation of the machine. Adjust the motor and driver ambient environmental condition to match the motor operating temperature and humidity. Before Using the Products Make an appropriate mounting of the Product matching to its wight and output rating. 7 Supplement When you dispose the batteries, observe any applicable regulations or laws after insulating them with tape. This Product shall be treated as Industrial Waste when you dispose. 9 Conformance to international standards Conformed Standards Driver EC Directives EMC Directives EN55011 EN61000-6-2 EN61800-3 Low-Voltage Directives EN61800-5-1 Machinery Directives Functional safety (*1) Motor – EN60034-1 EN60034-5 EN954-1 (Cat. 3) ISO13849-1 (PL c,d*2) (Cat. 3) EN61508 (SIL 2) EN62061 (SIL 2) EN61800-5-2 (STO) IEC61326-3-1 – UL1004-1 to 750W (200V) ( E327868: from ) 6.0kW UL Standards UL508C (E164620) UL1004 ( CSA Standards C22.2 No.14 ) E327868: 400W (400V) 600W (400V), 750W (400V) 0.9kW to 5.0kW C22.2 No.100 IEC : International Electrotechnical Commission EN : Europaischen Normen EMC : Electromagnetic Compatibility UL : Underwriters Laboratories CSA : Canadian Standards Association Pursuant to the directive 2004/108/EC, article 9(2) Panasonic Testing Centre Panasonic Service Europe, a division of Panasonic Marketing Europe GmbH Winsbergring 15, 22525 Hamburg, F.R. Germany Products shall conform to the statutory regulations applied in the place of destination. 2QO\IRUSRVLWLRQFRQWUROW\SHGRHVQRWVXSSRUWIXQFWLRQDOVDIHW\(*1) standards. *2 PL d: Provided that EDM is used. Note 10 For details on compatibility with international standard, refer to P.2-2 Conformance to international standards. Maintenance and Inspections 1 Before Using the Products Routine maintenance and inspection of the driver and motor are essential for the proper and safe operation. 2 Notes on Maintenance and Inspection Preparation 3 Connection 1) Turn on and turn off should be done by operators or inspectors themselves. When establishing a system using safety functions, completely understand the applicable safety standards and the operating instruction manual or technical documents for the product. 2) Internal circuit of the driver is kept charged with high voltage for a while even after power-off. Turn off the power and allow 15 minutes or longer after LED display of the front panel has gone off, before performing maintenance and inspection. 3) Disconnect all of the connection to the driver when performing megger test (Insulation resistance measurement) to the driver, otherwise it could result in breakdown of the driver. 4) Do not use benzine, thinner, alcohol, acidic cleaner and alkaline cleaner because they can discolor or damage the exterior case. 5) The upper fan on H-frame driver is kept deactivated while servo is off, for the purpose of energy saving. This is normal. 4 Inspection Items and Cycles General and normal running condition Setup $PELHQWFRQGLWLRQVÝ& DQQXDODYHUDJH ORDGIDFWRURIRU lower, operating hours of 20 hours or less per day. Perform the daily and periodical inspection as per the items below. Type 6 /RRVHWLJKWHQLQJ 7UDFHRIRYHUKHDW 'DPDJHWRWKHWHUPLQDOEORFN /RRVHIDVWHQHUVRQWHUPLQDOEORFN 7 Supplement Note Annual $PELHQWWHPSHUDWXUHKXPLGLW\VSHFNGXVWRUIRUHLJQREMHFW $EQRUPDOYLEUDWLRQDQGQRLVH 0DLQFLUFXLWYROWDJH 2GRU /LQWRURWKHUSDUWLFOHVDWDLUKROHV &OHDQQHVVDWIURQWSRUWLRQRIWKHGULYHUDQGFRQQHFWRU 'DPDJHRIWKHFDEOHV /RRVHFRQQHFWLRQRUPLVDOLJQPHQWEHWZHHQWKHPRWRUDQG PDFKLQHRUHTXLSPHQW 3LQFKLQJRIIRUHLJQREMHFWDWWKHORDG When in Trouble Motor with Gear Reducer Daily 5 Items to be inspected Adjustment Daily inspection Cycles Inspection cycle may change when the running conditions of the above change. 11 Maintenance and Inspections Guideline for Parts Replacement Use the table below for a reference. Parts replacement cycle varies depending on the actual operating conditions. Defective parts should be replaced or repaired when any error have occurred. Prohibited Product Disassembling for inspection and repair should be carried out only by authorized dealers or service company. Component Standard replacement cycles (hour) Smoothing condenser Approx. 5 years Cooling fan 2 to 3 years (10,000 to 30,000 hours) Aluminum electrolytic capacitor (on PCB) Approx. 5 years Rush current preventive relay Approx. 100,000 times (depending on working condition) Rush current preventive resistor Approx. 20,000 times (depending on working condition) Bearing 3 to 5 years (20,000 to 30,000 hours) Oil seal 5000 hours Encoder 3 to 5 years (20,000 to 30,000 hours) Battery for absolute encoder Life time varies depending on working conditions. Refer to the Operating Instructions attached to the battery for absolute encoder. Driver Motor Related page 12 3´:DUUDQW\µ Note These hours or cycles are reference. When you experience any HUURUUHSODFHPHQWLVUHTXLUHG even before this standard replacement cycle. 1. Introduction Before Using the Products 1. Before Using the Products 1 2 Outline .........................................................................................................1-2 On Opening the Product Package ...............................................................1-2 Preparation 2. Driver Check of the Model ......................................................................................1-3 Parts Description A to E-frame..............................................................................................1-4 F-frame .....................................................................................................1-5 G-frame.....................................................................................................1-6 3 H-frame .....................................................................................................1-7 D to F-frame (400 V) .................................................................................1-8 Connection G-frame (400 V) ........................................................................................1-9 H-frame (400 V) ......................................................................................1-10 Specifications.............................................................................................1-11 Block Diagram ...........................................................................................1-15 3. Motor 4 Check of the Model ....................................................................................1-21 Parts Description .......................................................................................1-22 Setup 4. Check of the Combination of the Driver and the Motor Incremental Specifications, 20-bit ..............................................................1-23 Absolute Specifications, 17-bit...................................................................1-25 Junction cable for motor ...........................................................................1-27 5 5. Installation Driver .........................................................................................................1-28 Adjustment Motor..........................................................................................................1-32 6. Permissible Load at Output Shaft Motor..........................................................................................................1-35 6 When in Trouble 7 Supplement 1-1 1Before Using the Products 1. Introduction Outline The AC Servo Motor & Driver, MINAS A5-series is the latest servo system that meets all GHPDQGVIURPDYDULHW\RIPDFKLQHVZKLFKUHTXLUHKLJKVSHHGKLJKSUHFLVLRQDQGKLJK SHUIRUPDQFHRUZKLFKUHTXLUHVLPSOLÀHGVHWWLQJV Compared with the preceding A4-series, product of A5-series offers superior performance ZKLOHUHTXLULQJVLPSOHVHWXSDQGDGMXVWPHQWE\WKHXVHU Newly designed motors have wide range of outputs from 50 W to 15.0 kW, associated ZLWKELWLQFUHPHQWDOHQFRGHUDQGUHGXFHGFRJJLQJWRUTXH (Only for position control type have range of outputs from 50 W to 5.0 kW.) They are compatible with 2 closed controls (serial communication type and A-/B-phase output type) and provided with various automatic adjusting functions such as real time auto tuning with many automatic setting parameters to make complex tuning easy. (Only for position control type do not conform to full-closed control.) These motors assure higher stability with low stiffness machine and high-speed, high accurate operation with high stiffness machine. They can be used in combination with a wide variety of machines. This manual is written as a complete guide for you so that you can fully and correctly make use of all functions available from MINAS A5. 1Before Using the Products 1. Introduction On Opening the Product Package 0DNHVXUHWKDWWKHPRGHOLVZKDW\RXKDYHRUGHUHG &KHFNLIWKHSURGXFWLVGDPDJHGRUQRWGXULQJWUDQVSRUWDWLRQ &KHFNLIWKH2SHUDWLQJ,QVWUXFWLRQV VDIHW\ DUHLQFOXGHGRUQRW &KHFN LI WKH SRZHU FRQQHFWRU PRWRU FRQQHFWRUV FRQQHFWRU IRU H[WHUQDO UHJHQHUDWLYH resistor connection (D-frame (400 V) and E-frame) and safety by-pass plug are included or not. (Neither the power connector nor motor connector are included to F-frame to H-frame.) (Safety bypass plug is not supplied with only for position control type because it does not use this plug.) &RQWDFWWRDGHDOHULI\RXÀQGDQ\IDLOXUHV 1-2 1 Before Using the Products 2. Driver 1Before Using Check of the Model the Products Contents of Name Plate Model number Serial Number e.g.) : P09 04 0001N Input/output voltage 2 Lot number Number of phase Preparation Month of production Rated input/output current Year of production (Lower 2 digits of AD year) Input/output frequency Rated output of applicable motor Manufacture date e.g.) : 2009 04 01 Manufacture year 3 Manufacture date Manufacture month Connection Model Designation Velocity, position, torque and full-closed FRQWUROW\SH M A D H T 1 5 0 5 1 to 4 5 to 6 7 8 to 9 10 to 12 Special specifications (letters and numbers) M A D H T 1 5 0 5 E 1 to 4 5 to 6 7 8 to 9 10 Setup Only for position control type 4 11 to 12 Special specifications (letters and numbers) Frame-size symbol NOTE) Only for position control type is SURYLGHG$)UDPHWR)IUDPH Symbol Current rating 10A T1 15A T2 30A T3 35A T4 50A T5 70A T7 100A TA 150A TB 300A TC Specifications Single phase, 100V 3-phase, 200V 3-phase, 400V Single/3-phase, 200V 7 Supplement Related page 6 Power supply Symbol 1 3 4 5 5 When in Trouble Frame A5-series, A-frame A5-series, B-frame A5-series, C-frame A5-series, D-frame A5-series, E-frame A5-series, F-frame A5-series, G-frame A5-series, H-frame Current detector rating Symbol Current rating 5A 05 7.5A 07 10A 10 12A 12 20A 20 30A 30 40A 40 64A 64 90A 90 120A A2 240A B4 Adjustment Symbol MADH MBDH MCDH MDDH MEDH MFDH MGDH MHDH Only for position control type Max. current rating of power device 3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 1-3 1Before Using the Products 2. Driver Parts Description A to D-frame Front panel Connector XA: for main power connection Connector X7: Monitor connector 05JFAT-SAXGF (JST) Connector X1: USB connector Main power input terminals Control power input terminals Terminals for external regenerative resistor (Normally short-circuit B3 to B2) L1 L2 L3 L1C L2C Connector X2: for Serial bus Connector X3: Safety function connector Connector X4: Parallel I/O connector B1 B3 B2 U V W Connector X5: for feedback scale connection Terminals for motor connection Connector XB: for motor connection Connector X6: for encoder connection Screws for earth (x2) 06JFAT-SAXGF (JST) Charge lamp LED cover Safety by-pass prug E-frame Front panel Connector XA: for main power connection Connector X7: Monitor connector 05JFAT-SAXGSA-L (JST) Main power input terminals Control power input terminals Terminals for external regenerative resistor (Normally short-circuit B3 to B2) Terminals for motor connection Connector X1: USB connector L1 L2 L3 L1C L2C Connector X2: for Serial bus Connector X3: Safety function connector B1 B3 B2 NC* Connector X4: Parallel I/O connector Connector X5: for feedback scale connection U V W Connector X6: for encoder connection Connector XB: for motor connection 03JFAT-SAXGSA-L (JST) Connector XC: Connector for external regenerative resistor 04JFAT-SAXGSA-L (JST) Note 1-4 Screws for earth (x2) Charge lamp LED cover * NC is no connect. Safety by-pass prug &RQQHFWRU;$DQG;%DUHDWWDFKHGLQ$WR'IUDPHGULYHU &RQQHFWRU;$;%DQG;&DUHDWWDFKHGLQ(IUDPHGULYHU 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 2. Driver 1 Before Using the Products Parts Description F-frame Details of terminal block 2 Front panel Connector X7: Monitor connector Control power input terminals Terminals for external regenerative resistor Terminals for motor connection * NC is no connect. Screws for earth (x2) Connector X1: USB connector Connector X2: for Serial bus Connector X3: Safety function connector Connector X4: Parallel I/O connector 3 Connector X5: for feedback scale connection Connection (Normally short-circuit B3 to B2) Preparation Main power input terminals L1 L2 L3 L1C L2C B1 B3 B2 NC* U V W Connector X6: for encoder connection 4 Charge lamp LED cover Safety by-pass prug Setup Terminal cover 5 Adjustment 6 When in Trouble 7 Related page Supplement Note 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ3´,QVWDOODWLRQµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ3WR´'LPHQVLRQVµ 1-5 2. Driver Parts Description G-frame Front panel Terminal cover screw Connector X7: Monitor connector ワヤ L1 ヹヒ ロヒヤ ヹビ L2 ロ ビヤ ヹピ Terminal cover L3 B1 ワヤ Connector X1: USB connector Connector X2: for Serial bus Connector X3: Safety function connector ワヤ ヹフ ュャヒ B2 Connector X4: Parallel I/O connector ュャビ NC ワヤ ヹブ U ワヤ ヹプ V ュャピ Connector X5: for feedback scale connection Connector X6: for encoder connection ュャフ W Terminal cover screw ワヤ ヤラモンヨユ Charge lamp Screws for earth (x2) Details of terminal block NC* L1C L2C NC* NC* DB1 DB2 NC* NC* DB3 DB4 NC* L1 Main power input terminals Terminals for external regenerative resistor L2 L3 B1 B2 NC* U Terminals for motor connection V W Control power input terminals Control terminal for dynamic brake resister Control terminal for dynamic brake resister (Normally short-circuit DB3 to DB4.) * NC is no connect. LED cover Safety by-pass prug Terminal cover Note Related page 1-6 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ3´,QVWDOODWLRQµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ3WR´'LPHQVLRQVµ 2. Driver 1 Before Using the Products Parts Description H-frame 2 Front panel Preparation Connector X7: Monitor connector Connector X1: USB connector Connector X2: for Serial bus Connector X3: Safety function connector ヹヒ ヹビ ヹピ Connector X4: Parallel I/O connector ヹフ 3 Connector X5: for feedback scale connection ヹブ ヹプ Connection Connector X6: for encoder connection ヤラモンヨユ Charge lamp 4 L1C L2C DB1 DB2 Setup L1 L2 L3 B1 B2 NC U V W 5 Adjustment Screws for earth (x2) Details of terminal block DB1 DB2 Control power input terminals Control terminal for dynamic brake resister L1C L2C 6 LED cover When in Trouble Safety by-pass prug L1 L2 L3 Main power input terminals B1 B2 NC* U V Terminals for motor connection Terminals for external regenerative resistor Related page * NC is no connect. 7 Terminal cover Terminal cover screw Supplement Note W 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ3´,QVWDOODWLRQµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ3WR´'LPHQVLRQVµ 1-7 2. Driver Parts Description D, E-frame (400 V) Connector XA: for main power connection Front panel 03JFAT-SAYGSA-L (JST) Connector XD: Control power input terminals Connector X7: Monitor connector 02MJFAT-SAGF (JST) Control power input terminals Main power input terminals 24V 0V L1 L2 L3 Terminals for external regenerative resistor (Normally short-circuit B3 to B2) B1 B3 B2 NC* Terminals for motor connection Connector X1: USB connector Connector X2: for Serial bus Connector X3: Safety function connector Connector X4: Parallel I/O connector Connector X5: for feedback scale connection Connector X6: for encoder connection U V W Connector XB: for motor connection 03JFAT-SAXGSA-L (JST) Connector XC: Connector for external regenerative resistor Screws for earth (x2) 04JFAT-SAXGSA-L(JST) Charge lamp LED cover * NC is no connect. Safety by-pass prug F-frame (400 V) Details of terminal block Control power input terminals Main power input terminals Terminals for external regenerative resistor (Normally short-circuit B3 to B2) Terminals for motor connection 24V 0V L1 L2 L3 B1 B3 B2 NC* U V W * NC is no connect. Front panel Connector X7: Monitor connector Connector X1: USB connector Connector X2: for Serial bus Connector X3: Safety function connector Connector X4: Parallel I/O connector Connector X5: for feedback scale connection Connector X6: for encoder connection Charge lamp Screws for earth (x2) LED cover Safety by-pass prug Terminal cover Note 1-8 &RQQHFWRU;DQG;DUHDWWDFKHGLQ$WR'IUDPHGULYHU &RQQHFWRU;$;%;&DQG;'DUHDWWDFKHGLQ'DQG(IUDPH 9 GULYHU 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 2. Driver 1 Before Using the Products Parts Description G-frame (400 V) 2 Front panel Terminal cover screw Connector X7: Monitor connector ワヤ ヹヒ ビフヷ ヹビ パヷ ヹピ Terminal cover L3 B1 ワヤ Connector X1: USB connector Connector X2: for Serial bus Connector X3: Safety function connector Preparation L1 L2 ワヤ ヹフ ュャヒ B2 Connector X4: Parallel I/O connector ュャビ NC ワヤ ヹブ U ワヤ ヹプ V ュャピ ュャフ W Terminal cover screw ワヤ ヤラモンヨユ フパパヷ Charge lamp 3 Connection Connector X5: for feedback scale connection Connector X6: for encoder connection 4 Screws for earth (x2) Details of terminal block L2 L3 Terminals for external regenerative resistor B1 B2 NC* U V W Control power input terminals 5 Control terminal for dynamic brake resister Adjustment Terminals for motor connection Setup NC* 24V 0V NC* NC* DB1 DB2 NC* NC* DB3 DB4 NC* L1 Main power input terminals Control terminal for dynamic brake resister (Normally short-circuit DB3 to DB4.) * NC is no connect. 6 When in Trouble LED cover Safety by-pass prug 7 Terminal cover Related page Supplement Note 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ3´,QVWDOODWLRQµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ3WR´'LPHQVLRQVµ 1-9 2. Driver Parts Description H-frame (400 V) Front panel Connector X7: Monitor connector Connector X1: USB connector Connector X2: for Serial bus Connector X3: Safety function connector ヹヒ ヹビ ヹピ Connector X4: Parallel I/O connector ヹフ Connector X5: for feedback scale connection ヹブ ヹプ Connector X6: for encoder connection ヤラモンヨユ Charge lamp 24V L1 L2 L3 0V DB1 B1 DB2 B2 NC U V W Screws for earth (x2) Details of terminal block DB1 DB2 Control power input terminals Control terminal for dynamic brake resister 24V 0V LED cover Safety by-pass prug L1 L2 L3 Main power input terminals B1 B2 NC* U V Terminals for motor connection Terminals for external regenerative resistor Note Related page 1-10 W * NC is no connect. Terminal cover Terminal cover screw 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ3´,QVWDOODWLRQµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ3WR´'LPHQVLRQVµ the Products Specifications (Velocity, position, torque, full-closed control type) Main circuit Single phase, 100 to 120V Control circuit Single phase, 100 to 120V 100V A to Control D-frame circuit E to H-frame Main circuit 400V *1 Control circuit temperature Environment humidity Altitude Vibration Encoder feedback Feedback scale feedback Input Control signal Analog signal Input Output Input Pulse signal Output Safety function Front panel Regeneration Dynamic brake 50/60Hz 50/60Hz 50/60Hz 3 DC24V ± 15% Primary to earth: withstand 1500 VAC, 1 min, (sensed current: 20 mA) [100V/200V] withstand 1960 VAC, 1 min, (sensed current: 20 mA) [400V] * 400V control circuit is excluded. $PELHQWWHPSHUDWXUHÝ&WRÝ& IUHHIURPIUHH]LQJ 6WRUDJHWHPSHUDWXUH²Ý&WRÝ& (Max. temperature guarantee: 80ÝC for 72 hours free from condensation*2) Both operating and storage : 20 to 85%RH or less (free from condensation*2) Lower than 1000m 5.88m/s2RUOHVVWR+] 1RFRQWLQXRXVXVHDWUHVRQDQFHIUHTXHQF\ IGBT PWM Sinusoidal wave drive 17-bit (131072 resolution) absolute encoder, 7-wire serial 20-bit (1048576 resolution) incremental encoder, 5-wire serial A/B phase, initialization signal defferential input. Manufacturers that support serial communication scale: Mitsutoyo Corp. Magnescale Co., Ltd. (old Sony Manufacturing Systems Corp.) General purpose 10 inputs The function of general-purpose input is selected by parameters. General purpose 6 outputs The function of general-purpose input is selected by parameters. 3 inputs (16Bit A/D : 1 input, 12Bit A/D : 2 inputs) 2 outputs (Analog monitor: 2 output) 2 inputs (Photo-coupler input, Line receiver input) Photocoupler input is compatible with both line driver I/F and open collector I/F. Line receiver input is compatible with line driver I/F. 4 outputs ( Line driver: 3 output, open collector: 1 output) Feed out the encoder feedback pulse (A, B and Z-phase) or feedback scale pulse (EXA, EXB and EXZ-phase) in line driver. Z-phase and EXZ-phase pulse is also fed out in open collector. Connection with PC etc. 1 : 1 communication to a host. 1 : n communication to a host. Used for functional safety. (1) 5 keys (MODE, SET, UP, DOWN, SHIFT) (2) LED (6-digit) (3) Monitor connector (Analog monitor output (2ch), Digital monitor output (1ch)) A, B, G and H-frame: no built-in regenerative resistor (external resistor only) C to F-frame: Built-in regenerative resistor (external resistor is also enabled.) A to G-frame: Built-in (external resistor is also available to G-frame) H-frame: External only Switching among the following 7 mode is enabled, 3RVLWLRQFRQWURO 9HORFLW\FRQWURO 7RTXHFRQWURO 3RVLWLRQ9HORFLW\FRQWURO 3RVLWLRQ7RUTXHFRQWURO 9HORFLW\7RUTXHFRQWURO )XOOFORVHGFRQWURO Caution 7KHVSHFLÀFDWLRQRXWRI-DSDQ *2 Air containing water vapor will become saturated with water vapor as the temperature falls, causing dew. Related page 3´,QVWDOODWLRQRI'ULYHUµ3´,QVWDOODWLRQRI0RWRUµ 1-11 4 5 6 7 Supplement Control mode 3-phase, 380 to 480V 50/60Hz When in Trouble Communication function USB RS232 RS485 Single phase, 200 to 230V 2 50/60Hz Adjustment Parallel I/O connector Output Single phase, 200 to 240V 50/60Hz Setup %DVLF6SHFLÀFDWLRQV Control method 3-phase, 200 to 230V 50/60Hz Connection Withstand voltage Single/3-phase, 200 to 240V +10% –15% +10% –15% +10% –15% +10% –15% +10% –15% +10% –15% +10% –15% Preparation Input power 200V A to Main D-frame circuit E to H-frame 1 2. Driver Before Using the Products 1Before Using 2. Driver Specifications (Velocity, position, torque, full-closed control type) Control input Control output Control input Position control Control output Max. command SXOVHIUHTXHQF\ Input pulse signal Pulse format input Electronic gear (Division/Multiplication of command pulse) 6PRRWKLQJÀOWHU 7RUTXHOLPLW Analog command input input 7RUTXHIHHGIRUZDUGLQSXW Instantaneous Speed Observer Damping Control Control input Function Velocity control Control output Velocity command input Analog 7RUTXHOLPLW input command input 7RUTXHIHHGIRUZDUGLQSXW Internal velocity command Soft-start/down function 7RUTXHFRQWURO Zero-speed clamp Instantaneous Speed Observer Control input Control output Analog 7RUTXHFRPPDQG input input Speed limit function Control input Full-closed control Control output Max. command SXOVHIUHTXHQF\ Input pulse signal Pulse format input Electronic gear (Division/Multiplication of command pulse) 6PRRWKLQJÀOWHU 7RUTXHOLPLW Analog command input input 7RUTXHIHHGIRUZDUGLQSXW Setup range of division/ multiplication of feedback scale Auto tuning Common Division of encoder feedback pulse Protective function Hard error Soft error Traceability of alarm data 1-12 (1) Servo-ON input (2) Alarm clear input (3) Gain switching input (4) Positive direction over-travel inhibition input (5) Negative direction over-travel inhibition input (6) Forced alarm input (7) Inertia ratio switching input (1) Servo-Alarm output (2) Servo-Ready output (3) External brake release signal 6SHHGDUULYDORXWSXW 7RUTXHLQOLPLWVLJQDORXWSXW (6) Zero-speed detection output signal (7) Alarm output (8) Alarm attribute output (1) Deviation counter clear (2) Command pulse inhibition (3) Command dividing gradual increase switching (4) Damping control switching 7RUTXHOLPLWVZLWFKLQJ &RQWUROPRGHVZLWFKLQJ (1) Positioning complete (In-position) (2)Positional command ON/OFF output Exclusive interface for Photo-coupler: 500kpps Exclusive interface for line driver : 4Mpps Differential input. Selectable with parameter. ((1) Positive and Negative direction, (2) A and B-phase, (3) Command and direction) ( 1 to 2 ) 30 3URFHVVFRPPDQGSXOVHIUHTXHQF\ðHOHFWURQLFJHDUUDWLR 1 to 230 as positional command input. Use electronic gear ratio in the range 1/1000 to 1000 times. 3ULPDU\GHOD\ÀOWHURU),5W\SHÀOWHULVDGDSWDEOHWRWKHFRPPDQGLQSXW ,QGLYLGXDOWRUTXHOLPLWIRUERWKSRVLWLYHDQGQHJDWLYHGLUHFWLRQLVHQDEOHG $QDORJYROWDJHFDQEHXVHGDVWRUTXHIHHGIRUZDUGLQSXW Available Available (1) Selection of internal velocity setup (2) Speed zero clamp (3) Speed command sign input (4)Control mode switching (1) Speed coincidence output (2)Speed command ON/OFF output Speed command input can be provided by means of analog voltage. Parameters are used for scale setting and command polarity. (6V/Rated rotational speed Default) ,QGLYLGXDOWRUTXHOLPLWIRUERWKSRVLWLYHDQGQHJDWLYHGLUHFWLRQLVHQDEOHG $QDORJYROWDJHFDQEHXVHGDVWRUTXHIHHGIRUZDUGLQSXW Switching the internal 8speed is enabled by command input. Individual setup of acceleration and deceleration is enabled, with 0 to 10s/1000r/min. Sigmoid acceleration/deceleration is also enabled. 0-clamp of internal velocity command with speed zero clamp input is enabled. Available 6SHHG]HURFODPS 7RUTXHFRPPDQGVLJQLQSXW &RQWUROPRGHVZLWFKLQJ (1) Speed coincidence output (2) Speed in-limit output 7RUTXHFRPPDQGLQSXWFDQEHSURYLGHGE\PHDQVRIDQDORJYROWDJH 3DUDPHWHUVDUHXVHGIRUVFDOHVHWWLQJDQGFRPPDQGSRODULW\ 9UDWHGWRUTXH'HIDXOW Speed limit value with parameter t is enabled. (1) Deviation counter clear (2) Command pulse inhibition (3) Command dividing gradual increase switching (4) Damping control switching 7RUTXHOLPLWVZLWFKLQJ (1) Full-closed positioning complete (2) Positional command ON/OFF output Exclusive interface for Photo-coupler: 500kpps Exclusive interface for line driver : 4Mpps Differential input. Selectable with parameter. ((1) Positive and Negative direction, (2) A and B-phase, (3) Command and direction) ( 1 to 2 ) 30 3URFHVVFRPPDQGSXOVHIUHTXHQF\ðHOHFWURQLFJHDUUDWLR 1 to 230 as positional command input. Use electronic gear ratio in the range 1/1000 to 1000 times. 3ULPDU\GHOD\ÀOWHURU),5W\SHÀOWHULVDGDSWDEOHWRWKHFRPPDQGLQSXW ,QGLYLGXDOWRUTXHOLPLWIRUERWKSRVLWLYHDQGQHJDWLYHGLUHFWLRQLVHQDEOHG $QDORJYROWDJHFDQEHXVHGDVWRUTXHIHHGIRUZDUGLQSXW 1/40 to 160 times The ratio of encoder pulse (numerator) to external scale pulse (denominator) can be set to 1 to 220 (numerator) to 1 to 220 (denominator), but should be set to a ratio within the range shown above. The load inertia is identified in real time by the driving state of the motor operating according WRWKHFRPPDQGJLYHQE\WKHFRQWUROOLQJGHYLFHDQGVHWXSVXSSRUWVRIWZDUH´3$1$7(50µ The gain is set automatically in accordance with the rigidity setting. Set up of any value is enabled (encoder feedback pulses count is the max.). Over-voltage, under-voltage, over-speed, over-load, over-heat, over-current and encoder error etc. Excess position deviation, command pulse division error, EEPROM error etc. The alarm data history can be referred to. Single phase, 100 to 120V +10% 50/60Hz –15% Control circuit Single phase, 100 to 120V +10% 50/60Hz –15% A to D-frame Single/3-phase, 200 to 240V +10% 50/60Hz –15% E to F-frame 3-phase, 200 to 230V +10% 50/60Hz –15% A to D-frame Single phase, 200 to 240V +10% 50/60Hz –15% E to F-frame Single phase, 200 to 230V +10% 50/60Hz –15% 100V Input power 200V Control circuit D to F-frame Control circuit D to F-frame Withstand voltage Environment Both operating and storage : 20 to 85%RH or less (free from condensation) Lower than 1000m Vibration 5.88m/s2RUOHVVWR+] 1RFRQWLQXRXVXVHDWUHVRQDQFHIUHTXHQF\ IGBT PWM Sinusoidal wave drive 20-bit (1048576 resolution) incremental encoder, 5-wire serial Input General purpose 10 inputs The function of general-purpose input is selected by parameters. Output General purpose 6 outputs The function of general-purpose input is selected by parameters. Output 2 outputs (Analog monitor: 2 output) Control signal Pulse signal Output USB 5 2 inputs (Photo-coupler input, Line receiver input) Photocoupler input is compatible with both line driver I/F and open collector I/F. Line receiver input is compatible with line driver I/F. 4 outputs ( Line driver: 3 output, open collector: 1 output) Feed out the encoder feedback pulse (A, B and Z-phase) or feedback scale pulse (EXA, EXB and EXZ-phase) in line driver. Z-phase and EXZ-phase pulse is also fed out in open collector. Connection with PC etc. (1) 5 keys (2) LED (6-digit) (3) Analog monitor output (2ch) Regeneration A, B-frame: no built-in regenerative resistor (external resistor only) C to F-frame: Built-in regenerative resistor (external resistor is also enabled.) Dynamic brake A to F-frame: Built-in Control mode (1) Position control (2) Internal velocity control (3) Position/ Internal velocity control 6 When in Trouble Front panel 4 Adjustment Parallel I/O connector Input Communication function Primary to earth: withstand 1500 VAC, 1 min, (sensed current: 20 mA) [100V/200V] withstand 1960 VAC, 1 min, (sensed current: 20 mA) [400V] * 400V control circuit is excluded. $PELHQWWHPSHUDWXUHÝ&WRÝ& IUHHIURPIUHH]LQJ 6WRUDJH WHPSHUDWXUH ²Ý& WR Ý& (Max. temperature guarantee: 80ÝC for 72 hours free from condensation*2) Altitude Encoder feedback Analog signal DC 24V ± 15% humidity Control method 3 +10% 50/60Hz –15% Setup %DVLF6SHFLÀFDWLRQV temperature 3-phase, 380 to 480V Connection Main circuit 2 Preparation Main circuit Main circuit Before Using the Products Specifications (Only for position control type) the Products 400V 1 2. Driver 1Before Using 7 7KHVSHFLÀFDWLRQRXWRI-DSDQ *2 Air containing water vapor will become saturated with water vapor as the temperature falls, causing dew. Related page 3´,QVWDOODWLRQRI'ULYHUµ3´,QVWDOODWLRQRI0RWRUµ Caution Only for position control type is provided A-Frame to F-frame. 1-13 Supplement Caution 2. Driver Specifications (Only for position control type) Control input (1) Deviation counter clear (2) Command pulse inhibition (3) Command dividing gradual increase switching (4) Damping control switching etc. Control output Positioning complete (In-position) etc. Position control Pulse input Max. command SXOVHIUHTXHQF\ Exclusive interface for Photo-coupler: 500kpps Exclusive interface for line driver : 4Mpps Input pulse signal format Differential input ((1) Positive and Negative direction, (2) A and B-phase, (3) Command and direction) Electronic gear (Division/ Multiplication of command pulse) 3URFHVV FRPPDQG SXOVH IUHTXHQF\ ð HOHFWURQLF JHDU UDWLR 1 to 230 as positional command input. Use electronic gear ratio in the range 1/1000 to 1000 times. 6PRRWKLQJÀOWHU 3ULPDU\GHOD\ÀOWHURU),5W\SHÀOWHULVDGDSWDEOHWRWKHFRPPDQGLQSXW 30 Internal velocity control Function Common Instantaneous Speed Observer Available Damping Control Available Control input (1) Selection of internal velocity setup (2) Speed zero clamp Control output Speed arrival Internal velocity command Switching the internal 8speed is enabled by command input. Soft-start/down function Individual setup of acceleration and deceleration is enabled, with 0 to 10s/1000r/ min. Sigmoid acceleration/deceleration is also enabled. Zero-speed clamp 0-clamp of internal velocity command with speed zero clamp input is enabled. Instantaneous Speed Observer Available Auto tuning The load inertia is identified in real time by the driving state of the motor operating according to the command given by the controlling device and set up support VRIWZDUH´3$1$7(50µ The gain is set automatically in accordance with the rigidity setting. Division of encoder feedback pulse Set up of any value is enabled (encoder pulses count is the max.). Protective function Hard error Over-voltage, under-voltage, over-speed, over-load, over-heat, over-current and encoder error etc. Soft error Excess position deviation, command pulse division error, EEPROM error etc. Traceability of alarm data 1-14 ( 1 to 2 ) The alarm data history can be referred to. 1 Before Using the Products 2. Driver 1Before Using Block Diagram the Products A, B-frame (100/200 V) U P L1 L2 L3 Fuse + Fuse 2 M W Voltage detection N RE Fuse + DC/DC L2C (12V +5V PS for gate drive PS for RE Preparation L1C V Gate drive B1 B3 B2 Front panel Error detection Sequence control Display operation control X1 Parameter control 3 Protective curcuit EEPROM USB X2 Serial Connection X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Division/ + mulitiplication – Position deviation amp. Deviation counter Position 16-bit – Speed Internal speed command Internal Control input Speed Velocity deviation amp. + External A/D Speed detection Torque limit Current control PWM circuit Torque A/D Control output X6 Encoder signal processing limit Pusle output Division processing 4 X5 Feedback scale signal processing limit Setup Feedback scale unit C, D-frame (100/200 V) U P L1 L2 L3 + V Resistor Fuse Voltage detection W + DC/DC L2C Adjustment Fuse M N Fan (D-frame only) L1C 5 Fuse RE (12V +5V PS for gate drive PS for RE Gate drive B1 B3 B2 Front panel X1 Error detection Sequence control Display operation control Parameter control EEPROM 6 Protective curcuit When in Trouble USB X2 Serial X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Control input Division/ + mulitiplication – A/D 16-bit Deviation counter Position deviation amp. Internal speed command Internal Control output Pusle output Position + External – Speed Velocity deviation amp. Speed Speed detection Torque limit Current control PWM circuit Torque A/D Encoder signal processing limit Division processing 7 X6 X5 Supplement Feedback scale signal processing limit Feedback scale unit Note 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 1-15 2. Driver Block Diagram E-frame (200 V) U P L1 L2 L3 Fuse + V Resistor Fuse Voltage detection N Fan L1C Fuse + M W RE Gate drive (12V +5V PS for gate drive PS for RE DC/DC L2C B1 B3 B2 Front panel Error detection Sequence control Display operation control X1 Parameter control Protective curcuit EEPROM USB X2 Serial X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Division/ + mulitiplication – Position deviation amp. Deviation counter Position A/D 16-bit – Speed Internal speed command Internal Control input Speed Velocity deviation amp. + External Speed detection Torque limit Current control PWM circuit Torque A/D Control output X6 Encoder signal processing limit Pusle output Division processing X5 Feedback scale signal processing limit Feedback scale unit F-frame (200 V) U P L1 L2 L3 Fuse Resistor Fuse M W N Voltage detection L1C V + Fan Fuse + L2C DC/DC RE Gate drive (12V +5V PS for gate drive PS for RE B1 B3 B2 Front panel Display operation control X1 Sequence control Error detection Parameter control Protective curcuit EEPROM USB X2 Serial X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Control input Division/ + mulitiplication – A/D 16-bit Deviation counter Position deviation amp. Internal speed command Internal Control output Pusle output Position + External – Speed Velocity deviation amp. Speed Speed detection Torque limit Current control PWM circuit Torque A/D Encoder signal processing limit Division processing X6 X5 Feedback scale signal processing limit Feedback scale unit Note 1-16 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 2. Driver 1 Before Using the Products Block Diagram G-frame (200 V) U P L1 L2 L3 Fuse 2 M W N Voltage detection Fan Fuse + Gate drive DB1 (12V +5V PS for gate drive PS for RE DC/DC L2C RE Preparation L1C V + Fuse DB2 DB3 DB4 B1 B3 B2 Front panel Error detection Sequence control Display operation control X1 Parameter control 3 Protective curcuit EEPROM USB X2 Serial Connection X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Division/ + mulitiplication – Position deviation amp. Deviation counter Position + External A/D 16-bit – Speed Internal speed command Internal Control input Speed Velocity deviation amp. Speed detection Torque limit Current control PWM circuit Torque A/D Control output X6 Encoder signal processing limit Pusle output Division processing 4 X5 Feedback scale signal processing limit Setup Feedback scale unit H-frame (200 V) U P L1 L2 L3 Fuse Fuse 5 M W N Fan Fuse + L2C DC/DC Gate drive DB1 (12V +5V PS for gate drive PS for RE Adjustment Voltage detection L1C V + RE DB2 B1 B3 B2 Front panel X1 Error detection Sequence control Display operation control Parameter control 6 Protective curcuit EEPROM USB When in Trouble X2 Serial X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Control input Division/ + mulitiplication – A/D 16-bit Deviation counter Position deviation amp. Internal speed command Internal Control output Pusle output Position + External – Speed Velocity deviation amp. Speed Speed detection Torque limit Current control PWM circuit Torque A/D Encoder signal processing limit Division processing 7 X6 X5 Supplement Feedback scale signal processing limit Feedback scale unit Note 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 1-17 2. Driver Block Diagram D-frame (400 V) U P L1 L2 L3 Fuse + V Fuse W Voltage detection N RE Fan 24V M Resistor Fuse + DC/DC 0V ±12V +5V PS for gate drive PS for RE Gate drive B1 B3 B2 Front panel Error detection Sequence control Display operation control X1 Parameter control Protective curcuit EEPROM USB X2 Serial X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Division/ + mulitiplication – Position deviation amp. Deviation counter Position + External A/D 16-bit – Speed Internal speed command Internal Control input Speed Velocity deviation amp. Speed detection Torque limit Current control PWM circuit Torque A/D Control output X6 Encoder signal processing limit Pusle output Division processing X5 Feedback scale signal processing limit Feedback scale unit E-frame (400 V) U P L1 L2 L3 Fuse + V W Voltage detection N RE Fan 24V M Resistor Fuse Fuse + DC/DC 0V ±12V +5V PS for gate drive PS for RE Gate drive B1 B3 B2 Front panel X1 Error detection Sequence control Display operation control Parameter control Protective curcuit EEPROM USB X2 Serial X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Control input Division/ + mulitiplication – A/D 16-bit Deviation counter Position deviation amp. Internal speed command Internal Control output Pusle output Position + External – Speed Velocity deviation amp. Speed Speed detection Torque limit Current control PWM circuit Torque A/D Encoder signal processing limit Division processing X6 X5 Feedback scale signal processing limit Feedback scale unit Note 1-18 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. 2. Driver 1 Before Using the Products Block Diagram F-frame (400 V) U P L1 L2 L3 Fuse + V Resistor Fuse Voltage detection N Fuse + ±12V +5V PS for gate drive PS for RE DC/DC 0V Preparation RE Fan 24V 2 M W Gate drive B1 B3 B2 Front panel Error detection Sequence control Display operation control X1 Parameter control 3 Protective curcuit EEPROM USB X2 Serial Connection X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Division/ + mulitiplication – Position deviation amp. Deviation counter Position + External A/D 16-bit – Torque limit Speed Internal speed command Internal Control input Speed Velocity deviation amp. Speed detection Current control PWM circuit Torque A/D Control output X6 Encoder signal processing limit Pusle output 4 Division processing X5 Feedback scale signal processing limit Setup Feedback scale unit G-frame (400 V) U P L1 L2 L3 Fuse 5 M W N Fan Fuse + 0V DC/DC Gate drive DB1 (12V +5V PS for gate drive PS for RE RE Adjustment Voltage detection 24V V + Fuse DB2 DB3 DB4 B1 B3 B2 Front panel X1 Error detection Sequence control Display operation control Parameter control 6 Protective curcuit EEPROM USB When in Trouble X2 Serial X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Control input Division/ + mulitiplication – A/D 16-bit Deviation counter Position deviation amp. Internal speed command Internal Control output Pusle output Position + External – Speed Velocity deviation amp. Speed Speed detection Torque limit Current control PWM circuit Torque A/D Encoder signal processing limit Division processing X6 7 X5 Supplement Feedback scale signal processing limit Feedback scale unit Note 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided with X2, X3 and X5. G-frame: Only for position control type is not provided. 1-19 2. Driver Block Diagram H-frame (400 V) U P L1 L2 L3 Fuse M W N Voltage detection 24V V + Fuse Fan Fuse + 0V DC/DC Gate drive DB1 (12V +5V PS for gate drive PS for RE RE DB2 B1 B3 B2 Front panel X1 Error detection Sequence control Display operation control Parameter control Protective curcuit EEPROM USB X2 Serial X3 Safety function X4 Alarm signal Pulse train command Analog velocity command Control input Division/ + mulitiplication – A/D 16-bit Deviation counter Position deviation amp. Internal speed command Internal Control output Pusle output Position + External – Speed Velocity deviation amp. Speed Speed detection Torque limit Current control PWM circuit Torque A/D Encoder signal processing limit Division processing X6 X5 Feedback scale signal processing limit Feedback scale unit Note 1-20 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU Only for position control type is not provided. 1 Before Using the Products 3. Motor 1Before Using Check of the Model the Products Contents of Name Plate Serial Number e.g.) : 09 04 0001N Model Rated input voltage/current 2 Rated output Rated frequency Rated rotational speed M S M E 5 A Z S 1 S 1 to 4 Type 5 to 6 7 Motor rated output Symbol MSMD *1 *1 MSME *2 MDME *2 MFME *2 MGME *2 *2 *1 The position control type only. *2 Only for position control type is MSME, MDME and MHME: 1.0kW to 5.0kW, MGME: 0.9kW to 3.0kW, MFME is none. 10 11 to 12 Special specifications Motor structure Design order Symbol Specifications 1 Standard Voltage specifications Connector for encoder : N/MS3102A20-29P Symbol Specifications C IP65 motor 1 100 V 0.9 kW to 5.0 kW 2 200 V only selectable 4 400 V 100/200 V common Z (50W only) ( 4 ) 5 Rotary encoder specifications Specifications Symbol Format Pulse count Resolution Wire count 20bit 1,048,576 G Incremental 5-wire 17bit 131,072 S *3 Absolute 7-wire Adjustment MHME Symbol Output 50W 5A 100W 01 200W 02 400W 04 600W 06 750W 08 900W 09 1.0kW 10 1.5kW 15 2.0kW 20 2.5kW 25 3.0kW 30 4.0kW 40 4.5kW 45 5.0kW 50 6.0kW 60 7.5kW 75 C1 11.0kW C5 15.0kW 9 Setup MHMD Specifications Low inertia (50W to 750W) High inertia (200W to 750W) Low inertia (50W to 5.0kW) Middle inertia (400W to 15.0kW) Middle inertia (1.5kW to 4.5kW) Middle inertia (0.9kW to 6.0kW) High inertia (1.0kW to 7.5kW) 8 3 Connection Model Designation Preparation Lot number Month of production Year of production (Lower 2 digits of AD year) Manufacture date e.g.) : 2009 04 01 Manufacture year Manufacture date Manufacture month *3 Only for position control type does not support the 17-bit absolute specification. It supports only 20-bit incremental specification. 6 Motor structure Symbol Shaft Holding brake Oil seal Round Key way Without With Without With*4 MSME (750W(400V), 1.0kW to 5.0kW), MDME, MFME, MGME, MHME Symbol When in Trouble MSME (50W to 750W) Holding brake Oil seal Shaft Round Key way Without With Without With A C B D *5 S G *5 T H *4 The product with oil seal is a special order product. *5 Key way with center tap [Products are standard stock items or manufactured by order. For details, inquire the dealer.] Related page Supplement Note 7 )RUGHWDLOVRIVSHFLÀFPRGHOUHIHUWRWKH'LPHQVLRQVRI6XSSOHPHQW 3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3WR´'LPHQVLRQVµ 1-21 3. Motor 1Before Using Parts Description the Products 060( :WR: Connector for encoder Connector for motor Flange Motor frame Mounting holes (X4) [with Brake] Connector for encoder Connector for brake Connector for motor Flange Motor frame Mounting holes (X4) e.g.) : Low inertia type (MSME series, 50W) MSME MDME MFME MGMA MHME 750W(400V), 1.0kW to 5.0kW 400W to 15.0kW 1.5kW to 4.5kW 0.9kW to 6.0kW 1.0kW to 7.5kW Connector for encoder Connector for motor Oil seal Flange Motor frame Mounting holes (X4) e.g.) : Middle inertia type (MDME series, 1.0kW) Note 1-22 )RUGHWDLOVRIVSHFLÀFPRGHOUHIHUWRWKH'LPHQVLRQVRI6XSSOHPHQW 3WR the Products 4. Check of the Combination of the Driver and the Motor Incremental Specifications, 20-bit 7KLVGULYHULVGHVLJQHGWREHXVHGLQDFRPELQDWLRQZLWKWKHPRWRUZKLFKDUHVSHFLÀHGE\ XV&KHFNWKHVHULHVQDPHRIWKHPRWRUUDWHGRXWSXWWRUTXHYROWDJHVSHFLÀFDWLRQVDQG HQFRGHUVSHFLÀFDWLRQV Remarks Type Single phase, 100V MSMD Single/ 3-phase, 200V Low inertia 3000r/min Single/ 3-phase, 200V Low inertia 3000r/min 3-phase, 200V 3-phase, 400V 2000r/min 3-phase, 200V MDME Middle inertia 2000r/min 3-phase, 400V Note MADHT1505E MADHT1507 MBDHT2510 MCDHT3520 MADHT1105 MADHT1107 MBDHT2110 MCDHT3120 MADHT1507E MBDHT2510E MCDHT3520E MADHT1105E MADHT1107E MBDHT2110E MCDHT3120E MADHT1505 MADHT1505E MADHT1507 MBDHT2510 MCDHT3520 MADHT1507E MBDHT2510E MCDHT3520E B-frame C-frame MDDHT5540 MDDHT5540E D-frame MEDHT7364 MFDHTA390 MEDHT7364E MFDHTA390E E-frame MFDHTB3A2 MFDHTB3A2E MDDHT2412 MDDHT3420 MDDHT3420 MEDHT4430 MFDHT5440 MDDHT2412E MDDHT3420E MDDHT3420E MEDHT4430E MFDHT5440E MFDHTA464 MFDHTA464E MDDHT3530 MDDHT5540 MEDHT7364 MFDHTA390 MDDHT3530E MDDHT5540E MEDHT7364E MFDHTA390E MFDHTB3A2 MFDHTB3A2E MGDHTC3B4 MHDHTC3B4 A-frame B-frame C-frame A-frame B-frame C-frame A-frame 3 4 F-frame D-frame 5 E-frame F-frame D-frame E-frame F-frame 6 G-frame − MDDHT2407 MDDHT2407E MDDHT2412 MDDHT3420 MEDHT4430 MFDHT5440 MDDHT2412E MDDHT3420E MEDHT4430E MFDHT5440E MFDHTA464 MFDHTA464E MGDHTB4A2 MHDHTB4A2 B-frame C-frame H-frame D-frame E-frame F-frame G-frame − H-frame 6XIÀ[RI□LQWKHDSSOLFDEOHPRWRUPRGHOUHSUHVHQWVGHVLJQRUGHU 6XIÀ[RI*LQWKHDSSOLFDEOHPRWRUPRGHOUHSUHVHQWVWKHPRWRUVWUXFWXUH 1-23 7 Supplement 1500r/min MADHT1505 A-frame When in Trouble 1500r/min 50W 100W 200W 400W 50W 100W 200W 400W 750W 50W 100W 200W 400W 50W 100W 200W 400W 750W 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 750W 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 7.5kW 11.0kW 15.0kW 400W 600W 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 7.5kW 11.0kW 15.0kW Adjustment Single/ 3-phase, 200V MSMD5AZG1 * MSMD011G1 * MSMD021G1 * MSMD041G1 * MSMD5AZG1 * MSMD012G1 * MSMD022G1 * MSMD042G1 * MSMD082G1 * MSME5AZG1 * MSME011G1 * MSME021G1 * MSME041G1 * MSME5AZG1 * MSME012G1 * MSME022G1 * MSME042G1 * MSME082G1 * MSME102G□ * MSME152G□ * MSME202G□ * MSME302G□ * MSME402G□ * MSME502G□ * MSME084G1 * MSME104G□ * MSME154G□ * MSME204G□ * MSME304G□ * MSME404G□ * MSME504G□ * MDME102G□ * MDME152G□ * MDME202G□ * MDME302G□ * MDME402G□ * MDME502G□ * MDME752G1 * MDMEC12G1 * MDMEC52G1 * MDME044G1 * MDME064G1 * MDME104G□ * MDME154G□ * MDME204G□ * MDME304G□ * MDME404G□ * MDME504G□ * MDME754G1 * MDMEC14G1 * MDMEC54G1 * Frame Setup MSME Rated output Driver Model of Only for position control type MADHT1105E MADHT1107E MBDHT2110E MCDHT3120E Connection Single phase, 100V Model Model of velocity, position, torque and full-closed control type MADHT1105 MADHT1107 MBDHT2110 MCDHT3120 Preparation Power supply 2 Do not use in other combinations than those listed below. Motor Rated rotational speed 1 Before Using the Products 1Before Using 4. Check of the Combination of the Driver and the Motor Incremental Specifications, 20-bit Motor Power supply Type Rated rotational speed Single/ 3-phase, 200V MFME 3-phase, 2000r/min 200V Middle inertia 3-phase, 400V Single/ 3-phase, 200V 3-phase, 200V MGME Middle inertia 1000r/min 3-phase, 400V Single phase, 100V Single/ 3-phase, 200V Single/ 3-phase, 200V MHMD High inertia 3000r/min 2000r/min 3-phase, 200V MHME High inertia 3-phase, 400V 1500r/min 2000r/min 1500r/min Note 1-24 Driver Model Rated output Model of velocity, position, torque and full-closed control type Model of Only for position control type Frame MFME152G1 * 1.5kW MDDHT5540 MDDHT5540E D-frame MFME252G1 * MFME452G1 * MFME154G1 * MFME254G1 * MFME454G1 * 2.5kW 4.5kW 1.5kW 2.5kW 4.5kW MEDHT7364 MFDHTB3A2 MDDHT3420 MEDHT4430 MFDHTA464 MEDHT7364E MFDHTB3A2E MDDHT3420E MEDHT4430E MFDHTA464E E-frame F-frame D-frame E-frame F-frame MGME092G□ * 0.9kW MDDHT5540 MDDHT5540E D-frame MGME202G□ * MGME302G□ * MGME452G1 * MGME602G1 * MGME094G□ * MGME204G□ * MGME304G□ * MGME454G1 * MGME604G1 * MHMD021G1 * 2.0kW 3.0kW 4.5kW 6.0kW 0.9kW 2.0kW 3.0kW 4.5kW 6.0kW 200W MFDHTA390 MFDHTA390E MFDHTB3A2 MFDHTB3A2E MGDHTC3B4 MDDHT3420 MFDHT5440 − MDDHT3420E MFDHT5440E MFDHTA464 MFDHTA464E MGDHTB4A2 MBDHT2110 − MBDHT2110E G-frame B-frame MHMD041G1 * 400W MCDHT3120 MCDHT3120E C-frame MHMD022G1 * MHMD042G1 * MHMD082G1 * MHME102G□ * 200W 400W 750W 1.0kW MADHT1507 MBDHT2510 MCDHT3520 MDDHT3530 MADHT1507E MBDHT2510E MCDHT3520E MDDHT3530E A-frame B-frame C-frame MHME152G□ * 1.5kW MDDHT5540 MDDHT5540E MHME202G□ * MHME302G□ * MHME402G□ * MHME502G□ * MHME752G1 * MHME104G□ * MHME154G□ * MHME204G□ * MHME304G□ * MHME404G□ * MHME504G□ * MHME754G1 * 2.0kW 3.0kW 4.0kW 5.0kW 7.5kW 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 7.5kW MEDHT7364 MFDHTA390 MEDHT7364E MFDHTA390E MFDHTB3A2 MFDHTB3A2E MGDHTC3B4 MDDHT2412 MDDHT3420 MEDHT4430 MFDHT5440 − MDDHT2412E MDDHT3420E MEDHT4430E MFDHT5440E MFDHTA464 MFDHTA464E MGDHTB4A2 − 6XIÀ[RI□LQWKHDSSOLFDEOHPRWRUPRGHOUHSUHVHQWVGHVLJQRUGHU 6XIÀ[RI*LQWKHDSSOLFDEOHPRWRUPRGHOUHSUHVHQWVWKHPRWRUVWUXFWXUH F-frame G-frame D-frame F-frame D-frame E-frame F-frame G-frame D-frame E-frame F-frame G-frame the Products 4. Check of the Combination of the Driver and the Motor Absolute Specifications, 17-bit 7KLVGULYHULVGHVLJQHGWREHXVHGLQDFRPELQDWLRQZLWKWKHPRWRUZKLFKDUHVSHFLÀHGE\ XV&KHFNWKHVHULHVQDPHRIWKHPRWRUUDWHGRXWSXWWRUTXHYROWDJHVSHFLÀFDWLRQVDQG HQFRGHUVSHFLÀFDWLRQV Remarks Type Rated rotational speed Single phase, 100V MSME Low inertia 3000r/min 3-phase, 200V Single/3-phase, 200V 2000r/min 1500r/min MDME Middle inertia 2000r/min 1500r/min MADHT1505 A-frame B-frame C-frame MADHT1507 MBDHT2510 MCDHT3520 B-frame C-frame MDDHT5540 D-frame MEDHT7364 MFDHTA390 E-frame MFDHTB3A2 MDDHT2412 MDDHT3420 MDDHT3420 MEDHT4430 MFDHT5440 MFDHTA464 MDDHT3530 MDDHT5540 MEDHT7364 MFDHTA390 MFDHTB3A2 3 A-frame F-frame 4 D-frame E-frame F-frame D-frame E-frame F-frame MGDHTC3B4 G-frame MHDHTC3B4 H-frame 5 MDDHT2407 MDDHT2412 MDDHT3420 MEDHT4430 MFDHT5440 MFDHTA464 D-frame E-frame F-frame MGDHTB4A2 G-frame MHDHTB4A2 H-frame 6 When in Trouble 3-phase, 400V 50W 100W 200W 400W 50W 100W 200W 400W 750W 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 750W 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 7.5kW 11.0kW 15.0kW 400W 600W 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 7.5kW 11.0kW 15.0kW Adjustment 3-phase, 200V MSME5AZS1 * MSME011S1 * MSME021S1 * MSME041S1 * MSME5AZS1 * MSME012S1 * MSME022S1 * MSME042S1 * MSME082S1 * MSME102S□ * MSME152S□ * MSME202S□ * MSME302S□ * MSME402S□ * MSME502S□ * MSME084S1 * MSME104S□ * MSME154S□ * MSME204S□ * MSME304S□ * MSME404S□ * MSME504S□ * MDME102S□ * MDME152S□ * MDME202S□ * MDME302S□ * MDME402S□ * MDME502S□ * MDME752S1 * MDMEC12S1 * MDMEC52S1 * MDME044S1 * MDME064S1 * MDME104S□ * MDME154S□ * MDME204S□ * MDME304S□ * MDME404S□ * MDME504S□ * MDME754S1 * MDMEC14S1 * MDMEC54S1 * Frame Setup 3-phase, 400V Rated output Connection Single/ 3-phase, 200V Model Driver Model of velocity, position, torque and full-closed control type MADHT1105 MADHT1107 MBDHT2110 MCDHT3120 Preparation Power supply Note 2 Do not use in other combinations than those listed below. Motor 1 Before Using the Products 1Before Using 7 Supplement 6XIÀ[RI□LQWKHDSSOLFDEOHPRWRUPRGHOUHSUHVHQWVGHVLJQRUGHU 6XIÀ[RI*LQWKHDSSOLFDEOHPRWRUPRGHOUHSUHVHQWVWKHPRWRUVWUXFWXUH 'HIDXOWRIWKHGULYHULVVHWIRUWKHLQFUHPHQWDOHQFRGHUVSHFLÀFDWLRQV When you use in absolute, make the following operations. a) Install a battery for absolute encoder. b) 6ZLWFKWKHSDUDPHWHU3U $EVROXWHHQFRGHUVHWXS IURP GHIDXOW WR 2QO\IRUSRVLWLRQFRQWUROW\SHGRHVQRWVXSSRUWWKHELWDEVROXWHVSHFLÀFDWLRQ ,WVXSSRUWVRQO\ELWLQFUHPHQWDOVSHFLÀFDWLRQ 1-25 4. Check of the Combination of the Driver and the Motor Absolute Specifications, 17-bit Motor Power supply Type Single/3-phase, 200V 3-phase, 200V MFME Middle inertia Rated rotational speed 2000r/min 3-phase, 400V Single/3-phase, 200V 3-phase, 200V MGME Middle inertia 1000r/min 3-phase, 400V Single/ 3-phase, 200V 2000r/min 3-phase, 200V MHME High inertia 3-phase, 400V 1500r/min 2000r/min 1500r/min Note 1-26 Driver Model of velocity, position, torque and Frame full-closed control type Model Rated output MFME152S1 * 1.5kW MDDHT5540 D-frame MFME252S1 * MFME452S1 * MFME154S1 * MFME254S1 * MFME454S1 * 2.5kW 4.5kW 1.5kW 2.5kW 4.5kW MEDHT7364 MFDHTB3A2 MDDHT3420 MEDHT4430 MFDHTA464 E-frame F-frame D-frame E-frame F-frame MGME092S□ * 0.9kW MDDHT5540 D-frame MGME202S□ * MGME302S□ * MGME452S1 * MGME602S1 * MGME094S□ * MGME204S□ * MGME304S□ * MGME454S1 * MGME604S1 * MHME102S□ * 2.0kW 3.0kW 4.5kW 6.0kW 0.9kW 2.0kW 3.0kW 4.5kW 6.0kW 1.0kW MFDHTA390 MHME152S□ * 1.5kW MDDHT5540 MHME202S□ * MHME302S□ * MHME402S□ * MHME502S□ * MHME752S1 * MHME104S□ * MHME154S□ * MHME204S□ * MHME304S□ * MHME404S□ * MHME504S□ * MHME754S1 * 2.0kW 3.0kW 4.0kW 5.0kW 7.5kW 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 7.5kW MEDHT7364 MFDHTA390 MFDHTB3A2 MGDHTC3B4 MDDHT3420 MFDHT5440 MFDHTA464 MGDHTB4A2 MDDHT3530 MFDHTB3A2 MGDHTC3B4 MDDHT2412 MDDHT3420 MEDHT4430 MFDHT5440 MFDHTA464 MGDHTB4A2 6XIÀ[RI□LQWKHDSSOLFDEOHPRWRUPRGHOUHSUHVHQWVGHVLJQRUGHU 6XIÀ[RI*LQWKHDSSOLFDEOHPRWRUPRGHOUHSUHVHQWVWKHPRWRUVWUXFWXUH 'HIDXOWRIWKHGULYHULVVHWIRUWKHLQFUHPHQWDOHQFRGHUVSHFLÀFDWLRQV When you use in absolute, make the following operations. a) Install a battery for absolute encoder. b) 6ZLWFKWKHSDUDPHWHU3U $EVROXWHHQFRGHUVHWXS IURP GHIDXOW WR 2QO\IRUSRVLWLRQFRQWUROW\SHGRHVQRWVXSSRUWWKHELWDEVROXWHVSHFLÀFDWLRQ ,WVXSSRUWVRQO\ELWLQFUHPHQWDOVSHFLÀFDWLRQ F-frame G-frame D-frame F-frame G-frame D-frame E-frame F-frame G-frame D-frame E-frame F-frame G-frame the Products 4. Check of the Combination of the Driver and the Motor Junction cable for motor Encoder cable Motor series ,QFUHPHQWDO6SHFLÀFDWLRQVELW Note)1 MSMD 50W to 750W MSME 50W to 750W (200V) 7-98 MFECA0 ** 0EAM — MFECA0 ** 0MJD MFECA0 ** 0MJE (Highly bendable type, Direction of motor shaft) (Highly bendable type, Direction of motor shaft) MFECA0 ** 0MKD MFECA0 ** 0MKE (Highly bendable type, Opposite direction of motor shaft) (Highly bendable type, Opposite direction of motor shaft) 7-98 MFECA0 ** 0TJD MFECA0 ** 0TJE 7-99 (Standard bendable type, Direction of motor shaft) (Standard bendable type, Direction of motor shaft) MFECA0 ** 0TKD MFECA0 ** 0TKE (Standard bendable type, Opposite direction of motor shaft) (Standard bendable type, Opposite direction of motor shaft) note)2 750W (400V), 1.0kW to 5.0kW MFECA0 ** 0ESE note)2 MFECA0 ** 0ETE note)3 MFECA0 ** 0ESEnote)2 MFECA0 ** 0ETE note)3 MFECA0 ** 0ETE MFECA0 ** 0ESE note)2 MFECA0 ** 0ETE note)3 — MFECA0 ** 0ESE note)2 MFECA0 ** 0ETE note)3 1.5kW to 4.5kW MGME 0.9kW to 6.0kW MHMD 200W to 750W MHME 1.0kW to 7.5kW 2 3 7-99 to 7-100 Connection MFECA0 ** 0ESD MFECA0 ** 0ETD note)3 MFECA0 ** 0ESD note)2 MFECA0 ** 0ETD note)3 MFECA0 ** 0ETD MFECA0 ** 0ESD note)2 MFECA0 ** 0ETD note)3 MFECA0 ** 0EAM MFECA0 ** 0ESD note)2 MFECA0 ** 0ETD note)3 MDME 400W to 15.0kW MFME Detail page Preparation MSME Absolute Specifications, 17-bit Note)1 1 Before Using the Products 1Before Using 1RWH ´ µUHSUHVHQWVWKHFDEOHOHQJWK1RWH 'HVLJQRUGHU& N:WRN: 0*0(WRN: 1RWH 'HVLJQRUGHU 4 Motor cable/ Brake cable MSMD 50W to 750W MFMCA0 ** 0EED — MFMCA0 ** 0NJD MFMCA0 ** 0RJD ( Standard bendable type, Direction of motor shaft — ) MFMCA0 ** 3FCT MFMCA0 ** 2FCD MFMCE0 ** 2FCD MFMCA0 ** 3FCT — MFMCA0 ** 2FCD MFMCD0 ** 2ECD MFMCE0 ** 2FCD — — 6 7-102 to 7-106 — MFMCB0 ** 0GET 7 — MFMCA0 ** 3FCT 1RWH ´ µUHSUHVHQWVWKHFDEOHOHQJWK Caution 0RWRUFDEOH IRU0+0(N:0*0(N:0'0(N:WRN: LVQRWSUHSDUHGLQ option. Related page )RURWKHUFDEOHFRQQHFWRUDQGFRQQHFWRUNLWUHIHUWR3´2SWLRQVµ 1-27 Supplement MFMCE0 ** 2ECD MFMCA0 ** 3ECT — When in Trouble MFMCD0 ** 3ECT MFMCA0 ** 3ECT MFMCA0 ** 0EED ) Adjustment MFMCE0 ** 2FCD MFMCD0 ** 2ECD 5 Standard bendable type, (Opposite direction of motor shaft) MFMCF0 ** 2ECD MFMCD0 ** 2ECD 7-106 ( MFMCA0 ** 3ECT MFMCA0 ** 2ECD MFMCA0 ** 3ECT 7-101 MFMCB0 ** 0SJT MFMCB0 ** 0SKT MFMCA0 ** 2FCD MFMCE0 ** 2FCD MFMCA0 ** 3FCT MFMCA0 ** 2FCD MFMCE0 ** 2FCD MFMCA0 ** 3FCT MFMCA0 ** 2FCD MFMCD0 ** 2ECD Highly bendable type, (Opposite direction of motor shaft) Standard bendable type, Direction of motor shaft Standard bendable type, (Opposite direction of motor shaft) 1.0kW to 2.0kW(200V) 750W to 2.0kW(400V) 3.0kW to 5.0kW 1.0kW to 2.0kW(200V) 400W to 2.0kW(400V) 3.0kW to 5.0kW 1.5kW(200V) 1.5kW(400V) 2.5kW 4.5kW 0.9kW(200V) 0.9kW(400V) 2.0kW to 4.5kW 200W to 750W 1.0kW, 1.5kW(200V) 1.0kW, 1.5kW(400V) 2.0kW 3.0kW to 5.0kW 7-101 7-106 MFMCB0 ** 0PKT MFMCA0 ** 0RKD MSME MSME MSME MDME MDME MDME MFME MFME MFME MFME MGME MGME MGME MHMD MHME MHME MHME MHME MFMCB0 ** 0GET Highly bendable type, (Direction of motor shaft) MFMCA0 ** 0NKD MSME 50W to 750W Detail page MFMCB0 ** 0PJT Highly bendable type, (Direction of motor shaft) Highly bendable type, (Opposite direction of motor shaft) Brake cable Note)1 Setup Motor cable Note)1 without Brake with Brake Motor series 1Before Using the Products 5. Installation Driver Install the driver properly to avoid a breakdown or an accident. Installation Place 1) Install the driver in a control panel enclosed in noncombustible material and placed indoor where the product is not subjected to rain or direct sunlight. The products are not waterproof. 2) Where the products are not subjected to corrosive atmospheres such as hydrogen sulÀGHVXOIXURXVDFLGFKORULQHDPPRQLDVXOIXUFKORULFJDVVXOIXULFJDVDFLGDONDOLQH DQGVDOWDQGVRRQDQGDUHIUHHIURPVSODVKRILQÁDPPDEOHJDV 3) Where the motor is free from grinding oil, oil mist, iron powder or chips. 4) Well-ventilated and low humidity and dust-free place. 5) Vibration-free place. 6) Do not use benzine, thinner, alcohol, acidic cleaner and alkaline cleaner because they can discolor or damage the exterior case. Environmental Conditions Item Ambient temperature Ambient humidity Storage temperature*1 Storage humidity Vibration Altitude Conditions Ý&WRÝ& IUHHIURPIUHH]LQJ 20% to 85% RH (free from condensation) ²Ý&WRÝ& (Max. temperature guarantee: 80ÝC for 72 hours free from condensation*2) 20% to 85% RH (free from condensation*2) Lower than 5.88m/s2 (0.6G), 10 to 60Hz (Do not continuously use the driver for along time at the resonance point.) Lower than 1000m *1 Extreme temperatures are permissible only for short period such as during transportation. *2 Air containing water vapor will become saturated with water vapor as the temperature falls, causing dew. How to Install 1) Rack-mount type. Install in vertical position, and reserve enough space around the servo driver for ventilation. 2) Base mount (rear mount) is standard for A/B/C/D-frame driver. 3) To change the mounting surface of A/B/C/D-frame driver, use the optional mounting brackHW)RUFKRRVLQJWKHFRUUHFWRSWLRQDOPRXQWLQJEUDFNHWUHIHUWR3´0RXQWLQJ%UDFNHWµ 4) In consideration of strength of the screws and the material of the mounting base, seOHFWDSSURSULDWHIDVWHQLQJWRUTXHIRUWKHSURGXFWPRXQWLQJVFUHZVVRWKDWWKHVFUHZV will not be loosened or damaged. Example) To tighten a steel screw into a steel base A to G-frame: M5 2.7 to 3.3 N·m, H-frame: M6 4.68 to 5.72 N·m H-frame A to D-frame E to G-frame Basemount (Standard) [Rear mount] Frontmount [Use mounting bracket] Front or rearmount [Use mounting bracket] Mounting bracket (optional parts)Fastening torque of ground terminal (M4) to be 0.7 to 0.8 N m. 1-28 Rearmount [Basemount] Mounting bracket (Attachment) Fastening torque of ground terminal (M4) to be 0.7 to 0.8 N m. Fastening torque of ground terminal (M5) to be 1.4 to 1.6 N m. Fastening torque of ground terminal (M6) to be 2.4 to 2.6 N m. 5. Installation 1 Mounting Direction and Spacing Fan Control panel Fan 100mm or more 2 Preparation 5HVHUYHHQRXJKVXUURXQGLQJVSDFHIRUHIIHFWLYHFRROLQJ ,QVWDOOIDQVWRSURYLGHXQLIRUPGLVWULEXWLRQRIWHPSHUDWXUHLQWKHFRQWUROSDQHO 'WR+IUDPHLVSURYLGHGZLWKDFRROLQJIDQDWWKHERWWRP (On the H-frame, the cooling fan is also installed on the upper side.) Observe the environmental conditions of the control panel described in the previous page. Before Using the Products Driver 3 a a a 40mm or more Connection 40mm or more a Direction of air flowing from the internal cooling fan (D to H-frame) Note 100mm or more A to F-frame 10mm or more G, H-frame 50mm or more It is recommended to use the conductive paint when you make your own mounting bracket, or repaint after peeling off the paint on the machine for installing the products, in order to make noise countermeasure. Setup Caution on Installation Caution 1-29 6 7 Supplement 3´6SHFLÀFDWLRQVµ3´,QVWDOODWLRQRIPRWRUµ 3´'LPHQVLRQVµ3´0RXQWLQJEUDFNHWµ 5 When in Trouble :KHQHYHU OLIWLQJ WKH SURGXFW GXULQJ WUDQVSRUWDWLRQLQVWDOODWLRQ RI + IUDPH VHUYR GULYHU WZR RU more persons should hold it by metallic member, not by plastic member. :HKDYHEHHQPDNLQJWKHEHVWHIIRUWWRHQVXUHWKHKLJKHVWTXDOLW\KRZHYHUDSSOLFDWLRQRIH[FHStionally large external noise disturbance and static electricity, or failure in input power, wiring and components may result in unexpected action. It is highly recommended that you make a fail-safe design and secure the safety in the operative range. If stranded wires are used as the cable, bunch the conductors of the cable using a rod terminals or a round terminals. If stranded wires are used as they are, unexpected accidents such as an electric shock and short circuit or injury may result. 7KHUHPLJKWEHDFKDQFHRIVPRNHJHQHUDWLRQGXHWRWKHIDLOXUHRIWKHVHSURGXFWV3D\DQH[WUD attention when you apply these products in a clean room environment. %H VXUH WR LQVWDOO D QRIXVH EUHDNHU LQ WKH SRZHU VXSSO\ ,Q DGGLWLRQ EH VXUH WR JURXQG WKH grounding terminal or grounding wire provided. (In order to prevent electric shock and malfuncWLRQV&ODVV'JURXQGLQJ JURXQGLQJUHVLVWDQFHRIїRUOHVV LVUHFRPPHQGHG ,IWKHSURGXFWLVJURXQGHGLQVXIÀFLHQWO\QRWRQO\WKHGULYHUPD\QRWGHOLYHULWVSHUIRUPDQFHVXIÀFLHQWO\EXWDOVRVDIHW\KD]DUGVVXFKDVDPDOIXQFWLRQGXHWRDHOHFWULÀFDWLRQRUDGLVWXUEDQFH may be caused. ,IHOHFWULFZLUHVDUHERXQGDQGUXQWKURXJKPHWDOGXFWWKH\FDQQRWFDUU\WKHUDWHGFXUUHQWGXHWR temperature rise. If they are forced to carry the rated current, they may burn. When determining size of the wire. 'RQRWXVHRUVWRUHWKHSURGXFWLQDSODFHVXEMHFWWRPV2 or more vibration or shock, forHLJQPDWHULDOVVXFKDVGXVWPHWDOOLFSRZGHUDQGRLOPLVWOLTXLGVVXFKDVZDWHURLODQGJULQGLQJ ÁXLG FORVH WR ÁDPPDEOH PDWHULDOV RU LQ DQ DWPRVSKHUH RI FRUURVLYH JDV +2S, SO2, NO2, Cl2, HWF RULQÁDPPDEOHJDVXQGHUDQ\FLUFXPVWDQFH Adjustment Related page 4 5. Installation Driver Be sure to conduct wiring properly and securely. Insecure or improper wiring may cause the motor running out of control or being damaged from overheating. In addition, pay attention not to allow conductive materials, such as wire chips, entering the driver during the installation and wiring. 6HFXUHWKHVFUHZVDQGHDUWKVFUHZRQWKHWHUPLQDOEORFNZLWKWKHWRUTXHVSHFLÀHGLQWKHVSHFLÀcation. :KHQHVWDEOLVKLQJDV\VWHPXVLQJVDIHW\IXQFWLRQVFRPSOHWHO\XQGHUVWDQGWKHDSSOLFDEOHVDIHW\ standards and the operating instruction manual or technical documents for the product. 1HYHU PDNH DQ DSSURDFK WRWKH PRWRUDQG WKH PDFKLQH V GULYHQ E\ WKHPRWRU ZKLOH SRZHU LV applied because they may become failure or malfunction. 'RQRWXVHVHUYRRQVLJQDO 65921 DVWKHVWDUWVWRSVLJQDO'RLQJVRPD\GDPDJHWKHEXLOWLQ dynamic brake circuit in the driver. 3D\DWWHQWLRQWRWKHKHDWGLVVLSDWLRQ7KHGULYHUZLOOJHQHUDWHKHDWZKLOHWKHPRWRULVLQRSHUDtion. Using the driver in a sealed control box may cause an abnormal heating of the control box. A proper consideration should be given to cool the driver so that the ambient temperature PDWFKHVWKHVSHFLÀHGRSHUDWLQJWHPSHUDWXUHUDQJH 7KHUHLVDSRVVLELOLW\WKDWWKHPRWRUZLOOEHGDPDJHGE\KHDWRUHPLWVPRNHRUGXVWGXHWRDIDXOW in the motor itself or the driver coupled with it. A proper consideration should be given if the motor is used in a clean room or similar environment. 7KHXSSHUIDQRQWKH+IUDPHGULYHUVWRSVGXULQJVHUYR2))WRVDYHHQHUJ\7KLVLVQRUPDO ,I WKH G\QDPLF EUDNH LV DSSOLHG GXULQJ RSHUDWLRQ DW D KLJK VSHHG SURYLGH DSSUR[ PLQXWH dwell period. Restarting the motor earlier may cause a broken wire in the dynamic brake making the brake inoperable. 7KHFDSDFLWDQFHRIFDSDFLWRULQWKHSRZHUVXSSO\UHFWLÀHUFLUFXLWGHFUHDVHVLWVFDSDFLWDQFHZLWK age. To prevent a secondary accident due to malfunction, it should be replaced with new one after 5-year use. Replacement should be performed by us or our authorized distributor. %HIRUHXVLQJWKHSURGXFWEHVXUHWRUHDGWKHLQVWUXFWLRQPDQXDO 6DIHW\SDUW Recommended Electric Wires for Driver )RUWKHPDLQFLUFXLWXVHHOHFWULFZLUHWKDWZLWKVWDQGVDWOHDVW9$&ZLWKWHPSHUDWXUHUDWLQJʝRUKLJKHU :KHQ XVLQJ EXQGOHG ZLUHV UXQQLQJ WKURXJK PHWDOOLF FRQGXLW WKH DPRXQWV RI FXUUHQW determined according to the reduction rate must be subtracted from the nominal allowable current. (OHFWULFZLUHV Use heat resistant wire. Common polyvinyl chloride wires will deteriorate by heat at a higher rate. The surface of vinyl chloride insulation becomes hardened and brittle at low temperaWXUHDQGQHHGVVSHFLÀFSURWHFWLYHPHDVXUHZKHQXVHGLQFROGUHJLRQ %HQGUDGLXVRIWKHFDEOHPXVWEHWLPHVRUPRUHLWVÀQLVKRXWVLGHGLDPHWHU &DEOHVFDQQRWEHXVHGIRUFRQWLQXRXVUHJHQHUDWLRQEHFDXVHWKH\DUHQRWGHVLJQHGIRU such application. Related page 1-30 3´-XQFWLRQFDEOHIRUPRWRUµ 5. Installation 1 Relationship between Wire Diameter and Permissible Current :KHQVHOHFWLQJDFDEOHUHIHUWRWKHIROORZLQJVHOHFWLRQJXLGHVKRZLQJUHODWLRQVKLSEHWZHHQFDEOHVSHFLÀFDWLRQDQGFXUUHQWFDUU\LQJFDSDFLW\ Example: Power supply 3-phase, 200 V, 35 A, ambient temperature 30°C 49 61 88 115 139 162 217 298 395 7KHFXUUHQWFRUUHFWLRQFRHIÀFLHQWLVGHWHUPLQHGXVLQJWKHIROORZLQJIRUPXOD 4 (Max. permissible temp. – ambient temp.) ÷ 30 Caution 7KHFXUUHQWFRUUHFWLRQFRHIÀFLHQWLVGHWHUPLQHGDFFRUGLQJWRWKHFDEOH&KHFNWKHVSHFLÀFDWLRQRIWKHFDEOH used. 7KH FXUUHQW UHGXFWLRQ FRHIILFLHQW LV SURYLGHG IRU WKH FDVH &XUUHQWUHGXFWLRQFRHIILFLHQW where the cable (4-conductor cable in the case of example), No. of wires in a tube Coefficient is housed in plastic race/sheath, plastic tube, metal race/ ◎ Up to 3 0.70 VKHDWKPHWDOWXEHRUÁH[LEOHFRQGXLW 4 0.63 Because the neutral conductor is not counted as a wire, the cur5 or 6 0.56 UHQWUHGXFWLRQFRHIÀFLHQWIRU´RUOHVVµLVDSSOLHGDVLQGLFDWHGE\ 7 to 15 0.49 ( ) in the table right. 16 to 40 0.43 41 to 60 61 or more 5HFRPPHQGHGHFRFDEOH 0.39 0.34 Conductor 14 22 38 60 100 150 Caution Note Max. Sheath (Reference) conductor thickness Finish O.D. resistance (mm) (mm) (20°C) (W/km) 1.5 12.0 9.42 1.5 13.5 5.30 1.5 16.0 3.40 1.5 17.0 2.36 Outside diameter (mm) 7/0.6 7/0.8 7/1.0 7/1.2 1.8 2.4 3.0 3.6 0.8 0.8 1.0 1.0 Circular compression Circular compression Circular compression Circular compression Circular compression Circular compression Circular compression 4.4 1.0 1.5 19.0 5.5 1.2 1.6 7.3 1.2 9.3 Test voltage (V/1 min.) Minimum (Reference) insulation Approx. resistance mass 0:NP (kg/km) 1500 1500 1500 1500 2500 2500 2500 2000 170 250 360 475 1.34 2000 1500 730 23 0.849 2000 1500 1100 1.8 28 0.491 2500 1500 1800 1.5 2.0 35 0.311 2500 1500 2790 12.0 2.0 2.4 44 0.187 2500 1500 4630 14.7 2.0 2.6 51 0.124 3000 1000 6710 17.0 2.5 2.9 60 0.0933 3000 1500 8990 6 7 6KLHOGZLOOLQFUHDVHÀQLVKRXWVLGHGLDPHWHUE\DSSUR[PP $SSURSULDWHFDEOHVKRXOGEHVHOHFWHGWRKDYHVXIÀFLHQWDOORZDQFHIRUSDUDPHWHUVVXFKDVRSHUDWLQJDPELent temperature and current. &XUUHQW UHGXFWLRQ FRHIILFLHQW IXQGDPHQWDO SHUPLVVLEOH FXUUHQW HWF VWDWHG RQ WKLV SDJH DUH VXEMHFW WR change due to e.g. standard revision. Consult cable manufacturers for the latest information. 1-31 Supplement 200 Insulation thickness (mm) Structure or shape (wires/mm2) When in Trouble Nominal cross section (mm2) 2 3.5 5.5 8 5 Adjustment Wire category: 4-conductor polyethylene-insulated power cable with heat-resistant polyethylene sheath (Standard: EM JIS C 3605) Maximum permissible temperature: 90°C Setup Caution 3 Connection 5.5 to 8 (excl.) 8 to 14 (excl.) 14 to 22 (excl.) 11 to 30 (excl.) 30 to 38 (excl.) 38 to 68 (excl.) 60 to 100 (excl.) 100 to 150 (excl.) 150 to 200 (excl.) Applicable permissible current = IXQGDPHQWDOSHUPLVVLEOHFXUUHQW[FXUUHQWUHGXFWLRQFRHIÀFLHQW[FXUUHQW FRUUHFWLRQFRHIÀFLHQW = 37 x 0.7 x 1.414 . =. 36.6 (A) This permissible value is larger than 35 A to be carried though the cable. Therefore, according to the list of recommended eco-cables, the cable to be selected for the cable with nominal cross section 3.5 mm2 is a polyethylene-insulated heat-resistant 4-conductor power FDEOHKDYLQJPPÀQLVK2' DSSUR[PPZLWKVKLHOG 2 Preparation Determine the fundamental permissible current according to the )XQGDPHQWDOSHUPLVVLEOH cable conductor material (example: stranded copper wire). (For the current Copper purpose of this example, the ampere indicated by is selected from Stranded conductor wire the table right.) (nominal cross section: mm2) (unit: A) Next, determine the number of conductors. (In this example, the 2 to 3.5 (excl.) 27 cable contains 4 conductors (3 + ground).) Determine the applicable 3.5 to 5.5 (excl.) 37 ◇ permissible current using the following formula. Before Using the Products Driver 1Before Using the Products 5. Installation Motor Install the motor properly to avoid a breakdown or an accident. Installation Place Since the conditions of location affect a lot to the motor life, select a place which meets the conditions below. 1) Indoors, where the products are not subjected to rain or direct sun beam. The products are not waterproof. 2) Where the products are not subjected to corrosive atmospheres such as hydrogen sulÀGHVXOIXURXVDFLGFKORULQHDPPRQLDVXOIXUFKORULFJDVVXOIXULFJDVDFLGDONDOLQH DQGVDOWDQGVRRQDQGDUHIUHHIURPVSODVKRILQÁDPPDEOHJDV 3) Where the motor is free from grinding oil, oil mist, iron powder or chips. 4) Well-ventilated and humid and dust-free place, far apart from the heat source such as a furnace. 5) Easy-to-access place for inspection and cleaning 6) Vibration-free place. 7) Avoid enclosed place. Motor may gets hot in those enclosure and shorten the motor life. Environmental Conditions Item Ambient temperature*1 Ambient humidity Storage temperature*2 Storage humidity Vibration Motor only Impact Motor only Enclosure Motor only rating (Connector type) Altitude Conditions Ý&WRÝ& IUHHIURPIUHH]LQJ 20% to 85% RH (free from condensation) ²Ý&WRÝ& (Max. temperature guarantee: 80ÝC for 72 hours free from condensation*5) 20% to 85% RH (free from condensation*5) Lower than 49m/s2 (5G) at running, 24.5m/s2 (2.5G) at stall Lower than 98m/s2 (10G) IP67 (except rotating portion of output shaft and connecting pin part of the motor connector and the encoder connector)*3*4 Lower than 1000m *1 Ambient temperature to be measured at 5cm away from the motor. *2 Permissible temperature for short duration such as transportation. *3 7KHVHPRWRUVFRQIRUPWRWKHWHVWFRQGLWLRQVVSHFLÀHGLQ(1VWDQGDUGV (1(1 'R QRWXVHWKHVHPRWRUVLQDSSOLFDWLRQZKHUHZDWHUSURRISHUIRUPDQFHLVUHTXLUHGVXFKDVFRQWLQXRXV wash-down operation. *4 This condition is applied when the connector mounting screw in case of motor 750W or less are WLJKWHQHG WR WKH UHFRPPHQGHG WLJKWHQLQJ WRUTXH 5HIHU WR 3 %H VXUH WR XVH PRXQWLQJ screw supplied with the connector. Correctly install and secure the gasket supplied with the cable connector. *5 Air containing water vapor will become saturated with water vapor as the temperature falls, causing dew. How to Install You can mount the motor either horizontally or vertically as long as you observe the followings. 1) Horizontal mounting 0RXQWWKHPRWRUZLWKFDEOHRXWOHWIDFLQJGRZQZDUGIRUZDWHURLOFRXQWHUPHDVXUH 2) Vertical mounting 8VH WKH PRWRU ZLWK RLO VHDO PDNHWRRUGHU LQ FDVH RI PRWRU : RU OHVV ZKHQ mounting the motor with gear reducer to prevent the reducer oil/grease from entering to the motor. 1-32 5. Installation 1 Before Using the Products Motor Oil/Water Protection 2 Motor Preparation 1) Don't submerge the motor cable to water or oil. 2) Install the motor with the cable outlet facing downward. 3) Avoid a place where the motor is always subjectCable ed to oil or water. 4) Use the motor with an oil seal when used with the gear reducer, so that the oil may not enter to the Oil / Water motor through shaft. Stress to Cables 4 Permissible Load to Output Shaft 5 Adjustment )RUSHUPLVVLEOHORDGRIHDFKPRGHOUHIHUWR3´3HUPLVVLEOH/RDGDW2XWSXW6KDIWµ. Setup 1) Design the mechanical system so that the applied radial load and/or thrust load to the motor shaft at installation and at normal operation can meet the permissible value VSHFLÀHGWRHDFKPRGHO 2) Pay an extra attention when you use a rigid coupling. (Excess bending load may damage the shaft or deteriorate the bearing life.) 8VHDÁH[LEOHFRXSOLQJZLWKKLJKVWLIIQHVVGHVLJQHGH[FOXVLYHO\IRUVHUYRDSSOLFDWLRQLQ order to make a radial thrust caused by micro misalignment smaller than the permissible value. Note 3 Connection 1) Avoid a stress application to the cable outlet and connecting portion by bending or selfweight. (VSHFLDOO\LQDQDSSOLFDWLRQZKHUHWKHPRWRULWVHOIWUDYHOVÀ[WKHMXQFWLRQFDEOHLQWRWKH bearer so that the stress by bending can be minimized. 3) Take the cable bending radius as large as possible. (When you use our optional cable, Minimum R20mm) Notes on Installation 3´-XQFWLRQFDEOHIRUPRWRUµ3´,QVWDOODWLRQRIGULYHUµ 3´3HUPLVVLEOH/RDGDW2XWSXW6KDIWµ3´'LPHQVLRQVµ 1-33 7 Supplement Related page 6 When in Trouble 1) Do not apply direct impact to the shaft by hammer while attaching/detaching a coupling to and from the motor shaft. Motor (Or it may damage the encoder mounted on the other side of the shaft.) 2) Make a full alignment. (incomplete alignment may cause vibration and damage the bearing.) 3) If the motor shaft is not electrically grounded, it may cause electrolytic corrosion to the bearing depending on the condition of the machine and its mounting environment, and PD\UHVXOWLQWKHEHDULQJQRLVH&KHFNDQGYHULÀFDWLRQE\FXVWRPHULVUHTXLUHG 5. Installation Motor Wiring Precautions on Movable Section When wiring cable bear, take the following precautions: &DEOHEHDUZLULQJ 7KHEHQGUDGLXVRIWKHFDEOHPXVWEHWLPHVRUPRUHLWVÀQLVKRXWVLGHGLDPHWHU )RUÀQLVKRXWVLGHGLDPHWHUUHIHUWR3+RZWR,QVWDOO´5HODWLRQVKLSEHWZHHQ:LUH 'LDPHWHUDQG3HUPLVVLEOH&XUUHQWµDQGDVVRFLDWHGWDEOHV 'RQRWÀ[RUEXQGOHZLUHVLQWKHFDEOHEHDU :KHQVHFXULQJWKHFDEOHÀ[LWRQO\DWQRQPRYDEOHHQGVRIWKHFDEOHEHDUZKHUHWKH cable is free from any stress (e.g. tension). (Avoid tight lock.) [Recommended cable bear wiring] Cable bear Cable Caution Cable end Do not keep the cable loosened (too long) or under tension (too short). Otherwise, the sheath will be cracked by internal wall of the cable bear, tangled by other cable, etc., causing unpredictable troubles. &DEOHGLVWRUWLRQ Keep the cable free from twists or kinks. Distorted cable will cause loose connection, lowering performance and reliability. /DPLQDWLRQIDFWRURIFDEOHLQFDEOHEHDU 3ODFHFDEOHVRQDÁDWVXUIDFHLQSDUDOOHOZLWKRXWEULQJLQJWKHPLQWRFRQWDFWZLWKHDFK other and measure the dimension necessary to cover these cables. Then select a cable bear which is wider than the measured dimension. The lamination factor of cables should be lower than 60% (recommended factor is 30% or below). Do not run smaller and larger size cables in the same cable bear. Thin cables may break under the pressure of thick cables. If it is necessary to mix cables of different size, isolate them by using suitable separating material such as partition. [Wiring arrangement in cable bear – example] Cable Thick cable 1-34 Partition Thin cable Cable Partition the Products 6. Permissible Load at Output Shaft Motor Radial load (P) direction L Thrust load (A and B) direction 1 Before Using the Products 1Before Using 2 A M P Unit : N (1kgf=9.8N) At assembly Motor series MSME During running Thrust load Radial thrust A-direction B-direction 88 117.6 68.6 58.8 200W, 400W 392 147 196 245 98 750W 686 294 392 392 147 50W, 100W 147 88 117.6 68.6 58.8 200W, 400W 392 147 196 245 98 750W (200V) 686 294 392 392 147 750W (400V), 1.0kW, 1.5kW, 2.0kW, 3.0kW 980 588 686 490 196 784 343 490 196 784 343 588 686 1666 784 980 7.5kW 2058 980 1176 1176 490 11.0kW, 15.0kW 4508 1470 1764 2254 686 0.9kW 980 588 686 686 196 2.0kW 1666 784 980 1176 3.0kW 4.0kW 5.0kW 3.0kW 4.5kW 2058 980 1176 6.0kW MHMD MHME 1764 588 490 196 784 294 980 588 2.5kW, 4.0kW 1862 686 200W, 400W 392 147 196 245 98 750W 686 294 392 392 147 1.0kW, 1.5kW 980 588 686 490 196 2.0kW to 5.0kW 1666 784 980 784 343 7.5kW 2058 980 1176 1176 490 6 7 When the load point varies, calculate the permissible radial load, P (N) from the distance RIWKHORDGSRLQW/ PP IURPWKHPRXQWLQJÁDQJHEDVHGRQWKHIRUPXODRIWKHULJKWWDble, and make it smaller than the calculated result. 1-35 Supplement Note 490 1.5kW 686 5 When in Trouble MFME 1470 4 Adjustment 980 3 Setup 147 400W to 2.0kW MGME Thrust load A and B-direction 50W, 100W 4.0kW, 5.0kW MDME Radial thrust Connection MSMD Motor output Preparation B L/2 6. Permissible Load at Output Shaft Motor L P Motor series MSMD MSME MDME 1-36 Motor output Formula of Load and load point relation Motor series Motor output Formula of Load and load point relation 50W P= 3533 L+39 0.9kW P= 33957 L+14.5 100W P= 4905 L+59 2.0kW P= 69384 L+19 200W 14945 P= L+46 3.0kW P= 86730 L+19 400W P= 19723 L+65.5 4.5kW 6.0kW P= 89964 L+20 750W P= 37044 L+77 1.5kW P= 25235 L+19 50W P= 3533 L+39 2.5kW P= 40376 L+19 100W P= 4905 L+59 4.0kW P= 42336 L+19 200W P= 14945 L+46 200W P= 14945 L+46 400W P= 19723 L+65.5 400W P= 19723 L+65.5 750W (200V) P= 37044 L+77 750W P= 37044 L+77 750W (400V) 1.0kW to 3.0kW P= 20090 L+13.5 1.0kW 1.5kW P= 24255 L+14.5 4.0kW 5.0kW P= 36848 L+14.5 2.0kW to 5.0kW P= 46256 L+19 400W 600W P= 20090 L+13.5 7.5kW P= 89964 L+20 1.0kW to 2.0kW P= 20580 L+14.5 3.0kW P= 36848 L+14.5 4.0kW 5.0kW P= 42336 L+19 7.5kW P= 89946 L+20 11.0kW 15.0kW P= 200606 L+31 MGME MFME MHMD MHME 2. Preparation 1 Before Using the Products 1. Conformance to international standards EC Directives .............................................................................................2-2 Composition of Peripheral Equipments ......................................................2-6 2. System Configuration and Wiring Driver and List of Applicable Peripheral Equipments ...............................2-10 A to G-frame, 100/200 V type: Overall Wiring/ Wiring of the Main Circuit/ Wiring Diagram ..................................2-12 E-frame, 200 V type: Overall Wiring/ Wiring of the Main Circuit/ Wiring Diagram ...2-16 F-frame, 200 V type: Overall Wiring/ Wiring of the Main Circuit/ Wiring Diagram ...2-20 G-frame, 200 V type: Overall Wiring/ Wiring of the Main Circuit/ Wiring Diagram ..2-24 H-frame, 200 V type: Overall Wiring/ Wiring of the Main Circuit/ Wiring Diagram...2-28 D, E-frame, 400 V type: Overall Wiring/ Wiring of the Main Circuit/ Wiring Diagram ..2-32 F-frame, 400 V type: Overall Wiring/ Wiring of the Main Circuit/ Wiring Diagram ...2-36 G-frame, 400 V type: Overall Wiring/ Wiring of the Main Circuit/ Wiring Diagram ..2-40 H-frame, 400 V type: Overall Wiring/ Wiring of the Main Circuit/ Wiring Diagram...2-44 Specifications of Motor connector ............................................................2-48 Wiring method to connector .....................................................................2-50 2 Preparation 3 Connection 3. Wiring to the connector, X1 Connecting host computer.............................................................................. 2-51 4. Wiring to the connector, X2 Connecting communication connector ........................................................... 2-51 5. Wiring to the connector, X3 Safety function connector.........................................................................2-53 6. Wiring to the connector, X4 4 Connection to Host Controller ..................................................................2-54 7. Wiring to the connector, X5 Connect on to External Scale...................................................................2-55 Setup 8. Wiring to the connector, X6 Connection to Encoder.............................................................................2-57 9. Wiring to the connector, X7 Monitor output ..........................................................................................2-60 10. Timing Chart Timing on power-up .................................................................................2-61 Alarm ........................................................................................................2-62 Servo-Lock ...............................................................................................2-63 Servo-ON/OFF .........................................................................................2-64 5 Adjustment 11. Built-in Holding Brake Outline ......................................................................................................2-65 Specifications ...........................................................................................2-66 12. Dynamic Brake Outline ......................................................................................................2-67 Connections of external dynamic brake resistor (Example) ........................... 2-68 Condition setting chart .................................................................................... 2-70 6 13. Setup of Parameter and Mode When in Trouble Outline / Setup / Connection ....................................................................2-72 Composition and List of Parameters ........................................................2-73 List of Parameters ....................................................................................2-74 Setup of Torque Limit ...............................................................................2-82 14. Setup of command division and multiplication ratio (electronic gear ratio) Relation between Electronic Gear and Position Resolution or Traveling Speed ...2-84 15. How to Use the Front Panel 7 Supplement Setup ........................................................................................................2-86 Structure of Each Mode ...........................................................................2-88 Setup of front panel lock ..........................................................................2-90 Monitor Mode (SELECTION display) .......................................................2-91 Monitor Mode (EXECUTION display).......................................................2-92 Parameter Setup Mode ..........................................................................2-106 EEPROM Writing Mode .........................................................................2-107 Auxiliary Function Mode (SELECTION display) .....................................2-108 Auxiliary Function Mode (EXECUTION display) ....................................2-109 2-1 1. Conformance to international standards 2 Preparation EC Directives EC Directives 7KH(&'LUHFWLYHVDSSO\WRDOOVXFKHOHFWURQLFSURGXFWVDVWKRVHKDYLQJVSHFLÀFIXQFWLRQV and have been exported to EU and directly sold to general consumers. Those products DUHUHTXLUHGWRFRQIRUPWRWKH(8XQLÀHGVWDQGDUGVDQGWRIXUQLVKWKH&(PDUNLQJRQWKH products. However, our AC servos meet the relevant EC Directives for Low Voltage Equipment so that the machine or equipment comprising our AC servos can meet EC Directives. EMC Directives MINAS Servo System conforms to relevant standard under EMC Directives setting up certain model (condition) with certain locating distance and wiring of the servo motor and the driver. And actual working condition often differs from this model condition especially in wiring and grounding. Therefore, in order for the machine to conform to the EMC Directives, especially for noise emission and noise terminal voltage, it is necessary to examine the machine incorporating our servos. Conformity to UL Standards Observe the following conditions of (1) and (2) to make the system conform to UL508C (E164620). (1) Use the driver in an environment of Pollution Degree 2 or 1 prescribed in IEC60664-1. (e.g. Install in the control box with IP54 enclosure.) (2) Make sure to install a circuit breaker or fuse which are UL recognized (Listed PDUNHG EHWZHHQWKHSRZHUVXSSO\DQGWKHQRLVHÀOWHU Remarks Note 8VHDFRSSHUFDEOHZLWKWHPSHUDWXUHUDWLQJRIÝ&RUKLJKHU For rated current of circuit breaker and fuse, refer to P.2-10 “Driver and List of Applicable Peripheral Equipments”. (3) Over-load protection level Over-load protective function will be activated when the effective current exceeds 115% or more than the rated current based on the time characteristics (see the next SDJH &RQÀUPWKDWWKHHIIHFWLYHFXUUHQWRIWKHGULYHUGRHVQRWH[FHHGWKHUDWHGFXUrent. Set up the peak permissible current with Pr0.13 (Setup of 1st torque limit) and Pr5.22 (Setup 2nd torque limit). (4) Motor over-temperature protection is not provided. 0RWRURYHUORDGWHPSHUDWXUHSURWHFWLRQVKDOOEHSURYLGHGDWWKHÀQDOLQVWDOODWLRQXSRQ required by the NEC (National Electric Code). Note 2-2 For Overload protection time characterstics, refer to P.6-14. 1. Conformance to international standards 1 SEMI F47 ,QFOXGHVDIXQFWLRQLQFRPSOLDQFHZLWKWKH6(0,)VWDQGDUGIRUYROWDJHVDJLPPXQLW\ under no load or light load. ,GHDOIRUWKHVHPLFRQGXFWRUDQG/&'LQGXVWULHV (1) Excluding the single-phase 100-V type. (2) Please verify the actual compliance of your machine with the F47 standard for voltage sag immunity. 2 Preparation Caution Before Using the Products EC Directives Conformed Standards Driver EN55011 EN61000-6-2 EN61800-3 Low-Voltage Directives EN61800-5-1 Machinery Directives Functional safety EN60034-1 EN60034-5 EN954-1 (Cat. 3) ISO13849-1 (PL c,d*2) (Cat. 3) EN61508 (SIL 2) EN62061 (SIL 2) EN61800-5-2 (STO) IEC61326-3-1 4 – Setup (*1) – Connection EC Directives EMC Directives 3 Motor UL1004-1 to 750W (200V) ( E327868: from ) 6.0kW UL Standards UL508C (E164620) UL1004 ( C22.2 No.14 5 C22.2 No.100 Adjustment CSA Standards ) E327868: 400W (400V) 600W (400V), 750W (400V) 0.9kW to 5.0kW IEC : International Electrotechnical Commission EN : Europaischen Normen EMC : Electromagnetic Compatibility UL : Underwriters Laboratories CSA : Canadian Standards Association 6 When in Trouble Pursuant to the directive 2004/108/EC, article 9(2) Panasonic Testing Centre Panasonic Service Europe, a division of Panasonic Marketing Europe GmbH Winsbergring 15, 22525 Hamburg, F.R. Germany 2QO\IRUSRVLWLRQFRQWUROW\SHGRHVQRWVXSSRUWIXQFWLRQDOVDIHW\(*1) standards. *2 PL d: Provided that EDM is used. 7 Use options correctly after reading Operating Instructions of the options to better understand the precautions. Take care not to apply excessive stress to each optional part. 2-3 Supplement Caution 1. Conformance to international standards EC Directives Installation Environment Use the servo driver in the environment of Pollution Degree 1 or 2 prescribed in IEC-60664-1 (e.g. Install the driver in control panel with IP54 protection structure.) 100V/200V Power supply Metallic control box Noise filter for signal lines *1 Residual current device (RCD) Circuit breaker ① Surge absorber ② Noise filter Driver XA L1 L2 L3 XB U V W L1C L2C ⑥ ③ X6 Noise filter for signal lines ⑦ Insulated power supply for interface Noise filter for signal lines *2 X4 ⑧ Controller ④ Motor M RE Noise filter for A to F-frame: signal lines Motor cable X3 without shield cable Noise filter for G, H-frame: signal lines ⑤ Safety *3 Motor cable with shield controller cable Ground (PE) *1 A to D-frame: Noise filter for signal lines, E to H-frame: Noise filter for signal lines *2 A to F-frame: Noise filter for signal lines, G, H-frame: Noise filter for signal lines *3 Only for position control type is not provided with X3 terminal. 400V Power supply Metallic control box Noise filter for signal lines *1 Residual current device (RCD) Circuit breaker ① Surge absorber ② Noise filter ⑥ Driver XA L1 L2 L3 Insulated DC24V 24V 0V ③ X6 Noise filter for signal lines ⑦ Insulated power supply for interface XB U V W Noise filter for signal lines *2 X4 ⑧ Controller ④ Motor M RE Noise filter for D to F-frame: signal lines Motor cable X3 without shield cable Noise filter for G, H-frame: signal lines ⑤ Safety *3 Motor cable with shield controller cable Ground (PE) *1 D to F-frame: Noise filter for signal lines, G, H-frame: Noise filter for signal lines *2 D to F-frame: Noise filter for signal lines, G, H-frame: Noise filter for signal lines *3 Only for position control type is not provided with X3 terminal. 0DQGDWRU\UHTXLUHPHQWVWRFRQIRUPWR(0&GLUHFWLYH ・ Install the servo driver on the metallic casing (control board). ・,QVWDOOQRLVHÀOWHUDQGOLJKWQLQJVXUJHDEVRUEHULQWKHSRZHUVXSSO\OLQH ・ Use braided shield cable (tin plated annealed copper wire) for I/O signal cable and encoder cable. ・3URYLGH WKH QRLVH ÀOWHU DV VKRZQ LQ WKH ÀJXUH IRU HDFK FDEOH ,2 OLQH DQG SRZHU source line to be connected to the servo driver. ・6KLHOGRIFDEOHVQRWVKRZQRQWKHÀJXUHVKRXOGEHGLUHFWO\JURXQGHGWKURXJK3( Because these conditions for EMC directive are affected by status of connected devices, wiring, connection and location, compliance should be checked after completing installation. 2-4 1. Conformance to international standards 1 Before Using the Products EC Directives 'HWDLOVRIFDEOH OHIWKDQGILJXUH From To Cable function Length Remarks Shield 1RLVHÀOWHU for signal lines ① Breaker 1RLVHÀOWHU Power line 2m Single phase or 3-phase none none ② 1RLVHÀOWHU Servo driver Power line 2m ー none with ③ Servo driver Servo motor Junction cable for motor 20m ー *1 with ④ Servo driver Servo motor Junction cable for encoder 20m ー with with ⑤ Switch box Servo driver I/O cable 3m ー with with ⑥ Frame ground 1RLVHÀOWHU FG line 1m ー none none ⑦ Frame ground 1RLVHÀOWHU FG line 1m ー none none ⑧ AC power supply Switch box Power line 1m ー none none 2 Preparation Symbol 3 Connection *1 Frame A to F: none, Frame G and H: with. 5HIHUWR3IRUDOHIWKDQGILJXUHDQGWKHOLVWRIWKH3HULSKHUDO(TXLSPHQWVDIWHU 4 Setup 5 Adjustment 6 When in Trouble 7 Use options correctly after reading Operating Instructions of the options to better understand the precautions. Take care not to apply excessive stress to each optional part. 2-5 Supplement Caution 1. Conformance to international standards 2 Preparation &RPSRVLWLRQRI3HULSKHUDO(TXLSPHQWV Power Supply +10% 100V type : Single phase, 100V –15% (A to C-frame) +10% 200V type : Single/3-phase, 200V –15% (A to D-frame) +10% 200V type : 3-phase, 200V –15% (E to H-frame) +10% 400V type : Main power supply 3-phase, 380V –15% (D to H-frame) : Control power supply DC 24V ± 15% to 120V +10% –15% 50/60Hz to 240V +10% –15% 50/60Hz to 230V +10% –15% 50/60Hz to 480V +10% –15% 50/60Hz (1) This product is designed to be used in over-voltage category (installation category) III of EN 61800-5-1:2007. (2) Use an insulated power supply of DC12 to 24V which has CE marking or complies with EN60950. Remarks Use sheathed (jacketed) cable, twisted cable or closely bundled cable for power cable. 3RZHUFDEOHDQGVLJQDOZLUHVPXVWEHVXIÀFLHQWO\LVRODWHGIURPHDFKRWKHU Twisted Servo driver Closely bundled cable Servo driver L1 L1C L2 L2C L3 United Circuit Breaker Install a circuit breaker which complies with IEC Standards and UL recognized (Listed and PDUNHG EHWZHHQSRZHUVXSSO\DQGQRLVHÀOWHU The short-circuit protection circuit on the product is not for protection of branch circuit. The branch circuit should be protected in accordance with NEC and the applicable local regulations in your area. Note 2-6 For driver and applicable peripheral equipments, refer to P.2-10 "Driver and List of Applicable Peripheral Equipments". 1. Conformance to international standards 1 Before Using the Products &RPSRVLWLRQRI3HULSKHUDO(TXLSPHQWV Noise Filter Option part No. 9ROWDJHVSHFLÀFDWLRQV for driver Manufacturer’s part No. Applicable driver (frame) DV0P4170 Single phase 100V/200V SUP-EK5-ER-6 A, B-frame 3-phase 200V Manufacturer 2 A, B-frame Single phase 100V/200V 3-phase 200V 3SUP-HU10-ER-6 DV0P4220 Single/ 3-phase 200V 3SUP-HU30-ER-6 D-frame DV0PM20043 3-phase 200V 3SUP-HU50-ER-6 E-frame DV0P3410 3-phase 200V 3SUP-HL50-ER-6B F-frame C-frame Okaya Electric Ind. 3 5HFRPPHQGHGFRPSRQHQWV Model No. Remarks 3-phase 200V 3-phase 400V Applicable driver (frame) A, B, C-frame D-frame E, F-frame G-frame H-frame D, E-frame F-frame Manufacturer TDK-Lambda Corp. 4 Schaffner G, H-frame Isolate the input and output AC input Noise Filter The effect of the noise filter is a little. AC output AC input Noise Filter 1 4 2 5 2 6 3 3 E 4 1 5 E 6 6 Ground Ground AC output When in Trouble Do not place the input and output lines in the same duct or do not tie both in a bundle. Surge Absorber 9ROWDJHVSHFLÀFDWLRQV for driver Manufacturer’s part No. DV0P1450 3-phase 200V R・A・V-781BXZ-4 DV0P4190 Single phase 100V/200V R・A・V-781BWZ-4 DV0PM20050 3-phase 400V R・A・V-801BXZ-4 Manufacturer 7 Okaya Electric Ind. Remarks When performing withstand voltage test of machine and equipment, be sure to remove the surge absorber; otherwise, it will be damaged. Related page 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ3´2SWLRQµ 2-7 Supplement Option part No. 5 Adjustment 6HOHFWDQRLVHÀOWHUZKRVHFDSDFLW\LVFRPPHQVXUDWHZLWKWKHSRZHUVRXUFHFDSDFLW\ LQ consideration of the load condition). )RUWKHGHWDLOHGVSHFLÀFDWLRQVRIHDFKQRLVHÀOWHUFRQWDFWWKHPDQXIDFWXUHU :KHQWZRRUPRUHVHUYRGULYHUVDUHXVHGZLWKDVLQJOHQRLVHÀOWHUDWWKHFRPPRQSRZHUVRXUFHFRQVXOWZLWKWKHQRLVHÀOWHUPDQXIDFWXUHU Do not run the input and output wiring on the same passage: noise resistance will drop. (Figure at lower right) Isolate the input and output line from each other. (Figure at lower left) Setup RTHN-5010 RTHN-5030 RTHN-5050 FS5559-60-34 FS5559-80-34 FN258L-16-07 FN258L-30-07 FN258-42-07 FN258-42-33 Rated current 10 30 50 60 80 16 30 42 42 Connection 9ROWDJHVSHFLÀFDWLRQV for driver Preparation DV0PM20042 1. Conformance to international standards &RPSRVLWLRQRI3HULSKHUDO(TXLSPHQWV Noise Filter for Signal Lines Signal line, Encoder line, Control power line, Power line (A to D-frame: 100V/ 200V and D to F-frame: 400V) and Motor line (A to F-frame). Option part No. Manufacturer’s part No. Manufacturer DV0P1460 ZCAT3035-1330 TDK Corp. 5HFRPPHQGHGFRPSRQHQWV Option part No. Manufacturer’s part No. Applicable driver (frame) RJ8035 E-frame 200 V, F-frame 200 V RJ8095 G, H-frame T400-61D G, H-frame Power cable Motor cable Manufacturer KK-CORP.CO.JP MICROMETALS 6LJQDOZLUH Power wire 0RWRUOLQH (QFRGHUOLQH :LQGFDEOHVWKHQXPEHURIWXUQVUHTXLUHGWRIRUPWKHVLJQDOQRLVHÀOWHU If sheathed (jacketed): remove the sheath (jacket) to the length so that wires (L1, L2, / FDQEHZRXQGRQWKHVLJQDOQRLVHÀOWHU LQFOXGLQJSRZHUOLQHGHGLFDWHGÀOWHU )RU effective noise reduction capability, L1, L2 and L3 should be wound together. If not effective, increase the number of signal noise filters (including power line GHGLFDWHGÀOWHUV 6HHÀJXUHEHORZ :KHQ LQVWDOOLQJ WKH VLJQDO QRLVH ÀOWHU LQFOXGLQJ PRWRU OLQH GHGLFDWHG ÀOWHU WR RXU optional cable, remove the sheath (jacket) to the length so that wires can be wound RQ WKH VLJQDO QRLVH ÀOWHU LQFOXGLQJ SRZHU OLQH GHGLFDWHG ÀOWHU )RU HIIHFWLYH QRLVH reduction capability, U, V and W should be wound together. If not effective, increase the number of signal noise filters (including power line GHGLFDWHGÀOWHUV 6HHÀJXUHEHORZ :LQGFDEOHVWKHQXPEHURIWXUQVUHTXLUHGWRIRUPWKHVLJQDOQRLVHÀOWHU DV0P1460 Sheath (jacket) Cover Electric wire * If not effective, increase the number of turns. FG line Sheath (jacket) Cover Electric wire * If not effective, increase the number of turns. FG line DV0P1460 Sheath (jacket) Cover Electric wire * If not effective, increase the number of filters. FG line 2-8 1. Conformance to international standards 1 Before Using the Products &RPSRVLWLRQRI3HULSKHUDO(TXLSPHQWV Residual current device Install a type B Residual current device (RCD) at primary side of the power supply. 2 Grounding Preparation (1) To prevent electric shock, be sure to connect the ground terminal ( ) of the driver, and the ground terminal (PE) of the control panel. (2) The ground terminal ( ) must not be shared with other equipment. Two ground terminals are provided. Structure of control board 3 Connection If there is a gap at cable inlet/outlet, mounting hole of operation panel or a door, radio waves will penetrate into or radiate out through the gap. To prevent unfavorable conditions due to radio frequency activities, observe the following control board design and selection instruction. The control board should be made of metal which provides electrical continuity. The control board should not have electrically-isolated conductor. All units installed in the casing should be grounded to the case. 4 Increasing noise resistance of control I/O signal Setup 5 Adjustment When noise is applied to the control input/output, it causes displacement and malfunctioning of I/O signal. X1 to X7 are secondary side circuit which should be isolated from the primary power source (24 VDC control power source, 24 VDC braking power source and 24 VDC for regenerative resistor). Do not connect the secondary side circuit to the primary power source and ground wire. Otherwise, I/O signal will cause error operation. Control power source (particularly 24 VDC) should be completely isolated from external operating power source. Never connect the ground of the control power source to that of external power source. The signal line should have shield, the both end of which should be connected to the ground. 6 When in Trouble 7 For driver and applicable peripheral equipments, refer to P.2-10 “Driver and List of Applicable Peripheral Equipments”. Caution Use options correctly after reading Operating Instructions of the options to better understand the precautions. Take care not to apply excessive stress to each optional part. 2-9 Supplement Note 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWV Preparation Driver Applicable Voltage motor *1 Rated output MSME 3-phase, 200V MHME MDME MFME MDDH MSME MSME MDME MHME MGME 3-phase, 400V MSME MDME MFME MHME MDME MSME 3-phase, MHME 200V MEDH 0.9kW 1.0kW 1.5kW 1.0kW approx. 0.5kVA approx. 1.3kVA approx. 1.8kVA approx. 1.8kVA ) ( ) approx. 2.3kVA / DV0P1450 DV0P4170 DV0P4190 DV0P4170 DV0P4190 / / DV0PM20042 DV0P1450 20A (3P+1a) 0.75mm2/ AWG18 600 VAC or more 15A DV0P1460 DV0P4190 / DV0P1450 DV0P4220 30A (3P+1a) 20A 2.0kW approx. 3.3kVA MFME 2.5kW MGME 2.0kW FN258L-16-07 20A (3P+1a) Recommended DV0PM20050 component ) DV0P1460 RJ8035 30A DV0PM20043 DV0P1450 ( Recommended component ) approx. 3.8kVA approx. 3.8kVA FN258L-16-07 ( Recommended component ) DV0PM20050 DV0P1460 4.5kW approx. 6.8kVA 5.0kW approx. 7.5kVA 2.0kW approx. 3.8kVA 3.0kW approx. 4.5kVA 4.0kW approx. 6.0kVA 4.5kW approx. 6.8kVA 5.0kW approx. 7.5kVA 0.75mm2/ AWG18 600 VAC or more 30A (3P+1a) 0.52mm2/ AWG20 100 VAC or more 0.75mm2/ AWG18 100 VAC or more 11mm or smaller DV0P1460 RJ8035 50A DV0P3410 DV0P1450 ( Recommended component ø5.3 ) Terminal block M5 *5 100A (3P+1a) 11mm or smaller 0.75mm2/ AWG18 600 VAC or more ø5.3 Terminal block M5 3.5mm2/ AWG12 600 VAC or more 3.5mm2/ AWG12 600 VAC or more 7mm or smaller 10mm or smaller 30A FN258L-30-07 ( Recommended component ) DV0PM20050 DV0P1460 2.0mm2/ AWG14 600 VAC or more 0.52mm2/ AWG20 100 VAC or more 60A (3P+1a) 60A (3P+1a) approx. 4.5kVA approx. 6.0kVA 2.0mm2/ AWG14 600V VAC or more *5 15A Diameter and withstand voltage of brake cable 0.28mm2/ AWG22 to 0.75mm2/ AWG18 100VAC or more 0.75mm2/ AWG18 600 VAC or more DV0P4190 ( Diameter Crimp Diameter and terminal and withstand for control withstand voltage power voltage of of control supply motor cable power terminal *4 supply cable block DV0P4190 / DV0PM20042 DV0PM20042 10A 1.5kW Crimp terminal for main circuit terminal block DV0P4190 approx. 1.8kVA approx. 3.3kVA MFME / 3-phase Rated Diameter operating and current of withstand magnetic voltage of contactor Contact FRQÀJXUDWLRQ main circuit cable *2 approx. 2.3kVA 2.0kW MGME MSME MDME MHME 10A Single phase Noise ÀOWHUIRU signal approx. 1.8kVA MSME MDME 3-phase, MHME 400V MSME MDME MGME MHME MSME 3-phase, MDME 400V MHME )( approx. 0.9kVA approx. 3.8kVA MGME / 3-phase DV0P4170 approx. 0.9kVA 2.5kW MGME MDME MHME MSME Single phase DV0P4170 approx. 0.5kVA MFME MFME ( approx. 0.4kVA 0.9kW MDME MHME 3.0kW MSME MGME MDME 3-phase, 4.0kW MHME 200V MSME MFDH at the rated (rated load) (current) Surge absorber Connection to exclusive connector MGME Noise ÀOWHU Circuit breaker Connection to exclusive connector Single 50W to MSME phase, 100W 100V MADH MSMD Single/ MHMD 3-phase, 50W to 200W 200V Single 200W MSME 100V MBDH MSMD Single/ MHMD 3-phase, 400W 200V Single 400W MSME 100V MCDH MSMD Single/ MHMD 3-phase, 750W 200V MDME 1.0kW MHME 5HTXLUHG Power 60A (3P+1a) ø4.3 Terminal block M4 0.75mm2/ AWG18 100 VAC or more ø3.2 Terminal block M3 *1 Select peripheral equipments for single/3phase common specification according to the power source. *2 For the external dynamic brake resistor, use the magnetic contactor with the same rating as that for the main circuit. *3 When use the external regenerative resistor of the option (DV0PM20058, DV0PM20059), use the cable with the same diameter as the main circuit cable. *4 The diameter of the ground cable and the external dynamic brake resistor cable must be equal to, or larger than that of the motor cable. The motor cable is a shield cable, which conforms to the EC Directives and UL Standards. (G, H-frame only) *5 Use thses products to suit an international standard. Related page 2-10 1RLVHÀOWHU36XUJHDEVRUEHU3 1RLVHÀOWHUIRUVLJQDO30RWRUEUDNHFRQQHFWRU3 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 1 Driver Applicable Voltage motor *1 Rated output 5HTXLUHG Power 6.0kW approx. 9.0kVA MHME 7.5kW approx. 11kVA MDME 7.5kW approx. 11kVA 6.0kW approx. 9.0kVA 7.5kW approx. 11kVA 11kW approx. 17kVA 3-phase, 200V MGDH MGME 3-phase, 400V MHME 3-phase, 200V 15kW MHDH MDME 11kW approx. 22kVA 60A 30A FS5559-60-34 ( Recommended component ) FN258-42-07 or FN258-42-33 DV0PM20050 50A 60A 5.3mm2/ AWG10 600 VAC or more DV0P1460 RJ8095 60A (3P+1a) ( Recommended component ) Diameter Crimp Diameter and terminal and withstand for control withstand voltage power voltage of of control supply motor cable power terminal *4 supply cable block 0.75mm2/ AWG18 600 VAC or more ø5.3 Terminal block M5 0.75mm / AWG18 100 VAC or more 2 10mm or smaller ø5.3 2 Diameter and withstand voltage of brake cable Terminal block M5 13.3 mm2/ AWG6 600 VAC or more DV0P1450 (Recommended component ) *5 FN258-42-07 or FN258-42-33 DV0PM20050 (Recommended component ) 150A (3P+1a) 100A (3P+1a) 16mm or smaller 13.3mm2/ AWG6 600 VAC or more *3 0.75mm2/ AWG18 600 VAC or more ø6.4 Terminal block M6 10mm or smaller ø4.3 0.75mm2/ AWG18 100 VAC or more Terminal block M4 21.1 mm2/ AWG4 600 VAC or more 0.75mm2/ AWG18 100 VAC or more 3 13.3 mm2/ AWG6 600 VAC or more Connection approx. 22kVA 11mm or smaller T400-61D FS5559-80-34 approx. 17kVA ) Crimp terminal for main circuit terminal block (Recommended component ) 100A 125A ( Rated Diameter operating and current of withstand magnetic voltage of contactor Contact FRQÀJXUDWLRQ main circuit cable *2 100A (3P+1a) DV0P1450 (Recommended component ) 3-phase, 400V 15kW Surge absorber Noise ÀOWHUIRU signal Preparation approx. 11kVA MGME Noise ÀOWHU at the rated (rated load) (current) 7.5kW MDME Circuit breaker Before Using the Products 'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWV 21.1 mm2/ AWG4 600 VAC or more $ERXWFLUFXLWEUHDNHUDQGPDJQHWLFFRQWDFWRU 7R FRPSO\ WR (& 'LUHFWLYHV LQVWDOO D FLUFXLW EUHDNHU EHWZHHQ WKH SRZHU DQG WKH QRLVH ÀOWHU without fail, and the circuit breaker should conform to IEC Standards and UL recognized (Listed and marked). Suitable for use on a circuit capable of delivering not more than 5,000Arms symmetrical amperes, below the maximum input voltage of the product. 6HOHFWDFLUFXLWEUHDNHUDQGQRLVHÀOWHUZKLFKPDWFKWRWKHFDSDFLW\RISRZHU supply (including a load condition). Setup Remarks 4 Terminal block and protective ground terminals 8VHDFRSSHUFRQGXFWRUFDEOHVZLWKWHPSHUDWXUHUDWLQJRIÝ&RUKLJKHU 8VHWKHDWWDFKHGH[FOXVLYHFRQQHFWRUIRU$WR(IUDPHDQGPDLQWDLQWKHSHHOHGRIIOHQJWKRIWR 9mm. (Refer to P.2-50) )DVWHQLQJWRUTXHOLVW 7HUPLQDOEORFNVFUHZ7HUPLQDOFRYHUIDVWHQLQJVFUHZ Terminal name F200V L1, L2, L3, L1C, L2C, B1, B2, B3, NC, U, V, W 24V、0V L1, L2, L3, B1, B2, B3, NC, U, V, W L1C, L2C, 24V, 0V, DB1, DB2, DB3, DB4, NC L1, L2, L3, B1, B2, NC, U, V, W L1C, L2C, 24V, 0V, DB1, DB2 L1, L2, L3, B1, B2, NC, U, V, W F400V G H )DVWHQLQJWRUTXHOLVW *URXQGWHUPLQDOVFUHZ&RQQHFWRUWRKRVWFRQWUROOHU ; Connector to host controller (X4) Nominal )DVWHQLQJWRUTXH Nominal )DVWHQLQJWRUTXH size 1P *1 size 1P *1 M4 0.7 to 0.8 M5 1.4 to 1.6 M2.6 0.3 to 0.35 M6 2.4 to 2.6 Terminal block screw Driver frame A to E F, G H *1 Applying fastening torque larger than the maximum value may result in damage to the product. Remarks Be sure to conduct wiring properly and securely. Insecure or improper wiring may cause the motor running out of control or being damaged from overheating. In addition, pay attention not to allow conductive materials, such as wire chips, entering the driver during the installation and wiring. 2-11 7 Supplement 'RQRWWXUQRQSRZHUZLWKRXWWLJKWHQLQJDOOWHUPLQDOEORFNVFUHZVSURSHUO\ 'R QRW WXUQ RQ SRZHU ZLWKRXW WLJKWHQLQJ DOO WHUPLQDO EORFN VFUHZV SURSHUO\ RWKHUZLVH ORRVHFRQWDFWVPD\JHQHUDWHKHDW VPRNLQJÀULQJ 7RFKHFNIRUORRVHQHVVFRQGXFWSHULRGLFLQVSHFWLRQRIIDVWHQLQJWRUTXHRQFHD\HDU 6 When in Trouble Frame Terminal cover fastening screw Nominal )DVWHQLQJWRUTXH Nominal )DVWHQLQJWRUTXH size 1P *1 size 1P *1 M5 1.0 to 1.7 M3 0.4 to 0.6 M3 0.19 to 0.21 M4 0.7 to 1.0 M5 1.0 to 1.7 M5 2.0 to 2.4 M3 0.3 to 0.5 M4 0.7 to 1.0 M5 2.0 to 2.5 M6 2.2 to 2.5 Terminal block screw Adjustment Driver 5 2 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ Preparation Overall Wiring (A to D-frame, 100/200 V type) Connecting Example of A to D-frame $SSO\WKHYROWDJHGHVLJQDWHGRQWKHQDPHSODWH IURPWKHSRZHUVRXUFH 0DLQV 5HVLGXDO FXUUHQWGHYLFH 6\PPHWULFFXUUHQWVKRXOGEH$UPVRUEHORZ ,IWKHVKRUWFLUFXLWFXUUHQWRQWKHSRZHUVRXUFH H[FHHGVWKLVYDOXHXVHDFXUUHQWOLPLWLQJGHYLFH HJFXUUHQWOLPLWLQJIXVHFXUUHQWOLPLWLQJFLUFXLW EUHDNHURUWUDQVIRUPHU :LULQJRI0DLQ&RQQHFWRU ;$ Wiring to Connector, XA &RQQHFWLRQWRLQSXWSRZHU &LUFXLW%UHDNHU 0&&% 7RSURWHFWSRZHUVXSSO\OLQHIURPRYHUORDGLQJLQVWDOODZLULQJFLUFXLWEUHDNHUUDWHGWR WKHFDSDFLW\RIWKHSRZHUVXSSO\ P.2-14 / 3LQ / 3LQ Noise Filter (NF) 5HPRYHVH[WHUQDOQRLVHIURPWKHSRZHU OLQHV$QGUHGXFHVDQHIIHFWRIWKHQRLVH JHQHUDWHGE\WKHVHUYRGULYHU / 3LQ /& 3LQ /& 3LQ 0DJQHWLF&RQWDFWRU 0& 7XUQVRQRIIWKHPDLQSRZHURIWKHVHUYR GULYHU 8VHFRLOVXUJHVXSSUHVVLRQXQLWVWRJHWKHU ZLWKWKLV Never start nor stop the servo motor ZLWKWKLV0DJQHWLF&RQWDFWRU Reactor (L) WREHVXSSOLHGE\FXVWRPHU 5HGXFHVKDUPRQLFFXUUHQWRIWKHPDLQ SRZHU :LULQJWR&RQQHFWRU;% :LULQJRI0RWRU&RQQHFWRU ;% 3LQ% SLQ % SLQ DQG % SLQ %DQG%WREHNHSWVKRUWHGIRU QRUPDORSHUDWLRQ )RU&IUDPH DQG'IUDPH :KHQ\RXFRQQHFWDQH[WHUQDO UHJHQHUDWLYHUHVLVWRUGLVFRQQHFWD VKRUWFLUFXLWZLUHEHWZHHQ%DQG% )RU&IUDPHDQG'IUDPH WKHQ FRQQHFWWKHH[WHUQDOUHJHQHUDWLYH UHVLVWRUEHWZHHQ%DQG%VHWXS 3UWRRU Note 1RWHWKDWQRUHJHQHUDWLYHUHVLVWRULV HTXLSSHGLQ)UDPH$DQG%W\SH Note Related page 2-12 P.2-14 &RQQHFWLRQWRH[WHUQDOFRPSRQHQWV % 3LQ % 3LQ Regenerative resistor (optional) Remarks :KHQ\RXXVHDQH[WHUQDOUHJHQHUDWLYHUHVLVWRU install an external protective apparatus, such as thermal fuse without fail. 7KHUPDOIXVHDQGWKHUPRVWDWDUHEXLOWLQWRWKH UHJHQHUDWLYHUHVLVWRU 2SWLRQ If the thermal fuse is activated, it will not resume. 0RXQWWKHUHJHQHUDWLYHUHVLVWRUon incombustible material such as metal. 7KLVRYHUDOOZLULQJGLDJUDPLVDW\SLFDORQH7KHSDJHVWKDWIROORZVKRZZLULQJIRUVSHFLÀF application. The wiring indicated with the broken line shall be provided only when required. 3´2SWLRQVµ 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 1 : High voltage 3& WREHVXSSOLHG E\FXVWRPHU Wiring to Connector, X7 0RQLWRURXWSXW 2 3 6HWXSVXSSRUWVRIWZDUH´3$1$7(50µ 3OHDVHGRZQORDGIURPRXUZHEVLWH :LULQJWR&RQQHFWRU; P.2-51 &RQQHFWLRQWR3& 3$1$7(50 :LULQJWR&RQQHFWRU; 3 &RQQHFWLRQWR6DIHW\E\SDVVSOXJ &KDUJHODPS 5HG/(' *1 4 6KRUWFLUFXLWZLUH %% :LULQJWR&RQQHFWRU; P.2-54 &RQQHFWLRQWRKRVWFRQWUROOHU :LULQJWR&RQQHFWRU; P.2-55 &RQQHFWLRQWRIHHGEDFNVFDOH 7KHVHFRORUVDUHXVHG IRURSWLRQDOFDEOH :LULQJWR&RQQHFWRU; &RQQHFWLRQWRHQFRGHU *URXQG HDUWK -XQFWLRQFDEOHIRUHQFRGHU -XQFWLRQFDEOHIRUPRWRU :LULQJWR&RQQHFWRU;% P.2-14 &RQQHFWLRQWRPRWRUGULYLQJSKDVH DQGJURXQG P.2-57 5 Remarks ;WR;DUHXVHGIRUWKH VHFRQGDU\FLUFXLW7RFRQQHFWWKHVH WHUPLQDOVWRWKHSULPDU\SRZHU VXSSO\ SDUWLFXODUO\9'&SRZHU VXSSO\IRUEUDNH LQVXODWLRQLV UHTXLUHG 'RQRWFRQQHFWWKHVHWHUPLQDOVWR WKHVDPHSRZHUVXSSO\ '&3RZHUVXSSO\ IRUEUDNH'&9 WREHVXSSOLHGE\FXVWRPHU 7 Supplement Related page 6 When in Trouble -XQFWLRQFDEOH IRUEUDNH 'RQRWPDNHGLVSODFHPHQWZLULQJRULQVSHFWLRQ ZKLOHWKH/('LVOLWFDXVHRIHOHFWULFVKRFN Adjustment *URXQG WHUPLQDO Setup 8SKDVH UHG 9SKDVH ZKLWH :SKDVH EODFN Note 3 Connection :LULQJWR&RQQHFWRU; P.2-51 &RQQHFWLRQWR5656 RUKRVWFRQWUROOHU Preparation +DQGOHOHYHU 8VHWKLVIRUFRQQHFWRU FRQQHFWLRQ6WRUHWKLV DIWHUFRQQHFWLRQIRU RWKHURFFDVLRQV 5HIHUWR32-50 IRU FRQQHFWLRQ Before Using the Products Overall Wiring (A to D-frame, 100/200 V type) •7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU • Only for position control type is not provided with X2, X3 and X5. 3´Wiring of the Main Circuit (A to G-frame, 100/200 V type)µ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ URL: http://industrial.panasonic.com/jp/i/fa_motor.html 2-13 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Wiring of the Main Circuit (A to D-frame, 100/200 V type) Preparation A to D-frame, 100 V / 200 V type :LULQJVKRXOGEHSHUIRUPHGE\DVSHFLDOLVWRUDQDXWKRUL]HGSHUVRQQHO 'RQRWWXUQRQWKHSRZHUXQWLOWKHZLULQJLVFRPSOHWHG 1HYHUWRXFKWKHSRZHUFRQQHFWRU ;$DQG;% WRZKLFKKLJKYROWDJHLVDSSOLHG There is a risk of electric shock. Tips on Wiring 1) Wire connector (XA and XB). 2) Connect the wired connector to the driver. Fully insert the connector to the bottom until it clicks. Power supply 5&' MCCB NF MC L 5 4 3 2 1 L1 L2 / L1C L2C XA ([WHUQDOUHJHQHUDWLYH resistor W 6 5 4 3 2 1 DC 24V DC power supply IRUEUDNH U 5HG V :KLWH Varistor Fuse (125 V 10 A) Note Related page 2-14 % B2 U V 0DWFKWKHFRORUVRIWKHPRWRUOHDGZLUHVWRWKRVHRIWKH FRUUHVSRQGLQJPRWRURXWSXWWHUPLQDOV 89: 'RQ WGLVFRQQHFWWKHVKRUWLQJFDEOHEHWZHHQ%DQG% &DQG'IUDPHW\SH 6KRUWLQJFDEOHLVQRWUHTXLUHGIRU $DQG%IUDPH'LVFRQQHFWWKLVRQO\ZKHQWKHH[WHUQDO UHJHQHUDWLYHUHJLVWHULVXVHG Avoid shorting and grounding. Don't connect the main power. W Earth-ground this. 7RSUHYHQWHOHFWULFVKRFNEHVXUHWRFRQQHFWWKHJURXQG *UHHQRU E WHUPLQDO RIWKHGULYHUDQGWKHJURXQGWHUPLQDO *UHHQ\HOORZ JURXQGSODWH RIWKHFRQWUROSDQHO 7KHVHFRORUV 7 KHJURXQGWHUPLQDO PXVWQRWEHVKDUHGZLWKRWKHU DUHXVHGIRU RSWLRQDOFDEOH HTXLSPHQW 7ZRJURXQGWHUPLQDOVDUHSURYLGHG *URXQGUHVLVWDQFHїPD[ )RUDSSOLFDEOHZLUHUHIHUWR3 Don't connect the earth cable to other inserting slot, nor make them touch. %ODFN Motor B1 &KHFNWKHQDPHSODWHRIWKHGULYHUIRUSRZHU VSHFLILFDWLRQV 3URYLGHDUHVLGXDOFXUUHQWGHYLFH7KHUHVLGXDO FXUUHQWGHYLFHWREHWKHRQHGHVLJQHGIRU,QYHUWHU DQGLVHTXLSSHGZLWKFRXQWHUPHDVXUHVIRUKDUPRQLFV 3URYLGHDFLUFXLWEUHDNHU 0DNHVXUHWRSURYLGHDQRLVHILOWHU 3URYLGHFRLOVXUJHVXSSUHVVLRQXQLWVWRWKHFRLORIWKH 0DJQHWLF&RQWDFWRUUHFRPPHQGHGE\PDQXIDFWXUHU Never start/stop the motor with this Magnetic Contactor. 3URYLGHDQ$&5HDFWRU Connect L1 and L1C, and L3 and L2C at single phase use (100V and 200V), and don't use L2. XB &RPSRVHDGXSOH[%UDNH&RQWURO&LUFXLWVRWKDWWKH EUDNHFDQDOVREHDFWLYDWHGE\DQH[WHUQDOLPPHGLDWH VWRSVLJQDO 7KHKROGLQJEUDNHKDVQRSRODULWLHV )RUWKHKROGLQJEUDNHSRZHUVXSSO\FDSDFLW\DQGKRZWR XVHWKHEUDNHUHIHUWR´6SHFLILFDWLRQVRI%XLOWLQ+ROGLQJ %UDNHµRQ3 3URYLGHDYDULVWRU &RQQHFWD$IXVHLQVHULHVZLWKWKHYDULVWRU The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ3´:LULQJPHWKRGWRFRQQHFWRUµ 3´&RQQHFWRUNLWIRU;$µ3´&RQQHFWRUNLWIRU;%µ Preparation Wiring Diagram (A to D-frame, 100/200 V type) Compose the circuit so that the main circuit power will be shut off when an error occurs. In Case of Single Phase, A to D-frame, 100 V / 200 V type Power supply Single phase, 100V –15% to 120V +10% Single phase, 200V –15% to 240V +10% Remarks ON OFF ALM MC Coil surge suppression units L Noise filter MCCB L1 L2 L3 L1C L2C MC Remove the short wire when you connect the external regenerative resistor. (C, D-Frame) Red White * These colors Black are used for Green or Green/Yellow optional cable. Motor Main power supply Control power supply 3 XB Connection B1 B3 B2 U V W External regenerative resistor XA Motor connection 4 ALM 37 36 X4 ALM+ Setup Insulated + DC12 to 24V ï (±5%) 2 Preparation When you use single phase, connect the main power between L1 and L3 terminals. Built-in thermostat of an external regenerative resistor (light yellow) 1 Before Using the Products 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 $/0ï In Case of 3-Phase, A to D-frame, 200 V type Power supply 3-phase, 200V –15% to 240V +10% ON OFF ALM MC Built-in thermostat of an external regenerative resistor (light yellow) Noise filter MCCB L MC External regenerative resistor Red White * These colors Black are used for Green or Green/Yellow optional cable. Motor Note Related page Control power supply 6 XB Motor connection 7 ALM 37 36 X4 ALM+ Supplement Insulated + DC12 to 24V ï (±5%) B1 B3 B2 U V W XA Main power supply When in Trouble Remove the short wire when you connect the external regenerative resistor. (C, D-Frame) L1 L2 L3 L1C L2C Adjustment Coil surge suppression units 5 $/0ï The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ3´:LULQJPHWKRGWRFRQQHFWRUµ 2-15 2 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ Preparation Overall Wiring (E-frame, 200 V type) Connecting Example of E-frame $SSO\WKHYROWDJHGHVLJQDWHGRQWKHQDPHSODWH IURPWKHSRZHUVRXUFH 6\PPHWULFFXUUHQWVKRXOGEH$UPVRUEHORZ ,IWKHVKRUWFLUFXLWFXUUHQWRQWKHSRZHUVRXUFHH[FHHGV WKLVYDOXHXVHDFXUUHQWOLPLWLQJGHYLFH HJFXUUHQWOLPLWLQJIXVHFXUUHQWOLPLWLQJFLUFXLWEUHDNHURU WUDQVIRUPHU 0DLQV Residual FXUUHQWGHYLFH :LULQJRI0DLQ&RQQHFWRU ;$ &LUFXLW%UHDNHU 0&&% 7RSURWHFWSRZHUVXSSO\OLQHIURPRYHUORDGLQJLQVWDOODZLULQJFLUFXLWEUHDNHUUDWHGWR WKHFDSDFLW\RIWKHSRZHUVXSSO\ :LULQJWR&RQQHFWRU;$ &RQQHFWLRQWRLQSXWSRZHU 3 / 3LQ Noise Filter (NF) 5HPRYHVH[WHUQDOQRLVHIURPWKHSRZHU OLQHV$QGUHGXFHVDQHIIHFWRIWKHQRLVH JHQHUDWHGE\WKHVHUYRGULYHU L2 (Pin-4) 0DJQHWLF&RQWDFWRU 0& 7XUQVRQRIIWKHPDLQSRZHURIWKHVHUYR GULYHU 8VHFRLOVXUJHsuppression unitsWRJHWKHU ZLWKWKLV Never start nor stop the servo motor ZLWKWKLV0DJQHWLF&RQWDFWRU L2C (Pin-1) L3 (Pin-3) L1C (Pin-2) Reactor (L) (to be supplied by customer) 5HGXFHVKDUPRQLFFXUUHQWRIWKHPDLQ SRZHU :LULQJRI0RWRU&RQQHFWRU ;& 3LQ% SLQ % SLQ DQG %SLQ %DQG%WREHNHSWVKRUWHGIRU normal operation. :KHQ\RXFRQQHFWDQH[WHUQDO UHJHQHUDWLYHUHVLVWRUGLVFRQQHFWD VKRUWFLUFXLWZLUHEHWZHHQ%DQG %WKHQFRQQHFWWKHH[WHUQDO UHJHQHUDWLYHUHVLVWRUEHWZHHQ% DQG%VHWXS3UWRRU Note Related page 2-16 :LULQJWR&RQQHFWRU;& 3 &RQQHFWLRQWRH[WHUQDOFRPSRQHQWV B1 (Pin-6) B2 (Pin-4) Regenerative resistor (optional) 5HPDUNV :KHQ\RXXVHDQH[WHUQDOUHJHQHUDWLYHUHVLVWRU install an external protective apparatus, such as thermal fuse without fail. 7KHUPDOIXVHDQGWKHUPRVWDWDUHEXLOWLQWRWKH UHJHQHUDWLYHUHVLVWRU 2SWLRQ If the thermal fuse is activated, it will not resume. 0RXQWWKHUHJHQHUDWLYHUHVLVWRUon incombustible material such as metal. 7KLVRYHUDOOZLULQJGLDJUDPLVDW\SLFDORQH7KHSDJHVWKDWIROORZVKRZZLULQJIRUVSHFLÀF application. The wiring indicated with the broken line shall be provided only when required. 3´2SWLRQVµ 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 1 +LJKYROWDJH PC (to be supplied by customer) :LULQJWR&RQQHFWRU; 0RQLWRURXWSXW 2 3 6HWXSVXSSRUWVRIWZDUH´3$1$7(50µ 3OHDVHGRZQORDGIURPRXUZHEVLWH :LULQJWR&RQQHFWRU; 3 &RQQHFWLRQWR3& 3$1$7(50 :LULQJWR&RQQHFWRU; 3 &RQQHFWLRQWR6DIHW\E\SDVVSOXJ 4 6KRUWFLUFXLWZLUH %% :LULQJWR&RQQHFWRU; 3 3 &RQQHFWLRQWRKRVWFRQWUROOHU :LULQJWR&RQQHFWRU; 3 &RQQHFWLRQWRfeedback scale &KDUJHODPS 5HG/(' *1 Ground terminal Junction cable for encoder 3 Brake cable 5 5HPDUNV ;WR;DUHXVHGIRUWKH VHFRQGDU\FLUFXLW7R FRQQHFWWKHVHWHUPLQDOVWR WKHSULPDU\SRZHUVXSSO\ SDUWLFXODUO\9'& SRZHUVXSSO\IRUEUDNH LQVXODWLRQLVUHTXLUHG 'RQRWFRQQHFWWKHVH WHUPLQDOVWRWKHVDPH SRZHUVXSSO\ DC Power supply for brake DC24V (to be supplied by customer) 7 Related page Supplement 'RQRWPDNHGLVSODFHPHQWZLULQJRULQVSHFWLRQZKLOHWKH/('LVOLWFDXVHRIHOHFWULFVKRFN Note 6 When in Trouble Junction cable for motor &RQQHFWLRQWRPRWRUGULYLQJ phase and ground 3 Adjustment Ground HDUWK :LULQJWR&RQQHFWRU; &RQQHFWLRQWRencoder Setup :LULQJWR&RQQHFWRU;% &RQQHFWLRQWRPRWRU 8SKDVH UHG 9SKDVH ZKLWH :SKDVH EODFN 7KHVHFRORUVDUHXVHG IRURSWLRQDOFDEOH 3 Connection :LULQJWR&RQQHFWRU; 3 &RQQHFWLRQWR5656 RUKRVWFRQWUROOHU Preparation +DQGOHOHYHU 8VHWKLVIRUFRQQHFWRU FRQQHFWLRQ6WRUHWKLV after connection for RWKHURFFDVLRQV 5HIHUWR3for FRQQHFWLRQ Before Using the Products Overall Wiring (E-frame, 200 V type) •7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU • Only for position control type is not provided with X2, X3 and X5. 3´Wiring of the Main Circuit (IUDPH9W\SH µ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ URL: http://industrial.panasonic.com/jp/i/fa_motor.html 2-17 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Wiring of the Main Circuit (E-frame, 200 V type) Preparation E-frame, 200 V type :LULQJVKRXOGEHSHUIRUPHGE\DVSHFLDOLVWRUDQDXWKRUL]HGSHUVRQQHO 'RQRWWXUQRQWKHSRZHUXQWLOWKHZLULQJLVFRPSOHWHG 1HYHUWRXFKWKHSRZHUFRQQHFWRU ;$;%DQG;& WRZKLFKKLJKYROWDJHLVDSSOLHG There is a risk of electric shock. Tips on Wiring 1) Wire connector (XA, XB and XC). 2) Connect the wired connector to the driver. Fully insert the connector to the bottom until it clicks. 3RZHU VXSSO\ 5&' 0&&% 1) L MC 5 4 3 2 1 L1 L2 / L1C L2C XA 4 3 2 1 ([WHUQDOUHJHQHUDWLYH resistor % % % 1& XC U 5HG V :KLWH %ODFN W *UHHQ Motor 3 2 1 U V W ;% E 7KHVHFRORUV DUHXVHGIRU RSWLRQDOFDEOH *URXQGUHVLVWDQFHїPD[ )RUDSSOLFDEOHZLUHUHIHUWR3 DC 24V Varistor Fuse (125 V 10 A) Note Related page 2-18 '&SRZHUVXSSO\ IRUEUDNH &KHFNWKHQDPHSODWHRIWKHGULYHUIRUSRZHU VSHFLILFDWLRQV 3URYLGHDUHVLGXDOFXUUHQWGHYLFH7KHUHVLGXDOFXUUHQW GHYLFHWREHWKHRQHGHVLJQHGIRU,QYHUWHUDQGLV HTXLSSHGZLWKFRXQWHUPHDVXUHVIRUKDUPRQLFV 3URYLGHDFLUFXLWEUHDNHU 0DNHVXUHWRSURYLGHDQRLVHILOWHU 3URYLGHFRLOVXUJHVXSSUHVVLRQXQLWVWRWKHFRLORIWKH 0DJQHWLF&RQWDFWRUUHFRPPHQGHGE\PDQXIDFWXUHU Never start/stop the motor with this Magnetic Contactor. 3URYLGHDQ$&5HDFWRU Connect L1 and L1C, and L3 and L2C at single phase use (100V and 200V), and don't use L2. 'RQ WGLVFRQQHFWWKHVKRUWLQJFDEOHEHWZHHQ%DQG% 'LVFRQQHFWWKLVRQO\ZKHQWKHH[WHUQDOUHJHQHUDWLYH UHJLVWHULVXVHG 'RQRWFRQQHFWDQ\WKLQJWR1& 0DWFKWKHFRORUVRIWKHPRWRUOHDGZLUHVWRWKRVHRIWKH FRUUHVSRQGLQJPRWRURXWSXWWHUPLQDOV 89: Avoid shorting and grounding. Don't connect the main power. Earth-ground this. 7RSUHYHQWHOHFWULFVKRFNEHVXUHWRFRQQHFWWKHJURXQG WHUPLQDO RIWKHGULYHUDQGWKHJURXQGWHUPLQDO JURXQGSODWH RIWKHFRQWUROSDQHO 7KHJURXQGWHUPLQDO PXVWQRWEHVKDUHGZLWKRWKHU HTXLSPHQW 7ZRJURXQGWHUPLQDOVDUHSURYLGHG Don't connect the earth cable to other inserting slot, nor make them touch. &RPSRVHDGXSOH[%UDNH&RQWURO&LUFXLWVRWKDWWKH EUDNHFDQDOVREHDFWLYDWHGE\DQH[WHUQDOLPPHGLDWH VWRSVLJQDO 7KHKROGLQJEUDNHKDVQRSRODULWLHV )RUWKHKROGLQJEUDNHSRZHUVXSSO\FDSDFLW\DQGKRZWR XVHWKHEUDNHUHIHUWR´6SHFLILFDWLRQVRI%XLOWLQ+ROGLQJ %UDNHµRQ3 3URYLGHDYDULVWRU &RQQHFWD$IXVHLQVHULHVZLWKWKHYDULVWRU The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ3´:LULQJPHWKRGWRFRQQHFWRUµ 3´&RQQHFWRUNLWIRU;$µ3´&RQQHFWRUNLWIRU;%;&µ 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ Preparation Wiring Diagram (E-frame, 200 V type) Compose the circuit so that the main circuit power will be shut off when an error occurs. In Case of 3-Phase, E-frame, 200 V type 2 Power supply 3-phase, 200V –15% to 230V +10% OFF ALM MC Built-in thermostat of an external regenerative resistor (light yellow) Preparation ON Noise filter Coil surge suppression units MCCB L MC Red White * These colors Black are used for Green optional cable. 3 Control power supply XC XB Motor connection 4 ALM 37 36 X4 ALM+ Setup Insulated + DC12 to 24V ï (±5%) U V W XA Main power supply Connection Remove the short wire when you connect the external regenerative resistor. Motor L1 L2 L3 L1C L2C B1 B3 B2 NC External regenerative resistor 1 Before Using the Products 2 $/0ï 5 Adjustment 6 When in Trouble 7 Related page Supplement Note The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ3´:LULQJPHWKRGWRFRQQHFWRUµ 2-19 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Preparation Overall Wiring (F-frame, 200 V type) Connecting Example of F-frame $SSO\WKHYROWDJHGHVLJQDWHGRQWKHQDPHSODWH from the power source. 0DLQV Residual current device Symmetric current should be 5000 Arms or below. If the short-circuit current on the power source exceeds this value, use a current-limiting device (e.g. current-limiting fuse, current-limiting circuit breaker or transformer). &RQQHFWLRQZLWKLQSXW SRZHUVXSSO\ :LULQJRI0DLQ&LUFXLW &LUFXLW%UHDNHU 0&&% To protect power supply line from overloading, install a wiring circuit breaker rated to the capacity of the power supply. P.2-22 L1 L2 L3 L1C 1RLVH)LOWHU 1) Removes external noise from the power lines. And reduces an effect of the noise generated by the servo driver. L2C 0DJQHWLF&RQWDFWRU 0& Turns on/off the main power of the servo driver. Use coil surge suppression units together with this. 1HYHUVWDUWQRUVWRSWKHVHUYRPRWRU ZLWKWKLV0DJQHWLF&RQWDFWRU 5HDFWRU / (to be supplied by customer) Reduces harmonic current of the main power. 3LQ%%DQG% %DQG%WREHNHSWVKRUWHG IRUQRUPDORSHUDWLRQ :KHQ\RXFRQQHFWDQH[WHUQDO regenerative resistor, disconnect a short bar between B2 and B3, then connect the external regenerative resistor between B1 and B2, set up Pr0.16 to 1 or 2. 3LQ1& 'RQRWFRQQHFWDQ\WKLQJ Note Related page 2-20 &RQQHFWLRQWRH[WHUQDO FRPSRQHQWV P.2-22 B1 B2 5HJHQHUDWLYHUHVLVWRU RSWLRQDO 5HPDUNV :KHQ\RXXVHDQH[WHUQDOUHJHQHUDWLYHUHVLVWRU LQVWDOODQH[WHUQDOSURWHFWLYHDSSDUDWXVVXFK DVWKHUPDOIXVHZLWKRXWIDLO 7KHUPDOIXVHDQGWKHUPRVWDWDUHEXLOWLQWRWKH regenerative resistor (Option). ,IWKHWKHUPDO IXVHLVDFWLYDWHGLWZLOOQRWUHVXPH 0RXQWWKHUHJHQHUDWLYHUHVLVWRURQ LQFRPEXVWLEOHPDWHULDOVXFKDVPHWDO 7KLVRYHUDOOZLULQJGLDJUDPLVDW\SLFDORQH7KHSDJHVWKDWIROORZVKRZZLULQJIRUVSHFLÀF application. The wiring indicated with the broken line shall be provided only when required. 3´2SWLRQVµ 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 1 : High voltage :LULQJWR&RQQHFWRU; 0RQLWRURXWSXW P.2-60 Before Using the Products Overall Wiring (F-frame, 200 V type) PC (to be supplied by customer) Setup support software ´3$1$7(50µ Please download from our web site. 2 :LULQJWR&RQQHFWRU; P.2-51 &RQQHFWLRQWR5656 or host controller :LULQJWR&RQQHFWRU; 3 P.2-53 :LULQJWR&RQQHFWRU; P.2-54 &RQQHFWLRQWRKRVWFRQWUROOHU :LULQJWR&RQQHFWRU; P.2-55 &RQQHFWLRQWRfeedback scale :LULQJWR&RQQHFWRU; &RQQHFWLRQWRencoder * These colors are used for optional cable. P.2-57 5HPDUNV Ground terminal Charge lamp (Red LED)*1 P.2-22 Junction cable for encoder DC Power supply for brake DC24V (to be supplied by customer) Supplement Related page 6 7 *1 Do not make displacement, wiring or inspection while the LED is lit - cause of electric shock. Note 5 When in Trouble Junction cable for motor &RQQHFWLRQWRPRWRUGULYLQJ SKDVHDQGJURXQG ;WR;DUHXVHGIRUWKHVHFRQGDU\ circuit. To connect these terminals to the primary power supply (particularly, 24 VDC power supply for brake), insulation is required. Do not connect these terminals to the same power supply. Adjustment Junction cable for brake Ground (earth) 4 Setup U-phase(red) V-phase(white) W-phase(black) Connection &RQQHFWLRQWR6DIHW\E\SDVVSOXJ Short circuit wire (B2-B3) Preparation :LULQJWR&RQQHFWRU; P.2-51 &RQQHFWLRQWR3& 3$1$7(50 •7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU • Only for position control type is not provided with X2, X3 and X5. 3´Wiring of the Main Circuit )IUDPH9W\SH µ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ URL: http://industrial.panasonic.com/jp/i/fa_motor.html 2-21 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Wiring of the Main Circuit (F-frame, 200 V type) Preparation F-frame, 200 V type :LULQJVKRXOGEHSHUIRUPHGE\DVSHFLDOLVWRUDQDXWKRUL]HGSHUVRQQHO 'RQRWWXUQRQWKHSRZHUXQWLOWKHZLULQJLVFRPSOHWHG Never touch the terminal to which high voltage is applied. There is a risk of electric shock. Tips on Wiring 7DNHRIIWKHFRYHUÀ[LQJVFUHZVDQGGHWDFKWKHWHUPLQDOFRYHU 2) Make wiring Use clamp type terminals of round shape with insulation cover for wiring to the terminal block. For cable diameter and size, reter to "Driver and List of Applicable Peripheral Equipments" (P.2-10). Tighten the terminal block screw with a torque between 1.0 and 1.7 N P $WWDFKWKHWHUPLQDOFRYHUDQGÀ[ZLWKVFUHZV Tighten the screw securing the cover with a torque written on P.2-11. L1 3RZHU VXSSO\ 5&' MCCB 1) MC L L2 L3 L1C L2C B1 ([WHUQDOUHJHQHUDWLYH UHVLVWRU B3 B2 NC U 5HG :KLWH %ODFN *UHHQ Motor U V V W W E 7KHVHFRORUV DUHXVHGIRU RSWLRQDOFDEOH *URXQGUHVLVWDQFHїPD[ )RUDSSOLFDEOHZLUHUHIHUWR3 DC 24V '&SRZHU VXSSO\ IRUEUDNH Varistor )XVH 9$ Note Related page 2-22 &KHFNWKHQDPHSODWHRIWKHGULYHUIRUSRZHUVSHFLILFDWLRQV 3URYLGHDUHVLGXDOFXUUHQWGHYLFH7KHUHVLGXDOFXUUHQW GHYLFHWREHWKHRQHGHVLJQHGIRU,QYHUWHUDQGLV HTXLSSHGZLWKFRXQWHUPHDVXUHVIRUKDUPRQLFV 3URYLGHDFLUFXLWEUHDNHU 0DNHVXUHWRSURYLGHDQRLVHILOWHU 3URYLGHFRLOVXUJHVXSSUHVVLRQXQLWVWRWKHFRLORIWKH 0DJQHWLF&RQWDFWRUUHFRPPHQGHGE\PDQXIDFWXUHUNever start/stop the motor with this Magnetic Contactor. 3URYLGHDQ$&5HDFWRU 'RQ WGLVFRQQHFWWKHVKRUWEDUEHWZHHQ%DQG% 'LVFRQQHFWWKLVRQO\ZKHQDQH[WHUQDOUHJHQHUDWLYHUHJLVWHU LVXVHG 'RQRWFRQQHFWDQ\WKLQJWR1& 0DWFKWKHFRORUVRIWKHPRWRUOHDGZLUHVWRWKRVHRIWKH FRUUHVSRQGLQJPRWRURXWSXWWHUPLQDOV 89: Avoid shorting and grounding. Don't connect the main power. Earth-ground this. 7RSUHYHQWHOHFWULFVKRFNEHVXUHWRFRQQHFWWKHJURXQG WHUPLQDO RIWKHGULYHUDQGWKHJURXQGWHUPLQDO JURXQG SODWH RIWKHFRQWUROSDQHO 7KHJURXQGWHUPLQDO PXVWQRWEHVKDUHGZLWKRWKHU HTXLSPHQW 7ZRJURXQGWHUPLQDOVDUHSURYLGHG Don't connect the earth cable to other inserting slot, nor make them touch. &RPSRVHDGXSOH[%UDNH&RQWURO&LUFXLWVRWKDWWKHEUDNH FDQDOVREHDFWLYDWHGE\DQH[WHUQDOLPPHGLDWHVWRSVLJQDO 7KHKROGLQJEUDNHKDVQRSRODULWLHV )RUWKHKROGLQJEUDNHSRZHUVXSSO\FDSDFLW\DQGKRZWR XVHWKHEUDNHUHIHUWR´6SHFLILFDWLRQVRI%XLOWLQ+ROGLQJ %UDNHµRQ3 3URYLGHDYDULVWRU &RQQHFWD$IXVHLQVHULHVZLWKWKHYDULVWRU The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ Preparation Wiring Diagram (F-frame, 200 V type) Compose the circuit so that the main circuit power will be shut off when an error occurs. In Case of 3-Phase, F-frame, 200 V type 2 Power supply 3-phase, 200V –15% to 230V +10% OFF ALM MC Built-in thermostat of an external regenerative resistor (light yellow) Preparation ON Noise filter Coil surge suppression units MCCB L MC (Remove the short wire when you connect the external regenerative resistor.) Red White * These colors Black are used for optional cable. Green Motor L1 L2 L3 L1C L2C B1 B3 B2 NC U V W Main power supply 3 Control power supply Motor connection 4 ALM 37 36 X4 ALM+ Setup Insulated + DC12 to 24V ï (±5%) Terminal block Connection External regenerative resistor 1 Before Using the Products 2 $/0ï 5 Adjustment 6 When in Trouble 7 Related page Supplement Note The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 2-23 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Preparation Overall Wiring (G-frame, 200 V type) Connecting Example of G-frame $SSO\WKHYROWDJHGHVLJQDWHGRQWKHQDPHSODWH from the power source. 0DLQV Residual current device Symmetric current should be 5000 Arms or below. If the short-circuit current on the power source exceeds this value, use a current-limiting device (e.g. current-limiting fuse, current-limiting circuit breaker or transformer). &RQQHFWLRQZLWKLQSXW SRZHUVXSSO\ :LULQJRI0DLQ&LUFXLW &LUFXLW%UHDNHU 0&&% To protect power supply line from overloading, install a wiring circuit breaker rated to the capacity of the power supply. L1C 1RLVH)LOWHU 1) Removes external noise from the power lines. And reduces an effect of the noise generated by the servo driver. L2 P.2-26 L2C L1 L3 0DJQHWLF&RQWDFWRU 0& Turns on/off the main power of the servo driver. Use coil surge suppression units together with this. 1HYHUVWDUWQRUVWRSWKHVHUYRPRWRUZLWKWKLV 0DJQHWLF&RQWDFWRU 5HDFWRU / (to be supplied by customer) Reduces harmonic current of the main power. &RQQHFWLRQWRH[WHUQDOFRPSRQHQWVP.2-26 B1 B2 5HJHQHUDWLYHUHVLVWRU(optional) 5HPDUNV :KHQ\RXXVHDQH[WHUQDOUHJHQHUDWLYHUHVLVWRU LQVWDOODQH[WHUQDOSURWHFWLYHDSSDUDWXVVXFK DVWKHUPDOIXVHZLWKRXWIDLO. 7KHUPDOIXVHDQGWKHUPRVWDWDUHEXLOWLQWRWKH regenerative resistor (Option). ,IWKHWKHUPDOIXVH LVDFWLYDWHGLWZLOOQRWUHVXPH 0RXQWWKHUHJHQHUDWLYHUHVLVWRURQLQFRPEXVWLEOH PDWHULDOVXFKDVPHWDO. 1RWH The wiring indicated with the broken line shall be provided only when required. Note Related page 2-24 3LQ%DQG% :KHQ\RXFRQQHFWDQH[WHUQDOUHJHQHUDWLYH resistor, connect the external regenerative resistor between B1 and B2, set up Pr0.16 to 1 or 2. 3LQ'%'%'%DQG'% ・ 1RUPDOO\OHDYH'%DQG'%VKRUWFLUFXLWHG ・ To connect the external dynamic brake resistor, UHIHUWR´'\QDPLF%UDNHµRQ3'RQRWXVH WKHH[WHUQDOG\QDPLFEUDNHUHVLVWRUWRJHWKHU ZLWKWKHEXLOWLQUHVLVWRU 3LQ1& 'RQRWFRQQHFWDQ\WKLQJ 7KLVRYHUDOOZLULQJGLDJUDPLVDW\SLFDORQH7KHSDJHVWKDWIROORZVKRZZLULQJIRUVSHFLÀF application. The wiring indicated with the broken line shall be provided only when required. 3´2SWLRQVµ 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 1 : High voltage Before Using the Products Overall Wiring (G-frame, 200 V type) PC (to be supplied by customer) 2 P.2-60 6HWXSVXSSRUWVRIWZDUH´3$1$7(50µ Please download from our web site. :LULQJWR&RQQHFWRU; Preparation :LULQJWR&RQQHFWRU; 0RQLWRURXWSXW P.2-51 &RQQHFWLRQWR3& 3$1$7(50 ワヤ L1 ヹヒ ロヒヤ ヹビ L2 ロ ビヤ ヹピ L3 ワヤ :LULQJWR&RQQHFWRU; P.2-53 &RQQHFWLRQWR6DIHW\E\SDVVSOXJ 3 Connection :LULQJWR&RQQHFWRU; P.2-51 &RQQHFWLRQWR5656 or host controller ワヤ B1 ヹフ ュャヒ :LULQJWR&RQQHFWRU; P.2-54 &RQQHFWLRQWRKRVWFRQWUROOHU B2 ュャビ NC U-phase ワヤ V-phase ヹプ ュャピ V :-phase ュャフ :LULQJWR&RQQHFWRU; &RQQHFWLRQWRencoder W ワヤ ヤラモンヨユ P. Junction cable for encoder 5 Short bar (DB3-DB4) Charge lamp (LED) Do not make displacement, wiring or inspection while the LED is lit - cause of electric shock. Ground (earth) 0RWRUFDEOH 6KLHOGZLUH &RQQHFWLRQWRPRWRUGULYLQJ SKDVHDQGJURXQG 5HPDUNV ;WR;DUHXVHGIRUWKHVHFRQGDU\ circuit. To connect these terminals to the primary power supply (particularly, 24 VDC power supply for brake), insulation is required. Do not connect these terminals to the same power supply. DC Power supply for brake DC24V (to be supplied by customer) 7 Supplement Related page 6 When in Trouble Brake cable P.2-26 Adjustment Ground terminal Setup :LULQJWR&RQQHFWRU; P.2-55 &RQQHFWLRQWRfeedback scale ヹブ U Note 4 ワヤ •7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHG 3´Wiring of the Main Circuit *IUDPH9W\SH µ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ URL: http://industrial.panasonic.com/jp/i/fa_motor.html 2-25 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Wiring of the Main Circuit (G-frame, 200 V type) Preparation G-frame, 200 V type :LULQJVKRXOGEHSHUIRUPHGE\DVSHFLDOLVWRUDQDXWKRUL]HGSHUVRQQHO 'RQRWWXUQRQWKHSRZHUXQWLOWKHZLULQJLVFRPSOHWHG Never touch the terminal to which high voltage is applied. There is a risk of electric shock. Tips on Wiring 7DNHRIIWKHFRYHUÀ[LQJVFUHZVDQGGHWDFKWKHWHUPLQDOFRYHU 2) Make wiring Use clamp type terminals of round shape with insulation cover for wiring to the terminal block. For cable diameter and size, reter to "Driver and List of Applicable Peripheral Equipments" (P.2-11). Tighten the terminal block screw with a torque between 2.0 and 2.4 1 m (left side) and 1.0 and 1.7 1 m (right side). $WWDFKWKHWHUPLQDOFRYHUDQGÀ[ZLWKVFUHZV Tighten the screw securing the cover with the torque written on P.2-11. NC L1C L2C 3RZHU 5&' MCCB VXSSO\ 1) MC U V W E L L1 NC L2 NC L3 DB1 B1 DB2 B2 NC NC NC U DB3 V DB4 W NC /HIW VLGH 5LJKW VLGH Motor *URXQGUHVLVWDQFHїPD[ )RUDSSOLFDEOHZLUHUHIHUWR3 DC 24V '&SRZHU VXSSO\ IRUEUDNH Varistor )XVH 9$ Note Related page 2-26 &KHFNWKHQDPHSODWHRIWKHGULYHUIRUSRZHU VSHFLILFDWLRQV 3URYLGHDUHVLGXDOFXUUHQWGHYLFH7KHUHVLGXDOFXUUHQW GHYLFHWREHWKHRQHGHVLJQHGIRU,QYHUWHUDQGLV HTXLSSHGZLWKFRXQWHUPHDVXUHVIRUKDUPRQLFV 3URYLGHDFLUFXLWEUHDNHU 0DNHVXUHWRSURYLGHDQRLVHILOWHU 3URYLGHFRLOVXUJHVXSSUHVVLRQXQLWVWRWKHFRLORIWKH 0DJQHWLF&RQWDFWRUUHFRPPHQGHGE\PDQXIDFWXUHUNever start/stop the motor with this Magnetic Contactor. 3URYLGHDQ$&5HDFWRU WREHVXSSOLHGE\FXVWRPHU 7KHYROWDJHDSSOLHGDFURVV'%DQG'%PXVWEH9$& RUEHORZRU9'&RUEHORZ 0DWFKWKHFRQQHFWRURIWKHPRWRUDQGGULYHU´89:µ Avoid shorting and grounding. Don't connect the main power. )RUQRUPDORSHUDWLRQGRQRWGLVFRQQHFWWKHVKRUWLQJEDU IURP'%DQG'%UHPRYHWKHEDURQO\ZKHQWKHH[WHUQDO G\QDPLFEUDNHUHVLVWRULVXVHG Earth-ground this. 7RSUHYHQWHOHFWULFVKRFNEHVXUHWRFRQQHFWWKHJURXQG WHUPLQDO RIWKHGULYHUDQGWKHJURXQGWHUPLQDO JURXQG SODWH RIWKHFRQWUROSDQHO 7KHJURXQGWHUPLQDO PXVWQRWEHVKDUHGZLWKRWKHU HTXLSPHQW 7ZRJURXQGWHUPLQDOVDUHSURYLGHG Don't connect the earth cable to other inserting slot, nor make them touch. &RPSRVHDGXSOH[%UDNH&RQWURO&LUFXLWVRWKDWWKHEUDNH FDQDOVREHDFWLYDWHGE\DQH[WHUQDOLPPHGLDWHVWRSVLJQDO 7KHKROGLQJEUDNHKDVQRSRODULWLHV )RUWKHKROGLQJEUDNHSRZHUVXSSO\FDSDFLW\DQGKRZWR XVHWKHEUDNHUHIHUWR´6SHFLILFDWLRQVRI%XLOWLQ+ROGLQJ %UDNHµRQ3 3URYLGHDYDULVWRU &RQQHFWD$IXVHLQVHULHVZLWKWKHYDULVWRU * Do not connect anything to NC. The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Wiring Diagram (G-frame, 200 V type) Preparation Compose the circuit so that the main circuit power will be shut off when an error occurs. In Case of 3-Phase, G-frame, 200 V type 2 Power supply 3-phase, 200V –15% to 230V +10% ALM OFF MC1 Built-in thermostat of an external regenerative resistor (light yellow) Preparation ON Coil surge suppression units L Noise filter MCCB Power supply (3-phase) 1 Before Using the Products 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 MC1 External regenerative resistor Main power supply 3 Control power supply Connection Note 1) L1 L2 L3 L1C L2C B1 B2 NC DB1 DB2 DB3 DB4 U V W Motor connection 4 Motor 37 36 ALM+ Setup Insulated + DC12 to 24V ï (±5%) ALM ALM− Note 1) Normally, do not disconnect the shorting bar. 5 Adjustment 6 When in Trouble 7 Related page Supplement Note The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 2-27 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Preparation Overall Wiring (H-frame, 200 V type) Connecting Example of H-frame $SSO\WKHYROWDJHGHVLJQDWHGRQWKHQDPHplate from the power source. Mains Residual current device Symmetric current should be 5000 Arms or below. If the short-circuit current on the power source exceeds this value, use a current-limiting device (e.g. current-limiting fuse, current-limiting circuit breaker or transformer). :LULQJRI0DLQ&LUFXLW &LUFXLW%UHDNHU 0&&% To protect power supply line from overloading, install a wiring circuit breaker rated to the capacity of the power supply. Charge lamp (LED) Do not make displacement, wiring or inspection while the LED is lit - cause of electric shock. 1RLVH)LOWHU 1) Removes external noise from the power lines. And reduces an effect of the noise generated by the servo driver. 0DJQHWLF&RQWDFWRU 0& Turns on/off the main power of the servo driver. Use coil surge suppression units together with this. 1HYHUVWDUWQRUVWRSWKHVHUYRPRWRUZLWKWKLV 0DJQHWLF&RQWDFWRU L2C 5HDFWRU / (to be supplied by customer) Reduces harmonic current of the main power. 9'& SRZHUVXSSO\IRU UHJHQHUDWLYHUHVLVWRU to be supplied by customer ( ) L1 L2 L3 &RQQHFWLRQWRH[WHUQDO FRPSRQHQWV Related page 2-28 P.2-30 P.2-30 B2 5HJHQHUDWLYHUHVLVWRU (optional) :KHQ\RXXVHDQH[WHUQDOUHJHQHUDWLYH resistor, LQVWDOODQH[WHUQDOSURWHFWLYH DSSDUDWXVVXFKDVWKHUPDOIXVHZLWKRXW IDLO. 7KHUPDOIXVHDQGWKHUPRVWDWDUHEXLOWLQWRWKH regenerative resistor (Option). ,IWKHWKHUPDO IXVHLVDFWLYDWHGLWZLOOQRWUHVXPH 0RXQWWKHUHJHQHUDWLYHUHVLVWRURQ LQFRPEXVWLEOHPDWHULDOVXFKDVPHWDO. )RUZLULQJRIWKHFLUFXLWUHIHUWR´:LULQJ Diagram” on P.2-31. Note &RQQHFWLRQZLWKLQSXW SRZHUVXSSO\ B1 * Use a power supply with 5 A or larger capacity. 5HPDUNV L1C 0DJQHWLF&RQWDFWRU 0& '\QDPLF%UDNH UHVLVWRU be supplied by (tocustomer ) Turns on/off the dynamic brake resistor. Use coil surge suppression units together with this. 5HPDUNV :KHQ\RXXVHDQH[WHUQDOG\QDPLFEUDNHUHVLVWRULQVWDOODQ H[WHUQDOSURWHFWLYHDSSDUDWXVVXFKDVWKHUPDOIXVH ZLWKRXWIDLO 0RXQWWKHG\QDPLFEUDNHUHVLVWRURQLQFRPEXVWLEOHPDWHULDO VXFKDVPHWDO )RUZLULQJRIWKHFLUFXLWUHIHUWR´:LULQJ'LDJUDPµRQ3 )RUDQH[DPSOHRIWKHUHFRPPHQGHGSURWHFWLYHFLUFXLWUHIHUWR “Dynamic Brake” on P.2-67. 7KLVRYHUDOOZLULQJGLDJUDPLVDW\SLFDORQH7KHSDJHVWKDWIROORZVKRZZLULQJIRUVSHFLÀF application. The wiring indicated with the broken line shall be provided only when required. 3´2SWLRQVµ 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 1 : High voltage :LULQJWR&RQQHFWRU; P.2-60 0RQLWRURXWSXW Before Using the Products Overall Wiring (H-frame, 200 V type) PC(to be supplied by customer) Setup support software “PANATERM” Please download from our web site. 2 ヹビ Preparation :LULQJWR&RQQHFWRU; P.2-51 &RQQHFWLRQWR3& 3$1$7(50 ヹヒ ヹピ :LULQJWR&RQQHFWRU; P.2-51 &RQQHFWLRQWR5656 or host controller ヹフ 3 ヹブ ヤラモンヨユ :LULQJWR&RQQHFWRU; P.2-54 &RQQHFWLRQWRKRVWFRQWUROOHU :LULQJWR&RQQHFWRU; P.2-55 &RQQHFWLRQWRfeedback scale L1C L2 L3 B1 DB1 DB2 B2 NC U V W Junction cable for encoder Ground terminal Motor cable (Shield wire) &RQQHFWLRQWRPRWRUGULYLQJ SKDVHDQGJURXQG 5 3LQ%DQG% P.2-30 :KHQ\RXFRQQHFWDQH[WHUQDOUHJHQHUDWLYH resistor, connect the external regenerative resistor between B1 and B2, set up Pr0.16 to 1 or 2. 3LQ'%DQG'% :KHQLQVWDOOLQJDQH[WHUQDOG\QDPLFEUDNH resistor, connect the magnetic contactor (for controlling) for external dynamic brake to between LIC and DB1. 5HPDUNV DC Power supply for brake DC24V (to be supplied by customer) Related page 7 3LQ1& 'RQRWFRQQHFWDQ\WKLQJ Supplement Note 7KHYROWDJHDSSOLHGDFURVV'%DQG '%PXVWEH9$&RUEHORZRU 9'&RUEHORZ 6 When in Trouble Brake cable 5HPDUNV ;WR;DUHXVHGIRUWKHVHFRQGDU\FLUFXLW To connect these terminals to the primary power supply (particularly, the 24 VDC power supply for brake and the 24 VDC power supply for regenerative resistor), insulation is required. Do not connect these terminals to the same power supply. Adjustment Ground (earth) U-phase V-phase W-phase 4 P.2-57 Setup L1 L2C :LULQJWR&RQQHFWRU; &RQQHFWLRQWRencoder Connection :LULQJWR&RQQHFWRU; P.2-53 &RQQHFWLRQWR6DIHW\E\SDVVSOXJ ヹプ •7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHG 3´Wiring of the Main Circuit +IUDPH9W\SH µ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ URL: http://industrial.panasonic.com/jp/i/fa_motor.html 2-29 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Wiring of the Main Circuit (H-frame, 200 V type) Preparation H-frame, 200 V type :LULQJVKRXOGEHSHUIRUPHGE\DVSHFLDOLVWRUDQDXWKRUL]HGSHUVRQQHO 'RQRWWXUQRQWKHSRZHUXQWLOWKHZLULQJLVFRPSOHWHG Never touch the terminal to which high voltage is applied. There is a risk of electric shock. Tips on Wiring 7DNHRIIWKHFRYHUÀ[LQJVFUHZVDQGGHWDFKWKHWHUPLQDOFRYHU 2) Make wiring Use clamp type terminals of round shape with insulation cover for wiring to the terminal block. For cable diameter and size, reter to "Driver and List of Applicable Peripheral Equipments" (P.2-11). Tighten the terminal block screw with a torque between 0.7 and 0.8 1 m (upper side) and 2.2 and 2.5 1 m (lower side). $WWDFKWKHWHUPLQDOFRYHUDQGÀ[ZLWKVFUHZV Tighten the screw securing the cover with the torque written on P.2-11. Upper VLGH L1C L2C Power 5&' MCCB supply 1) MC L L1 DB1 L2 DB2 L3 DC 24V 3RZHUVXSSO\IRU UHJHQHUDWLYHUHVLVWRU B1 B2 NC U V W E U V W Lower VLGH Motor *URXQGUHVLVWDQFHїPD[ )RUDSSOLFDEOHZLUHUHIHUWR3 DC 24V DC power supply IRUEUDNH Varistor )XVH 9$ Note Related page 2-30 &KHFNWKHQDPHSODWHRIWKHGULYHUIRUSRZHU VSHFLILFDWLRQV 3URYLGHDUHVLGXDOFXUUHQWGHYLFH7KHUHVLGXDOFXUUHQW GHYLFHWREHWKHRQHGHVLJQHGIRU,QYHUWHUDQGLV HTXLSSHGZLWKFRXQWHUPHDVXUHVIRUKDUPRQLFV 3URYLGHDFLUFXLWEUHDNHU 0DNHVXUHWRSURYLGHDQRLVHILOWHU 3URYLGHFRLOVXUJHVXSSUHVVLRQXQLWVWRWKHFRLORIWKH 0DJQHWLF&RQWDFWRUUHFRPPHQGHGE\PDQXIDFWXUHU Never start/stop the motor with this Magnetic Contactor. 7KHYROWDJHDSSOLHGDFURVV'%DQG'%PXVWEH 9$&RUEHORZRU9'&RUEHORZ 3URYLGHDQ$&5HDFWRU WREHVXSSOLHGE\FXVWRPHU 'RQRWFRQQHFWDQ\WKLQJWR1& 0DWFKWKHFRQQHFWRURIWKHPRWRUDQGGULYHU“U, V, W” Avoid shorting and grounding. Don't connect the main power. Earth-ground this. 7RSUHYHQWHOHFWULFVKRFNEHVXUHWRFRQQHFWWKHJURXQG WHUPLQDO RIWKHGULYHUDQGWKHJURXQGWHUPLQDO JURXQGSODWH RIWKHFRQWUROSDQHO 7KHJURXQGWHUPLQDO PXVWQRWEHVKDUHGZLWKRWKHU HTXLSPHQW 7ZRJURXQGWHUPLQDOVDUHSURYLGHG Don't connect the earth cable to other inserting slot, nor make them touch. &RPSRVHDGXSOH[%UDNH&RQWURO&LUFXLWVRWKDWWKH EUDNHFDQDOVREHDFWLYDWHGE\DQH[WHUQDOLPPHGLDWH VWRSVLJQDO 7KHKROGLQJEUDNHKDVQRSRODULWLHV )RUWKHKROGLQJEUDNHSRZHUVXSSO\FDSDFLW\DQGKRZWR XVHWKHEUDNHUHIHUWR´6SHFLILFDWLRQVRI%XLOWLQ+ROGLQJ %UDNHµRQ3 3URYLGHDYDULVWRU &RQQHFWD$IXVHLQVHULHVZLWKWKHYDULVWRU The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Wiring Diagram (H-frame, 200 V type) Preparation Compose the circuit so that the main circuit power will be shut off when an error occurs. In Case of 3-Phase, H-frame, 200 V type 2 Power supply 3-phase, 200V –15% to 230V +10% OFF ALM MC1 Coil surge suppression units L Noise filter MCCB Power supply (3-phase) MC1 Insulated + DC24V ï Note 1) MC2 External R1 regenerative resistor R2 Note 4) Coil surge suppression units Note 2) Note 5) Note 5) Note 5) Dynamic Brake resistor Note 3) MC2 Motor Note 4) Main power supply 3 Control power supply Connection L1 L2 L3 L1C L2C B1 B2 NC DB1 DB2 U V W Built-in thermostat of an external regenerative resistor (T1 and T2 terminals) Preparation ON Motor connection 4 ALM 37 36 ALM+ ALM− Setup Insulated + DC12 to 24V ï (±5%) Note 1) Magnetic contactor MC2 must be the same rating as the contactor MC1 in the main circuit. 5 Adjustment Note 2) Servo may be turned on in the external sequence if the contact deposits: to protect the system, provide the auxiliary contact. Note 3) Use 1.2 ї, 400 W resistor (to be supplied by customer). Note 4) To use the external dynamic brake resistor: Connect the R1 and R2 terminals to B1 and B2. Connect the T1 and T2 terminals as shown in the left diagram. Connect the 24 V and 0 V terminals to a 24 VDC power supply. Connect the E terminal to the ground. Refer to P.7-122 “Options” for the specifications of the external regenerative resistor. Note 5) Provide an external protective device (e.g. thermal fuse) to monitor the temperature of the external dynamic brake resistor. 7 Supplement Related page 6 When in Trouble Note 1 Before Using the Products 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 2-31 2 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ Preparation Overall Wiring (D, E-frame, 400 V type) Connecting Example of D, E-frame $SSO\WKHYROWDJHGHVLJQDWHGRQWKHQDPHSODWH from the power source. Symmetric current should be 5000 Arms or below. If the short-circuit current on the power source exceeds this value, use a current-limiting device (e.g. current-limiting fuse, current-limiting circuit breaker or transformer). :LULQJRI0DLQ&RQQHFWRU ;$ &LUFXLW%UHDNHU 0&&% To protect power supply line from overloading, install a wiring circuit breaker rated to the capacity of the power supply. 1RLVH)LOWHU 1) Removes external noise from the power lines. And reduces an effect of the noise generated by the servo driver. 0DLQV Residual current device * Use a power supply with 2 A or larger capacity. 9'&SRZHUVXSSO\ IRUFRQWURO (to be supplied by customer) 24V 0V :LULQJWR&RQQHFWRU;' P.2-34 &RQQHFWLRQWRcontrol power :LULQJWR&RQQHFWRU;$ P.2-34 &RQQHFWLRQWRLQSXWSRZHU L1 (Pin-3) L2 (Pin-2) L3 (Pin-1) 0DJQHWLF&RQWDFWRU 0& Turns on/off the main power of the servo driver. Use coil surge suppression units together with this. 1HYHUVWDUWQRUVWRSWKHVHUYRPRWRU ZLWKWKLV0DJQHWLF&RQWDFWRU 5HDFWRU / (to be supplied by customer) Reduces harmonic current of the main power. :LULQJRI0RWRU&RQQHFWRU ;& 3LQ% SLQ % SLQ DQG% SLQ %DQG%WREHNHSWVKRUWHGIRUQRUPDO RSHUDWLRQ :KHQ\RXFRQQHFWDQH[WHUQDOUHJHQHUDWLYH resistor, disconnect a short circuit wire between B2 and B3, then connect the external regenerative resistor between B1 and B2, set up Pr0.16 to 1 or 2. 5HPDUNV Note Related page 2-32 :LULQJWR&RQQHFWRU;& P.2-34 &RQQHFWLRQWRH[WHUQDOFRPSRQHQWV B1 (Pin-4) B2 (Pin-2) 5HJHQHUDWLYHUHVLVWRU(optional) :KHQ\RXXVHDQH[WHUQDOUHJHQHUDWLYHUHVLVWRU LQVWDOODQH[WHUQDOSURWHFWLYHDSSDUDWXVVXFK DVWKHUPDOIXVHZLWKRXWIDLO 7KHUPDOIXVHDQGWKHUPRVWDWDUHEXLOWLQWRWKH regenerative resistor (Option). ,IWKHWKHUPDOIXVH LVDFWLYDWHGLWZLOOQRWUHVXPH 0RXQWWKHUHJHQHUDWLYHUHVLVWRURQLQFRPEXVWLEOH PDWHULDOVXFKDVPHWDO 7KLVRYHUDOOZLULQJGLDJUDPLVDW\SLFDORQH7KHSDJHVWKDWIROORZVKRZZLULQJIRUVSHFLÀF application. The wiring indicated with the broken line shall be provided only when required. 3´2SWLRQVµ 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 1 : High voltage :LULQJWR&RQQHFWRU; P.2-60 0RQLWRURXWSXW PC (to be supplied by customer) Setup support software ´3$1$7(50µ Please download from our web site. :LULQJWR&RQQHFWRU; 2 P.2-51 &RQQHFWLRQWR3& 3$1$7(50 :LULQJWR&RQQHFWRU; Preparation Handle lever Use this for connector connection. Store this after connection for other occasions. (Refer to P.2-50 for connection.) Before Using the Products Overall Wiring (D, E-frame, 400 V type) P.2-51 &RQQHFWLRQWR5656 or host controller 3 :LULQJWR&RQQHFWRU; P.2-54 &RQQHFWLRQWRKRVWFRQWUROOHU Connection :LULQJWR&RQQHFWRU; P.2-53 &RQQHFWLRQWR6DIHW\E\SDVVSOXJ Short circuit wire (B2-B3) :LULQJWR&RQQHFWRU;% &RQQHFWLRQWRPRWRU :LULQJWR&RQQHFWRU; P.2-55 &RQQHFWLRQWRfeedback scale P.2-34 :LULQJWR&RQQHFWRU; &RQQHFWLRQWRencoder P.2-57 Setup U-phase(red) V-phase(white) :SKDVH EODFN 4 5HPDUNV Ground terminal Ground (earth) Charge lamp (Red LED)*1 Brake cable 6 P.2-34 When in Trouble 0RWRUFDEOH 6KLHOGZLUH &RQQHFWLRQWRPRWRUGULYLQJ SKDVHDQGJURXQG DC Power supply for brake DC24V (to be supplied by customer) 7 Related page Supplement *1 Do not make displacement, wiring or inspection while the LED is lit - cause of electric shock. Note 5 Adjustment Junction cable for encoder ;WR;DUHXVHGIRUWKHVHFRQGDU\ circuit. To connect these terminals to the primary power supply (particularly, the 24 VDC power supply for control and the 24 VDC power supply for brake), insulation is required. Do not connect these terminals to the same power supply. •7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU • Only for position control type is not provided with X2, X3 and X5. 3´Wiring of the Main Circuit '(IUDPH9W\SH µ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ URL: http://industrial.panasonic.com/jp/i/fa_motor.html 2-33 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Wiring of the Main Circuit (D, E-frame, 400 V type) Preparation D, E-frame, 400 V type :LULQJVKRXOGEHSHUIRUPHGE\DVSHFLDOLVWRUDQDXWKRUL]HGSHUVRQQHO 'RQRWWXUQRQWKHSRZHUXQWLOWKHZLULQJLVFRPSOHWHG 1HYHU WRXFK WKH SRZHU FRQQHFWRU ;$ ;% ;& DQG ;' WR ZKLFK KLJK YROWDJH LV DSplied. There is a risk of electric shock. Tips on Wiring 1) Wire connector (XA, XB, XC and XD). 2) Connect the wired connector to the driver. Fully insert the connector to the bottom until it clicks. 2 1 DC 24V Power RCD MCCB supply NF MC L 3 2 1 4 3 2 1 Yellow (X2) W Black *UHHQ or *UHHQ/ Yellow Motor L1 L2 / XA B1 % B2 N 3 2 1 V :KLWH 0V XD XC U Red 24V U V W XB E 7KHVHFRORUV DUHXVHGIRU RSWLRQDOFDEOH *URXQGUHVLVWDQFHїPD[ )RUDSSOLFDEOHZLUHUHIHUWR3 DC 24V Varistor Fuse (125 V 10 A) Note Related page 2-34 DC power supply IRUEUDNH 'LUHFWSRZHUVXSSO\IRUFRQWUROFLUFXLW &KHFNWKHQDPHSODWHRIWKHGULYHUIRUSRZHU VSHFLILFDWLRQV 3URYLGHDUHVLGXDOFXUUHQWGHYLFH7KHUHVLGXDOFXUUHQW GHYLFHWREHWKHRQHGHVLJQHGIRU,QYHUWHUDQGLV HTXLSSHGZLWKFRXQWHUPHDVXUHVIRUKDUPRQLFV 3URYLGHDFLUFXLWEUHDNHU 0DNHVXUHWRSURYLGHDQRLVHILOWHU 3URYLGHFRLOVXUJHVXSSUHVVLRQXQLWVWRWKHFRLORIWKH 0DJQHWLF&RQWDFWRUUHFRPPHQGHGE\PDQXIDFWXUHU Never start/stop the motor with this Magnetic Contactor. 3URYLGHDQ$&5HDFWRU $&SKDVHSRZHUVXSSO\9IRUPDLQFLUFXLW 'RQ WGLVFRQQHFWWKHVKRUWLQJFDEOHEHWZHHQ%DQG %'LVFRQQHFWWKLVRQO\ZKHQWKHH[WHUQDO UHJHQHUDWLYHUHJLVWHULVXVHG 'RQRWFRQQHFWDQ\WKLQJWR1 0DWFKWKHFRORUVRIWKHPRWRUOHDGZLUHVWRWKRVHRIWKH FRUUHVSRQGLQJPRWRURXWSXWWHUPLQDOV 89: Avoid shorting and grounding. Don't connect the main power. Earth-ground this. 7RSUHYHQWHOHFWULFVKRFNEHVXUHWRFRQQHFWWKH JURXQGWHUPLQDO RIWKHGULYHUDQGWKHJURXQG WHUPLQDO JURXQGSODWH RIWKHFRQWUROSDQHO 7KHJURXQGWHUPLQDO PXVWQRWEHVKDUHGZLWKRWKHU HTXLSPHQW 7ZRJURXQGWHUPLQDOVDUHSURYLGHG Don't connect the earth cable to other inserting slot, nor make them touch. &RPSRVHDGXSOH[%UDNH&RQWURO&LUFXLWVRWKDWWKH EUDNHFDQDOVREHDFWLYDWHGE\DQH[WHUQDOLPPHGLDWH VWRSVLJQDO 7KHKROGLQJEUDNHKDVQRSRODULWLHV )RUWKHKROGLQJEUDNHSRZHUVXSSO\FDSDFLW\DQGKRZ WRXVHWKHEUDNHUHIHUWR´6SHFLILFDWLRQVRI%XLOWLQ +ROGLQJ%UDNHµRQ3 3URYLGHDYDULVWRU &RQQHFWD$IXVHLQVHULHVZLWKWKHYDULVWRU The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ3´:LULQJPHWKRGWRFRQQHFWRUµ 3´&RQQHFWRUNLWIRU;$µ3´&RQQHFWRUNLWIRU;%;&µ3´&RQQHFWRUNLWIRU;'µ Preparation Wiring Diagram (D, E-frame, 400 V type) Compose the circuit so that the main circuit power will be shut off when an error occurs. In Case of 3-Phase, D, E-frame, 400 V type 2 Power supply 3-phase, 380V –15% to 480V +10% OFF ALM MC Built-in thermostat of an external regenerative resistor (light yellow) Coil surge suppression units Insulated + XD Note 1) 24V 0V ï MCCB L Noise filter DC24V L1 L2 L3 (Remove the short wire when you connect the external regenerative resistor.) U V W XA 3 Main power supply XC XB Motor connection 4 ALM 37 36 ALM+ X4 Setup Insulated + DC12 to 24V ï (±5%) Control power supply Connection B1 B3 B2 N External regenerative resistor Motor Preparation ON 1 Before Using the Products 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 $/0ï Note 1) Shielding the circuit is recommended for the purpose of noise reduction. 5 Adjustment 6 When in Trouble 7 Related page Supplement Note The wiring indicated with the broken line shall be provided only when required. 3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ3´:LULQJPHWKRGWRFRQQHFWRUµ 2-35 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Preparation Overall Wiring (F-frame, 400 V type) Connecting Example of F-frame $SSO\WKHYROWDJHGHVLJQDWHGRQWKHQDPHSODWH from the power source. Symmetric current should be 5000 Arms or below. If the short-circuit current on the power source exceeds this value, use a current-limiting device (e.g. current-limiting fuse, current-limiting circuit breaker or transformer). 0DLQV Residual current device * Use a power supply with 2 A or larger capacity. 9'&SRZHUVXSSO\ IRUFRQWURO (to be supplied by customer) 24V 0V :LULQJRI0DLQ&LUFXLW &LUFXLW%UHDNHU 0&&% To protect power supply line from overloading, install a wiring circuit breaker rated to the capacity of the power supply. 1RLVH)LOWHU 1) Removes external noise from the power lines. And reduces an effect of the noise generated by the servo driver. &RQQHFWLRQZLWKFRQWURO SRZHUVXSSO\ 3 &RQQHFWLRQZLWKLQSXW SRZHUVXSSO\ 3 / L2 / 0DJQHWLF&RQWDFWRU 0& Turns on/off the main power of the servo driver. Use coil surge suppression units together with this. 1HYHUVWDUWQRUVWRSWKHVHUYRPRWRU ZLWKWKLV0DJQHWLF&RQWDFWRU 5HDFWRU / (to be supplied by customer) Reduces harmonic current of the main power. 3LQ%%DQG% %DQG%WREHNHSWVKRUWHGIRU normal operation. :KHQ\RXFRQQHFWDQH[WHUQDO regenerative resistor, disconnect a VKRUWEDUEHWZHHQ%DQG% then connect the external regenHUDWLYHUHVLVWRUEHWZHHQ%DQG %VHWXS3UWRRU 3LQ1& 'RQRWFRQQHFWDQ\WKLQJ Note Related page 2-36 &RQQHFWLRQWRH[WHUQDO FRPSRQHQWV 3 % % 5HJHQHUDWLYHUHVLVWRU RSWLRQDO 5HPDUNV :KHQ\RXXVHDQH[WHUQDOUHJHQHUDWLYHUHVLVWRU LQVWDOODQH[WHUQDOSURWHFWLYHDSSDUDWXVVXFK DVWKHUPDOIXVHZLWKRXWIDLO 7KHUPDOIXVHDQGWKHUPRVWDWDUHEXLOWLQWRWKH regenerative resistor (Option). ,IWKHWKHUPDOIXVH LVDFWLYDWHGLWZLOOQRWUHVXPH 0RXQWWKHUHJHQHUDWLYHUHVLVWRURQLQFRPEXVWLEOH PDWHULDOVXFKDVPHWDO 7KLVRYHUDOOZLULQJGLDJUDPLVDW\SLFDORQH7KHSDJHVWKDWIROORZVKRZZLULQJIRUVSHFLÀF application. The wiring indicated with the broken line shall be provided only when required. 3´2SWLRQVµ 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 1 : High voltage Before Using the Products Overall Wiring (F-frame, 400 V type) PC (to be supplied by customer) 2 P.2-60 6HWXSVXSSRUWVRIWZDUH´3$1$7(50µ Please download from our web site. :LULQJWR&RQQHFWRU; Preparation :LULQJWR&RQQHFWRU; 0RQLWRURXWSXW P. &RQQHFWLRQWR3& 3$1$7(50 3 :LULQJWR&RQQHFWRU; P. &RQQHFWLRQWR5656 or host controller Connection :LULQJWR&RQQHFWRU; P. &RQQHFWLRQWR6DIHW\E\SDVVSOXJ :LULQJWR&RQQHFWRU; P.2-54 &RQQHFWLRQWRKRVWFRQWUROOHU Short bar %% U-phase(red) V-phase(white) :SKDVH EODFN :LULQJWR&RQQHFWRU; Setup :LULQJWR&RQQHFWRU; P.2-55 &RQQHFWLRQWRfeedback scale 4 P.2-57 &RQQHFWLRQWRencoder 5HPDUNV Charge lamp 5HG/(' Junction cable for motor &RQQHFWLRQWRPRWRUGULYLQJ SKDVHDQGJURXQG 3 Junction cable for encoder '&3RZHUVXSSO\IRUEUDNH '&9 (to be supplied by customer) 7 Related page Supplement 'RQRWPDNHGLVSODFHPHQWZLULQJRULQVSHFWLRQZKLOHWKH/('LVOLWFDXVHRIHOHFWULFVKRFN Note 6 When in Trouble Junction cable for brake Ground (earth) 5 Adjustment Ground terminal ;WR;DUHXVHGIRUWKHVHFRQGDU\FLUFXLW To connect these terminals to the primary SRZHUVXSSO\ SDUWLFXODUO\WKH9'&SRZHU VXSSO\IRUFRQWURODQGWKH9'&SRZHU supply for brake), insulation is required. 'RQRWFRQQHFWWKHVHWHUPLQDOVWRWKHVDPH power supply. •7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU • Only for position control type is not provided with X2, X3 and X5. 3´Wiring of the Main Circuit )IUDPH9W\SH µ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ URL: http://industrial.panasonic.com/jp/i/fa_motor.html 2-37 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Wiring of the Main Circuit (F-frame, 400 V type) Preparation F-frame, 400 V type :LULQJVKRXOGEHSHUIRUPHGE\DVSHFLDOLVWRUDQDXWKRUL]HGSHUVRQQHO 'RQRWWXUQRQWKHSRZHUXQWLOWKHZLULQJLVFRPSOHWHG Never touch the terminal to which high voltage is applied. There is a risk of electric shock. Tips on Wiring 7DNHRIIWKHFRYHUÀ[LQJVFUHZVDQGGHWDFKWKHWHUPLQDOFRYHU 2) Make wiring Use clamp type terminals of round shape with insulation cover for wiring to the terminal block. For cable diameter and size, reter to "Driver and List of Applicable Peripheral Equipments" (P.2-10). Tighten the terminal block screw with a torque written on P.2-11. $WWDFKWKHWHUPLQDOFRYHUDQGÀ[ZLWKVFUHZV Tighten the screw securing the cover with a torque written on P.2-11. 24V DC 24V 0V L1 3RZHU 5&' MCCB VXSSO\ 1) MC L L2 L3 B1 B3 B2 NC 2 4 &RQQHFWRU IRUPRWRU 1 3 1 2 172167-1 PIN No. Application 1 U-phase V-phase 2 W-phase 3 Ground 4 172165-1 PIN No. Application 1 Brake 2 Brake :KHQWKHPRWRUVRI060( :WR: !DUHXVHGWKH\DUHFRQQHFWHGDVVKRZQEHORZ Connector: Made by Japan Aviation Electronics Industry, Ltd. (The figures below show connectors for the motor.) * Do not remove the gasket supplied with the junction cable connector. Securely install the gasket in place. Otherwise, the degree of protection of IP67 will not be guaranteed. 1 2 3 4 &RQQHFWRUIRUHQFRGHU 5 6 7 JN6CR07PM2 20-bit Incremental PIN No. Application FG(SHIELD) 1 — 2 E0V 3 PS 4 — 5 E5V 6 PS 7 17-bit Absolute PIN No. Application FG(SHIELD) 1 %$7ï 2 E0V 3 PS 4 BAT+ 5 E5V 6 PS 7 Tightening torque of the screw (M2) 0.19 to 0.21 N·m * Be sure to use only the screw supplied with the connector, to avoid damage. PE &RQQHFWRUIRUPRWRU PIN No. Application 1 U-phase 2 V-phase 3 W-phase PE Ground 3 2 1 JN8AT04NJ1 Tightening torque of the screw (M2) 0.085 to 0.095 N·m (screwed to plastic) * Be sure to use only the screw supplied with the connector, to avoid damage. [Motor with brake] 1 &RQQHFWRUIRUEUDNH Remarks 2-48 PIN No. Application 1 Brake * Electromagnetic brake is 2 Brake a nonpolar device. 2 Tightening torque of the screw (M2) 0.19 to 0.21 N·m JN4AT02PJM-R * Be sure to use only the screw supplied with the connector, to avoid damage. Do not connect anything to NC. 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 1 :KHQWKHPRWRUVRI060( : 9 N:WRN: 0'0(0)0(0*0(0+0(!DUHXVHG WKH\DUHFRQQHFWHGDVVKRZQEHORZ Connector: Made by Japan Aviation Electronics Industry, Ltd. (The figures below show connectors for the motor.) &RQQHFWRUIRUHQFRGHU M K J A B N L C P T G 1 2 3 4 5 6 7 8 9 10 D R S H E F JN2AS10ML3-R N/MS3102A20-29P 20-bit Incremental PIN No. Application ,3 motor &RQQHFWRUIRUHQFRGHU 6PDOOW\SH 17-bit Absolute PIN No. Application NC NC NC NC NC NC E0V E5V FG(SHIELD) PS PS NC NC NC NC BATï BAT+ A B C D E F G H J K L M N P R S T E0V NC PS E5V NC NC PS NC FG(SHIELD) NC 1 2 3 4 5 6 7 8 9 10 17-bit Absolute PIN No. Application E0V 1 NC 2 PS 3 E5V 4 BATï 5 BAT+ 6 PS 7 NC 8 FG(SHIELD) 9 10 NC 3 4 Remarks Do not connect anything to NC. Setup NC NC NC NC NC NC E0V E5V FG(SHIELD) PS PS NC NC NC NC NC NC 20-bit Incremental PIN No. Application Connection A B C D E F G H J K L M N P R S T 2 Preparation ,3 motor &RQQHFWRUIRUHQFRGHU /DUJHW\SH Before Using the Products Specifications of Motor connector &RQQHFWRUIRUPRWRUEUDNH Table of Connector for motor and Connector for brake 0RWRU PRGHO 0RWRUFDSDFLW\ 9 9 ZLWK%UDNH ZLWKRXW%UDNH ZLWK%UDNH ZLWKRXW%UDNH C C ' ' 1.5W MFME ' ' ' ' 2.5kW, 4.5kW C A ' A 0.9kW ' % ' % MGME 2.0kW to 4.5kW () ( () ( 6.0kW C A ' A 1.0kW to 1.5kW ' % ' % MHME 2.0kW to 5.0kW () ( () ( 7.5kW 0RWRU PRGHO Connector for motor Connector for motor I A C B A JL04V-2E20-4PE-B-R D JL04HV-2E22-22PE-B-R PIN No. Application A U-phase B V-phase C W-phase D Ground F E G H I C D JL04V-2E20-18PE-B-R JL04V-2E24-11PE-B-R PIN No. Application with Brake: Brake G without Brake: NC with Brake: Brake H without Brake: NC NC A U-phase F V-phase I W-phase B Ground E Ground D NC C PIN No. Application with Brake: Brake A without Brake: NC with Brake: Brake B without Brake: NC NC C U-phase D V-phase E W-phase F Ground G Ground H NC I D A D A C B C B E JL04V-2E32-17PE-B-R F N/MS3102A 14S-2P PIN No. Application U-phase A V-phase B W-phase C Ground D PIN No. Application Brake A Brake B NC C NC D Remarks Do not connect anything to NC. 2-49 7 Supplement B 6 A B C B E D C D Connector for brake 5 When in Trouble G H A F 0RWRUFDSDFLW\ Adjustment 750W 1.0kW to 2.0kW 3.0kW to 5.0kW 400W, 600W 1.0kW to 2.0kW MDME 3.0kW to 5.0kW 7.5kW to 15.0kW MSME 9 9 ZLWK%UDNH ZLWKRXW%UDNH ZLWK%UDNH ZLWKRXW%UDNH — — ' A C A ' A ' % ' % — — ' A C A ' A ' % ' % () ( () ( 2. 6\VWHP&RQÀJXUDWLRQDQG:LULQJ 2 Wiring method to connector Preparation )ROORZWKHSURFHGXUHVEHORZIRUWKHZLULQJFRQQHFWLRQWRWKH&RQQHFWRU XA , XB and XC . How to connect 1. Peel off the insulation cover of the cable. )RUVLQJOHZLUH 3OHDVHREH\WKHOHQJWKLQÀJXUH )RUVWUDQGHGZLUHV IHUUXOHVPXVWEHXVHGDVLOOXVWUDWHGEHORZ Example: Ferrules with plastic insulating sleeve (AI series, Phoenix Contact, Ltd.) 1) Peel off the sheath so that the conductor portion of the cable will protrude from the tip of the ferrule. (It should protrude 1 mm or more from the ferrule.) 2) Insert the cable into the ferrule and crimp it with an appropriate crimping tool. 3) After crimping, cut off the cable conductor portion protruding from the ferrule. (The allowable protruding length after cutting should be 0 to 0.5 mm.) Part No. of the crimping tool: CRIMPFOX U-D66 (1204436) Available from Phoenix Contact, Ltd. (1) A>B A B 8 to 9 mm Examples: Nylon-insulated ferrule (NTUB series, J.S.T. Mfg. Co., Ltd.) Vinyl-insulated ferrule (VTUB series, J.S.T. Mfg. Co., Ltd.) 1) Peel off the sheath of the cable conductor portion to the length equal to that of sheath on the ferrule. 2) Insert the cable into the ferrule and crimp it with an appropriate crimping tool. 3DUW1RRIWKHFULPSLQJWRRO<17 Available from J.S.T. Mfg. Co., Ltd ① A≧B A≦B+C A B C (2) ② 1mm or more (3) :KHQSHHOLQJRIIWKHVKHDWKRIWKHFDEOHWDNHFDUHQRWWRGDPDJHRWKHUSRUWLRQV :KHQFULPSLQJWKHIHUUXOHVXIÀFLHQWO\FKHFNWKHVWDWXVRIWKHIHUUXOHDQGFDEOH,IWKHFRQGXFWRUVRIWKHFDEOH stick out from the insulation cover or protrude excessively from the tip of the ferrule, accidents such as an elecWULFVKRFNDQGÀUHIURPDVKRUWFLUFXLWPD\UHVXOW 100V/200V specifications 400V specifications Conductor Size AWG18 to 12 6KHDWK2XWOLQH ѮWRѮPP Conductor Size AWG18 7HUPLQDO0RGHO1XPEHU $,*< 3KRHQL[&RQWDFW/WG Conductor Size AWG16 to 14 Terminal Model Number VTUB-2 or NTUB-2 (J.S.T. Mfg. Co., Ltd) XA, XB, XC Conductor Size AWG18 to 12 6KHDWK2XWOLQH ѮWRѮPP Conductor Size AWG16 to 14 Terminal Model Number VTUB-2 or NTUB-2 (J.S.T. Mfg. Co., Ltd) XD Conductor Size AWG24 to 20 6KHDWK2XWOLQH ѮWRѮPP Conductor Size AWG24 to 22 Terminal Model Number VTUB-0.5 (J.S.T. Mfg. Co., Ltd) 2. Insert the cable to the connector in the following 2 methods. (a) Insert the cable using the supplied handle lever. E ,QVHUWWKHFDEOHXVLQJDÁDWEODGHVFUHZGULYHU (GJHZLGWKWRPP (a) Using handle lever 1 Attach the handle lever to the handling slot on the upper portion. Press down the lever to push down the spring. 2 Insert the peeled cable while pressing down the lever, until it hits the insertion slot (round hole). (b) Using screw driver 3 Release the lever. 1 Press the screw driver to the handling slot on the upper portion to push down the spring. * You can pull out the cable by pushing down the spring as the above. 7DNHRIIWKHFRQQHFWRUIURPWKH6HUYR'ULYHUEHIRUHPDNLQJFRQQHFWLRQ ,QVHUWRQO\RQHFDEOHLQWRHDFKRQHRIFDEOHLQVHUWLRQVORW 3D\DWWHQWLRQWRLQMXU\E\VFUHZGULYHU 2-50 2 Insert the peeled cable while pressing down the screw driver, until it hits the insertion slot (round hole). 3 Release the screw driver. 1 Connecting host computer Preparation This is used for USB connection to a personal computer. It is possible to change the parameter setting and perform monitoring. Application Caution Connector Pin No. VBUS 1 Dï 2 D+ 3 — 4 Do not connect. GND 5 Connected to ground of control circuit. Contents 2 Use for communication with personal computer. Preparation USB signal terminal Symbol Before Using the Products 3. Wiring to the connector, X1 2 3 Use commercially available USB mini-B connector for the driver. Connection 4. Wiring to the connector, X2 2 Connecting communication connector Preparation 4 This is used for connection to the host controller when two or more units are used. RS232 and RS485 interfaces are supplied. Symbol Connector Pin No. Signal ground GND 1 Connected to ground of control circuit. NC – 2 Do not connect. TXD 3 RXD 4 RS232 The transmission / reception method. ï 5 485+ 6 ï 7 485+ 8 FG Shell RS485 signal 5 RS485 The transmission / reception method. 6 Connected with protective earth terminal in the servo driver. Connector (plug): 2040008-1 (optional, available from Tyco Electronics) [Connector pin assignment] 8 6 4 2 7 5 3 1 Note Related page 7 (Viewed from cable) ; WR ; DUH XVHG IRU WKH VHFRQGDU\ FLUFXLW7R FRQQHFW WKHVH WHUPLQDOV WR WKH SULPDU\ SRZHU supply (particularly, the 24 VDC power supply for control, the 24 VDC power supply for brake, and the 24 VDC power supply for regenerative resistor [H-frame only]), insulation is required. Do not connect these terminals to the same power supply. 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 3´&RQQHFWRU.LWIRU&RPPXQLFDWLRQ&DEOH IRU5656 µ 2-51 Supplement Remarks When in Trouble Frame ground Contents Adjustment RS232 signal Setup Application 4. Wiring to the connector, X2 Connecting host computer 7KLVVHUYRGULYHUIHDWXUHVNLQGVRIFRPPXQLFDWLRQIXQFWLRQ56DQG56DQG\RXFDQXVHLQ 3 connecting methods. To communicate with a single driver through RS232 Connect the host (PC or controller) to an driver through RS232. [How to connect] Shut off both powers of the PC andthe driver before inserting/pulling out the connector. Cable prepared by the user Connector X2 Connector To communicate with multiple drivers through RS232 and RS485 By connecting the host (PC and host controller) and one driver via RS232 and connecting other drivers via RS485 each other, you can connect multiple drivers. RS485 RS485 RS232 Connector X2 Connector X2 Set the axis number (Pr5.31) of driver to be connected through RS485 to a value in the range 1 to 31. Note Connector X2 Host controller (PC controller) Set the axis number (Pr5.31) of driver to be connected to the host through RS232 to 0. 3$1$7(50@µ Composition and List of Parameters Preparation 7KHSDUDPHWHU1RLVGLVSOD\HGLQWKHIRUPRI3U;<< ;&ODVVLÀFDWLRQ<<1R )RUWKHGHWDLOVRQWKHSDUDPHWHUVUHIHUWR3´'HWDLOVRISDUDPHWHUµ Parametr No. Class No.* Class name Group page 00 to 17 Basic setting Parameter for Basic setting P.2-74 1 00 to 27 Gain adjustment Parameter for Gain adjustment P.2-75 2 00 to 23 Damping control Parameter for Damping control P.2-76 3 00 to 29 4 00 to 44 I/F monitor setting Parameter for I/F monitor setting P.2-78 5 00 to 35 Enhancing setting Parameter for Enhancing setting P.2-79 6 00 to 39 Special setting Parameter for Special setting P.2-81 Verocity/ Torque/ Parameter for Verocity/ Torque/ Full-closed Full-closed control control 2 Preparation 0 1 Before Using the Products 13. Setup of Parameter and Mode 2 P.2-77 3 Connection * The Parameter No. consists of 2 digits. 4 ,QWKLVGRFXPHQWIROORZLQJV\PEROVUHSUHVHQWHDFKPRGH Symbol Control mode Position control 0 S Velocity control 1 T Torque control 2 F Full-Closed control 6 P/S Position (1st)/Velocity (2nd) control 3* P/T Position (1st)/Torque (2nd) control 4* S/T Velocity (1st)/Torque (2nd) control 5* 5 Adjustment P Setup Setup value of Pr0.01 6 When in Trouble * When you select the combination mode of 3, 4 or 5, you can select either 1st or 2nd with control mode switching input (C-MODE). When C-MODE is ON : 1st mode selection When C-MODE is OFF : 2nd mode selection Do not enter the command 10ms before/after the switching. 7 Supplement 2-73 13. Setup of Parameter and Mode 2 Preparation List of Parameters [Class 0] Basic setting Parametr No. Default Title Range Class No. A,B C D,E,F G,H -frame -frame -frame -frame Unit Turning Related on of Control Mode Detail power page supply P S T F 0 00 Rotational direction setup 0 to 1 1 ï ○ ○ ○ ○ ○ 0 01 Control mode setup 0 to 6 0 ï ○ ○ ○ ○ ○ 0 02 Real-time auto-gain tuning setup 0 to 6 1 ï ○ ○ ○ ○ 0 03 Selection of machine stiffness at realtime auto-gain tuning 0 to 31 ï ○ ○ ○ ○ 0 04 Inertia ratio ○ ○ ○ ○ 0 05 0 4-4 4-5 13 11 0 to 10000 250 % Selection of command pulse input 0 to 1 0 ï ○ ○ ○ 06 Command pulse rotational direction setup 0 to 1 0 ï ○ ○ ○ 0 07 Command pulse input mode setup 0 to 3 1 ï ○ ○ ○ 0 08 Command pulse counts per one motor revolution 0 to 220 10000 pulse ○ ○ ○ 0 09 1st numerator of electronic gear 0 to 230 0 ï ○ ○ 0 10 Denominator of electronic gear 0 to 230 10000 ï ○ ○ 0 11 Output pulse counts per one motor revolution 1 to 262144 2500 P/r ○ ○ ○ ○ ○ 0 12 Reversal of pulse output logic 0 to 3 0 ï ○ ○ ○ ○ ○ 0 13 1st torque limit 0 to 500 500*1 % 100000 Command unit 1 ï 4-6 4-7 0 to 2 27 0 14 Position deviation excess setup 0 15 Absolute encoder setup 0 to 2 0 16 External regenerative resistor setup 0 to 3 0 17 Load factor of external regenerative resistor selection 0 to 4 3 0 3 4-8 4-9 ○ ○ ○ ○ 4-11 ○ ○ ○ ○ ○ ï ○ ○ ○ ○ ○ ï ○ ○ ○ ○ ○ 4-12 0 'HÀQLWLRQRIV\PEROVXQGHU´3RZHU2II2QµLIDFKDQJHLVPDGHLWZLOOEHUHÁHFWHGXSRQWKHSDUDPHWHUZKHQWKH power to the driver is turned off and then on again. * 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ3SRVLWLRQFRQWURO6YHORFLW\FRQWURO7WRUTXHFRQWURO)IXOOFORVHGFRQWURO *1 Default settings depend on the combination of driver and motor. Refer to P. 2-82 “Torque limit setting”. Note 2-74 Parameter describes of this page is P.4-4 to P.4-12. 13. Setup of Parameter and Mode 1 [Class 1] Gain adjustment Parametr No. Default Title Range Class No. A,B C D,E,F G,H -frame -frame -frame -frame Unit Turning Related on of Control Mode Detail power page supply P S T F 1 00 1st gain of position loop 0 to 30000 480 320 0.1/s* ○ 1 01 1st gain of velocity loop 1 to 32767 270 180 0.1Hz* ○ ○ ○ ○ 1 02 1st time constant of velocity loop integration 1 to 10000 210 310 0.1ms* ○ ○ ○ ○ 4-13 1 03 VWÀOWHURIVSHHGGHWHFWLRQ 1 04 VWWLPHFRQVWDQWRIWRUTXHÀOWHU 0 to 2500 84 1 05 2nd gain of position loop 0 to 30000 1 06 2nd gain of velocity loop 1 to 32767 1 07 2nd time constant of velocity loop integration 1 to 10000 1 08 QGÀOWHURIVSHHGGHWHFWLRQ 0 to 5 1 09 QGWLPHFRQVWDQWRIWRUTXHÀOWHU 0 to 2500 1 10 Velocity feed forward gain 0 to 1000 1 11 9HORFLW\IHHGIRUZDUGÀOWHU 1 12 1 0 ○ ○ ○ ○ ○ 126 0.01ms ○ ○ ○ ○ 570 380 0.1/s* ○ 270 180 0.1Hz* ○ ○ ○ ○ 10000 0.1ms* ○ ○ ○ ○ 0 ï 126 3 ○ ○ ○ ○ ○ 4-14 0.01ms* ○ ○ ○ ○ 300 0.10%* ○ ○ 0 to 6400 50 0.01ms* ○ ○ Torque feed forward gain 0 to 1000 0 0.10%* ○ ○ ○ 13 7RUTXHIHHGIRUZDUGÀOWHU 0 to 6400 0 0.01ms* ○ ○ ○ 4-15 1 14 2nd gain setup 0 to 1 1 ï ○ ○ ○ ○ 1 15 Mode of position control switching 0 to 10 0 ï ○ ○ 1 16 Delay time of position control switching 0 to 10000 50 0.1ms* ○ ○ 1 17 Level of position control switching 0 to 20000 50 ï ○ ○ 1 18 Hysteresis at position control switching 0 to 20000 33 ï ○ ○ 4-17 1 19 Position gain switching time 0 to 10000 33 0.1ms* ○ ○ 1 20 Mode of velocity control switching 0 to 5 0 ï ○ 1 21 Delay time of velocity control switching 0 to 10000 0 0.1ms* ○ 1 22 Level of velocity control switching 0 to 20000 0 ï ○ 1 23 Hysteresis at velocity control switching 0 to 20000 0 ï ○ 1 24 Mode of torque control switching 0 to 3 0 ï ○ 1 25 Delay time of torque control switching 0 to 10000 0 0.1ms* ○ 1 26 Level of torque control switching 0 to 20000 0 ï ○ 1 27 Hysteresis at torque control switching 0 to 20000 0 ï ○ 4 5 2-75 7 Supplement Parameter describes of this page is P.4-13 to P.4-19. 6 When in Trouble The symbol “ * ” attached to “Unit”. indicates that the digits of setting unit will change if the parameter is set by using the setup support software PANATERM. Adjustment 4-18 'HÀQLWLRQRIV\PEROVXQGHU´3RZHU2II2QµLIDFKDQJHLVPDGHLWZLOOEHUHÁHFWHGXSRQWKHSDUDPHWHUZKHQWKH power to the driver is turned off and then on again. * 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ3SRVLWLRQFRQWURO6YHORFLW\FRQWURO7WRUTXHFRQWURO)IXOOFORVHGFRQWURO Note Setup 4-16 4-19 Caution Connection ï 84 2 Preparation 0 to 5 Before Using the Products List of Parameters 13. Setup of Parameter and Mode List of Parameters [Class 2] Damping control Parametr No. Default Title Range Class No. 2 00 $GDSWLYHÀOWHUPRGHVHWXS 2 01 1st notch frequency 2 02 2 A,B C D,E,F G,H -frame -frame -frame -frame Unit Turning Related on of Control Mode Detail power page supply P S T F 0 to 4 0 ï 50 to 5000 5000 Hz ○ ○ ○ ○ 1st notch width selection 0 to 20 2 ï ○ ○ ○ ○ 03 1st notch depth selection 0 to 99 0 ï ○ ○ ○ ○ 2 04 2nd notch frequency 50 to 5000 5000 Hz ○ ○ ○ ○ 2 05 2nd notch width selection 0 to 20 2 ï ○ ○ ○ ○ 2 06 2nd notch depth selection 0 to 99 0 ï ○ ○ ○ ○ 2 07 3rd notch frequency 50 to 5000 5000 Hz ○ ○ ○ ○ 2 08 3rd notch width selection 0 to 20 2 ï ○ ○ ○ ○ 2 09 3rd notch depth selection 0 to 99 0 ï ○ ○ ○ ○ 4-21 2 10 4th notch frequency 50 to 5000 5000 Hz ○ ○ ○ ○ 2 11 4th notch width selection 0 to 20 2 ï ○ ○ ○ ○ 2 12 4th notch depth selection 0 to 99 0 ï ○ ○ ○ ○ 2 13 6HOHFWLRQRIGDPSLQJÀOWHUVZLWFKLQJ 0 to 3 0 ï ○ ○ 2 14 1st damping frequency 0 to 2000 0 0.1Hz* ○ ○ 2 15 VWGDPSLQJÀOWHUVHWXS 0 to 1000 0 0.1Hz* ○ ○ 4-23 2 16 2nd damping frequency 0 to 2000 0 0.1Hz* ○ ○ 4-22 2 17 QGGDPSLQJÀOWHUVHWXS 0 to 1000 0 0.1Hz* ○ ○ 4-23 2 18 3rd damping frequency 0 to 2000 0 0.1Hz* ○ ○ 4-22 2 19 UGGDPSLQJÀOWHUVHWXS 0 to 1000 0 0.1Hz* ○ ○ 4-23 2 20 4th damping frequency 0 to 2000 0 0.1Hz* ○ ○ 4-22 2 21 WKGDPSLQJÀOWHUVHWXS 0 to 1000 0 0.1Hz* ○ ○ 2 22 3RVLWLRQDOFRPPDQGVPRRWKLQJÀOWHU 0 to 10000 0 0.1ms* ○ ○ 2 23 3RVLWLRQDOFRPPDQG),5ÀOWHU 0 to 10000 0 0.1ms* ○ ○ 4-24 ○ ○ ○ 4-20 4-22 4-23 'HÀQLWLRQRIV\PEROVXQGHU´3RZHU2II2QµLIDFKDQJHLVPDGHLWZLOOEHUHÁHFWHGXSRQWKHSDUDPHWHUZKHQWKH power to the driver is turned off and then on again. * 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ3SRVLWLRQFRQWURO6YHORFLW\FRQWURO7WRUTXHFRQWURO)IXOOFORVHGFRQWURO Caution Note 2-76 The symbol “ * ” attached to “Unit”. indicates that the digits of setting unit will change if the parameter is set by using the setup support software PANATERM. Parameter describes of this page is P.4-20 to P.4-24. 13. Setup of Parameter and Mode 1 >&ODVV@9HURFLW\7RUTXH)XOOFORVHGFRQWURO Parametr No. Default Title Range Class No. Turning Related on of Control Mode Detail power page supply P S T F 0 ï ○ 0 to 1 0 ï ○ 10 to 2000 500 (r/min)/ V 0 to 1 1 ï ○ 1st speed of speed setup ïWR 0 r/min ○ 05 2nd speed of speed setup ïWR 0 r/min ○ 3 06 3rd speed of speed setup ïWR 0 r/min ○ 3 07 4th speed of speed setup ïWR 0 r/min ○ 3 08 5th speed of speed setup ïWR 0 r/min ○ 3 09 6th speed of speed setup ïWR 0 r/min ○ 3 10 7th speed of speed setup ïWR 0 r/min ○ 3 11 8th speed of speed setup ïWR 0 r/min ○ 00 3 01 3 02 Input gain of speed command 3 03 Reversal of speed command input 3 04 3 4-25 ○ ○ 4-26 3 4-27 4 3 12 Acceleration time setup 0 to 10000 0 3 13 Deceleration time setup 0 to 10000 0 ms/ (1000r/min) ms/ (1000r/min) 3 14 Sigmoid acceleration/ deceleration time setup 0 to 1000 0 ms 3 15 Speed zero-clamp function selection 0 to 3 0 ï ○ ○ 3 16 Speed zero clamp level 10 to 20000 30 r/min ○ ○ 3 17 Selection of torque command 0 to 2 0 ï ○ 3 18 Torque command direction selection 0 to 1 0 ï ○ 3 19 Input gain of torque command 10 to 100 30 0.1V/100%* ○ 3 20 Input reversal of torque command 0 to 1 0 ï ○ 3 21 Speed limit value 1 0 to 20000 0 r/min ○ 3 22 Speed limit value 2 0 to 20000 0 r/min ○ 3 23 External scale selection 0 to 2 0 ï ○ ○ 0 ï ○ ○ ○ ○ Setup ○ 4-28 5 4-29 Adjustment 20 4-30 24 Numerator of external scale division 0 to 2 3 25 Denominator of external scale division 1 to 220 10000 ï ○ ○ 3 26 Reversal of direction of external scale 0 to 1 0 ï ○ ○ 3 27 External scale Z phase disconnection detection disable 0 to 1 0 ï ○ ○ 3 28 Hybrid deviation excess setup 1 to 227 16000 Command unit ○ ○ 3 29 Hybrid deviation clear setup 0 to 100 0 Revolution ○ ○ 6 4-31 4-32 The symbol “ * ” attached to “Unit”. indicates that the digits of setting unit will change if the parameter is set by using the setup support software PANATERM. Parameter describes of this page is P.4-25 to P.4-32. 2-77 7 Supplement 'HÀQLWLRQRIV\PEROVXQGHU´3RZHU2II2QµLIDFKDQJHLVPDGHLWZLOOEHUHÁHFWHGXSRQWKHSDUDPHWHUZKHQWKH power to the driver is turned off and then on again. * 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ3SRVLWLRQFRQWURO6YHORFLW\FRQWURO7WRUTXHFRQWURO)IXOOFORVHGFRQWURO Note When in Trouble 3 Caution Connection 0 to 3 3 2 Preparation Speed setup, Internal/External switching Speed command rotational direction selection A,B C D,E,F G,H -frame -frame -frame -frame Unit Before Using the Products List of Parameters 13. Setup of Parameter and Mode List of Parameters [Class 4] I/F monitor setting Parametr No. Default Title Range Class No. A,B C D,E,F G,H -frame -frame -frame -frame Unit Turning Related on of Control Mode Detail power page supply P S T F 4 00 SI1 input selection (Pin No.8) 0 to 00FFFFFFh 8553090 ï ○ ○ ○ ○ ○ 4-33 4 01 SI2 input selection (Pin No.9) 0 to 00FFFFFFh 8487297 ï ○ ○ ○ ○ ○ 4 02 SI3 input selection (Pin No.26) 0 to 00FFFFFFh 9539850 ï ○ ○ ○ ○ ○ 4 03 SI4 input selection (Pin No.27) 0 to 00FFFFFFh 394758 ï ○ ○ ○ ○ ○ 4 04 SI5 input selection (Pin No.28) 0 to 00FFFFFFh 4108 ï ○ ○ ○ ○ ○ 4 05 SI6 input selection (Pin No.29) 0 to 00FFFFFFh 197379 ï ○ ○ ○ ○ ○ 4-34 4 06 SI7 input selection (Pin No.30) 0 to 00FFFFFFh 3847 ï ○ ○ ○ ○ ○ 4 07 SI8 input selection (Pin No.31) 0 to 00FFFFFFh 263172 ï ○ ○ ○ ○ ○ 4 08 SI9 input selection (Pin No.32) 0 to 00FFFFFFh 328965 ï ○ ○ ○ ○ ○ 4 09 SI10 input selection (Pin No.33) 0 to 00FFFFFFh 3720 ï ○ ○ ○ ○ ○ 4 10 0 to 00FFFFFFh 197379 ï ○ ○ ○ ○ ○ 4 11 0 to 00FFFFFFh 131586 ï ○ ○ ○ ○ ○ 4 12 0 to 00FFFFFFh 65793 ï ○ ○ ○ ○ ○ 4 13 0 to 00FFFFFFh 328964 ï ○ ○ ○ ○ ○ 4 14 ï ○ ○ ○ ○ ○ 15 ) 0 to 00FFFFFFh ) 0 to 00FFFFFFh 460551 4 ( SO2 output selection ( SO3 output selection ( SO4 output selection ( SO5 output selection ( SO6 output selection ( 394758 ï ○ ○ ○ ○ ○ 4 16 Type of analog monitor 1 0 to 21 0 ï ○ ○ ○ ○ 4 17 Analog monitor 1 output gain 0 to 214748364 0 ï ○ ○ ○ ○ 4 18 Type of analog monitor 2 0 to 21 4 ï ○ ○ ○ ○ 4-36 4 19 Analog monitor 2 output gain 0 to 214748364 0 ï ○ ○ ○ ○ 4 20 Type of digital monitor 0 to 3 0 ï ○ ○ ○ ○ 4 21 Analog monitor output setup 0 to 2 0 ï ○ ○ ○ ○ 4 22 Analog input 1 (AI1) offset setup ïWR 0 0.366mV ○ ○ ○ ○ 4 23 $QDORJLQSXW $, ÀOWHU 0 to 6400 0 0.01ms* ○ ○ ○ ○ 4 24 Analog input 1 (AI1) overvoltage setup 0 to 100 0 0.1V* ○ ○ ○ ○ 4 25 Analog input 2 (AI2) offset setup ïWR 0 5.86mV ○ ○ ○ ○ 4 26 $QDORJLQSXW $, ÀOWHU 0 to 6400 0 0.01ms* ○ ○ ○ ○ 4 27 Analog input 2(AI2) overvoltage setup 0 to 100 0 0.1V* ○ ○ ○ ○ 4 28 Analog input 3 (AI3) offset setup ïWR 0 5.86mV ○ ○ ○ ○ 4 29 $QDORJLQSXW $, ÀOWHU 0 to 6400 0 0.01ms* ○ ○ ○ ○ 4-39 SO1 output selection ) ) ) ) Pin No.10, 11 Line driver output Pin No.34, 35 Line driver output Pin No.36, 37 Line driver output Pin No.38, 39 Line driver output Pin No.12 Open collector output Pin No.40 Open collector output 4-35 4-38 'HÀQLWLRQRIV\PEROVXQGHU´3RZHU2II2QµLIDFKDQJHLVPDGHLWZLOOEHUHÁHFWHGXSRQWKHSDUDPHWHUZKHQWKH power to the driver is turned off and then on again. * 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ3SRVLWLRQFRQWURO6YHORFLW\FRQWURO7WRUTXHFRQWURO)IXOOFORVHGFRQWURO Caution Note 2-78 The symbol “ * ” attached to “Unit”. indicates that the digits of setting unit will change if the parameter is set by using the setup support software PANATERM. Parameter describes of this page is P.4-33 to P.4-39. 13. Setup of Parameter and Mode 1 Parametr No. Range Class No. 4 30 Unit Related Turning on of Control Mode Detail power page supply P S T F 0 0.1V* ○ ○ ○ ○ ○ ○ Default Title A,B C D,E,F G,H -frame -frame -frame -frame 0 to 262144 10 Command unit 0 to 3 0 ï ○ ○ ○ 0 to 100 2 4 31 4 32 4 33 INP hold time 0 to 30000 0 1ms ○ 4 34 Zero-speed 10 to 20000 50 r/min ○ ○ ○ ○ 4 35 Speed coincidence range 10 to 20000 50 r/min ○ 4 36 At-speed (Speed arrival) 10 to 20000 1000 r/min ○ ○ 4 37 0 to 10000 0 1ms ○ ○ ○ ○ 4-41 4 38 0 to 10000 0 1ms ○ ○ ○ ○ 4 39 Brake release speed setup 30 to 3000 30 r/min 4 40 Selection of alarm output 1 0 to 10 0 ï ○ ○ ○ ○ 4 41 Selection of alarm output 2 0 to 10 0 ï ○ ○ ○ ○ 42 2nd Positioning complete (In-position) 0 to 262144 range 10 Command unit 4-39 Preparation Analog input 3 (AI3) overvoltage setup Positioning complete (In-position) range Positioning complete (In-position) output setup Before Using the Products List of Parameters 4-40 ○ ○ ○ ○ ○ ○ 4-42 Title Range A,B C D,E,F G,H -frame -frame -frame -frame Unit 5 00 2nd numerator of electronic gear 0 to 230 0 ï ○ ○ 5 01 3rd numerator of electronic gear 0 to 230 0 ï ○ ○ 5 02 4th numerator of electronic gear 0 to 230 0 ï ○ ○ 5 03 Denominator of pulse output division 0 to 262144 0 ï ○ ○ ○ ○ ○ 5 04 Over-travel inhibit input setup 0 to 2 1 ï ○ ○ ○ ○ ○ 5 05 Sequence at over-travel inhibit 0 to 2 0 ï ○ ○ ○ ○ ○ 5 06 Sequence at Servo-Off 0 to 9 0 ï ○ ○ ○ ○ 5 07 Sequence at main power OFF 0 to 9 0 ï ○ ○ ○ ○ 5 08 LV trip selection at main power OFF 0 to 1 1 ï ○ ○ ○ ○ 5 09 Detection time of main power off 70 to 2000 70 1ms 5 Adjustment Class No. Turning Related on of Control Mode Detail power page supply P S T F Setup [Class 5] Enhancing setting Default 4 ○ 'HÀQLWLRQRIV\PEROVXQGHU´3RZHU2II2QµLIDFKDQJHLVPDGHLWZLOOEHUHÁHFWHGXSRQWKHSDUDPHWHUZKHQWKH power to the driver is turned off and then on again. * 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ3SRVLWLRQFRQWURO6YHORFLW\FRQWURO7WRUTXHFRQWURO)IXOOFORVHGFRQWURO Parametr No. Connection 4 Mechanical brake action at stalling setup Mechanical brake action at running setup 3 4-43 6 When in Trouble 4-44 4-45 ○ 7 ○ ○ ○ ○ Note Parameter describes of this page is P.4-39 to P.4-45. 2-79 Supplement 'HÀQLWLRQRIV\PEROVXQGHU´3RZHU2II2QµLIDFKDQJHLVPDGHLWZLOOEHUHÁHFWHGXSRQWKHSDUDPHWHUZKHQWKH power to the driver is turned off and then on again. * 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ3SRVLWLRQFRQWURO6YHORFLW\FRQWURO7WRUTXHFRQWURO)IXOOFORVHGFRQWURO 13. Setup of Parameter and Mode List of Parameters Parametr No. Default Title Range Class No. 5 10 Sequence at alarm 5 11 5 A,B C D,E,F G,H -frame -frame -frame -frame Unit Related Turning on of Control Mode Detail power page supply P S T F 0 to 7 0 ï ○ ○ ○ ○ 4-45 Torque setup for emergency stop 0 to 500 0 % ○ ○ ○ ○ 12 Over-load level setup 0 to 500 0 % ○ ○ ○ ○ 5 13 Over-speed level setup 0 to 20000 0 r/min 5 14 Motor working range setup 0 to 1000 10 0.1 revolution* 5 15 ,)UHDGLQJÀOWHU 0 to 3 0 ï ○ ○ ○ ○ ○ 5 16 Alarm clear input setup 0 to 1 0 ï ○ ○ ○ ○ ○ 5 17 Counter clear input mode 0 to 4 3 ï ○ ○ 5 18 0 to 1 1 ï ○ ○ 5 19 0 to 4 0 ï ○ ○ ○ 5 20 Position setup unit select 0 to 1 0 ï ○ ○ ○ 5 21 Selection of torque limit 0 to 6 1 ï ○ ○ ○ 4-48 5 22 2nd torque limit 0 to 500 500*1 % ○ ○ ○ 5 23 Torque limit switching setup 1 0 to 4000 0 ms/100% ○ ○ ○ 5 24 Torque limit switching setup 2 0 to 4000 0 ms/100% ○ ○ ○ 5 25 0 to 500 500*1 % ○ ○ ○ 4-49 5 26 0 to 500 500*1 % ○ ○ ○ 5 27 Input gain of analog torque limit 10 to 100 30 0.1V/100%* ○ ○ ○ 5 28 LED initial status 0 to 35 1 ï ○ ○ ○ ○ ○ 5 29 RS232 baud rate setup 0 to 6 2 ï ○ ○ ○ ○ ○ 4-50 5 30 RS485 baud rate setup 0 to 6 2 ï ○ ○ ○ ○ ○ 5 31 Axis address 0 to 127 1 ï ○ ○ ○ ○ ○ 5 32 Command pulse input maximum setup 250 to 4000 4000 kpulse/s ○ ○ 5 33 Pulse regenerative output limit setup 0 to 1 0 ï ○ ○ ○ ○ ○ 4-51 5 34 For manufactuer's use ï 4 ï 5 35 Front panel lock setup 0 to 1 0 ï ○ ○ ○ ○ ○ Invalidation of command pulse inhibit input Command pulse inhibit input reading setup External input positive direction torque limit External input negative direction torque limit ○ ○ ○ ○ 4-46 ○ ○ 4-47 ○ 'HÀQLWLRQRIV\PEROVXQGHU´3RZHU2II2QµLIDFKDQJHLVPDGHLWZLOOEHUHÁHFWHGXSRQWKHSDUDPHWHUZKHQWKH power to the driver is turned off and then on again. * 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ3SRVLWLRQFRQWURO6YHORFLW\FRQWURO7WRUTXHFRQWURO)IXOOFORVHGFRQWURO *1 Default settings depend on the combination of driver and motor. Refer to P. 2-82 “Torque limit setting”. Caution Note 2-80 The symbol “ * ” attached to “Unit”. indicates that the digits of setting unit will change if the parameter is set by using the setup support software PANATERM. Parameter describes of this page is P.4-45 to P.4-51. 13. Setup of Parameter and Mode 1 [Class 6] Special setting Parametr No. Default Title Range Class No. 00 Analog torque feed forward conversion gain 6 02 6 Turning Related on of Control Mode Detail power page supply P S T F 0 to 100 0 0.1V/100%* Velocity deviation excess setup 0 to 20000 0 r/min ○ 04 JOG trial run command speed 0 to 500 300 r/min ○ ○ ○ ○ 4-51 6 05 Position 3rd gain valid time 0 to 10000 0 0.1ms* ○ ○ 6 06 Position 3rd gain scale factor 50 to 1000 100 % ○ ○ 6 07 Torque command additional value ïWR 0 % ○ ○ ○ 6 08 ïWR 0 % ○ ○ 6 09 ïWR 0 % ○ ○ 4-52 6 10 Function expansion setup 0 to 63 0 ï ○ ○ ○ ○ 6 11 Current response setup 50 to 100 100 % ○ ○ ○ ○ 6 13 Current response setup 0 to 10000 250 % ○ ○ ○ ○ 6 14 Emergency stop time at alarm 0 to 1000 200 1ms ○ ○ ○ ○ 6 15 2nd over-speed level setup 0 to 20000 0 r/min ○ ○ ○ ○ 6 16 For manufacturer's use ï 0 ï ○ 6 17 Front panel parameter writing selection 0 to 1 0 ï ○ ○ ○ ○ ○ 6 18 Power-up wait time 0 to 100 0 0.1s* ○ ○ ○ ○ ○ 6 19 Encoder Z phase setup 0 to 32767 0 pulse ○ ○ ○ ○ ○ 6 20 Z-phase setup of external scale 0 to 400 0 ѥV ○ ○ 6 21 0 to 228 0 pulse ○ ○ 4-54 6 22 0 to 1 0 ï ○ ○ 6 23 Disturbance torque compensating gain ïWR 0 % ○ ○ 6 24 'LVWXUEDQFHREVHUYHUÀOWHU 0 to 2500 53 0.01ms* ○ ○ 6 27 Alarm latch time selection 0 to 10 5 s 6 31 Real time auto tuning estimation speed 0 to 3 1 ï ○ ○ ○ ○ 6 32 Real time auto tuning custom setup ïWR 0 ï ○ ○ ○ ○ 4-56 6 33 For manufacturer's use ï 1000 ï 6 34 Hybrid vibration suppression gain 0 to 30000 0 0.1/s* ○ 6 35 +\EULGYLEUDWLRQVXSSUHVVLRQÀOWHU 0 to 6400 10 0.01ms* ○ 6 37 Oscillation detecting level 0 to 1000 0 0.1%* 6 38 Alarm mask setup ïWR 4 ï 6 39 For manufactuer's use ï 0 ï 4 4-53 ○ ○ ○ ○ 4-55 ○ ○ ○ ○ 7 Note The symbol “ * ” attached to “Unit”. indicates that the digits of setting unit will change if the parameter is set by using the setup support software PANATERM. Parameter describes of this page is P.4-51 to P.4-57. 2-81 Supplement 'HÀQLWLRQRIV\PEROVXQGHU´3RZHU2II2QµLIDFKDQJHLVPDGHLWZLOOEHUHÁHFWHGXSRQWKHSDUDPHWHUZKHQWKH power to the driver is turned off and then on again. * 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ3SRVLWLRQFRQWURO6YHORFLW\FRQWURO7WRUTXHFRQWURO)IXOOFORVHGFRQWURO Caution 6 When in Trouble 4-57 ○ ○ ○ ○ ○ 5 Adjustment ○ 3 Setup Serial absolute external scale Z phase setup A, B phase external scale pulse output method selection ○ Connection Positive direction torque compensation value Negative direction torque compensation value ○ ○ 2 Preparation 6 A,B C D,E,F G,H -frame -frame -frame -frame Unit Before Using the Products List of Parameters 13. Setup of Parameter and Mode 2 Preparation 6HWXSRI7RUTXH/LPLW Torque limit setup range is 0 to 300 and default is 300 except the combinations of the motor and the driver listed in the table below. Frame Model No. MDDHT5540 D MDDHT3420 MFDHTA390 MFDHTB3A2 F MFDHT5440 MFDHTA464 Applicable motor Max. value of Frame WRUTXHOLPLW Model No. Applicable motor Max. value of WRUTXHOLPLW MGME092G** 225 MGME602G** 272 MGME092S** 225 MGME602S** 272 MGME094G** 225 MDME752G** 265 MGME094S** 225 MDME752S** 265 MGME202G** 250 MHME752G** 265 MGME202S** 250 MHME752S** 265 MGME302G** 250 MGME604G** 272 MGME302S** 250 MGME604S** 272 MGME452G** 262 MDME754G** 267 MGME452S** 262 MDME754S** 267 MGME204G** 250 MHME754G** 267 MGME204S** 250 MHME754S** 267 MGME304G** 250 MDMEC12G** 265 MGME304S** 250 MDMEC12S** 265 MGME454G** 263 MDMEC52G** 253 MGME454S** 263 MDMEC52S** 253 MDMEC14G** 265 MDMEC14S** 265 MDMEC54G** 253 MDMEC54S** 253 MGDHTC3B4 G MGDHTB4A2 MHDHTC3B4 H MHDHTB4A2 The above limit applies to Pr0.13 (1st torque limit), Pr5.22 (2nd torque limit), Pr5.11 (Torque setup for emergency stop), Pr5.25 (External input positive direction torque limit) and Pr5.26(External input negative direction torque limit). Caution 2-82 When you change the motor model, above max. value may change as well. Check and reset the setup values of Pr0.13, Pr5.22, Pr5.11, Pr5.25 and Pr5.26. 13. Setup of Parameter and Mode 1 Cautions on Replacing the Motor As stated previously, torque limit setup range might change when you replace the combination of the motor and the driver. Pay attention to the followings. Before Using the Products 6HWXSRI7RUTXH/LPLW 2 :KHQWKHPRWRUWRUTXHLVOLPLWHG e.g.1) before replacing the motor after replacing the motor MADHT1507 MADHT1507 3 MSME012S1A MSME022S1A Pr0.13 Setup range : 0 to 300% Setup value : 100%. Torque limit value 0.64N m x 100% = 0.64N m Set up Pr0.13 to 200 to make torque limit value to 0.64N m (0.32N m x 200% = 0.64N m) Pr0.13 Setup range : Change to 0 to 300%. Setup value : Keep 100%. Torque limit value 0.32N m x 100% = 0.32N m :KHQ\RXZDQWWRREWDLQWKHPD[PRWRUWRUTXH Display shifts toward the arrowed direction by pressing and reversed direction by pressing . 7 (Mode switch button) :KHQ\RXWXUQRQWKH3URGXFWIRUWKHÀUVWWLPHGLVSOD\VKRZV To change this display, change the setup of Pr5.28 (Initial status of LED). . (at motor stall) 2-91 Supplement Parameter Setup Mode SELECTION display Note Setup Encoder positional deviation [Encoder unit] P.2-102 (16) P.2-100 (10) Connection P.2-102 (15) Feedback pulse sum P.2-93 (3) Factor of no-motor running 3 P.2-102 (13) 2 15. How to Use the Front Panel Preparation Monitor Mode (EXECUTION display) (1) Display of positional command deviation [command unit] Displays positional deviation of the command unit in High order or Low order. Positional command deviation ......Low order ......High order To switch between Low order (L) and High order (H), press . (2) Display of motor speed, positional command speed, YHORFLW\FRQWUROFRPPDQGDQGWRUTXHFRPPDQG 0RWRUVSHHG UPLQ Displays the motor speed (r/min). 3RVLWLRQDOFRPPDQGVSHHG UPLQ Displays positional command speed (r/min). 9HORFLW\FRQWUROFRPPDQG UPLQ Displays velocity control command (r/min). 7RUTXHFRPPDQG Displays torque command (%). 2-92 15. How to Use the Front Panel 1 (3) Display of Feedback Pulse Sum, Command Pulse Sum and External Scale Feedback Pulse Sum )HHGEDFN3XOVH6XP>(QFRGHUIHHGEDFNSXOVH] Before Using the Products Monitor Mode (EXECUTION display) 2 Preparation Feedback Pulse Sum ......Low order ......High order To switch between Low order (L) and High order (H), press . 3 &RPPDQG3XOVH6XP>&RPPDQG3XOVH@ Connection Command Pulse Sum ......Low order ......High order To switch between Low order (L) and High order (H), press 4 . Setup ([WHUQDO6FDOH)HHGEDFN3XOVH6XP External Scale Feedback Pulse Sum 5 ......Low order To switch between Low order (L) and High order (H), press Adjustment ......High order . 6 (4) Display of Control Mode When in Trouble .....Position control mode .....Velocity control mode .....Torque control mode .....Full-closed control mode 7 Supplement 2-93 15. How to Use the Front Panel Monitor Mode (EXECUTION display) (5) Display of I/O Signal Status Displays the control input and output signal to be connected to connector X4. Use this function to check if the wiring is correct or not. .....Active *1 .....Inactive *1 Pin No. .....Input signal .....Output signal 6KLIWWKHIODVKLQJGHFLPDOSRLQWZLWK 5LJKWVLGHRIGHFLPDOSRLQW3LQ1RVHOHFWLRQ /HIWVLGHRIGHFLPDOSRLQW,QSXW2XWSXW3LQ1RVHOHFWLRQ 6HOHFW,QRU2XWE\SUHVVLQJRUEXWWRQ 6HOHFWWKH3LQ1RWREHPRQLWRUHGE\SUHVVLQJ /RZHVWSODFH3LQ1R RIRXWSXWVLJQDO (Highest place Pin No. RILQSXWVLJQDO *1 When input signal When output signal Note 2-94 Active : Input signal photocoupler is ON. Inactive : Input signal photocoupler is OFF. Active : Output signal transistor is ON. Inactive : Output signal transistor is OFF. For detail of input/output signal, refer to P.3-30 “Inputs and outputs on connector X4” For detail of Error Code, refer to P.6-2 “Protective Function”. 15. How to Use the Front Panel 1 Before Using the Products Monitor Mode (EXECUTION display) (6) Display of Analog Input Value 2 Input voltage value [V] Preparation Input signal Select the signal No. to be monitored by pressings (Analog input 1 value, unit [V]) . Displays the value after offset correction. 3 (Analog input 2 value, unit [V]) Connection (Analog input 3 value, unit [V]) Caution Voltage exceeding ± 10V can not be displayed correctly. 4 Setup 5 Adjustment 6 When in Trouble 7 Supplement 2-95 15. How to Use the Front Panel Monitor Mode (EXECUTION display) (7) Display of Error Factor and Reference of History Error code No. ( appears if no error occurs) ........Present error ........History 0 (latest error) ........History 13 (oldest error) Error code Main Sub 11 0 Control power supply under- voltage protection 12 0 Over-voltage protection 0 Main power supply under-voltage protection (between P to N) 1 Main power supply under-voltage protection (AC interception detection) 0 Over-current protection 1 IPM error protection 15 0 Over-heat protection 16 0 Over-load protection 0 Over-regeneration load protection 1 Over-regeneration Tr error protection 0 Encoder communication disconnect error protection 1 Encoder communication error protection 0 Encoder communication data error protection 0 Position deviation excess protection 1 Velocity deviation excess protection 0 Hybrid deviation excess error protection 0 Over-speed protection 1 2nd over-speed protection 0 Command pulse input frequency error protection 2 Command pulse multiplier error protection 28 0 Limit of pulse replay error protection 29 0 'HYLDWLRQFRXQWHURYHUÁRZSURWHFWLRQ 30 0 Safety detection 0 IF overlaps allocation error 1 protection 1 IF overlaps allocation error 2 protection 2 IF input function number error 1 protection 3 IF input function number error 2 protection 4 IF output function number error 1 protection 5 IF output function number error 2 protection 6 &/ÀWWLQJHUURUSURWHFWLRQ 7 ,1+ÀWWLQJHUURUSURWHFWLRQ 13 14 18 21 23 24 25 26 27 33 2-96 Attribute Protective function History Can be Immediate cleared stop *1 15. How to Use the Front Panel 1 Error code Main Sub 34 0 Attribute Protective function 37 0 to 2 EEPROM check code error protection Analog input1 excess protection 1 Analog input2 excess protection 2 Analog input3 excess protection 40 0 Absolute system down error protection 41 0 Absolute counter over error protection 42 0 Absolute over-speed error protection 43 0 Initialization failure 44 0 Absolute single turn counter error protection 45 0 Absolute multi-turn counter error protection 47 0 Absolute status error protection 48 0 Encoder Z-phase error protection 49 0 Encoder CS signal error protection 0 External scale connection error protection 1 External scale communication error protection 0 External scale status 0 error protection 1 External scale status 1 error protection 2 External scale status 2 error protection 3 External scale status 3 error protection 4 External scale status 4 error protection 5 External scale status 5 error protection 0 A-phase connection error protection 1 B-phase connection error protection 2 Z-phase connection error protection 0 Compulsory alarm input protection 50 51 55 87 95 3 4 5 Adjustment 0 Setup Over-travel inhibit input protection Connection 0 2 Preparation 0 to 2 EEPROM parameter error protection 39 Can be Immediate stop cleared Software limit protection 36 38 History 6 0 to 4 Motor automatic recognition error protection 1) Certain alarms are not included in the history. For detailed information on alarms e.g. alarm numbers, refer to P.6-2. 2) When one of the errors which are listed in error history occurs, this error and history o shows the same error No. 2-97 7 Supplement Caution History...The error will be stored in the error history. Can be cleared...To cancel the error, use the alarm clear input (A-CLR). If the alarm clear input is not effective, turn off power, remove the cause of the error and then turn on power again. Immediate stop...Instantaneous controlled stop upon occurrence of an error. (Setting of “Pr.5.10 Sequence at alarm” is also required.) When in Trouble Other number Other error Note Before Using the Products Monitor Mode (EXECUTION display) 15. How to Use the Front Panel Monitor Mode (EXECUTION display) (8) Alarm Display ......No alarm occurred ......High priority alarm Alarm number 7RGLVSOD\WKHDODUPRFFXUUHQFHFRQGLWLRQSUHVVRUEXWWRQ alarm No. Alarm Content Latched time *1 A0 Overload protection Load factor is 85% or more the protection level. A1 Over-regeneration alarm Regenerative load factor is 85% or more the protection level. A2 Battery alarm Battery voltage is 3.2 V or lower. A3 Fan alarm Fan has stopped for 1 sec. WRVRU A4 Encoder communication alarm The number of successive encoder communication HUURUVH[FHHGVWKHVSHFLÀHGYDOXH WRVRU A5 Encoder overheat alarm The encoder detects overheat alarm. WRVRU A6 Oscillation detection alarm Oscillation or vibration is detected. WRVRU A7 Lifetime detection alarm Life expectancy of capacitor or fan is short. A8 External scale error alarm The external scale detects the alarm. WRVRU A9 External scale communication alarm The number of successive external scale FRPPXQLFDWLRQHUURUVH[FHHGVWKHVSHFLÀHGYDOXH WRVRU WRVRU VRU )L[HGDW )L[HGDW *1 Alarms can be cleared by using the alarm clear. Because the all existing alarms are kept cleared while the alarm FOHDULQSXW $&/5 LVNHSW21EHVXUHWRWXUQLW2))GXULQJQRUPDORSHUDWLRQ(LWKHUVRUFDQEHVHOHFWHG by using user parameter. ([FHSWLRQ%DWWHU\DODUPLVÀ[HGDWEHFDXVHLWLVODWFKHGE\WKHHQFRGHU %HFDXVHWKHHQGRIOLIHDODUPPHDQVWKDWWKHOLIHH[SHFWDQF\FDQQRWEHH[WHQGHGWKHDODUPLVVHWDW 2-98 15. How to Use the Front Panel 1 Before Using the Products Monitor Mode (EXECUTION display) (9) Display of Regenerative Load Factor, Over-load Factor and Inertia Ratio 5HJHQHUDWLYH/RDG)DFWRU 2 Preparation Display the ratio (%) against the alarm trigger level of regenerative protection. This is valid when Pr0.16 (External regenerative resistor setup) is 0 or 1. 2YHUORDG)DFWRU 3 Connection Displays the ratio (%) against the rated load. Refer to P.6-14, "Overload Protection Time Characteristics" of When in Trouble. ,QHUWLD5DWLR 4 Setup Displays the inertia ratio (%) . Value of Pr0.04 (Inertia Ratio) will be displayed as it is. 5 Adjustment 6 When in Trouble 7 Supplement Note For alarm function, refer to P.4-42 "Pr4.40, Pr4.41". 2-99 15. How to Use the Front Panel Monitor Mode (EXECUTION display) 10) Display of the Factor of No-Motor Running Displays the factor of no-motor running in number. .......Position control .......Torque control ....... Velocity control ....... Full-closed control Factor No. Control mode ([SODQDWLRQRIIDFWRU1R Factor No. Factor Content P S T F Occurrence of error/alarm ○ ○ ○ ○ An error is occurring, and an alarm is triggered. 00 No particular factor ○ ○ ○ ○ No factor is detected for No-motor run. The motor runs in normal case. 01 Main power shutoff ○ ○ ○ ○ The main power of the driver is not turned on. 02 No entry of SRV-ON input ○ ○ ○ ○ The Servo-ON input (SRV-ON) is not connected to COM–. 03 Over-travel inhibition input is valid ○ ○ ○ ○ While Pr5.04 is 0 (Run-inhibition input is valid), 3RVLWLYH GLUHFWLRQ RYHUWUDYHO LQKLELWLRQ LQSXW 327 LV RSHQ DQG VSHHG command is Positive direction. 1HJDWLYH GLUHFWLRQ RYHUWUDYHO LQKLELWLRQ LQSXW 127 LV RSHQ DQG VSHHG command is Negative direction. 04 Torque limit setup is small ○ ○ ○ ○ Either one of the valid torque limit setup value of Pr0.13 (1st) or Pr5.22 (2nd) is set to 5% or lower than the rating. ○ While Pr5.21 is 0 (analog torque limit input accepted), 3RVLWLYHGLUHFWLRQDQDORJWRUTXHOLPLWLQSXW 3$7/ LVQHJDWLYHYROWDJH and speed command is Positive direction. 1HJDWLYHGLUHFWLRQDQDORJWRUTXHOLPLWLQSXW 1$7/ LVSRVLWLYHYROWDJH and speed command is Negative direction. ○ Pr5.18 is 0 (Command pulse inhibition input is valid.), and INH is open. ÁDVKLQJ 05 Analog torque limit input is valid. ○ 06 INH input is valid. ○ 07 Command pulse input frequency is low. ○ ○ The position command per each control cycle is 1 pulse or smaller due to, 1RFRUUHFWHQWU\RIFRPPDQGSXOVH 1RFRUUHFWFRQQHFWLRQWRWKHLQSXWVHOHFWHGZLWK3U 1RPDWFKLQJWRLQSXWVWDWXVVHOHFWHGZLWK3USU3U 08 CL input is valid. ○ ○ While Pr5.17 is 0 (Deviation counter clear at level), the deviation counter clear input (CL) is connected to COM–. 09 ZEROSPD input is valid. ○ 10 External speed command is small. ○ While the analog speed command is selected, the analog speed command is smaller than 0.06[V]. 11 Internal speed command is 0. ○ While the internal speed command is selected, the internal speed command is set to lower than 30 [r/min] 12 Torque command is small. ○ The analog torque command input (SPR or P-ATL) is smaller than 5 [%] of the rating. 13 Speed limit is small. ○ :KLOH 3U LV VSHHG LV OLPLWHG E\ WK VSHHG RI LQWHUQDO VSHHG Pr3.07, (4th speed of speed setup) is set to lower than 30 [r/min]. :KLOH3ULV VSHHGLVOLPLWHGE\635LQSXW WKHDQDORJVSHHGOLPLW input (SPR) is smaller than 0.06 [V]. ○ The motor runs at 20 [r/min] or lower even though the factors from 1 to 13 are cleared, (the command is small, the load is heavy, the motor lock or hitting, driver/ motor fault etc.) 14 Other factor Note 2-100 Related Control Mode ○ ○ ○ While Pr3.15 is 1 (Speed zero clamp is valid.), the speed zero clamp input (ZEROSPD) is open. ○ ○ * Motor might run even though the other number than 0 is displayed. Refer to "6.In trouble". 15. How to Use the Front Panel 1 Before Using the Products Monitor Mode (EXECUTION display) (11) Display of No. of changes in I/O signals 2 No. of changes in I/O signals (the signal is invalid) Preparation Pin No. .....Input signal .....Output signal 6KLIWWKHIODVKLQJGHFLPDOSRLQWZLWK /HIWVLGHRIGHFLPDOSRLQW3LQ1RVHOHFWLRQ 3 Connection 5LJKWVLGHRIGHFLPDOSRLQW,QSXW2XWSXW3LQ1RVHOHFWLRQ 7KHVZLWFKRILQSXWRXWSXWE\SUHVVLQJRUEXWWRQ 4 Setup 6HOHFWWKH1RRISLQWKHQXPEHURIFKDQJHVRQWKDWSLQVKRXOGEHGLVSOD\HG E\SUHVVLQJRUEXWWRQ /RZHVWSODFH3LQ1R of output signal) 5 Adjustment (Highest place Pin No. of input signal) (12) Display of absolute encoder data 6 When in Trouble Encoder data ......One revolution data, Low order (L) 2QHUHYROXWLRQGDWD+LJKRUGHU + ......Multi-revolution data 6HOHFWWKHGDWDWREHGLVSOD\HGE\SUHVVLQJRUEXWWRQ 7 Supplement 2-101 15. How to Use the Front Panel Monitor Mode (EXECUTION display) (13) Display of absolute external scale position 'LVSOD\VWKHDEVROXWHSRVLWLRQRIVHULDODEVROXWHVFDOH ,IDVHULDOLQFUHPHQWDOVFDOHGLVSOD\VWKHVFDOHSRVLWLRQUHODWLYHWRWKHSRZHURQSRVLWLRQ ZKLFKLVGHÀQHGDV External scale data ......Absolute external scale position -Low order ......Absolute external scale position -High order Select encoder or external scale by pressing or button. (14) Display of No. of encoder/ external scale communication errors monitor No. of communication errors ......Encoder ......External scale Select encoder or external scale by pressing or button. (15) Display of communication axis address Displays the value set to Pr5.31 “Axis address”. (16) Display of encoder positional deviation [Encoder unit] encoder positional deviation [Encoder unit] ......Low order ......High order To switch between Low order (L) and High order (H), press 2-102 . 15. How to Use the Front Panel 1 Before Using the Products Monitor Mode (EXECUTION display) (17) Display of External Scale Deviation [External Scale Unit] 2 External Scale Deviation [External scale unit] Preparation ......Low order ......High order To switch between Low order (L) and High order (H), press . 3 (18) Display of hybrid deviation [Command unit] Connection Hybrid deviation [Command unit] ......Low order ......High order To switch between Low order (L) and High order (H), press 4 . Setup (19) Display of voltage across PN [V] 5 Displays the voltage across PN [V] (only for reference not an instrument) Adjustment (20) Display of Software Version Displays the software version of the driver. (Example of display: Ver 1.00) 6 When in Trouble (21) Display of driver serial number Driver serial number ......Driver serial number- Low order 7 ......Driver serial number- High order or . Supplement To switch between Low order (L) and High order (H), press (Example of display: Serial number 09010001) 2-103 15. How to Use the Front Panel Monitor Mode (EXECUTION display) (22) Display of motor serial number Motor serial number ......Motor serial number- Low order ......Motor serial number- High order To switch between Low order (L) and High order (H), press (Example of display: Serial number 09040001) or . (23) Display of accumulated operation time Displays accumulated operation time [h]. ......Low order ......High order To switch between Low order (L) and High order (H), press . (24) Automatic Motor Recognizing Function ......Automatic recognition is valid. ......Automatic recognition is invalid. (25) Display of temperature Displays the driver temperature [C]. (This is not meter readings but only for reference.) Displays the encoder temperature [C]. (This is not meter readings but only for reference.) 2-104 15. How to Use the Front Panel 1 Before Using the Products Monitor Mode (EXECUTION display) (26) Display of safety condition monitor 2 : Servo-off condition Preparation : Servo-on condition Dot information : Alarm condition Flashing Normal change is possible 3 Connection Servo ready condition OFF: Dot unlit ON: Dot lit 6HOHFWGHVLUHGPRQLWRURSWLRQE\SUHVVLQJRUEXWWRQ 4 ,QSXWSKRWRFRXSOHU21 ,QSXWSKRWRFRXSOHU2)) ,QSXWSKRWRFRXSOHU21 2XWSXWSKRWRFRXSOHU2)) 2XWSXWSKRWRFRXSOHU21 Setup ,QSXWSKRWRFRXSOHU2)) 5 Adjustment 6 When in Trouble 7 Supplement Related page P.7-2 “safety”. 2-105 15. How to Use the Front Panel 2 Parameter Setup Mode Preparation Monitor Mode SELECTION display (Mode switch button) EXECUTION display Parameter Setup Mode SELECTION display 3DUDPHWHU1R +H[DGHFLPDO1R Parameter value You can change the value which digit has a flashing decimal point. Class Note For parameters which place is displayed with “ ”, the content changed and written to EEPROM becomes valid after turning off the power once. 3UHVVRUWRVHOHFWSDUDPHWHU1R to be set. Pr0.00 Pr0.01 (SET button) Pr6.32 Pr6.33 Pr0.00 3UHVVDQGWKHIODVKLQJGHFLPDO separator shifts to the high order position, allowing the figure at this digit to any other figure. Pr0.01 3UHVVRUWRVHWXSWKHYDOXHRI parameter. (Value increases with decreases with .) 3UHVVDQGWKHIODVKLQJGHFLPDO separator shifts to the high order position, allowing the figure at this digit to any other figure. 3URORQJHGGHSUHVVLRQRIXSGDWHVWKH SDUDPHWHULQWKHGULYHU1RWHWKDWWKH parameter value selected by or is not reflected until is pressed in this way. 7RFDQFHOWKHYDOXHVHOHFWHGE\RU press instead of , and the driver internal parameter value is kept unchanged and the display returns to the parameter number display screen. Remarks After changing the parameter value and pressing , the content will be reflected in the control. 'RQRWH[WUHPHO\FKDQJHWKH parameter value which change might affect the motor movement very much (especially velocity loop or position loop gains). Pr0.11 Pr1.11 'LVSOD\WKH1RRISDUDPHWHUWREH changed and press to change to (;(&87,21GLVSOD\ (Mode switch button) EEPROM Writing Mode SELECTION display Note 2-106 $IWHUVHWWLQJXSSDUDPHWHUVUHWXUQWR6(/(&7PRGHUHIHUULQJWRVWUXFWXUHRIHDFKPRGH (P.2-88). (DFKSDUDPHWHUKDVDOLPLWLQQXPEHURISODFHVIRUXSSHUVKLIWLQJ Preparation EEPROM Writing Mode Parameter Setup Mode SELECTION display 0RGHVZLWFKEXWWRQ 2 EXECUTION display EEPROM Writing Mode SELECTION display Preparation 7RZULWHWKHSDUDPHWHUWR((3520SUHVV WRFKDQJHWR(;(&87,21GLVSOD\ 1 Before Using the Products 15. How to Use the Front Panel 2 .HHSSUHVVLQJXQWLOWKHGLVSOD\ changes to when you execute writing. * “Start” flashes instantaneously and is difficult to check visually. 3 Connection “ ” increases while keep pressing (for approx. 5sec) as the right fig. shows. 4 Starts writing. Setup (SET button) Writing completes Writing error When you change the parameters which contents become valid after resetting, will be displayed after finishing wiring. Turn off the control power once to reset. Auxiliary Function Mode SELECTION display Caution is displayed indicating that no writing is made to EEPROM. 2-107 7 Supplement 1. When writing error occurs, make writing again. If the writing error repeats many times, this might be a failure. 2. Don't turn off the power during EEPROM writing. Incorrect data might be written. If this happens, set up all of parameters again, and re-write after checking the data. :KHQWKHHUURUGHÀQHGE\(UU´8QGHUYROWDJHSURWHFWLRQRIFRQWUROSRZHUVXSSO\µ occurs, 6 When in Trouble 0RGHVZLWFKEXWWRQ Adjustment Note 5 2 Preparation 15. How to Use the Front Panel Auxiliary Function Mode (SELECTION display) EEPROM Writing Mode SELECTION display 0RGHVZLWFKEXWWRQ EXECUTION display Auxiliary Function Mode SELECTION display 7RVHOHFWWKHGHVLUHGDX[LOLDU\IXQFWLRQ SUHVVRU Display example $ODUP&OHDU Description Pages to refer $ODUP&OHDU 3 3UHVVLQJ $ODUPFOHDUVWDUWV $ODUPFOHDUFRPSOHWHV $$XWRPDWLF 2IIVHW$GMXVWPHQW $$XWRPDWLF 2IIVHW$GMXVWPHQW 3 $$XWRPDWLF 2IIVHW$GMXVWPHQW $$XWRPDWLF 2IIVHW$GMXVWPHQW 3 $$XWRPDWLF 2IIVHW$GMXVWPHQW $$XWRPDWLF 2IIVHW$GMXVWPHQW 3 0RWRU7ULDO5XQ 3 &OHDULQJRI $EVROXWH(QFRGHU &OHDULQJRI $EVROXWH(QFRGHU 3 ,QLWLDOL]DWLRQRI SDUDPHWHU ,QLWLDOL]DWLRQRI SDUDPHWHU 3 5HOHDVHRI IURQWSDQHOORFN 5HOHDVHRI IURQWSDQHOORFN 3 7ULDO5XQ $ODUP&OHDU 7'LVSOD\WKHDX[LOLDU\IXQFWLRQWREH FKDQJHGDQGSUHVVWRFKDQJHWR (;(&87,21GLVSOD\ 0RGHVZLWFKEXWWRQ Monitor Mode SELECTION display 2-108 6(7EXWWRQ Preparation Auxiliary Function Mode (EXECUTION display) 1) Alarm Clear Screen This function releases the current alarm status. Certain alarms will persist. If this is the case, refer to P.6-2 “When in Trouble - Protective Function”. 3UHVVWRFDOOIRU (;(&87,21GLVSOD\ (SET button) 2 Preparation EXECUTION display SELECTION display 1 Before Using the Products 15. How to Use the Front Panel 2 .HHSSUHVVLQJXQWLOWKHGLVSOD\FKDQJHVWR ZKHQ\RXH[HFXWHDODUPFUHDU 3 Connection ´µLQFUHDVHVZKLOHNHHS SUHVVLQJ IRUDSSUR[VHF DVWKHOHIWILJVKRZV 4 $ODUPFOHDUVWDUWV Setup &OHDULQJ ILQLVKHV $ODUPFOHDUFRPSOHWHV &OHDULVQRWILQLVKHG 5HOHDVHWKHHUURUE\ UHVHWWLQJWKHSRZHU 5 Adjustment 6 When in Trouble 7 After alarm cleaning, return to SELECTION display, referring to structure of each mode (P.2-88). 2-109 Supplement Note 15. How to Use the Front Panel Auxiliary Function Mode (EXECUTION display) (2) Analog inputs 1 to 3 automatic offset adjustment This function automatically adjusts offset setting of analog input. Analog input 1 (AI1)......Pr4.22 (Analog input 1 (AI1) offset setup) Analog input 2 (AI2)......Pr4.25 (Analog input 2 (AI2) offset setup) Analog input 3 (AI3)......Pr4.28 (Analog input 1 (AI3) offset setup) EXECUTION display SELECTION display ([DPSOHRI$QDORJLQSXW $, 6(7EXWWRQ :KHQ\RXH[HFXWHDXWRPDWLFRIIVHWDGMXVWPHQWPDNH FRPPDQGLQSXWWR9WKHQNHHSSUHVVLQJXQWLOWKHGLVSOD\ FKDQJHVWR 3UHVVWRFDOOIRU (;(&87,21GLVSOD\ ´µLQFUHDVHVZKLOHNHHS SUHVVLQJ IRUDSSUR[VHF DVWKHOHIWILJVKRZV $XWRPDWLFRIIVHWDGMXVWPHQWVWDUWV $GMXVWPHQW ILQLVKHV $XWRPDWLFRIIVHW DGMXVWPHQWILQLVKHV Remarks Note 2-110 (UURURFFXUV ( ,QYDOLGPRGHLVVHOHFWHG RURIIVHWYDOXHH[FHHGV WKHVHWXSUDQJHRI3U Host controller Servo driver Process of analog torque command input ZEROSPD input Speed limit value (Parameter) Speed zero clamp (ZEROSPD) function AT-SPEED output Setup Analog torque command (AI1, ±10V) Torque control section 5 Attained speed output V-COIN output Speed coincidence output Adjustment Process of analog torque command input Speed limit input (AI1, ±10V) Process of speed limit input ZEROSPD input AT-SPEED output V-COIN output Servo driver Speed zero clamp (ZEROSPD) function 6 Torque control section When in Trouble Host controller Analog torque command (AI2, ±10V) Attained speed output Speed coincidence output 7 5HODWHGSDJH Supplement Note 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXW 3´&RQWURO%ORFN'LDJUDPµ3´:LULQJ'LDJUDPWRWKHFRQQHFWRU;µ 3-9 1. Outline of mode Torque Control Mode Function (1) Process of analog torque command input 7KLV SURFHVV FRQYHUWV WKH DQDORJ WRUTXH FRPPDQG LQSXW YROWDJH WR WKH HTXLYDOHQW GLJLWDOWRUTXHFRPPDQGKDYLQJWKHVDPHHIIHFW Parameter No. Title Pr3.18 Torque command direction selection Pr3.19 ,QSXWJDLQRIWRUTXH command Pr3.20 ,QSXWUHYHUVDORIWRUTXH command Pr4.22 Pr4.23 5DQJH Unit 0 to 1 — 10 to 100 Function 6HOHFWWKHGLUHFWLRQSRVLWLYHQHJDWLYH direction of torque command. %DVHGRQWKHYROWDJH 9 DSSOLHGWRWKH 0.1V DQDORJWRUTXHFRPPDQG 7545 VHWXS WKHFRQYHUVLRQJDLQWRWRUTXHFRPPDQG 0 to 1 — 6HWXSWKHSRODULW\RIWKHYROWDJHDSSOLHG WRWKHDQDORJWRUTXHFRPPDQG 7545 $QDORJLQSXW $, offset setup ïWR 5578 0.359mV 6HWXSWKHRIIVHWFRUUHFWLRQYDOXHDSSOLHG WRWKHYROWDJHIHGWRWKHDQDORJLQSXW $QDORJLQSXW $, ÀOWHU 0 to 6400 0.01ms 6HWXSWKHWLPHFRQVWDQWRIVWGHOD\ÀOWHU WKDWGHWHUPLQHVWKHODJWLPHEHKLQGWKH YROWDJHDSSOLHGWRWKHDQDORJLQSXW 5HOHYDQWSDUDPHWHUV Parameter No. Note 3-10 Title Pr3.18 Torque command direction selection Pr3.19 ,QSXWJDLQRIWRUTXH command Pr3.20 ,QSXWUHYHUVDORIWRUTXH command Pr4.25 Pr4.26 5DQJH Unit 0 to 1 — 10 to 100 Function 6HOHFWWKHGLUHFWLRQSRVLWLYHQHJDWLYH direction of torque command. %DVHGRQWKHYROWDJH 9 DSSOLHGWRWKH 0.1V DQDORJWRUTXHFRPPDQG 7545 VHWXS WKHFRQYHUVLRQJDLQWRWRUTXHFRPPDQG 0 to 1 — 6HWXSWKHSRODULW\RIWKHYROWDJHDSSOLHG WRWKHDQDORJWRUTXHFRPPDQG 7545 $QDORJLQSXW $, offset setup ïWR 5.86mV 6HWXSWKHRIIVHWFRUUHFWLRQYDOXHDSSOLHG WRWKHYROWDJHIHGWRWKHDQDORJLQSXW $QDORJLQSXW $, ÀOWHU 0 to 6400 0.01ms 6HWXSWKHWLPHFRQVWDQWRIVWGHOD\ÀOWHU WKDWGHWHUPLQHVWKHODJWLPHEHKLQGWKH YROWDJHDSSOLHGWRWKHDQDORJLQSXW )RUGHWDLOVRIWKHVHSDUDPHWHUVUHIHUWR3DQG´'HWDLOVRISDUDPHWHUµ 1. Outline of mode 1 Before Using the Products Torque Control Mode (2) Speed limit function 7KHVSHHGOLPLWLVRQHRISURWHFWLYHIXQFWLRQVXVHGGXULQJWRUTXHFRQWURO 7KLVIXQFWLRQUHJXODWHVWKHPRWRUVSHHGVRWKDWLWGRHVQRWH[FHHGWKHVSHHGOLPLWZKLOH 2 WKHWRUTXHLVFRQWUROOHG Caution :KLOHWKHVSHHGOLPLWLVXVHGWRFRQWUROWKHPRWRUWKHWRUTXHFRPPDQGDSSOLHGWRWKH VKRXOGKDYHWKHIROORZLQJUHVXOWWKHPRWRUVSHHGLVHTXDOWRWKHVSHHGOLPLW 5HOHYDQWSDUDPHWHUV Parameter No. Title 5DQJH Unit 6SHHGOLPLWYDOXH 0 to 20000 UPLQ Pr3.22 6SHHGOLPLWYDOXH 0 to 20000 UPLQ Pr3.15 6SHHG]HURFODPS function selection 0 to 3 — Function 3 6HWXSWKHVSHHGOLPLWXVHGIRUWRUTXH FRQWUROOLQJ Parameter No. 5DQJH Unit Function Pr3.02 ,QSXWJDLQRIVSHHG command 10 to 2000 UPLQ 9 %DVHGRQWKHYROWDJHDSSOLHGWRWKH DQDORJVSHHGFRPPDQG 635 VHWXSWKH FRQYHUVLRQJDLQWRPRWRUFRPPDQGVSHHG Pr4.22 $QDORJLQSXW $, offset setup ïWR 5578 0.359mV 6HWXSWKHRIIVHWFRUUHFWLRQYDOXHDSSOLHG WRWKHYROWDJHIHGWRWKHDQDORJLQSXW Pr4.23 $QDORJLQSXW $, ÀOWHU 0 to 6400 0.01ms 6HWXSWKHWLPHFRQVWDQWRIVWGHOD\ÀOWHU WKDWGHWHUPLQHVWKHODJWLPHEHKLQGWKH YROWDJHDSSOLHGWRWKHDQDORJLQSXW Pr3.15 6SHHG]HURFODPS function selection 0 to 3 — 7XUQRQWKHSRZHUDIWHUFKHFNLQJWKHZLULQJ &KHFN WKH YDOXHV LQLWLDO IHHGEDFN SXOVH VXP DQG H[WHUQDO VFDOH IHHGEDFN SXOVH VXP ZLWK WKH front panel. 0RYHWKHZRUNDQGFKHFNWKHWUDYHOIURPWKHLQLWLDOYDOXHVRIWKHDERYH ,IWKHWUDYHORIWKHIHHGEDFNSXOVHVXPDQGWKHH[WHUQDOVFDOHIHHGEDFNSXOVHVXPDUHUHYHUVHGLQ SRVLWLYHDQGQHJDWLYHVHWXSWKHUHYHUVDORIH[WHUQDOVFDOHGLUHFWLRQ 3U WR 6HWXSWKHH[WHUQDOVFDOHGLYLVLRQUDWLR 3U3U XVLQJWKHIRUPXODEHORZ 7RWDOYDULDWLRQRIIHHGEDFNSXOVHVXP ([WHUQDOVFDOHGLYLVLRQUDWLR 7RWDOYDULDWLRQRIH[WHUQDOVFDOHIHHGEDFNSXOVHVXP ,IWKHGHVLJQYDOXHRIWKHH[WHUQDOVFDOHGLYLVLRQUDWLRLVREWDLQHGVHWXSWKLVYDOXH Note 5HODWHGSDJH 3-12 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKFRQQHFWRU; 3´&RQWURO%ORFN'LDJUDPµ3´:LULQJ'LDJUDPWRWKHFRQQHFWRU;µ 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ3´'HWDLOVRISDUDPHWHUµ Pr3.24 Pr3.25 1. Outline of mode 1 2 Preparation 6HWXSDSSURSULDWHYDOXHRIK\EULGGHYLDWLRQH[FHVV 3U LQFRPPDQGXQLWLQRUGHUWRDYRLG WKHGDPDJHWRWKHPDFKLQH $VHULHVGULYHUFDOFXODWHVWKHGLIIHUHQFHEHWZHHQWKHHQFRGHUSRVLWLRQDQGWKHH[WHUQDOVFDOH SRVLWLRQDVK\EULGGHYLDWLRQDQGLVXVHGWRSUHYHQWWKHPDFKLQHUXQDZD\RUGDPDJHLQFDVHRI WKHH[WHUQDOVFDOHEUHDNGRZQRUZKHQWKHPRWRUDQGWKHORDGLVGLVFRQQHFWHG ,IWKHK\EULGGHYLDWLRQH[FHVVUDQJHLVWRRZLGHGHWHFWLRQRIWKHEUHDNGRZQRUWKHGLVFRQQHFWLRQ ZLOOEHGHOD\HGDQGHUURUGHWHFWLRQHIIHFWZLOOEHORVW,IWKLVLVWRRQDUURZLWPD\GHWHFWWKHQRUPDO GLVWRUWLRQEHWZHHQWKHPRWRUDQGWKHPDFKLQHXQGHUQRUPDORSHUDWLRQDVDQHUURU :KHQ WKH H[WHUQDO VFDOH GLYLVLRQ UDWLRQ LV QRW FRUUHFW K\EULG GHYLDWLRQ H[FHVV HUURU (UU PD\RFFXUHVSHFLDOO\ZKHQWKHZRUNWUDYHOVORQJGLVWDQFHHYHQWKRXJKWKHH[WHUQDOVFDOHDQG WKHPRWRUSRVLWLRQPDWFKHV ,QWKLVFDVHZLGHQWKHK\EULGGHYLDWLRQH[FHVVUDQJHE\PDWFKLQJWKHH[WHUQDOVFDOHGLYLVLRQUDWLRWRWKHFORVHVWYDOXH Before Using the Products Full-closed Control Mode 3 Connection Function (1) Selection of external scale type 6HOHFWWKHW\SHRIH[WHUQDOVFDOHWREHXVHG 5HOHYDQWSDUDPHWHUV Parameter No. Pr3.23 Note External scale selection 5HYHUVDORIGLUHFWLRQRI external scale 5DQJH 4 Function 0 to 2 6HOHFWWKHW\SHRIH[WHUQDOVFDOH 0 to 1 5HYHUVHWKHGLUHFWLRQRIH[WHUQDOVFDOHIHHGEDFN counter. Setup Pr3.26 Title )RUGHWDLOVRIWKHVHSDUDPHWHUVUHIHUWR330 and 31´'HWDLOVRISDUDPHWHUµ 6HWXSRIH[WHUQDOVFDOHGLYLVLRQUDWLR 6HWXSWKHGLYLVLRQUDWLRRIHQFRGHUUHVROXWLRQDQGH[WHUQDOVFDOHUHVROXWLRQ 5HOHYDQWSDUDPHWHUV Pr3.24 Pr3.25 Note Title 1XPHUDWRURIH[WHUQDO VFDOHGLYLVLRQ 'HQRPLQDWRURI H[WHUQDOVFDOHGLYLVLRQ 5DQJH 0 to 220 1 to 220 Function 6HWXSWKHQXPHUDWRURIWKHH[WHUQDOVFDOHGLYLGLQJ setup. 6HWXSWKH'HQRPLQDWRURIWKHH[WHUQDOVFDOH GLYLGLQJVHWXS )RUGHWDLOVRIWKHVHSDUDPHWHUVUHIHUWR331´'HWDLOVRISDUDPHWHUµ 6 6HWXSRIK\EULGH[FHVVLYHGHYLDWLRQ 5DQJH Pr3.28 +\EULGGHYLDWLRQ excess setup 1 to 227 Pr3.29 +\EULGGHYLDWLRQFOHDU setup 0 to 100 Function ³@1RIXQFWLRQDVVLJQHG 5HODWHGSDJH P.3-50 7 Supplement 3-37 4. Inputs and outputs on connector X4 Input Signal and Pin No. Function allocatable to control input Title of VLJQDO 6HUYR21LQSXW Symbol 65921 Related control mode 'HIDXOWDVVLJQPHQW 29 (SI6) ,)FLUFXLW P S T F SI 3-30 SDJH 7KLVVLJQDOWXUQVRQRIIWKHVHUYR PRWRU Title of VLJQDO 3RVLWLYHGLUHFWLRQRYHUWUDYHOLQKLELWLRQLQSXW Symbol POT 'HIDXOWDVVLJQPHQW Related control mode 9 (SI2) ,)FLUFXLW P S T F SI 3-30 SDJH 3RVLWLYHGLUHFWLRQRYHUWUDYHOLQKLELWLQSXW 7KH RSHUDWLRQ ZLWK WKLV LQSXW WXUQHG 21 LV VHW XS LQ 3U ´6HWXS RI RYHUWUDYHO LQKLELW LQSXWµ :KHQXVLQJWKLVLQSXWVHW3U´6HWXSRIRYHUWUDYHOLQKLELWLQSXWµWRDYDOXHRWKHUWKDQ VRWKDWWKHLQSXWLV21ZKHQWKHPRYLQJSRUWLRQRIWKHPDFKLQHH[FHHGVWKLVVLJQDOUDQJH WRZDUGSRVLWLYHGLUHFWLRQ Title of VLJQDO 1HJDWLYHGLUHFWLRQRYHUWUDYHOLQKLELWLRQLQSXW Symbol NOT 'HIDXOWDVVLJQPHQW Related control mode 8 (SI1) ,)FLUFXLW P S T F SI 3-30 SDJH 1HJDWLYHGLUHFWLRQRYHUWUDYHOLQKLELWLQSXW 7KH RSHUDWLRQ ZLWK WKLV LQSXW WXUQHG 21 LV VHW XS LQ 3U ´6HWXS RI RYHUWUDYHO LQKLELW LQSXWµ :KHQXVLQJWKLVIXQFWLRQVHW3U´6HWXSRIRYHUWUDYHOLQKLELWLQSXWµWRDYDOXHRWKHUWKDQ VRWKDWWKHLQSXWLV21ZKHQWKHPRYLQJSRUWLRQRIWKHPDFKLQHH[FHHGVWKLVVLJQDOUDQJH WRZDUGQHJDWLYHGLUHFWLRQ Title of VLJQDO 'HYLDWLRQFRXQWHUFOHDULQSXW Symbol CL Related control mode 'HIDXOWDVVLJQPHQW 30 (SI7) ,)FLUFXLW P S T F SI 3-30 SDJH &OHDUVWKHSRVLWLRQDOGHYLDWLRQFRXQWHU 'HIDXOWVHWXSFOHDUVWKHFRXQWHUDWWKHULVLQJHGJHRIWKHFOHDULQSXW7RFKDQJHWKHVHWXS PRGLI\LWLQWKH3U´&RXQWHUFOHDULQSXWPRGHµ Pr5.17 CL signal width 'HYLDWLRQFOHDUWLPLQJ 1 ѥVRUPRUH 2 1 ms or more &RQWLQXDOO\FOHDUWKHFRXQWHUZKLOHWKHGHYLDWLRQFRXQWHU FOHDULQSXWLV21*1 3 ѥVRUPRUH 2QO\ RQFH FOHDU WKH FRXQWHU DW 2)) WR 21 HGJH RI WKH 4 1 ms or more GHYLDWLRQFRXQWHUFOHDULQSXWVLJQDO*1 'HYLDWLRQFRXQWHUFOHDULQSXW212)) LQSXWSKRWRFRXSOHU212)) Caution 5HODWHGSDJH 3-38 7KLV IXQFWLRQ FDQ EH DVVLJQHG WR RQO\ 6,$OORFDWLRQ RI WKLV IXQFWLRQ WR DQ\ RWKHU SLQ ZLOO cause an error. 3´'HWDLOVRI3DUDPHWHUµ 4. Inputs and outputs on connector X4 1 Title of VLJQDO Alarm clear input Symbol $&/5 Related control mode 'HIDXOWDVVLJQPHQW 31 (SI8) ,)FLUFXLW P S T F SI 3-30 SDJH &OHDUVWKHDODUPFRQGLWLRQ 7KLVLQSXWFDQQRWFOHDUVRPHDODUPV )RUGHWDLOVUHIHUWR3:KHQLQ7URXEOH´3URWHFWLYHIXQFWLRQµ3´ $ODUP'LVSOD\µ DQG3´'LVSOD\RI%DWWHU\$ODUPµ Command pulse inhibition input Symbol INH 'HIDXOWDVVLJQPHQW Related control mode 33 (SI10) ,)FLUFXLW P S T 2 F SI 3-30 SDJH 3 ,JQRUHVWKHSRVLWLRQDOFRPPDQGSXOVH :KHQXVLQJWKLVIHDWXUHVHW3U´,QYDOLGDWLRQRIFRPPDQGSXOVHLQKLELWLRQLQSXWµWR 7KLVIXQFWLRQFDQEHDVVLJQHGWRRQO\6,$OORFDWLRQRIWKLV IXQFWLRQWRDQ\RWKHUSLQZLOO cause an error. Title of VLJQDO Control mode switching input Symbol C-MODE 'HIDXOWDVVLJQPHQW Related control mode 32 (SI9) ,)FLUFXLW P S T F SI 3-30 SDJH 4 6HOHFWVDFRQWUROPRGH Caution (OHFWURQLFJHDU GLYLVLRQPXOWLSOLFDWLRQ VZLWFKLQJLQSXW Symbol DIV1 Title of VLJQDO (OHFWURQLFJHDU GLYLVLRQPXOWLSOLFDWLRQ VZLWFKLQJLQSXW Symbol DIV2 'HIDXOWDVVLJQPHQW 'HIDXOWDVVLJQPHQW Related control mode 28 (SI5) ,)FLUFXLW Related control mode — ,)FLUFXLW P Setup 7KLVVLJQDOLVUHTXLUHGLQDOOFRQWUROPRGHV1RVHWWLQJZLOOFDXVHDQHUURU 'RQRWLQSXWDQ\FRPPDQGPVEHIRUHDQGDIWHUFKDQJLQJWKHFRQWUROPRGH Title of VLJQDO S T F SI 3-30 SDJH P S T F OFF OFF 21 21 Title of VLJQDO Damping control switching input 1 Symbol VS-SEL1 Title of VLJQDO Damping control switching input 2 Symbol VS-SEL2 'HIDXOWDVVLJQPHQW 'HIDXOWDVVLJQPHQW Related control mode 26 (SI3) ,)FLUFXLW Related control mode — ,)FLUFXLW P 6 S T F SI 3-30 SDJH P S T F SI 3-30 SDJH $OVRUHIHUWR3´3U>'DPSLQJÀOWHUVZLWFKLQJVHOHFWLRQ@µ 3-39 7 Supplement 6HOHFWVDSSOLFDEOHIUHTXHQF\IRUGDPSLQJFRQWURO &RPELQDWLRQRIGDPSLQJFRQWUROLQSXWFKDQJHRYHUDQG 966(/966(/ HQDEOHV select of max. 4 options. Note When in Trouble OFF 21 OFF 21 6HOHFWHGFRPPDQGGLYLGLQJPXOWLSO\LQJSURFHVV Numerator Denominator Pr0.09 Pr0.10 Pr5.00 Pr0.10 Pr5.01 Pr0.10 Pr5.02 Pr0.10 Adjustment DIV2 5 SI 3-30 SDJH 8SWRQXPHUDWRUVFDQEHXVHGIRUFRPPDQGGLYLGLQJPXOWLSO\LQJE\XVLQJ',9DQG',9 ',9DQG',9YVQXPHUDWRUGHQRPLQDWRURIVHOHFWHGFRPPDQGGLYLGLQJPXOWLSO\LQJSURFHVV! DIV1 Connection Caution Preparation Title of VLJQDO Before Using the Products Input Signal and Pin No. 4. Inputs and outputs on connector X4 Input Signal and Pin No. Title of VLJQDO Gain switching input Symbol GAIN Related control mode 'HIDXOWDVVLJQPHQW 27 (SI4) P S T F SI 3-30 SDJH ,)FLUFXLW 6HOHFWVWRUQGJDLQ Title of VLJQDO Torque limit switching input Symbol TL-SEL Related control mode 'HIDXOWDVVLJQPHQW — P S T F SI 3-30 SDJH ,)FLUFXLW Select 1st or 2nd torque limit. Pr5.21 Torque limit switching input (TL-SEL) Torque limit switching setup (Pr5.23, Pr5.24) 3RVLWLYHGLUHFWLRQ Torque limit $QDORJLQSXW*1 0 1 — — 2 — — 3 OFF 21 Pr0.13 Pr0.13 Pr5.22 Pr0.13 Valid Pr5.22 4 $QDORJLQSXW*1 5 6 1HJDWLYHGLUHFWLRQ Torque limit OFF 21 — Pr0.13 Pr5.22 Pr5.25 Pr5.26 *1 7RVSHFLI\WKHWRUTXHOLPLWYDOXHE\DQDQDORJLQSXWUHIHUWR3U´$QDORJWRUTXHOLPLWIXQFWLRQµ 6HWXSRIUDWHRIFKDQJHDIWHUWRUTXHOLPLWVZLWFKRYHU :KHQ DSSO\LQJ 3U ´7RUTXH OLPLW VHOHFWLRQµ FKDQJLQJ UDWH RI WRUTXH VORSH DIWHU VHOHFWLQJQHZWRUTXHOLPLWFDQEHFKDQJHG :KHQFKDQJLQJIURPWKHVWWRUTXHOLPLWWRQGWRUTXHOLPLWWKHFKDQJLQJUDWH VORSH VHWDW 3U ´7RUTXH OLPLW VHOHFWLRQ VHWXS µ LV DSSOLHG DIWHU FKDQJLQJ IURP WKH QG WRUTXH OLPLW WRVWWRUTXHOLPLWWKHFKDQJLQJUDWH VORSH VHWDW3U´7RUTXHOLPLWVHOHFWLRQVHWXSµLV DSSOLHG7KHVLJQRIWKHFKDQJLQJUDWHLVDXWRPDWLFDOO\VHOHFWHGE\WKHGULYHUDFFRUGLQJWRWKH GLIIHUHQFHLQYDOXHEHWZHHQWKHVWDQGQGWRUTXHOLPLW ,I3U´7RUTXHOLPLWVHOHFWLRQVHWXSµDQG3U´7RUTXHOLPLWVHOHFWLRQVHWXSµDUHVHWWR VZLWFKRYHULVLQVWDQWDQHRXV Torque limit selection input (TL-SEL) 1st torque limit (Pr0.13) 2nd torque limit (Pr5.22) Caution Torque limit selection setup 1 (Pr5.23) Torque limit selection setup 2 (Pr 5.24) :KHQWKHVWWRUTXHOLPLW 3U DQGQGWRUTXHOLPLW 3U DUHFKDQJHGIURPWKHIURQW SDQHORUWKURXJKFRPPXQLFDWLRQWKHFKDQJLQJUDWHVHWXSLVLJQRUHGDQGWKHQHZWRUTXHOLPLW YDOXHLVLPPHGLDWHO\DQGGLUHFWO\DSSOLHG7KDWLVFKDQJLQJUDWHVHWWLQJLVHIIHFWLYHRQO\ZKHQ WKHVHOHFWLRQLVPDGHE\XVLQJWKHWRUTXHOLPLWVHOHFWLQSXW 7/6(/ 5HODWHGSDJH 3-40 3´'HWDLOVRI3DUDPHWHUµ 4. Inputs and outputs on connector X4 1 Selection 1 input of internal command speed Symbol INTSPD1 Title of VLJQDO Selection 2 input of internal command speed Symbol INTSPD2 Title of VLJQDO Selection 3 input of internal command speed Symbol INTSPD3 'HIDXOWDVVLJQPHQW 'HIDXOWDVVLJQPHQW 'HIDXOWDVVLJQPHQW Related control mode 33 (SI10) P Related control mode P F S T F SI 3-30 SDJH ,)FLUFXLW Related control mode 28 (SI5) T SI 3-30 SDJH ,)FLUFXLW 30 (SI7) S P S T F SI 3-30 SDJH ,)FLUFXLW 6HOHFWRQHRILQWHUQDOFRPPDQGVSHHGV 5HODWLRQVKLSEHWZHHQ3U´6ZLWFKLQJEHWZHHQLQWHUQDODQGH[WHUQDOVSHHGVHWXSµ and internal command speed selection 1-3 and the speed command selected>. Pr3.00 2 Selection 2 of internal command speed (INTSPD2) OFF OFF 21 21 OFF OFF 21 21 21 Selection of speed command 1st speed 2nd speed 3rd speed WKVSHHG 1st speed 2nd speed 3rd speed $QDORJVSHHG command VWWRWKVSHHG WKVSHHG WKVSHHG WKVSHHG WKVSHHG 1RHIIHFW 1RHIIHFW OFF 21 21 21 21 4 INTSPD2 Speed command [r/min] open COMï open COMï 4th open INTSPD2 open INTSPD3 open 2nd 1st Speed command [r/min] Speed zero clamp input Symbol =(5263' COMï COMï 8th 4th 1st 2nd 5th 6 1st Example 2) When Pr3.00=3 Related control mode 'HIDXOWDVVLJQPHQW 6th 3rd 26 (SI3) ,)FLUFXLW P S T F SI 3-30 SDJH 6HWWKHVSHHGFRPPDQGWR :KHQXVLQJVHW3U´6SHHG]HURFODPSIXQFWLRQVHOHFWLRQµWRDYDOXHRWKHUWKDQ Speed command sign input Symbol VC-SIGN Related control mode 'HIDXOWDVVLJQPHQW — ,)FLUFXLW P S T 7 F SI 3-30 SDJH 6SHFLI\WKHVLJQRIVSHHGFRPPDQGLQSXWDWYHORFLW\FRQWURO 5HIHUWR3´3U6SHHGFRPPDQGURWDWLRQDOGLUHFWLRQVHOHFWLRQµ 3-41 Supplement Title of VLJQDO When in Trouble Example 1) When Pr3.00=1 or 2 Title of VLJQDO COMï 7th 3rd 1st INTSPD1 5 Adjustment ,QWHUQDOFRPPDQGVSHHGVZLWFKLQJSDWWHUQVKRXOGEHVRDUUDQJHGDVVKRZQEHORZWKDWVLQJOH LQSXWVLJQDOVDUHVHOHFWHGDOWHUQDWHO\,IRUPRUHLQSXWVLJQDOVDUHVHOHFWHGVLPXOWDQHRXVO\ XQVSHFLÀHGLQWHUQDOFRPPDQGVSHHGPD\EHDGYHUWHQWO\VHOHFWHGZKRVHVHWWLQJYDOXHDQG DFFHOHUDWLRQGHFHOHUDWLRQVHWWLQJZLOOFDXVHXQH[SHFWHGRSHUDWLRQ INTSPD1 3 Setup 7KHVDPHDV3U OFF OFF 21 OFF OFF 21 21 21 3 Caution Selection 3 of internal command speed (INTSPD3) Connection 1 Selection 1 of internal command speed (INTSPD1) OFF 21 OFF 21 OFF 21 OFF 2 Preparation Title of VLJQDO Before Using the Products Input Signal and Pin No. 4. Inputs and outputs on connector X4 Input Signal and Pin No. Title of VLJQDO Torque command sign input Symbol TC-SIGN Related control mode 'HIDXOWDVVLJQPHQW — ,)FLUFXLW P S T F SI 3-30 SDJH 6SHFLI\WKHVLJQRIWRUTXHFRPPDQGLQSXWDWWRUTXHFRQWURO 21 OFF 1HJDWLYHGLUHFWLRQ 3RVLWLYHGLUHFWLRQ 5HIHUWR3´3U7RUTXHFRPPDQGGLUHFWLRQVHOHFWLRQµ Title of VLJQDO Forced alarm input Symbol E-STOP Related control mode 'HIDXOWDVVLJQPHQW — ,)FLUFXLW P S T F SI 3-30 SDJH *HQHUDWHV(UU´)RUFHGDODUPLQSXWHUURUµ Title of VLJQDO Inertia ratio switching input Symbol J-SEL Related control mode 'HIDXOWDVVLJQPHQW — ,)FLUFXLW P S T F SI 3-30 SDJH 6HOHFWVVWLQHUWLDUDWLRRUQGLQHUWLDUDWLRDFFRUGLQJWRWKHLQHUWLDUDWLRVHOHFWLQSXW -6(/ Inertia ratio switching input (J-SEL) Applicable inertia ratio OFF 1st Inertia ratio (Pr0.04) 21 2nd Inertia ratio (Pr6.12) 5HIHUWR3´3U)XQFWLRQH[SDQVLRQVHWXSµ Note 3-42 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXW 4. Inputs and outputs on connector X4 1 Before Using the Products Input Signal and Pin No. Input Signals (Analog Command) 14 Pin 1R 16 Pin 1R 18 Title of VLJQDO AI1 input Symbol AI1 Title of VLJQDO AI2 input Symbol AI2 Title of VLJQDO AI3 input Symbol AI3 Correspondence function 2 635754563/ Correspondence function Preparation Pin 1R 75453$7/ Correspondence function N-ATL 3 Function allocatable to Input Signals (Analog Command) 3RVLWLYHGLUHFWLRQ7RUTXHOLPLWLQSXW Symbol P-ATL Title of VLJQDO 1HJDWLYHGLUHFWLRQ7RUTXHOLPLWLQSXW Symbol N-ATL Related control mode P S T F $, 3-31 SDJH ,)FLUFXLW Related control mode P S T F $, 3-31 SDJH ,)FLUFXLW Connection Title of VLJQDO 4 6SHFLI\WKHWRUTXHOLPLWIRUHDFKGLUHFWLRQYDOXHE\WKHDQDORJYROWDJH 3RVLWLYHGLUHFWLRQ Torque limit input (P-ATL) 1HJDWLYHGLUHFWLRQ Torque limit input (N-ATL) 3RVLWLYHGLUHFWLRQ Torque limit 1HJDWLYHGLUHFWLRQ Torque limit 0 0 to 10V ïWR9 3$7/ 1$7/ Setup Pr5.21 1 6HWXSWKURXJKSDUDPHWHU*1 — 2 3 4 0 to 10V 0 to 10V 5 0 to 10V 1RHIIHFW — 5 1$7/ 3$7/ Setup by parameter *1 * :KHQVSHFLI\LQJWKHWRUTXHOLPLWYDOXHWKURXJKWKHSDUDPHWHUUHIHUWR3´7RUTXHOLPLW VHOHFWIXQFWLRQµ Adjustment 6 3$7/ 6 When in Trouble 7 Supplement Note 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXW 3-43 4. Inputs and outputs on connector X4 Input Signal and Pin No. Title of VLJQDO Speed command input Symbol 635 Related control mode ,)FLUFXLW P S T F $, 3-31 SDJH ,QSXWWKHVSHHGFRPPDQGLQWKHIRUPRIDQDORJYROWDJH 7KHWDEOHEHORZVKRZVUHODWLRQVKLSEHWZHHQWKHFRPELQDWLRQRI3U´6ZLWFKLQJEHWZHHQ LQWHUQDODQGH[WHUQDOVSHHGVHWXSµ3U´6SHHGFRPPDQGGLUHFWLRQVHOHFWLRQµ3U ´6SHHGFRPPDQGLQSXWLQYHUVLRQµDQDORJVSHHGFRPPDQG 635 RI,)FRQQHFWRUDQGVSHHG FRPPDQGVLJQVHOHFWLRQ 9&6,*1 DQGWKHPRWRUURWDWLRQDOGLUHFWLRQDQGWKHFRQYHUVLRQ JUDSKRIDQDORJVSHHGFRPPDQGLQSXWYROWDJHWRWKHVSHHGFRPPDQG Pr3.00 Pr3.01 Pr3.03 Speed command input 635 Speed command sign selection (VC-SIGN) 9ROWDJH (0 to 10V) 1RHIIHFW ï9ROWDJH ïWR9 1RHIIHFW 9ROWDJH (0 to 10V) 1RHIIHFW ï9ROWDJH ïWR9 1RHIIHFW 0 0 1 0 1 Title of VLJQDO Torque command input Symbol 7545 1RHIIHFW 9ROWDJH (0 to 10V) ï9ROWDJH ïWR9 9ROWDJH (0 to 10V) ï9ROWDJH ïWR9 OFF 1HJDWLYH direction 21 Related control mode ,)FLUFXLW Motor rotational direction 3RVLWLYH direction 1HJDWLYH direction 1HJDWLYH direction 3RVLWLYH direction 3RVLWLYH direction P S T F $, 3-31 SDJH ,QSXWWKHWRUTXHFRPPDQGLQWKHIRUPRIDQDORJYROWDJH :KHQ3U´7RUTXHFRPPDQGVHOHFWLRQµ SLQ1R :KHQ3U´7RUTXHFRPPDQGVHOHFWLRQµ SLQ1R Pr3.17 Pr3.18 Pr3.20 Torque command input 7545 Torque command sign selection (TC-SIGN) 9ROWDJH (0 to 10V) 1RHIIHFW ï9ROWDJH ïWR9 1RHIIHFW 9ROWDJH (0 to 10V) 1RHIIHFW ï9ROWDJH ïWR9 1RHIIHFW 0 0 1 0 1 Title of VLJQDO Speed limit input Symbol SPL 1RHIIHFW 9ROWDJH (0 to 10V) ï9ROWDJH ïWR9 9ROWDJH (0 to 10V) ï9ROWDJH ïWR9 OFF 1HJDWLYH direction 21 Related control mode ,)FLUFXLW Motor rotational direction 3RVLWLYH direction 1HJDWLYH direction 1HJDWLYH direction 3RVLWLYH direction 3RVLWLYH direction P S T F $, 3-31 SDJH :KHQVHWWLQJ3U´7RUTXHFRPPDQGVHOHFWLRQµWRLQSXWWKHVSHHGOLPLWYDOXHLQWKHIRUP RIDQDORJYROWDJH Note 3-44 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXW 4. Inputs and outputs on connector X4 Connection Output Signal and Pin No. Output Signals (Common) and Their Functions 1 Before Using the Products 3 &RQWURORXWSXWVLJQDORIGHVLUHGIXQFWLRQFDQEHDVVLJQHGWR,)FRQQHFWRU/RJLFRIWKHRXWSXW 2 SLQFDQQRWEHFKDQJHG Title of VLJQDO 6LJQDO 6LJQDO %5.2)) %5.2)) %5.2)) SO2 output 3LQ1R62ï 3LQ1RSO2+ Pr4.11 K (131586) 65'< 65'< 65'< Pr4.12 K (65793) $/0 $/0 $/0 Pr4.13 K (328964) ,13 $763((' $763((' Pr4.14 K (460551) =63 =63 =63 Pr4.15 K (394758) 7/& 7/& 7/& 36 37 Pin 1R 38 39 Pin 1R 12 Title of VLJQDO Symbol SO5 output Pin 1R 40 Title of VLJQDO Symbol SO6 output Title of VLJQDO SO3 output Symbol 3LQ1R62ï 3LQ1RSO3+ Title of VLJQDO SO4 output Symbol 3LQ1R62ï 3LQ1RSO4+ SO5 SO6 7KHIXQFWLRQLVFKDQJHGE\WKHVHWWLQJRISDUDPHWHU)RUGHWDLOVUHIHUWR3 6HH´)XQFWLRQVDVVLJQDEOHWRFRQWURORXWSXWµDVVKRZQEHORZ >³@1RIXQFWLRQDVVLJQHG 5 P.3-52 Adjustment 5HODWHGSDJH Function allocatable to control input Title of VLJQDO 6HUYR$ODUPRXWSXW Symbol ALM Related control mode 'HIDXOWDVVLJQPHQW 36, 37 (SO3) ,)FLUFXLW P S T F SO 3-32 SDJH 6HUYR5HDG\RXWSXW Symbol 65'< Related control mode 'HIDXOWDVVLJQPHQW 34, 35 (SO2) ,)FLUFXLW P S T F 6 When in Trouble 7KLVVLJQDOVKRZVWKDWWKHGULYHULVLQDODUPVWDWXV 2XWSXWWUDQVLVWRUWXUQV21ZKHQWKHGULYHULVDWQRUPDOVWDWXVDQGWXUQV2))DWDODUPVWDWXV Title of VLJQDO 4 Setup Pin 1R 3 Connection 34 35 Note 6LJQDO K (197379) Pin 1R Symbol Verocity control Torque control Pr4.10 10 11 Title of VLJQDO 3RVLWLRQ)XOO closed control SO1 output 3LQ1R62ï 3LQ1RSO1+ Pin 1R Symbol GHFLPDO notation 'HIDXOW6HWXS Preparation $SSOLFDEOH parameter 'HIDXOW parameter VHWWLQJ SO 3-32 SDJH 7KLVVLJQDOVKRZVWKDWWKHGULYHULVUHDG\WREHDFWLYDWHG 2XWSXWWUDQVLVWRUWXUQV21ZKHQERWKFRQWURODQGPDLQSRZHUDUH21EXWQRWDWDODUPVWDWXV 7 Supplement 3-45 4. Inputs and outputs on connector X4 Output Signal and Pin No. Title of VLJQDO External brake release signal Symbol %5.2)) Related control mode 'HIDXOWDVVLJQPHQW 10, 11 (SO1) ,)FLUFXLW P S T F SO 3-32 SDJH )HHGVRXWWKHWLPLQJVLJQDOZKLFKDFWLYDWHVWKHKROGLQJEUDNHRIWKHPRWRU 7XUQVWKHRXWSXWWUDQVLVWRU21DWWKHUHOHDVHWLPLQJRIWKHKROGLQJEUDNH Title of VLJQDO Positioning complete Symbol INP Title of VLJQDO Positioning complete 2 Symbol INP2 Related control mode 'HIDXOWDVVLJQPHQW 38, 39 (SO4) ,)FLUFXLW Related control mode — 'HIDXOWDVVLJQPHQW ,)FLUFXLW P S T F SO 3-32 SDJH P S T F SO 3-32 SDJH 2XWSXWVWKHSRVLWLRQLQJFRPSOHWHVLJQDOSRVLWLRQLQJFRPSOHWHVLJQDO 7XUQV21WKHRXWSXWWUDQVLVWRUXSRQFRPSOHWLRQRISRVLWLRQLQJ Title of VLJQDO 6SHHGDUULYDORXWSXW Symbol AT-SPPED Related control mode 'HIDXOWDVVLJQPHQW 38, 39 (SO4) ,)FLUFXLW P S T F SO 3-32 SDJH 2XWSXWVWKHVSHHGDUULYDOVLJQDO 7XUQV21WKHRXWSXWWUDQVLVWRUXSRQDUULYHRIVSHHG Title of VLJQDO Torque in-limit signal output Symbol TLC Related control mode 'HIDXOWDVVLJQPHQW 40 (SO6) ,)FLUFXLW P S T F SO 3-32 SDJH 2XWSXWVWKHWRUTXHLQOLPLWVLJQDO 7XUQV21WKHRXWSXWWUDQVLVWRUXSRQOLPLWRIWRUTXH Title of VLJQDO Zero-speed detection output signal Symbol ZSP 'HIDXOWDVVLJQPHQW Related control mode 12 (SO5) ,)FLUFXLW P S T F SO 3-32 SDJH 2XWSXWVWKH]HURVSHHGGHWHFWLRQVLJQDO 7XUQV21WKHRXWSXWWUDQVLVWRUXSRQGHWHFWLRQRI=HURVSHHG Title of VLJQDO Speed coincidence output Symbol V-COIN Related control mode 'HIDXOWDVVLJQPHQW — ,)FLUFXLW P S T F SO 3-32 SDJH 2XWSXWVWKHVSHHGFRLQFLGHQFHVLJQDO 7XUQV21WKHRXWSXWWUDQVLVWRUXSRQFRLQFLGHQFHRIVSHHG Title of VLJQDO Alarm output 1 Symbol :$51 Related control mode 'HIDXOWDVVLJQPHQW — ,)FLUFXLW 2XWSXWVWKHZDUQLQJRXWSXWVLJQDOVHWWR3U´:DUQLQJRXWSXWVHOHFWµ 7XUQV21WKHRXWSXWWUDQVLVWRUXSRQRFFXUUHQFHRIZDUQLQJFRQGLWLRQ 3-46 P S T SO 3-32 SDJH F 4. Inputs and outputs on connector X4 1 Title of VLJQDO Alarm output 2 Symbol :$51 Related control mode 'HIDXOWDVVLJQPHQW — ,)FLUFXLW P S T F SO 3-32 SDJH 2XWSXWVWKHZDUQLQJRXWSXWVLJQDOVHWWR3U´:DUQLQJRXWSXWVHOHFWµ 7XUQV21WKHRXWSXWWUDQVLVWRUXSRQRFFXUUHQFHRIZDUQLQJFRQGLWLRQ 2 Alarm $ Pr6.27 *1 Content $ %DWWHU\DODUP %DWWHU\YROWDJHLV9RUORZHU $ Fan alarm Encoder communication alarm (QFRGHURYHUKHDW alarm Oscillation detection alarm /LIHWLPHGHWHFWLRQ alarm External scale error alarm External scale communication alarm $ $ $ $ $ $ $ 2 bit5 3 bit0 )DQKDVVWRSSHGIRUVHF 7KHQXPEHURIVXFFHVVLYHHQFRGHUFRPPXQLFDWLRQ HUURUVH[FHHGVWKHVSHFLÀHGYDOXH 4 bit6 5 bit4 7KHHQFRGHUGHWHFWVRYHUKHDWDODUP 6 bit3 2VFLOODWLRQRUYLEUDWLRQLVGHWHFWHG 7 bit9 8 bit2 7KHIHHGEDFNVFDOHGHWHFWVWKHDODUP 9 bit8 7KHQXPEHURIVXFFHVVLYHIHHGEDFNVFDOH FRPPXQLFDWLRQHUURUVH[FHHGVWKHVSHFLÀHGYDOXH 10 bit10 Fixed at no time limit. 7KHOLIHH[SHFWDQF\RIFDSDFLW\RUIDQEHFRPHV VKRUWHUWKDQWKHVSHFLÀHGWLPH Fixed at no time limit. 3 4 Setup /RDGIDFWRULVRUPRUHWKHSURWHFWLRQOHYHO 5HJHQHUDWLYHORDGIDFWRULVRUPRUHWKH SURWHFWLRQOHYHO Connection 2YHUORDGSURWHFWLRQ 2YHUUHJHQHUDWLRQ alarm Pr4.40/ Pr6.38 Corresponding Pr4.41 *2 bit *3 1 bit7 Preparation 6HOHFWLRQRIDODUPRXWSXWDQGRXWSXW Alarm No. Before Using the Products Output Signal and Pin No. 5 Adjustment * 7KH´FLUFOHµPHDQVWKDWDWLPHLQWKHUDQJHWRVRUQRWLPHOLPLWFDQEHVHOHFWHGWKURXJK3U ´:DUQLQJODWFKLQJWLPHµ1RWHWKDWWKHEDWWHU\ZDUQLQJDQGWKHHQGRIOLIHZDUQLQJKDYHQRWLPHOLPLW * 6HOHFWWKHZDUQLQJRXWSXWVLJQDO :$51 RUZDUQLQJRXWSXWVLJQDO :$51 WKURXJK3U ´:DUQLQJRXWSXWVHOHFWµRU3U´:DUQLQJRXWSXWVHOHFWµ:KHQWKHVHWYDOXHLVDOOZDUQLQJV DUH25HGEHIRUHEHLQJRXWSXW'RQRWVHWWRDQ\YDOXHRWKHUWKDQWKRVHVSHFLILHGLQWKHWDEOHDERYH * $ZDUQLQJGHWHFWLRQFDQEHPDVNHGE\3U´:DUQLQJPDVNVHWXSµ&RUUHVSRQGLQJELWVDUHVKRZQ LQWKHWDEOH:DUQLQJLVPDVNHGZLWKELW *4 7KHXSSHUIDQRQWKH+IUDPHGULYHUVWRSVGXULQJVHUYR2))WRVDYHHQHUJ\7KLVLVQRUPDODQGQRIDQ alarm is displayed. Positional command ON/OFF output Symbol P-CMD 'HIDXOWDVVLJQPHQW Related control mode — ,)FLUFXLW P S T F SO 3-32 SDJH 7XUQVRQRXWSXWWUDQVLVWRUZLWKSRVLWLRQDOFRPPDQGDSSOLHG Title of VLJQDO Speed in-limit output Symbol V-LIMIT Related control mode 'HIDXOWDVVLJQPHQW — ,)FLUFXLW P S T F SO 3-32 SDJH 7 7XUQVRQRXWSXWWUDQVLVWRUZKHQWKHVSHHGLVOLPLWHGE\WRUTXHFRQWUROOLQJIXQFWLRQ Alarm attribute output Symbol ALM-ATB Related control mode 'HIDXOWDVVLJQPHQW — ,)FLUFXLW P S T F SO 3-32 SDJH 7XUQVRQRXWSXWWUDQVLVWRUZKHQDQDODUPWKDWFDQEHFOHDUHGJHQHUDWHV 3-47 Supplement Title of VLJQDO 6 When in Trouble Title of VLJQDO 4. Inputs and outputs on connector X4 Output Signal and Pin No. Title of VLJQDO Speed command ON/OFF output Symbol V-CMD 'HIDXOWDVVLJQPHQW Related control mode — ,)FLUFXLW P S T F SO 3-32 SDJH 7XUQVRQRXWSXWWUDQVLVWRUZKHQWKHVSHHGFRPPDQGLVDSSOLHGZKLOHWKHVSHHGLVFRQWUROOHG Output Signals (Pulse Train) and Their Functions Pin 1R 21 22 Pin 1R 48 49 Pin 1R 23 24 Title of VLJQDO A-phase output Symbol 3LQ1ROA+ 3LQ1ROA– Title of VLJQDO B-phase output Symbol 3LQ1ROB+ 3LQ1ROB– Title of VLJQDO Z-phase output Symbol 3LQ1ROZ+ 3LQ1ROZ– Related control mode ,)FLUFXLW Related control mode ,)FLUFXLW Related control mode ,)FLUFXLW P S T F PO1 3-32 SDJH P S T F PO1 3-32 SDJH P S T F PO1 3-32 SDJH )HHGVRXWWKHGLYLGHGHQFRGHUVLJQDORUIHHGEDFNVFDOHVLJQDO $%=SKDVH LQGLIIHUHQWLDO HTXLYDOHQWWR56 *URXQGIRUOLQHGULYHURIRXWSXWFLUFXLWLVFRQQHFWHGWRVLJQDOJURXQG *1' DQGLVQRWLQVXODWHG 0D[RXWSXWIUHTXHQF\LV0SSV DIWHUTXDGUXSOHG Pin 1R 19 Title of VLJQDO Z-phase output Symbol CZ Related control mode ,)FLUFXLW P S T F PO2 3-33 SDJH 2SHQFROOHFWRURXWSXWRI=SKDVHVLJQDO 7KHHPLWWHUVLGHRIWKHWUDQVLVWRURIWKHRXWSXWFLUFXLWLVFRQQHFWHGWRWKHVLJQDOJURXQG *1' and is not insulated. :KHQXVLQJWKH&=VLJQDOLVRODWHLWIURPH[WHUQDOQRLVH 1RWH WKDW WKH ORJLF RI = SKDVH RSHQ FROOHFWRU RXWSXW &= LV D UHYHUVDO RI WKH OLQH GULYHU RXWSXW 2= ORJLF Note :KHQWKHRXWSXWVRXUFHLVWKHHQFRGHU ,IWKHHQFRGHUUHVROXWLRQð Pr0.11 LVPXOWLSOHRI=SKDVHZLOOEHIHGRXWV\QFKURQL]LQJ Pr5.03 ZLWK$SKDVH,QRWKHUFDVHWKH=SKDVHZLGWKZLOOEHHTXDOWRWKHHQFRGHUUHVROXWLRQDQG ZLOOQRWV\QFKURQL]HZLWK$SKDVHEHFDXVHRIQDUURZHUZLGWKWKDQWKDWRI$SKDVH Pr0.11 when the encoder resolution × is Pr5.03 multiple of 4, Pr0.11 when the encoder resolution × is Pr5.03 not multiple of 4, A A B B Z Z synchronized not-synchronized ,QFDVHRIWKHZLUHELWLQFUHPHQWDOHQFRGHUWKHVLJQDOVHTXHQFHPLJKWQRWIROORZWKH DERYHÀJXQWLOWKHÀUVW=SKDVHLVIHGRXW:KHQ\RXXVHWKHSXOVHRXWSXWDVWKHFRQWURO VLJQDOURWDWHWKHPRWRURQHUHYROXWLRQRUPRUHWRPDNHVXUHWKDWWKH=SKDVHLVIHGRXWDW OHDVWRQFHEHIRUHXVLQJ 3-48 4. Inputs and outputs on connector X4 1 Before Using the Products Output Signal and Pin No. Output Signals (Analog) and Their Functions Pin 1R 42 Title of VLJQDO Torque monitor output Symbol IM Related control mode ,)FLUFXLW P S T F $2 3-33 SDJH Preparation 'HÀQLWLRQRIWKHRXWSXWVLJQDOYDULHVZLWKWKHRXWSXWRI3U DQDORJPRQLWRUW\SH 7KHRXWSXWVLJQDOLVLGHQWLFDOWRWKHDQDORJPRQLWRURQWKHIURQWPRQLWRU )RURXWSXWVHWWLQJUHIHUWR3´'HWDLOVRISDUDPHWHUµ Pin 1R 43 Title of VLJQDO Speed monitor output Symbol SP Related control mode ,)FLUFXLW P S T 2 F $2 3-33 SDJH 3 Connection 'HÀQLWLRQRIWKHRXWSXWVLJQDOYDULHVZLWKWKHRXWSXWRI3U DQDORJPRQLWRUW\SH 7KHRXWSXWVLJQDOLVLGHQWLFDOWRWKHDQDORJPRQLWRURQWKHIURQWPRQLWRU )RURXWSXWVHWWLQJUHIHUWR3´'HWDLOVRISDUDPHWHUµ Output Signals (Others) and Their Functions Pin 1R 13, 15 17, 25 Title of VLJQDO Signal ground Symbol GND Related control mode 4 P S T F T F — ,)FLUFXLW Setup 6LJQDOJURXQG 7KLVRXWSXWLVLQVXODWHGIURPWKHFRQWUROVLJQDOSRZHU &20² LQVLGHRIWKHGULYHU Pin 1R 50 Title of VLJQDO Frame ground Symbol FG Related control mode ,)FLUFXLW P S — Adjustment 7KLVRXWSXWLVFRQQHFWHGWRWKHHDUWKWHUPLQDOLQVLGHRIWKHGULYHU 5 6 When in Trouble 7 Supplement 3-49 3 5. IF Monitor Settings Connection How to Assign Various I/O Functions to the I/F Control Input Settings Title of signal SI1 input selection SI2 input selection SI3 input selection SI4 input selection SI5 input selection SI6 input selection SI7 input selection SI8 input selection SI9 input selection SI10 input selection Connector X4 Pin No. 8 9 26 27 28 29 30 31 32 33 Parameter No. Pr4.00 Pr4.01 Pr4.02 Pr4.03 Pr4.04 Pr4.05 Pr4.06 Pr4.07 Pr4.08 Pr4.09 7KHVHSDUDPHWHUVVKDOOEHVHWE\XVLQJ KH[DGHFLPDOQXPEHUV6HWWLQJVKDOOEHPDGHIRU HDFKFRQWUROPRGHDVVKRZQLQH[DPSOHVEHORZ 00 ーーーー▲▲ K3RVLWLRQ)XOOFORVHGFRQWURO 00 ーー**ーー K6SHHGFRQWURO 00 ■■ーーーー K7RUTXHFRQWURO Set an appropriate function number in place of ´ ■■ µ´ ** µDQG´ ▲▲ µ)RUWKHIXQFWLRQ QXPEHUVHHWKHWDEOHRQWKHEHORZ Title Symbol ,QYDOLG 3RVLWLYHGLUHFWLRQRYHUWUDYHOLQKLELWLRQLQSXW 1HJDWLYHGLUHFWLRQRYHUWUDYHOLQKLELWLRQLQSXW 6HUYR21LQSXW*1 $ODUPFOHDULQSXW &RQWUROPRGHVZLWFKLQJLQSXW*2 *DLQVZLWFKLQJLQSXW 'HYLDWLRQFRXQWHUFOHDULQSXW*3 &RPPDQGSXOVHLQKLELWLRQLQSXW*4 7RUTXHOLPLWVZLWFKLQJLQSXW 'DPSLQJFRQWUROVZLWFKLQJLQSXW 'DPSLQJFRQWUROVZLWFKLQJLQSXW (OHFWURQLFJHDUVZLWFKLQJLQSXW (OHFWURQLFJHDUVZLWFKLQJLQSXW Selection 1 input of internal command speed Selection 2 input of internal command speed Selection 3 input of internal command speed 6SHHG]HURFODPSLQSXW 6SHHGFRPPDQGVLJQLQSXW 7RUTXHFRPPDQGVLJQLQSXW Forced alarm input ,QHUWLDUDWLRVZLWFKLQJLQSXW ï POT 127 65921 $&/5 &02'( *$,1 &/ ,1+ 7/6(/ 966(/ 966(/ ',9 ',9 ,1763' ,1763' ,1763' =(5263' 9&6,*1 7&6,*1 E-STOP -6(/ 6HWXSYDOXH a-contact b-contact K 'RQRWVHWXS K K K K K K K 'RQRWVHWXS K K K K K 'RQRWVHWXS K K K K $K $K %K %K &K &K 'K 'K (K (K )K )K K K K K K K K K K K K K (e.g. 1) Parameter setting 00 82 82 82 h (Hexadecimal numbers) Position/ Full-closed Control (Negative direction over-travel inhibition input; b-contact) Velocity Control (Negative direction over-travel inhibition input; b-contact) Torque Control (Negative direction over-travel inhibition input; b-contact) Convert to a decimal number 8553090 Enter this value to the relevant parameter. (e.g. 2) Parameter setting 00 ■■ ** ▲▲ h (Hexadecimal numbers) Position/ Full-closed Control (Damping control switching input 1; a-contact) Velocity Control (Speed zero clamp input; b-contact) Torque Control (Speed zero clamp input; b-contact) Convert to a decimal number Enter this value to the relevant parameter. 3-50 5. IF Monitor Settings 1 Before Using the Products How to Assign Various I/O Functions to the I/F The front panel display is in decimal (six digits). For setting functions and parameters, hexadecimal and decimal numbers should be used respectively. 6 1 The expression of “00 ■■ ** ▲▲ h” indicates that the number is hexadecimal. 7 Supplement Note 6 When in Trouble * 6HUYRRQLQSXWVLJQDO 65921 PXVWEHXVHGWRHQDEOHVHUYRRQ * :KHQXVLQJFRQWUROPRGHVZLWFKLQJLQSXW &02'( VHWWKHVLJQDOWRDOOFRQWUROPRGHV ,IWKHVLJQDOLVVHWWRRQO\RUFRQWUROPRGHV(UU,)LQSXWIXQFWLRQQXPEHUHUURU RU(UU,)LQSXWIXQFWLRQQXPEHUHUURUZLOOEHJHQHUDWHG 7KHFRQWUROLQSXWSLQVHWWRLQYDOLGVWDWHGRHVQRWDIIHFWDQ\RSHUDWLRQ )XQFWLRQ VHUYRRQ LQSXW DODUP FOHDU HWF WR EH XVHG LQ PXOWLSOH FRQWURO PRGHV PXVWEHDVVLJQHGWRWKHVDPHSLQZLWKFRUUHFWORJLFDODUUDQJHPHQW,QFRUUHFWVHWWLQJ ZLOO FDXVH (UU ,) LQSXW PXOWLSOH DVVLJQPHQW HUURU RU (UU ,) LQSXW PXOWLSOH DVVLJQPHQWHUURU * 'HYLDWLRQFRXQWHUFOHDULQSXW &/ FDQEHDVVLJQHGRQO\WR6,LQSXW:URQJDVVLJQPHQW ZLOOFDXVH(UU&RXQWHUFOHDUDVVLJQPHQWHUURU * &RPPDQG SXOVH LQKLELW LQSXW ,1+ FDQ EH DVVLJQHG RQO\ WR 6, LQSXW :URQJ DVVLJQPHQWZLOOFDXVH(UU&RPPDQGSXOVHLQSXWLQKLELWLQSXW 5 Adjustment 'RQRWVHWXSWRDYDOXHRWKHUWKDQWKDWVSHFLÀHGLQWKHWDEOH 'R QRW DVVLJQ VSHFLILF IXQFWLRQ WR RU PRUH VLJQDOV 'XSOLFDWHG DVVLJQPHQW ZLOO FDXVH (UU,)LQSXWPXOWLSOHDVVLJQPHQWHUURURU(UU,)LQSXWPXOWLSOHDVVLJQPHQWHUURU 4 Setup Caution 3 Connection The SI1 input (connector X4, pin No. 8) means that the negative direction over-travel inhibition input is set to b-contact as a factory default. For using the device in the position or full-closed control mode, the negative direction over-travel inhibition input is set to b-contact by setting “8” and “2” in the seventh and eighth digits from the left respectively. The settings in the first to sixth digits from the left do not matter. For the hexadecimal value “00000082h” or simply “82h”, enter “130” (decimal) to the parameter Pr4.00. To make multiple settings, enter the function number in the first eight digits from the left and then enter a parameter in a decimal number after converting it from a hexadecimal number. An example of this is shown in example 1 (the case on the left side). Similarly, the SI3 input (connector X4, pin No. 26) has a function of damping control switching input 1 as a default when used in the position control mode. Also, if the speed control is used, it is set to the function of speed zero clamp input. Therefore, in order to set it to the damping control switching input in the position control mode, enter the value of “10” (decimal) in the parameter Pr4.02 meaning the hexadecimal number “0Ah”, or “Ah”. To change the speed zero clamp of pin No. 26 from b-contact to a-contact in the speed control mode, enter the decimal number of “4352” in the parameter Pr4.02 meaning the hexadecimal number of “00001100h”, or “1100h”. Preparation X7 2 ,QSXWFLUFXLWUHIHUWR3DQGIXQFWLRQUHIHUWR3WR3 5HODWHGSDJH 33 3-51 5. IF Monitor Settings How to Assign Various I/O Functions to the I/F Control Output Settings Title of signal SO1 input SO2 input SO3 input SO4 input SO5 input SO6 input Connector X4 Pin No. 12 40 Parameter No. Pr4.10 Pr4.11 Pr4.12 Pr4.13 Pr4.14 Pr4.15 7KHVHSDUDPHWHUVVKDOOEHVHWE\XVLQJ KH[DGHFLPDOQXPEHUV6HWWLQJVKDOOEHPDGHIRU HDFKFRQWUROPRGHDVVKRZQLQH[DPSOHVEHORZ 00 ーーーー▲▲ K3RVLWLRQ)XOOFORVHGFRQWURO 00 ーー**ーー K6SHHGFRQWURO 00 ■■ーーーー K7RUTXHFRQWURO Set an appropriate function number in place of ´ ■■ µ´ ** µDQG´ ▲▲ µ)RUWKHIXQFWLRQ QXPEHUVHHWKHWDEOHRQWKHULJKW (e.g. 1) Parameter setting Setup YDOXH K K K K K K K K K $K %K &K 'K (K )K Title Symbol ,QYDOLG 6HUYR5HDG\RXWSXW ([WHUQDOEUDNHUHOHDVHVLJQDO 3RVLWLRQLQJFRPSOHWHRXWSXW $WVSHHGRXWSXW Torque in-limit VLJQDOoutput =HURVSHHGGHWHFWLRQRXWSXWVLJQDO Speed coincidence output $ODUPRXWSXW $ODUPRXWSXW 3RVLWLRQDOFRPPDQG212))RXWSXW 3RVLWLRQLQJFRPSOHWH Speed in-limit output $ODUPDWWULEXWHRXWSXW 6SHHGFRPPDQG212))RXWSXW ï 65'< %5.2)) ,13 $7633(' 7/& =63 9&2,1 :$51 :$51 3&0' ,13 9/,0,7 $/0$7% 9&0' 00 03 03 03 h (Hexadecimal numbers) Position/ Full-closed Control (External brake release signal) Velocity Control (External brake release signal) Torque Control (External brake release signal) Convert to a decimal number 197379 Enter this value to the relevant parameter. (e.g. 2) Parameter setting 00 05 05 04 h (Hexadecimal numbers) Position/ Full-closed Control (Positioning complete) Velocity Control (Speed arrival output) Torque Control (Speed zero clamp input; b-contact) Convert to a decimal number 328964 Enter this value to the relevant parameter. 6DPHIXQFWLRQFDQEHDVVLJQHGWRRUPRUHRXWSXWVLJQDOV &RQWURORXWSXWSLQVHWWRLQYDOLGDOZD\VKDVWKHRXWSXWWUDQVLVWRUWXUQHG2)) 'RQRWFKDQJHWKHVHWXSYDOXHVKRZQLQWKHWDEOH Caution Note 3-52 *1RWHWKDWWKHVHWXSYDOXHVDUHGLVSOD\HGLQGHFLPDORQWKHIURQWSDQHO ,QSXWFLUFXLWUHIHUWR3DQGIXQFWLRQUHIHUWR3WR3 5HODWHGSDJH P.4-35 4. Setup 1 Before Using the Products 5. Details of parameter 2 List of Parameters .......................................................................................4-2 [Class 0] Basic setting ...............................................................................4-4 Preparation [Class 1] Gain adjustment ........................................................................4-13 [Class 2] Damping control ........................................................................4-20 [Class 3] Verocity/ Torque/ Full-closed control .........................................4-25 [Class 4] I/F monitor setting .....................................................................4-33 [Class 5] Enhancing setting .....................................................................4-43 [Class 6] Special setting ..........................................................................4-52 3 2.Trial Run (JOG run) Connection Inspection Before Trial Run ......................................................................4-59 Trial Run by Connecting the Connector X4 ..............................................4-60 Setup of Motor Rotational Speed and Input Pulse Frequency .................4-63 4 Setup 5 Adjustment 6 When in Trouble 7 Supplement 4-1 4 1. Details of parameter Setup List of Parameters $SDUDPHWHULVGHVLJQDWHGDVIROORZV Pr0.00 Class Parameter No. 'HÀQLWLRQRIV\PEROVXQGHU´5HODWHGPRGHµ 3SRVLWLRQFRQWURO6YHORFLW\FRQWURO 7WRUTXHFRQWURO)IXOOFORVHGFRQWURO Parametr No. Title Class No. 00 01 ○ ̶ ̶ ○ 07 [Class 1] Gain adjustment 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Note 4-2 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ̶ ̶ ○ ○ ̶ ̶ ○ ○ ̶ ̶ ○ 4-5 4-6 4-7 ○ ̶ ̶ ̶ ○ ̶ ̶ ○ 4-8 ○ ̶ ̶ ○ ○ ○ ○ ○ 4-9 ○ ○ ○ ○ ○ ○ ○ ○ ○ ̶ ̶ ○ 4-11 00 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 Title $GDSWLYHÀOWHUPRGHVHWXS frequency 1st notch ZLGWKVHOHFWLRQ depth selection frequency 2nd notch ZLGWKVHOHFWLRQ depth selection frequency 3rd notch ZLGWKVHOHFWLRQ depth selection frequency 4th notch ZLGWKVHOHFWLRQ depth selection 6HOHFWLRQRIGDPSLQJÀOWHUVZLWFKLQJ frequency 1st damping ÀOWHUVHWXS frequency 2nd damping ÀOWHUVHWXS frequency 3rd damping ÀOWHUVHWXS frequency 4th damping ÀOWHUVHWXS Positional VPRRWKLQJÀOWHU command ),5ÀOWHU Related Control Mode Detail P S T F page ○ ○ ̶ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-20 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-21 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ̶ ̶ ○ ○ ̶ ̶ ○ 4-22 ○ ̶ ̶ ○ 4-23 ○ ̶ ̶ ○ 4-22 ○ ̶ ̶ ○ 4-23 ○ ̶ ̶ ○ 4-22 ○ ̶ ̶ ○ 4-23 ○ ̶ ̶ ○ 4-22 ○ ̶ ̶ ○ ○ ̶ ̶ ○ 4-23 ○ ̶ ̶ ○ 4-24 ○ ̶ ̶ ○ ○ ○ ○ ○ ○ ○ ○ ○ 00 4-12 01 ○ ○ ○ ○ ○ ○ ○ ○ 4-13 ○ ○ ○ ○ ○ ○ ○ ○ ○ ̶ ̶ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-14 ○ ○ ○ ○ ○ ̶ ̶ ○ ○ ̶ ̶ ○ ○ ○ ̶ ○ ○ ○ ̶ ○ 4-15 ○ ○ ○ ○ ○ ̶ ̶ ○ ○ ̶ ̶ ○ 4-16 ○ ̶ ̶ ○ ○ ̶ ̶ ○ 4-17 ○ ̶ ̶ ○ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ 4-18 ̶ ○ ̶ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ [Class 3] Verocity/ Torque/ Full-closed control 03 04 05 06 ○ ○ ○ ○ 4-4 [Class 2] Damping control [Class 0] Basic setting ○ ○ ○ ○ 02 Class No. Related Control Mode Detail P S T F page 00 Rotational direction setup 01 Control mode setup 02 Real-time setup auto-gain Selection of machine 03 tuning stiffness 04 Inertia ratio 05 input selection Command 06 otational direction setup pulse input mode setup 07 Command pulse counts 08 SHURQHPRWRUUHYROXWLRQ 09 1st numerator of electronic gear 10 Denominator of electronic gear Output pulse counts per one motor 11 UHYROXWLRQ 12 5HYHUVDORISXOVHRXWSXWORJLF 13 1st torque limit 14 3RVLWLRQGHYLDWLRQH[FHVVVHWXS 15 $EVROXWHHQFRGHUVHWXS 16 ([WHUQDOUHJHQHUDWLYHUHVLVWRUVHWXS /RDGIDFWRURIH[WHUQDOUHJHQHUDWLYH 17 resistor selection gain of position loop JDLQRIYHORFLW\ORRS WLPHFRQVWDQWRIYHORFLW\ORRS 1st integration ÀOWHURIVSHHGGHWHFWLRQ WLPHFRQVWDQWRIWRUTXHÀOWHU gain of position loop JDLQRIYHORFLW\ORRS WLPHFRQVWDQWRIYHORFLW\ORRS 2nd integration ÀOWHURIVSHHGGHWHFWLRQ WLPHFRQVWDQWRIWRUTXHÀOWHU gain 9HORFLW\IHHGIRUZDUG ÀOWHU gain 7RUTXHIHHGIRUZDUG ÀOWHU 2nd gain setup mode Position delay time control VZLWFKLQJ OHYHO hysteresis 3RVLWLRQJDLQVZLWFKLQJWLPH mode Velocity delay time control VZLWFKLQJ OHYHO hysteresis mode Torque delay time control VZLWFKLQJ OHYHO hysteresis Parametr No. 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 4-19 28 29 6SHHGVHWXS,QWHUQDO([WHUQDO VZLWFKLQJ rotational direction selection Speed input gain command UHYHUVDOLQSXW 1st 2nd 3rd 4th Speed setup 5th 6th 7th 8th acceleration Time setup deceleration Sigmoid acceleration/ deceleration time setup function selection Speed zero-clamp OHYHO selection direction selection Torque command input gain LQSXWUHYHUVDO Speed limit 1 YDOXH 2 selection QXPHUDWRURIGLYLVLRQ ([WHUQDO GHQRPLQDWRURIGLYLVLRQ scale UHYHUVDORIGLUHFWLRQ Z phase disconnection detection disable H[FHVVVHWXS Hybrid GHYLDWLRQ clear setup ̶ ○ ̶ ̶ 4-25 ̶ ○ ̶ ̶ ̶ ○ ○ ̶ ̶ ○ ̶ ̶ 4-26 ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ 4-27 ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ○ ̶ 4-28 ̶ ○ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ 4-29 ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ 4-30 ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ 4-31 ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ ̶ ̶ ̶ ○ 4-32 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; &RPPXQLFDWLRQFRQQHFWRU ; 6DIHW\ IXQFWLRQFRQQHFWRU ; ([WHUQDOVFDOHFRQQHFWRU DQGDQDORJLQSXW 1. Details of parameter 1 Parametr No. Class No. ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-34 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-35 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-36 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 26 27 28 29 30 31 32 33 34 35 00 4-38 ○ ○ ○ ○ 02 04 05 06 07 ○ ̶ ̶ ○ 4-39 08 ○ ̶ ̶ ○ 09 ○ ̶ ̶ ○ 10 11 13 14 15 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ̶ ○ ○ ̶ 4-40 ̶ ○ ○ ̶ ○ ○ ○ ○ 4-41 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-42 ○ ̶ ̶ ○ ○ ̶ ̶ ○ ○ ○ ○ ○ 4-43 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 18 19 20 21 22 ○ ̶ ̶ ○ ○ ̶ ̶ ○ 17 4-44 ○ ○ ○ ○ 4-45 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-46 2 ○ ○ ○ ○ ○ ̶ ̶ ○ ○ ̶ ̶ ○ 4-47 ○ ̶ ̶ ○ ○ ̶ ̶ ○ ○ ○ ̶ ○ 4-48 ○ ○ ̶ ○ ○ ○ ̶ ○ ○ ○ ̶ ○ ○ ○ ̶ ○ 4-49 3 ○ ○ ̶ ○ ○ ○ ̶ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-50 ○ ○ ○ ○ ○ ○ ○ ○ ○ ̶ ̶ ○ ○ ○ ○ ○ 4-51 ○ ○ ○ ○ $QDORJWRUTXHIHHGIRUZDUG ○ FRQYHUVLRQJDLQ ○ 9HORFLW\GHYLDWLRQH[FHVVVHWXS ○ JOG trial run command speed ○ YDOLGWLPH Position 3rd gain ○ scale factor ○ 7RUTXHFRPPDQGDGGLWLRQDOYDOXH ○ 3RVLWLYHGLUHFWLRQ torque compensation ○ 1HJDWLYHGLUHFWLRQ YDOXH ○ )XQFWLRQH[SDQVLRQVHWXS ○ Current response setup ○ 2nd Inertia ratio ○ Emergency stop time at alarm ○ QGRYHUVSHHGOHYHOVHWXS )URQWSDQHOSDUDPHWHUZULWLQJ ○ selection ○ 3RZHUXSZDLWWLPH ̶ Encoder Z phase setup ̶ =SKDVHVHWXSRIH[WHUQDOVFDOH 6HULDODEVROXWHH[WHUQDOVFDOH=SKDVH ̶ setup $%SKDVHH[WHUQDOVFDOHSXOVH ̶ output method selection Disturbance torque compensating gain ○ ○ 'LVWXUEDQFHREVHUYHUÀOWHU ○ $ODUPODWFKWLPHVHOHFWLRQ ○ estimation speed Real time auto tuning ○ custom setup ̶ +\EULGYLEUDWLRQ gain suppression ̶ ÀOWHU ○ 2VFLOODWLRQGHWHFWLRQOHYHO ○ $ODUPPDVNVHWXS For manufacturer's use 4 ○ ̶ ○ ̶ ̶ ̶ ○ ○ ○ 4-52 ̶ ̶ ○ ̶ ̶ ○ ○ ̶ ○ ̶ ̶ ○ ̶ ̶ ○ 4-53 5 ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 4-54 ○ ○ ○ ○ ○ ○ 6 ̶ ̶ ○ ̶ ̶ ○ ̶ ̶ ○ 4-55 ̶ ̶ ○ ○ ̶ ̶ ○ ̶ ̶ ○ ○ ○ 4-56 ○ ○ ○ ○ ○ ○ 4-57 ̶ ̶ ○ 7 ̶ ̶ ○ ○ ○ ○ 4-58 ○ ○ ○ ○ ○ ○ ○ 4-46 ○ ○ ○ ○ 4-3 Supplement ○ ○ ○ ○ 23 24 27 31 32 34 35 37 38 39 ○ ̶ ̶ ○ When in Trouble 25 0RWRUZRUNLQJUDQJHVHWXS ,)UHDGLQJÀOWHU $ODUPFOHDULQSXWVHWXS Counter clear input mode Command pulse ,QYDOLGDWLRQ inhibit input reading setup Position setup unit select Selection of torque limit 2nd torque limit 1 7RUTXHOLPLWVZLWFKLQJ setup 2 SRVLWLYHGLUHFWLRQWRUTXH ([WHUQDO limit input QHJDWLYHGLUHFWLRQWRUTXH limit Input gain of analog torque limit LED initial status RS232 baud rate setup RS485 $[LVDGGUHVV &RPPDQGSXOVHLQSXWPD[LPXPVHWXS 3XOVHUHJHQHUDWLYHRXWSXWOLPLWVHWXS For manufacturer's use Front panel lock setup Adjustment 2nd 3rd numerator of electronic gear 4th 'HQRPLQDWRURISXOVHRXWSXWGLYLVLRQ 2YHUWUDYHOLQKLELWLQSXWVHWXS 6HTXHQFHDWRYHUWUDYHOLQKLELW 6HTXHQFHDW6HUYR2II sequence PDLQSRZHU LV trip selection OFF detection time Sequence at alarm Torque setup for emergency stop 2YHUORDGOHYHOVHWXS 2YHUVSHHGOHYHOVHWXS ○ ○ ○ ○ 14 15 16 17 18 19 20 21 22 23 24 Setup [Class 5] Enhancing setting 00 01 02 03 04 05 06 07 08 09 10 11 12 13 ○ ○ ○ ○ Related Control Mode Detail P S T F page Connection 42 ○ ○ ○ ○ 4-33 Title Preparation 40 41 Class No. [Class 6] Special setting 39 6, 3LQ1R 6, 3LQ1R 6, 3LQ1R 6, 3LQ1R 6, 3LQ1R Input selection 6, 3LQ1R 6, 3LQ1R 6, 3LQ1R 6, 3LQ1R 6, 3LQ1R 3LQ1R SO1 /LQHGULYHURXWSXW 3LQ1R SO2 /LQHGULYHURXWSXW 3LQ1R SO3 /LQHGULYHURXWSXW Output 3LQ1R selection SO4 /LQHGULYHURXWSXW 3LQ1R SO5 Open collector output 3LQ1R SO6 Open collector output type $QDORJPRQLWRU output gain type $QDORJPRQLWRU output gain Type of digital monitor $QDORJPRQLWRURXWSXWVHWXS offset setup $QDORJLQSXW ÀOWHU $, RYHUYROWDJHVHWXS offset setup $QDORJLQSXW ÀOWHU $, RYHUYROWDJHVHWXS offset setup $QDORJLQSXW ÀOWHU $, RYHUYROWDJHVHWXS Positioning complete range ,QSRVLWLRQ output setup ,13KROGWLPH Zero-speed Speed coincidence range $WVSHHG 6SHHGDUULYDO at stalling setup Mechanical brake action at running setup Mechanical brake action at running setup 1 Selection of alarm output 2 QG3RVLWLRQLQJFRPSOHWH ,QSRVLWLRQ range Parametr No. [Class 5] Enhancing setting [Class 4] I/F monitor setting 00 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 Related Control Mode Detail P S T F page Title Before Using the Products List of Parameters 4 1. Details of parameter Setup [Class 0] Basic setting 'HIDXOW>@ Pr0.00 * Rotational direction setup Range Unit Default Related control mode 0 to 1 — 1 P S T F 6HWXSWKHUHODWLRQVKLSEHWZHHQWKHGLUHFWLRQRIFRPPDQGDQGGLUHFWLRQRIPRWRUURWDWLRQ 0RWRUWXUQV&:LQUHVSRQVHWRSRVLWLYHGLUHFWLRQFRPPDQG &:ZKHQYLHZHGIURPORDG VLGHVKDIWHQG 0RWRUWXUQV&&:LQUHVSRQVHWRSRVLWLYHGLUHFWLRQFRPPDQG &&:ZKHQYLHZHGIURPORDG VLGHVKDIWHQG Positive direction (CCW) Negative direction (CW) Default Setup value 0 [1] Pr0.01 * Command direction Motor rotational direction Positive direction drive inhibit input Negative direction drive inhibit input 3RVLWLYHGLUHFWLRQ &: Valid — 1HJDWLYHGLUHFWLRQ &&: — Valid 3RVLWLYHGLUHFWLRQ &&: Valid — 1HJDWLYHGLUHFWLRQ &: — Valid Control mode setup Range Unit Default Related control mode 0 to 6 — 0 P S T F You can set up the control mode to be used. Content Setup value 1st mode 2st mode [0] Position — 1 Velocity — 2 Torque — 3 *1 Position Velocity 4 *1 Position Torque Velocity Torque Full-closed — 5 6 *1 * :KHQ\RXVHWXSWKHFRPELQDWLRQPRGHRI RU\RXFDQVHOHFWHLWKHUWKHVWRUWKHQG ZLWKFRQWUROPRGHVZLWFKLQJLQSXW &02'( :KHQ&02'(LVRSHQWKHVWPRGHZLOOEH selected. :KHQ&02'(LVVKRUWHGWKHQGPRGHZLOO be selected. Don't enter commands 10ms before/after VZLWFKLQJ C-MODE open close open 2nd 1st 1st 10ms or longer 10ms or longer 7KHZDYHIRUPDERYHVKRZVZKHQORJLFDO VHWWLQJRI&02'(LQSXWLVDFRQWDFW:KHQ EFRQWDFWLVXVHGRSHQDQGVKRUWLVUHYHUVHG Note Related page 4-4 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; &RPPXQLFDWLRQFRQQHFWRU ; 6DIHW\ IXQFWLRQFRQQHFWRU ; ([WHUQDOVFDOHFRQQHFWRU DQGDQDORJLQSXW 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 'HIDXOW>@ Pr0.02 Real-time auto-gain tuning setup Range Unit Default Related control mode 0 to 6 — 1 P S T F You can set up the action mode of the real-time auto-gain tuning. 2 0 ,QYDOLG [1] Standard %DVLF PRGH 'R QRW XVH XQEDODQFHG ORDG IULFWLRQ FRPSHQVDWLRQ RU JDLQVZLWFKLQJ 2 Positioning *1 Main application is positioning. It is recommended to use this mode RQ HTXLSPHQW ZLWKRXW XQEDODQFHG KRUL]RQWDO D[LV EDOO VFUHZ GULYLQJ HTXLSPHQWZLWKORZIULFWLRQHWF 3 9HUWLFDOD[LV*2 :LWK DGGLWLRQDO IHDWXUHV WR WKH SRVLWLRQLQJ PRGH XVH WKLV PRGH WR SRVLWLYHO\ DQG HIIHFWLYHO\ FRPSHQVDWH IRU XQEDODQFHG ORDG WR WKH YHUWLFDOD[LVRUPLQLPL]HYDULDWLRQVLQVHWWLQJWLPH 4 Friction compensation *3 :LWKDGGLWLRQDOIHDWXUHVWRWKHYHUWLFDOD[LVPRGHXVHWKLVPRGHWR SRVLWLYHO\DQGHIIHFWLYHO\UHGXFHSRVLWLRQLQJVHWWLQJWLPHZKHQWKHEHOW GULYLQJD[LVKDVKLJKIULFWLRQ 6 Varying degree of load inertia in motion Real-time auto-gain tuning function is disabled. Load characteristic (VWLPDWHWKHORDGFKDUDFWHULVWLFVZLWKRXWFKDQJLQJFXUUHQWSDUDPHWHU measurement VHWWLQJ7KLVPRGHUHTXLUHVXVHRIWKHVHWXSVXSSRUWVRIWZDUH Customize *4 Functions of real-time auto-gain tuning can be customized to meet the UHTXLUHPHQWVRIWKHVSHFLÀFDSSOLFDWLRQE\FRPELQLQJGHVLUHGIXQFWLRQV DFFRUGLQJWRWKH3U´5HDOWLPHDXWRJDLQWXQLQJFXVWRPVHWWLQJµ Range Unit 0 to 31 — 5 Related Default control mode $%&IUDPH13 P S T F D to H-IUDPH11 @ Pr0.04 Inertia ratio Range Unit Default Related control mode 0 to 10000 % 250 * P S T F Set 1st inertia ratio. @ 7KHLQHUWLDUDWLRZLOOEHHVWLPDWHGDWDOOWLPHZKLOHWKHUHDOWLPHDXWRJDLQWXQLQJLVYDOLGDQG LWVUHVXOWZLOOEHVDYHGWR((3520HYHU\PLQ Caution Pr0.05 * ,IWKHLQHUWLDUDWLRLVFRUUHFWO\VHWWKHVHWXSXQLWRI3UDQG3UEHFRPHV +] :KHQ WKHLQHUWLDUDWLRRI3ULVODUJHUWKDQWKHDFWXDOWKHVHWXSXQLWRIWKHYHORFLW\ORRSJDLQ EHFRPHVODUJHUDQGZKHQWKHLQHUWLDUDWLRRI3ULVVPDOOHUWKDQWKHDFWXDOWKHVHWXSXQLW RIWKHYHORFLW\ORRSJDLQEHFRPHVVPDOOHU Selection of command pulse input Range Unit Default 0 to 1 — 0 Related control mode P F @ Pr0.06 * Pr0.07 * Command pulse rotational direction setup Command pulse input mode setup Range Unit Default 0 to 1 — 0 Related control mode P Range Unit Default 0 to 3 — 1 F Related control mode P F 7KHWDEOHEHORZVKRZVFRPELQDWLRQVRI3U&RPPDQGSXOVHURWDWLRQDOGLUHFWLRQVHWXSDQG3U &RPPDQGSXOVHLQSXWPRGHVHWXS 3XOVHVDUHFRXQWHGDWHGJHVLQGLFDWHGE\WKHDUURZVDVVKRZQLQWKHWDEOH ,QSXWIRUPDWFRPPDQGSXOVH ( ( 0 or 2 [0] [1] &RPPDQG pulse format ÝSKDVH difference 2-phase pulse (A + B-phase) Positive direction pulse train + Negative direction pulse train pulse train + Signal Signal title 3RVLWLYHGLUHFWLRQ FRPPDQG t1 t1 0 or 2 1 3 pulse train + Signal t1 PULS B-phase SIGN t1 t1 t1 %SKDVHDGYDQFHVWR$E\Ý t1 %SKDVHGHOD\VIURP$E\Ý 4 t3 PULS t2 t2 t4 t5 SIGN PULS t2 t2 t4 t5 SIGN “L” “H” t6 t6 t1 t6 t1 t1 t1 A-phase PULS SIGN 5 B-phase t1 t1 t1 t1 %SKDVHGHOD\VIURP$E\Ý %SKDVHDGYDQFHVWR$E\Ý Adjustment 1 Positive direction pulse train + Negative direction pulse train t1 A-phase t6 ÝSKDVH difference 2-phase pulse (A + B-phase) 1HJDWLYHGLUHFWLRQ FRPPDQG Setup 3 3 Connection Pr0.06 setup value Pr0.07 setup value &RPPDQGSXOVH &RPPDQGSXOVH rotational LQSXWPRGH GLUHFWLRQVHWXS setup 2 Preparation @ Pr0.08 * Command pulse counts per one motor revolution Range Unit Default 0 to 1048576 pulse 10000 Related control mode P Set the command pulses that causes single turn of the motor shaft. :KHQWKLVVHWWLQJLV3UVWQXPHUDWRURIHOHFWURQLFJHDUDQG3U'HQRPLQDWRURI HOHFWURQLFJHDUEHFRPHYDOLG Pr0.09 1st numerator of electronic gear Range Unit Default 0 to 230 — 0 Related control mode P F 6HWWKHQXPHUDWRURIGLYLVLRQPXOWLSOLFDWLRQRSHUDWLRQPDGHDFFRUGLQJWRWKHFRPPDQGSXOVHLQSXW 7KLVVHWXSLVHQDEOHGZKHQ3UFRPPDQGSXOVHFRXQWVSHURQHPRWRUUHYROXWLRQ Pr0.10 Denominator of electronic gear Range Unit Default 1 to 230 — 10000 Related control mode P F 6HWWKH'HQRPLQDWRURIGLYLVLRQPXOWLSOLFDWLRQRSHUDWLRQPDGHDFFRUGLQJWRWKHFRPPDQG pulse input. 7KLVVHWXSLVHQDEOHGZKHQ3UFRPPDQGSXOVHFRXQWVSHURQHPRWRUUHYROXWLRQ ,QWHUUHODWLRQVKLSEHWZHHQ3U3UDQG3UGXULQJ3RVLWLRQFRQWURO! Pr0.08 Pr0.09 Pr0.10 Command division/multiplication operation Command pulse input 1 to 1048576 — 1RWHIIHFW — 1RWHIIHFW Positional command [Pr0.08 setup value] 5HJDUGOHVV RI VHWXS RI 3U DQG 3U WKLV RSHUDWLRQLVSURFHVVHGDFFRUGLQJWRVHWXSYDOXHRI Pr0.08. Command pulse input 0 Encoder resolution Encoder resolution Positional command [Pr0.10 setup value] 0 to 1073741824 :KHQ ERWK 3U DQG 3U DUH VHW WR WKLV RSHUDWLRQLVSURFHVVHGDFFRUGLQJWRVHWXSYDOXHRI Pr0.10. 0 Command pulse input 1 to 1073741824 1 to 1073741824 [Pr0.09 setting] Positional command [Pr0.10 setting] :KHQ VHWXS YDOXH RI 3U LV DQG 3Uʒ WKLV RSHUDWLRQLV SURFHVVHGDFFRUGLQJWR VHWXS YDOXHRI3UDQG3U ,QWHUUHODWLRQVKLSEHWZHHQ3U3UDQG3UGXULQJIXOOFORVHGFRQWURO! Related page 4-8 3´6HWXSRI0RWRU5RWDWLRQDO6SHHGDQG,QSXW3XOVH)UHTXHQF\µ 33´3URWHFWLYHIXQFWLRQ 'HWDLORIHUURUFRGH µ 1. Details of parameter 1 'HIDXOW>@ Pr0.08 Pr0.09 Pr0.10 Command division/multiplication operation Command pulse input 0 1 to 1073741824 1 to 1073741824 [Pr0.09 setting] Positional command [Pr0.10 setting] :KHQ VHWXS YDOXH RI 3Uʒ WKLV RSHUDWLRQ LV SURFHVVHGDFFRUGLQJWRVHWXSYDOXHRI3UDQG Pr0.10. 7KH GHVLUHG VHWWLQJ FDQ EH GHWHUPLQHG E\ VHOHFWLQJ YDOXH RI QXPHUDWRU DQG GHQRPLQDWRU RI HOHFWURQLFJHDU+RZHYHUDQH[FHVVLYHO\KLJKGLYLVLRQRUPXOWLSOLFDWLRQUDWLRFDQQRWJXDUDQWHH WKHRSHUDWLRQ7KHUDWLRVKRXOGEHLQDUDQJHEHWZHHQDQG ([FHVVLYHO\ KLJK PXOWLSOLFDWLRQ UDWLR ZLOO FDXVH (UU FRPPDQG SXOVH PXOWLSOLFDWLRQ HUURU SURWHFWLRQ GXHWRYDU\LQJFRPPDQGSXOVHLQSXWRUQRLVHVHYHQLIWKHRWKHUVHWWLQJVDUHZLWKLQ WKHVSHFLÀHGUDQJH 'XULQJ IXOO FORVHG FRQWUROOLQJ GR QRW FKDQJH FRPPDQG GLYLVLRQ DQG PXOWLSOLFDWLRQ UDWLR 2WKHUZLVH(UU +\EULGRYHUGHYLDWLRQDODUP ZLOOEHJHQHUDWHG Output pulse counts per one motor revolution 2 Range Unit Default Related control mode 0 to 262144 P/r 2500 P S T F 3 4 Setup Pr0.11 * ,I 3U LV GXULQJ IXOO FORVHG FRQWUROOLQJ WKH SURFHVV DV VKRZQ DERYH LV SHUIRUPHG ZLWK ERWK numerator and denominator set to 1. Connection Caution 1 Command pulse input 1 to 1073741824 Positional command Preparation ,QYDOLG 1 Before Using the Products [Class 0] Basic setting @ Pr5.03 * Denominator of pulse output division Range Unit Default Related control mode 0 to 262144 — 0 P S T F )RUDQDSSOLFDWLRQZKHUHWKHQXPEHURIRXWSXWSXOVHVSHURQHPRWRUUHYROXWLRQLVQRWDQ LQWHJHUVHWWKLVSDUDPHWHUWRDYDOXHRWKHUWKDQDQGWKHGLYLGLQJUDWLRFDQEHVHWE\XVLQJ Pr0.11 as the numerator and Pr5.03 as the denominator. 2XWSXWSXOVHFRXQWVSHURQHUHYROXWLRQ 1 3UVHWXSYDOXH/ Pr5.03 VHWXSYDOXH ð(QFRGHUUHVROXWLRQð 4 @ Pr0.12 * Reversal of pulse output logic Range Unit Default Related control mode 0 to 3 — 0 P S T F Pr0.12 [0] B-phase logic 1RQ UHYHUVDO 2 5HYHUVDO 3 Caution CW direction rotation Encoder $SKDVH $SKDVH ([WHUQDO scale B-phase B-phase Encoder $SKDVH $SKDVH ([WHUQDO scale B-phase B-phase 3 6HWXSYDOXHDQGDUHYDOLGRQO\IRUIXOOFORVHGFRQWURO6HWWLQJPXVWEHRULIQRWIRUIXOO closed control. The selection of the output source of Z-phase is held concurrently. 6HWXSYDOXHDQGDUH=SKDVHRXWSXWRIHQFRGHU 6HWXSYDOXHDQGDUH=SKDVHRXWSXWRIH[WHUQDOVFDOH 1st torque limit 4 Range Unit Default Related control mode 0 to 500 % 500 P S T F Setup Pr0.13 CCW direction rotation Connection 1 Output source 2 Preparation @ Pr0.16 * ([WHUQDOUHJHQHUDWLYHUHVLVWRUVHWXS Range Unit 0 to 3 — Related Default control mode $%*+IUDPH3 P S T F &'()IUDPH0 :LWK WKLV SDUDPHWHU \RX FDQ VHOHFW HLWKHU WR XVH WKH EXLOWLQ UHJHQHUDWLYH UHVLVWRU RI WKH GULYHURUWRVHSDUDWHWKLVEXLOWLQUHJHQHUDWLYHUHVLVWRUDQGH[WHUQDOO\LQVWDOOWKHUHJHQHUDWLYH UHVLVWRU EHWZHHQ%DQG%RI&RQQHFWRU;%LQFDVHRI$WR'IUDPHEHWZHHQ%DQG% RI &RQQHFWRU ;& LQ FDVH RI 'IUDPH 9 DQG (IUDPH EHWZHHQ % DQG % RI WHUPLQDO EORFNLQFDVHRI)WR+IUDPH $%*DQG+IUDPHGULYHULVQRWSURYLGHGZLWKEXLOWLQUHVLVWHU Setup value Regenerative resistor to be used [0] &WR)IUDPH 5HJHQHUDWLYHSURFHVVLQJFLUFXLWZLOOEHDFWLYDWHGDQG Built-in resistor UHJHQHUDWLYHUHVLVWRURYHUORDGSURWHFWLRQZLOOEHWULJJHUHG DFFRUGLQJWRWKHEXLOWLQUHVLVWRU DSSUR[GXW\ Function 1 ([WHUQDO resistor 7KHGULYHUWULSVGXHWRUHJHQHUDWLYHRYHUORDGSURWHFWLRQ (UU ZKHQUHJHQHUDWLYHSURFHVVLQJFLUFXLWLVDFWLYDWHGDQG LWVDFWLYHUDWLRH[FHHGV 2 ([WHUQDO resistor 5HJHQHUDWLYHSURFHVVLQJFLUFXLWLVDFWLYDWHGEXWQRUHJHQHUDWLYH RYHUORDGSURWHFWLRQLVWULJJHUHG [3] $%*+IUDPH 1RUHVLVWRU %RWKUHJHQHUDWLYHSURFHVVLQJFLUFXLWDQGUHJHQHUDWLYHSURWHFWLRQ DUHQRWDFWLYDWHGDQGEXLOWLQFDSDFLWRUKDQGOHVDOOUHJHQHUDWLYH SRZHU Remarks ,QVWDOODQH[WHUQDOSURWHFWLRQVXFKDVWKHUPDOIXVHZKHQ\RXXVHWKHH[WHUQDOUHJHQHUDWLYH resistor. 2WKHUZLVHWKHUHJHQHUDWLYHUHVLVWRUPLJKWEHKHDWHGXSDEQRUPDOO\DQGUHVXOWLQEXUQRXW UHJDUGOHVVRIYDOLGDWLRQRULQYDOLGDWLRQRIUHJHQHUDWLYHRYHUORDGSURWHFWLRQ Caution :KHQ\RXXVHWKHEXLOWLQUHJHQHUDWLYHUHVLVWRUQHYHUWRVHWXSRWKHUYDOXHWKDQ'RQ W WRXFKWKHH[WHUQDOUHJHQHUDWLYHUHVLVWRU ([WHUQDOUHJHQHUDWLYHUHVLVWRUJHWVYHU\KRWDQGPLJKWFDXVHEXUQLQJ Pr0.17 * /RDGIDFWRURIH[WHUQDOUHJHQHUDWLYH resistor selection Range Unit Default Related control mode 0 to 4 — 0 P S T F :KHQ VHOHFWLQJ WKH H[WHUQDO UHJHQHUDWLYH UHVLVWRU 3U VHOHFW WKH FRPSXWLQJ PHWKRGRIORDGIDFWRURIUHJHQHUDWLYHUHVLVWRU Setup value Function [0] 5HJHQHUDWLYHORDGIDFWRULVZKHQGXW\IDFWRURIH[WHUQDOUHJHQHUDWLYHUHVLVWRULV 10%. 1 to 4 Note Related page 4-12 )RUPDQXIDFWXUHU VXVH GRQRWVHWXS $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´6\VWHP&RQÀJXUDWLRQDQG:LULQJµ3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter Setup [Class 1] Gain adjustment Pr1.00 1st gain of position loop Range Unit 0 to 30000 0.1/s 1 Related Default control mode $%C-IUDPH480 P F D to H-IUDPH320 You can determine the response of the positional control system. +LJKHUWKHJDLQRISRVLWLRQORRS\RXVHWIDVWHUWKHSRVLWLRQLQJWLPH\RXFDQREWDLQ 1RWHWKDWWRRKLJKVHWXSPD\FDXVHRVFLOODWLRQ 1st gain of velocity loop Range Unit 1 to 32767 0.1Hz 2 Related Default control mode $%C-IUDPH270 P S T F D to H-IUDPH180 @ Pr1.05 2nd gain of position loop Pr1.06 2nd gain of velocity loop Pr1.07 2nd time constant of velocity loop integration Pr1.08 2nd filter of speed detection Pr1.09 2nd time constant of torque filter Related Default control mode $%C-IUDPH570 P F D to H-IUDPH380 Range Unit 0 to 30000 0.1/s Range Unit 1 to 32767 0.1Hz Range Unit Default Related control mode 1 to 10000 0.1ms 10000 P S T F Range Unit Default Related control mode 0 to 5 — 0 P S T F Range Unit 0 to 2500 0.01ms Related Default control mode $%C-IUDPH270 P S T F D to H-IUDPH180 Related Default control mode $%C-IUDPH 84 P S T F D to H-IUDPH126 3RVLWLRQORRSYHORFLW\ORRSVSHHGGHWHFWLRQÀOWHUDQGWRUTXH FRPPDQGÀOWHUKDYHWKHLU SDLUVRIJDLQRUWLPHFRQVWDQW VWDQGQG Related page Pr1.10 )RUGHWDLOVRIVZLWFKLQJWKHVWDQGWKHQGJDLQRUWKHWLPHFRQVWDQWUHIHUWR3*DLQ 6ZLWFKLQJ)XQFWLRQRI$GMXVWPHQW The function and the content of each parameter is as same as that of the 1st gain and time constant. 9HORFLW\IHHGIRUZDUGJDLQ Range Unit Default 0 to 1000 0.10% 300 Related control mode P F 0XOWLSO\ WKH YHORFLW\ FRQWURO FRPPDQG FDOFXODWHG DFFRUGLQJ WR WKH LQWHUQDO SRVLWLRQDO command by the ratio of this parameter and add the result to the speed command resulting from the positional control process. Pr1.11 9HORFLW\IHHGIRUZDUGILOWHU Range Unit Default 0 to 6400 0.01ms 50 Related control mode P F 6HWWKHWLPHFRQVWDQWRIVWGHOD\ÀOWHUZKLFKDIIHFWVWKHLQSXWRIYHORFLW\IHHGIRUZDUG 8VDJHH[DPSOHRIYHORFLW\IHHGIRUZDUG! 7KHYHORFLW\IHHGIRUZDUGZLOOEHFRPHHIIHFWLYHDVWKHYHORFLW\IHHGIRUZDUGJDLQLVJUDGXDOO\ LQFUHDVHG ZLWK WKH YHORFLW\ IHHG IRUZDUG ILOWHU VHW DW DSSUR[ PV 7KH SRVLWLRQDO GHYLDWLRQGXULQJRSHUDWLRQDWDFRQVWDQWYHORFLW\LVUHGXFHGDVVKRZQLQWKHHTXDWLRQEHORZ LQSURSRUWLRQWRWKHYDOXHRIYHORFLW\IHHGIRUZDUGJDLQ 3RVLWLRQDOGHYLDWLRQ>XQLWRIFRPPDQG@ FRPPDQGVSHHG>XQLWRIFRPPDQGV@ SRVLWLRQDOORRSJDLQ>V@ð YHORFLW\IHHGIRUZDUGJDLQ>@ Note Related page 4-14 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 'HIDXOW>@ Pr1.12 7RUTXHIHHGIRUZDUGJDLQ Range Unit Default 0 to 1000 0.1% 0 Related control mode P S F Pr1.13 7RUTXHIHHGIRUZDUGILOWHU Range Unit Default 0 to 6400 0.01ms 0 Related control mode P S F Caution 2nd gain setup Range Unit Default Related control mode 0 to 1 — 1 P S T F $UUDQJHWKLVSDUDPHWHUZKHQSHUIRUPLQJRSWLPXPDGMXVWPHQWE\XVLQJWKHJDLQVZLWFKLQJ function. *DLQVHOHFWLRQVZLWFKLQJ 0 VWJDLQLVÀ[HGDWDYDOXH%\XVLQJWKHJDLQVZLWFKLQJLQSXW *$,1 FKDQJH WKHYHORFLW\ORRSRSHUDWLRQIURP3,WR3 *$,1LQSXWSKRWRFRXSOHU2)) PI operation *$,1LQSXWSKRWRFRXSOHU21 P operation *7KHDERYHGHVFULSWLRQDSSOLHVZKHQWKHORJLFDOVHWWLQJRI*$,1LQSXWLV DFRQWDFW212))RISKRWRFRXSOHULVUHYHUVHGZKHQEFRQWDFW [1] (QDEOH JDLQ VZLWFKLQJ RI VW JDLQ 3U3U DQG QG JDLQ 3U 3U 4-15 7 Supplement )RUVZLWFKLQJFRQGLWLRQRIWKHVWDQGWKHQGUHIHUWR3*DLQ6ZLWFKLQJ)XQFWLRQRI $GMXVWPHQW 6 When in Trouble Related page Setup value 5 Adjustment Pr1.14 =HURSRVLWLRQDOGHYLDWLRQLVLPSRVVLEOHLQDFWXDOVLWXDWLRQEHFDXVHRIGLVWXUEDQFHWRUTXH $VZLWKWKHYHORFLW\IHHGIRUZDUGODUJHWRUTXHIHHGIRUZDUGÀOWHUWLPHFRQVWDQWGHFUHDVHV WKHRSHUDWLQJQRLVHEXWLQFUHDVHVSRVLWLRQDOGHYLDWLRQDWDFFHOHUDWLRQFKDQJHSRLQW 4 Setup 8VDJHH[DPSOHRIWRUTXHIHHGIRUZDUG! 7RXVHWKHWRUTXHIHHGIRUZDUGFRUUHFWO\VHWWKHLQHUWLDUDWLR 8VHWKHYDOXHWKDWZDVGHWHUPLQHGDWWKHVWDUWRIWKHUHDOWLPHDXWRWXQLQJRUVHWWKHLQHUWLD UDWLRWKDWFDQEHFDOFXODWHGIURPWKHPDFKLQHVSHFLÀFDWLRQWR3U,QHUWLDUDWLR 7KHWRUTXHIHHGIRUZDUGZLOOEHFRPHHIIHFWLYHDVWKHWRUTXHIHHGIRUZDUGJDLQLVJUDGXDOO\ LQFUHDVHGZLWKWKHWRUTXHIHHGIRUZDUGÀOWHULVVHWDWDSSUR[ PV 3RVLWLRQDOGHYLDWLRQDWDFRQVWDQWDFFHOHUDWLRQGHFHOHUDWLRQFDQEHPLQLPL]HGFORVHWRE\ LQFUHDVLQJWKHWRUTXHIRUZDUGJDLQ7KLVPHDQVWKDWSRVLWLRQDOGHYLDWLRQFDQEHPDLQWDLQHG DWQHDURYHUHQWLUHRSHUDWLRQUDQJHZKLOHGULYLQJLQWUDSH]RLGDOVSHHGSDWWHUQXQGHULGHDO FRQGLWLRQZKHUHGLVWXUEDQFHWRUTXHLVQRWDFWLYH 3 Connection 6HWXSWKHWLPHFRQVWDQWRIVWGHOD\ÀOWHUZKLFKDIIHFWVWKHLQSXWRIWRUTXHIHHGIRUZDUG 7KHWRUTXHIHHGIRUZDUGZLOOEHFRPHHIIHFWLYHDVWKHWRUTXHIHHGIRUZDUGJDLQLVJUDGXDOO\ LQFUHDVHGZLWKWKHWRUTXHIHHGIRUZDUGÀOWHULVVHWDWDSSUR[ PV 2 Preparation 0XOWLSO\WKHWRUTXHFRPPDQGFDOFXODWHGDFFRUGLQJWRWKHYHORFLW\FRQWUROFRPPDQGE\WKH UDWLRRIWKLVSDUDPHWHUDQGDGGWKHUHVXOWWRWKHWRUTXHFRPPDQGUHVXOWLQJIURPWKHYHORFLW\ control process. 3RVLWLRQDOGHYLDWLRQDWDFRQVWDQWDFFHOHUDWLRQGHFHOHUDWLRQFDQEHPLQLPL]HGFORVHWRE\ LQFUHDVLQJWKHWRUTXHIRUZDUGJDLQ7KLVPHDQVWKDWSRVLWLRQDOGHYLDWLRQFDQEHPDLQWDLQHG DWQHDURYHUHQWLUHRSHUDWLRQUDQJHZKLOHGULYLQJLQWUDSH]RLGDOVSHHGSDWWHUQXQGHULGHDO FRQGLWLRQZKHUHGLVWXUEDQFHWRUTXHLVQRWDFWLYH Before Using the Products [Class 1] Gain adjustment 1. Details of parameter [Class 1] Gain adjustment Pr1.15 0RGHRISRVLWLRQFRQWUROVZLWFKLQJ Range Unit Default 0 to 10 — 0 Related control mode P F 6HWXSWKHWULJJHULQJFRQGLWLRQRIJDLQVZLWFKLQJIRUSRVLWLRQFRQWURO Setup value 6ZLWFKLQJ condition [0] )L[HGWRVWJDLQ 1 )L[HGWRQGJDLQ )L[HGWRWKHQGJDLQ 3UWR3U 2 :LWKJDLQ VZLWFKLQJLQSXW VWJDLQZKHQWKHJDLQVZLWFKLQJLQSXW *$,1 LVRSHQ QGJDLQZKHQWKHJDLQVZLWFKLQJLQSXW *$,1 LVFRQQHFWHGWR&20 *,IQRLQSXWVLJQDOLVDOORFDWHGWRWKHJDLQVZLWFKLQJLQSXW *$,1 WKHVWJDLQLVÀ[HG 3 Torque command is large 6KLIWWRWKHQGJDLQZKHQWKHDEVROXWHYDOXHRIWKHWRUTXHFRPPDQGH[FHHGHG OHYHO K\VWHUHVLV SUHYLRXVO\ZLWKWKHVWJDLQ 5HWXUQWRWKHVWJDLQZKHQWKHDEVROXWHYDOXHRIWKHWRUTXHFRPPDQGZDVNHSWEHORZ OHYHO K\VWHUHVLV SUHYLRXVO\GXULQJGHOD\WLPHZLWKWKHQGJDLQ 5 Speed command is large 9DOLGIRUSRVLWLRQDQGIXOOFORVHGFRQWUROV 6KLIWWRWKHQGJDLQZKHQWKHDEVROXWHYDOXHRIWKHVSHHGFRPPDQGH[FHHGHG OHYHO K\VWHUHVLV UPLQ SUHYLRXVO\ZLWKWKHVWJDLQ 5HWXUQWRWKHVWJDLQZKHQWKHDEVROXWHYDOXHRIWKHVSHHGFRPPDQGZDVNHSWEHORZ OHYHO K\VWHUHVLV UPLQ SUHYLRXVO\GXULQJGHOD\WLPHZLWKWKHQGJDLQ 6 Position GHYLDWLRQLV large 9DOLGIRUSRVLWLRQDQGIXOOFORVHGFRQWUROV 6KLIWWRWKHQGJDLQZKHQWKHDEVROXWHYDOXHRIWKHSRVLWLRQDOGHYLDWLRQH[FHHGHG OHYHO K\VWHUHVLV SXOVH SUHYLRXVO\ZLWKWKHVWJDLQ 5HWXUQWRWKHVWJDLQZKHQWKHDEVROXWHYDOXHRIWKHSRVLWLRQDOGHYLDWLRQZDVNHSWEHORZ OHYHOK\VWHUHVLV SXOVH SUHYLRXVO\RYHUGHOD\WLPHZLWKWKHQGJDLQ *8QLWRIOHYHODQGK\VWHUHVLV SXOVH LVVHWDVWKHHQFRGHUUHVROXWLRQIRUSRVLWLRQDOFRQWURO DQGH[WHUQDOVFDOHUHVROXWLRQIRUIXOOFORVHGFRQWURO 7 Position command H[LVWV 9DOLGIRUSRVLWLRQDQGIXOOFORVHGFRQWUROV 6KLIWWRWKHQGJDLQZKHQWKHSRVLWLRQDOFRPPDQGZDVQRWSUHYLRXVO\ZLWKWKHVWJDLQ 5HWXUQWRWKHVWJDLQZKHQWKHSRVLWLRQDOFRPPDQGZDVNHSWSUHYLRXVO\GXULQJGHOD\ WLPHZLWKWKHQGJDLQ 8 1RWLQ positioning complete 9DOLGIRUSRVLWLRQDQGIXOOFORVHGFRQWUROV 6KLIWWRWKHQGJDLQZKHQWKHSRVLWLRQLQJZDVQRWFRPSOHWHGSUHYLRXVO\ZLWKWKHVWJDLQ 5HWXUQWRWKHVWJDLQZKHQWKHSRVLWLRQLQJZDVNHSWLQFRPSOHWHGFRQGLWLRQSUHYLRXVO\ GXULQJGHOD\WLPHZLWKWKHQGJDLQ 9 $FWXDOVSHHGLV large 9DOLGIRUSRVLWLRQDQGIXOOFORVHGFRQWUROV 6KLIW WR WKH QG JDLQ ZKHQ WKH DEVROXWH YDOXH RI WKH DFWXDO VSHHG H[FHHGHG OHYHO K\VWHUHVLV UPLQ SUHYLRXVO\ZLWKWKHVWJDLQ 5HWXUQWRWKHVWJDLQZKHQWKHDEVROXWHYDOXHRIWKHDFWXDOVSHHGZDVNHSWEHORZ OHYHO K\VWHUHVLV UPLQ SUHYLRXVO\GXULQJGHOD\WLPHZLWKWKHQGJDLQ 10 Position command H[LVWV $FWXDOVSHHG 9DOLGIRUSRVLWLRQDQGIXOOFORVHGFRQWUROV 6KLIWWRWKHQGJDLQZKHQWKHSRVLWLRQDOFRPPDQGZDVQRWSUHYLRXVO\ZLWKWKHVWJDLQ 5HWXUQ WR WKH VW JDLQ ZKHQ WKH SRVLWLRQDO FRPPDQG ZDV NHSW DW GXULQJ WKH GHOD\ WLPHDQGWKHDEVROXWHYDOXHRIDFWXDOVSHHGZDVNHSWEHORZ OHYHOK\VWHUHVLV UPLQ SUHYLRXVO\ZLWKWKHQGJDLQ Pr1.16 *DLQVZLWFKLQJFRQGLWLRQ )L[HGWRWKHVWJDLQ 3UWR3U 'HOD\WLPHRISRVLWLRQFRQWUROVZLWFKLQJ Range Unit Default 0 to 10000 0.1ms 50 Related control mode P F )RUSRVLWLRQFRQWUROOLQJ:KHQVKLIWLQJIURPWKHQGJDLQWRWKHVWJDLQZLWK3U3RVLWLRQ FRQWURO VZLWFKLQJ PRGH VHW DW RU VHW XS WKH GHOD\ WLPH IURP WULJJHU GHWHFWLRQWRWKHVZLWFKLQJRSHUDWLRQ Note Related page 4-16 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 'HIDXOW>@ Pr1.17 /HYHORISRVLWLRQFRQWUROVZLWFKLQJ Range Unit Default 0 to 20000 Modedependent 50 Related control mode P F )RUSRVLWLRQFRQWUROOLQJ6HWXSWULJJHULQJOHYHOZKHQ3U3RVLWLRQFRQWUROJDLQVZLWFKLQJ PRGHLVVHWDWRU 8QLWRIVHWWLQJYDULHVZLWKVZLWFKLQJPRGH Pr1.18 6HWWKHOHYHOHTXDOWRRUKLJKHUWKDQWKHK\VWHUHVLV +\VWHUHVLVDWSRVLWLRQFRQWUROVZLWFKLQJ Range Unit Default 0 to 20000 Modedependent 33 Related control mode P F )RU SRVLWLRQ FRQWUROOLQJ 6HW XS WULJJHULQJ K\VWHUHVLV ZKHQ 3U 3RVLWLRQ FRQWURO JDLQ VZLWFKLQJPRGHLVVHWDWRU 8QLWRIVHWWLQJYDULHVZLWKVZLWFKLQJPRGH Pr1.19 :KHQOHYHOK\VWHUHVLVWKHK\VWHUHVLVLVLQWHUQDOO\DGMXVWHGVRWKDWLWLVHTXDOWROHYHO 3RVLWLRQJDLQVZLWFKLQJWLPH Range Unit Default 0 to 10000 0.1ms 33 Related control mode P F 3RVLWLRQJDLQVZLWFKLQJWLPH! :KHQXVLQJSRVLWLRQFRQWURODQGIXOOFORVHGFRQWUROJDLQRISRVLWLRQORRSUDSLGO\FKDQJHV FDXVLQJ WRUTXH FKDQJH DQG YLEUDWLRQ %\ DGMXVWLQJ 3U 3RVLWLRQ JDLQ VZLWFKLQJ WLPH LQFUHDVLQJUDWHRIWKHSRLVRQORRSJDLQFDQEHGHFUHDVHGDQGYLEUDWLRQOHYHOFDQEHUHGXFHG 6HWWLQJRIWKLVSDUDPHWHUGRHVQRWDIIHFWWKHJDLQVZLWFKLQJWLPHZKHQWKHJDLQRISRVLWLRQ ORRSLVVZLWFKHGWRORZHUOHYHO JDLQLVVZLWFKHGLPPHGLDWHO\ 2nd (Pr1.05) Position gain switching time (ms) (Pr1.19) 1st (Pr1.00) Result of switching 1st 5 Adjustment ([DPSOHVW 3U !QG 3U 4 Setup )RUSRVLWLRQFRQWUROOLQJ,IWKHGLIIHUHQFHEHWZHHQ3UVWJDLQRISRVLWLRQORRSDQG3U QGJDLQRISRLVRQORRSLVODUJHWKHLQFUHDVLQJUDWHRISRVLWLRQORRSJDLQFDQEHOLPLWHGE\ this parameter. 7KHSRVLWLRQORRSJDLQZLOOLQFUHDVHRYHUWKHWLPHVHW Caution 3 Connection Caution 2 Preparation Caution Before Using the Products [Class 1] Gain adjustment 2nd 6 1st When in Trouble 7 Related page $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-17 Supplement Note 1. Details of parameter [Class 1] Gain adjustment 'HIDXOW>@ Pr1.20 0RGHRIYHORFLW\FRQWUROVZLWFKLQJ Range Unit Default 0 to 5 — 0 Related control mode S )RUYHORFLW\FRQWUROOLQJ6HWWKHFRQGLWLRQWRWULJJHUJDLQVZLWFKLQJ Setup value 6ZLWFKLQJFRQGLWLRQ [0] )L[HGWRWKHVWJDLQ )L[HGWRWKHVWJDLQ 3UWR3U 1 )L[HGWRWKHQGJDLQ )L[HGWRWKHQGJDLQ 3UWR3U 2 3 4 Related page Pr1.21 *DLQVZLWFKLQJFRQGLWLRQ *DLQVZLWFKLQJLQSXW VWJDLQZKHQWKHJDLQVZLWFKLQJLQSXW *$,1 LVRSHQ QGJDLQZKHQWKHJDLQVZLWFKLQJLQSXW *$,1 LVFRQQHFWHGWR COM–. *,IQRLQSXWVLJQDOLVDOORFDWHGWRWKHJDLQVZLWFKLQJLQSXW *$,1 WKHVWJDLQLVÀ[HG Torque command 6KLIW WR WKH QG JDLQ ZKHQ WKH DEVROXWH YDOXH RI WKH WRUTXH FRPPDQG H[FHHGHG OHYHO K\VWHUHVLV SUHYLRXVO\ ZLWK the 1st gain. 5HWXUQWRWKHVWJDLQZKHQWKHDEVROXWHYDOXHRIWKHWRUTXH FRPPDQGZDVNHSWEHORZ OHYHOK\VWHUHVLV SUHYLRXVO\ GXULQJGHOD\WLPHZLWKWKHQGJDLQ Speed command YDULDWLRQLVODUJHU 9DOLGRQO\GXULQJYHORFLW\FRQWURO 6KLIW WR WKH QG JDLQ ZKHQ WKH DEVROXWH YDOXH RI WKH VSHHG FRPPDQGYDULDWLRQVH[FHHGHG OHYHOK\VWHUHVLV UPLQV SUHYLRXVO\ZLWKWKHVWJDLQ 5HWXUQWRWKHVWJDLQZKHQWKHDEVROXWHYDOXHRIWKHVSHHG FRPPDQGYDULDWLRQVZDVNHSWEHORZ OHYHOK\VWHUHVLV U PLQV GXULQJGHOD\WLPHSUHYLRXVO\ZLWKWKHQGJDLQ *7KHVWJDLQLVÀ[HGZKLOHWKHYHORFLW\FRQWUROLVQRWDSSOLHG )RUWKHVZLWFKLQJOHYHODQGWLPLQJUHIHUWR36HWXSRI*DLQ6ZLWFKLQJ&RQGLWLRQRI$GMXVWPHQW 'HOD\WLPHRIYHORFLW\FRQWUROVZLWFKLQJ Range Unit Default 0 to 10000 0.1ms 0 Related control mode S )RUYHORFLW\FRQWUROOLQJ:KHQVKLIWLQJIURPWKHQGJDLQWRWKHVWJDLQZLWK3U9HORFLW\ FRQWURO VZLWFKLQJ PRGH VHW DW RU VHW WKH GHOD\ WLPH IURP WULJJHU GHWHFWLRQ WR WKH VZLWFKLQJRSHUDWLRQ Pr1.22 /HYHORIYHORFLW\FRQWUROVZLWFKLQJ Range Unit Default 0 to 20000 Modedependent 0 Related control mode S )RUYHORFLW\FRQWUROOLQJ6HWXSWULJJHULQJOHYHOZKHQ3U9HORFLW\FRQWUROJDLQVZLWFKLQJ PRGHLVVHWDWRU Caution Pr1.23 8QLWRIVHWWLQJYDULHVZLWKVZLWFKLQJPRGH 6HWWKHOHYHOHTXDOWRRUKLJKHUWKDQWKHK\VWHUHVLV +\VWHUHVLVDWYHORFLW\FRQWUROVZLWFKLQJ Range Unit Default 0 to 20000 Modedependent 0 Related control mode S )RU YHORFLW\ FRQWUROOLQJ 6HW XS WULJJHULQJ K\VWHUHVLV ZKHQ 3U 9HORFLW\ FRQWURO JDLQ VZLWFKLQJPRGHLVVHWDWRU Caution Note Related page 4-18 8QLWRIVHWWLQJYDULHVZLWKVZLWFKLQJPRGH :KHQOHYHOK\VWHUHVLVWKHK\VWHUHVLVLVLQWHUQDOO\DGMXVWHGVRWKDWLWLVHTXDOWROHYHO $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 'HIDXOW>@ Pr1.24 0RGHRIWRUTXHFRQWUROVZLWFKLQJ Range Unit Default 0 to 3 — 0 Related control mode T )RUWRUTXHFRQWUROOLQJ6HWWKHFRQGLWLRQWRWULJJHUJDLQVZLWFKLQJ 6ZLWFKLQJFRQGLWLRQ [0] )L[HGWRWKHVWJDLQ )L[HGWRWKHVWJDLQ 3UWR3U 1 )L[HGWRWKHQGJDLQ )L[HGWRWKHQGJDLQ 3UWR3U 2 Pr1.25 *DLQVZLWFKLQJLQSXW VWJDLQZKHQWKHJDLQVZLWFKLQJLQSXW *$,1 LVRSHQ QGJDLQZKHQWKHJDLQVZLWFKLQJLQSXW *$,1 LVFRQQHFWHGWR COM–. *,IQRLQSXWVLJQDOLVDOORFDWHGWRWKHJDLQVZLWFKLQJLQSXW *$,1 WKHVWJDLQLVÀ[HG Torque command 6KLIW WR WKH QG JDLQ ZKHQ WKH DEVROXWH YDOXH RI WKH WRUTXH FRPPDQG H[FHHGHG OHYHO K\VWHUHVLV SUHYLRXVO\ ZLWK the 1st gain. 5HWXUQWRWKHVWJDLQZKHQWKHDEVROXWHYDOXHRIWKHWRUTXH FRPPDQGZDVNHSWEHORZ OHYHOK\VWHUHVLV SUHYLRXVO\ GXULQJGHOD\WLPHZLWKWKHQGJDLQ 'HOD\WLPHRIWRUTXHFRQWUROVZLWFKLQJ Range Unit Default 0 to 10000 0.1ms 0 Related control mode T /HYHORIWRUTXHFRQWUROVZLWFKLQJ Range Unit Default 0 to 20000 Modedependent 0 Related control mode T )RU WRUTXH FRQWUROOLQJ 6HW XS WULJJHULQJ OHYHO ZKHQ 3U7RUTXH FRQWURO JDLQ VZLWFKLQJ mode is set at 3. 8QLWYDULHVGHSHQGLQJRQWKHVHWXSRIPRGHRIFRQWUROVZLWFKLQJ Pr1.27 6HWWKHOHYHOHTXDOWRRUKLJKHUWKDQWKHK\VWHUHVLV +\VWHUHVLVDWWRUTXHFRQWUROVZLWFKLQJ Range Unit Default 0 to 20000 Modedependent 0 Related control mode T :KHQOHYHOK\VWHUHVLVWKHK\VWHUHVLVLVLQWHUQDOO\DGMXVWHGVRWKDWLWLVHTXDOWROHYHO 6 When in Trouble )RU WRUTXH FRQWUROOLQJ 6HW XS WULJJHULQJ K\VWHUHVLV ZKHQ 3U 7RUTXH FRQWURO JDLQ VZLWFKLQJPRGHLVVHWDW 8QLWRIVHWWLQJYDULHVZLWKVZLWFKLQJPRGH Caution 5 Adjustment Caution 4 Setup )RUWRUTXHFRQWUROOLQJ:KHQVKLIWLQJIURPWKHQGJDLQWRWKHVWJDLQZLWK3U7RUTXH FRQWUROVZLWFKLQJPRGHVHWDWVHWXSWKHGHOD\WLPHIURPWULJJHUGHWHFWLRQWRWKHVZLWFKLQJ operation. Pr1.26 3 Connection 3 2 *DLQVZLWFKLQJFRQGLWLRQ Preparation Setup value Before Using the Products [Class 1] Gain adjustment 7 Related page $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-19 Supplement Note 4 1. Details of parameter Setup [Class 2] Damping control Pr2.00 Adaptive filter mode setup Range Unit Default 0 to 4 — 0 Related control mode P S F 6HW XS WKH UHVRQDQFH IUHTXHQF\ WR EH HVWLPDWHG E\ WKH DGDSWLYH ILOWHU DQG VSHFLI\ WKH operation after estimation. Setup value Pr2.01 Content [0] $GDSWLYHÀOWHU LQYDOLG 3DUDPHWHUVUHODWHGWRWKHUGDQGWKQRWFKÀOWHUKROGWKH FXUUHQWYDOXH 1 $GDSWLYHÀOWHU ÀOWHULVYDOLG 2QHDGDSWLYHÀOWHULVHQDEOHG3DUDPHWHUVUHODWHGWRWKHUG QRWFKÀOWHUZLOOEHXSGDWHGEDVHGRQDGDSWLYHSHUIRUPDQFH 2 $GDSWLYHÀOWHU ÀOWHUVDUHYDOLG 7ZRDGDSWLYHÀOWHUVDUHHQDEOHG3DUDPHWHUVUHODWHGWRWKH UGDQGWKQRWFKÀOWHUVZLOOEHXSGDWHGEDVHGRQDGDSWLYH performance. 3 Resonance frequency measurement mode Measure the resonance frequency. Result of measurement FDQEHFKHFNHGZLWK3$1$7(503DUDPHWHUVUHODWHGWRWKH UGDQGWKQRWFKÀOWHUKROGWKHFXUUHQWYDOXH 4 Clear result of adaptation 3DUDPHWHUVUHODWHGWRWKHUGDQGWKQRWFKÀOWHUDUH GLVDEOHGDQGUHVXOWVRIDGDSWLYHRSHUDWLRQDUHFOHDUHG 1st notch frequency Range Unit Default Related control mode 50 to 5000 Hz 5000 P S T F 6HWWKHFHQWHUIUHTXHQF\RIWKHVWQRWFKÀOWHU Caution Pr2.02 7KHQRWFKÀOWHUIXQFWLRQZLOOEHLQYDOLGDWHGE\VHWWLQJXSWKLVSDUDPHWHUWR VWQRWFKZLGWKVHOHFWLRQ Range Unit Default Related control mode 0 to 20 — 2 P S T F 6HWWKHZLGWKRIQRWFKDWWKHFHQWHUIUHTXHQF\RIWKHVWQRWFKÀOWHU Caution Pr2.03 +LJKHUWKHVHWXSODUJHUWKHQRWFKZLGWK\RXFDQREWDLQ8VHZLWKGHIDXOWVHWXSLQQRUPDO operation. 1st notch depth selection Range Unit Default Related control mode 0 to 99 — 0 P S T F 6HWWKHGHSWKRIQRWFKDWWKHFHQWHUIUHTXHQF\RIWKHVWQRWFKÀOWHU Caution Pr2.04 +LJKHUWKHVHWXSVKDOORZHUWKHQRWFKGHSWKDQGVPDOOHUWKHSKDVHGHOD\\RXFDQREWDLQ 2nd notch frequency Range Unit Default Related control mode 50 to 5000 Hz 5000 P S T F 6HWWKHFHQWHUIUHTXHQF\RIWKHQGQRWFKÀOWHU Caution Pr2.05 7KHQRWFKÀOWHUIXQFWLRQZLOOEHLQYDOLGDWHGE\VHWWLQJXSWKLVSDUDPHWHUWR QGQRWFKZLGWKVHOHFWLRQ Range Unit Default Related control mode 0 to 20 — 2 P S T F 6HWWKHZLGWKRIQRWFKDWWKHFHQWHUIUHTXHQF\RIWKHQGQRWFKÀOWHU Caution 4-20 +LJKHUWKHVHWXSODUJHUWKHQRWFKZLGWK\RXFDQREWDLQ8VHZLWKGHIDXOWVHWXSLQQRUPDORSHUDWLRQ 1. Details of parameter 1 'HIDXOW>@ Pr2.06 2nd notch depth selection Range Unit Default Related control mode 0 to 99 — 0 P S T F 6HWWKHGHSWKRIQRWFKDWWKHFHQWHUIUHTXHQF\RIWKHQGQRWFKÀOWHU Caution 2 +LJKHUWKHVHWXSVKDOORZHUWKHQRWFKGHSWKDQGVPDOOHUWKHSKDVHGHOD\\RXFDQREWDLQ 3rd notch frequency Range Unit Default Related control mode 50 to 5000 Hz 5000 P S T F 1RWFKIUHTXHQF\LVDXWRPDWLFDOO\VHWWRWKHVWUHVRQDQFHIUHTXHQF\HVWLPDWHGE\WKHDGDSWLYHÀOWHU Caution Pr2.08 ,QQRUHVRQDQFHSRLQWLVIRXQGWKHIUHTXHQF\LVVHWWR UGQRWFKZLGWKVHOHFWLRQ Unit Default Related control mode 0 to 20 — 2 P S T F Pr2.09 +LJKHUWKHVHWXSODUJHUWKHQRWFKZLGWK\RXFDQREWDLQ8VHZLWKGHIDXOWVHWXSLQQRUPDORSHUDWLRQ :KHQWKHDSSOLFDEOHÀOWHUIXQFWLRQLVXVHGSDUDPHWHUYDOXHLVDXWRPDWLFDOO\VHW 3rd notch depth selection Range Unit Default Related control mode 0 to 99 — 0 P S T F 3 Connection Range 6HWWKHZLGWKRIQRWFKDWWKHFHQWHUIUHTXHQF\RIWKHUGQRWFKÀOWHU Caution Preparation Pr2.07 Before Using the Products [Class 2] Damping control 4 6HWWKHGHSWKRIQRWFKDWWKHFHQWHUIUHTXHQF\RIWKHUGQRWFKÀOWHU Pr2.10 Setup Caution +LJKHUWKHVHWXSVKDOORZHUWKHQRWFKGHSWKDQGVPDOOHUWKHSKDVHGHOD\\RXFDQREWDLQ :KHQWKHDSSOLFDEOHÀOWHUIXQFWLRQLVXVHGSDUDPHWHUYDOXHLVDXWRPDWLFDOO\VHW 4th notch frequency Range Unit Default Related control mode 50 to 5000 Hz 5000 P S T F 5 1RWFKIUHTXHQF\LVDXWRPDWLFDOO\VHWWRWKHQGUHVRQDQFHIUHTXHQF\HVWLPDWHGE\WKHDGDSWLYHÀOWHU Pr2.11 7KHQRWFKÀOWHUIXQFWLRQZLOOEHLQYDOLGDWHGE\VHWWLQJXSWKLVSDUDPHWHUWR WKQRWFKZLGWKVHOHFWLRQ Range Unit Default Related control mode 0 to 20 — 2 P S T F 6HWWKHZLGWKRIQRWFKDWWKHFHQWHUIUHTXHQF\RIWKHWKQRWFKÀOWHU Caution 4th notch depth selection Range Unit Default Related control mode 0 to 99 — 0 P S T F 6 When in Trouble Pr2.12 +LJKHUWKHVHWXSODUJHUWKHQRWFKZLGWK\RXFDQREWDLQ8VHZLWKGHIDXOWVHWXSLQQRUPDORSHUDWLRQ :KHQWKHDSSOLFDEOHÀOWHUIXQFWLRQLVXVHGSDUDPHWHUYDOXHLVDXWRPDWLFDOO\VHW Adjustment Caution 6HWWKHGHSWKRIQRWFKDWWKHFHQWHUIUHTXHQF\RIWKHWKQRWFKÀOWHU Caution Related page 7 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-21 Supplement Note +LJKHUWKHVHWXSVKDOORZHUWKHQRWFKGHSWKDQGVPDOOHUWKHSKDVHGHOD\\RXFDQREWDLQ :KHQWKHDSSOLFDEOHÀOWHUIXQFWLRQLVXVHGSDUDPHWHUYDOXHLVDXWRPDWLFDOO\VHW 1. Details of parameter [Class 2] Damping control 'HIDXOW>@ Pr2.13 6HOHFWLRQRIGDPSLQJILOWHUVZLWFKLQJ Range Unit Default 0 to 3 — 0 Related control mode P F $PRQJÀOWHUVVHOHFWWKHÀOWHUVWREHXVHGIRUGDPSLQJFRQWURO :KHQVHWXSYDOXHLV8SWRÀOWHUVFDQEHXVHGVLPXOWDQHRXVO\ :KHQVHWXSYDOXHLVRU6HOHFWWKHÀOWHUZLWKH[WHUQDOLQSXW V 966(/DQGRU966(/ Setup value VS-SEL2 VS-SEL1 [0] — — 1 1st damping 2nd damping 3rd damping 4th damping — — 2 :LWKVHWXSYDOXH6HOHFWWKHÀOWHUZLWKFRPPDQGGLUHFWLRQ Setup value 3 Caution Pr2.14 Pr2.16 Position command direction 1st damping 2nd damping 3rd damping 4th damping 3RVLWLYHGLUHFWLRQ 1HJDWLYHGLUHFWLRQ 6ZLWFKLQJ RI GDPSLQJ FRQWUROV ZLOO EH GRQH RQ WKH ULVLQJ HGJH RI WKH FRPPDQG ZKRVH QXPEHU RI SXOVHV PV KDV EHHQ FKDQJHG IURP ZKLOH WKH SRVLWLRQLQJ FRPSOHWH signal is being output. :KHQWKHGDPSLQJIUHTXHQF\LVLQFUHDVHGRUGLVDEOHGDQGSRVLWLRQLQJFRPSOHWHUDQJHLV ODUJHDQGSXOVHVDUHVWRUHGLQWKHÀOWHUDWWKDWWLPH WKHDUHDUHSUHVHQWHGE\WKHYDOXHRI SRVLWLRQFRPPDQGEHIRUHÀOWHUVXEWUDFWHGE\WKHYDOXHRISRVLWLRQFRPPDQGDIWHUÀOWHUDQG LQWHJUDWHGZLWKWKHWLPH 1RWHWKDWVLQFHWKHVHSXOVHVZLOOEHGLVFKDUJHGDWDKLJKHUUDWH XSRQVZLWFKLQJWRUHWXUQEDFNWRWKHRULJLQDOSRVLWLRQWKHPRWRUPD\UXQDWDVSHHGKLJKHU than the command speed for a short time. 1st damping frequency 2nd damping frequency Pr2.18 3rd damping frequency Pr2.20 4th damping frequency Range Unit Default 0 to 2000 0.1Hz 0 Range Unit Default 0 to 2000 0.1Hz 0 Range Unit Default 0 to 2000 0.1Hz 0 Range Unit Default 0 to 2000 0.1Hz 0 Related control mode P F Related control mode P F Related control mode P F Related control mode P F +]@ Related page Note Related page 4-22 7KHVHWXSIUHTXHQF\LVWR>+]@6HWXSRIWREHFRPHVLQYDOLG5HIHUWR3 'DPSLQJFRQWURODVZHOOEHIRUHXVLQJWKLVSDUDPHWHU $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 Pr2.15 Pr2.17 Pr2.21 2nd damping filter setup 3rd damping filter setup 4th damping filter setup Range Unit Default 0 to 1000 0.1Hz 0 Range Unit Default 0 to 1000 0.1Hz 0 Range Unit Default 0 to 1000 0.1Hz 0 Range Unit Default 0 to 1000 0.1Hz 0 Related control mode P F Related control mode P F P F Related control mode P F ,IWRUTXHVDWXUDWLRQRFFXUVZLWKGDPSLQJIUHTXHQF\ VWWK HQDEOHGGHFUHDVHWKHVHWXS YDOXHRULIWKHRSHUDWLRQLVVORZLQFUHDVHLW8VXDOO\VHWLWWR 7KHPD[LPXPVHWXSYDOXHLVLQWHUQDOO\OLPLWHGWRWKHFRUUHVSRQGLQJGDPSLQJIUHTXHQF\RU GDPSLQJIUHTXHQF\ZKLFKHYHULVVPDOOHU Related page 5HIHUWR3'DPSLQJFRQWURODVZHOOEHIRUHXVLQJWKLVSDUDPHWHU Positional command smoothing filter Range Unit Default 0 to 10000 0.1ms 0 Related control mode P F 6HWXSWKHWLPHFRQVWDQWRIWKHVWGHOD\ÀOWHULQUHVSRQVHWRWKHSRVLWLRQDOFRPPDQG :KHQDVTXDUHZDYHFRPPDQGIRUWKHWDUJHWVSHHG9FLVDSSOLHGVHWXSWKHWLPHFRQVWDQW RIWKHVWGHOD\ÀOWHUDVVKRZQLQWKHÀJXUHEHORZ Positional command before filter Positional command after filter 4 Setup Speed [r/min] 3 Connection Caution Pr2.22 2 Related control mode Preparation Pr2.19 1st damping filter setup Before Using the Products [Class 2] Damping control Filter switching waiting time *2 Vc Vc×0.632 *1 Positional command smoothing filter setup time [ms] (Pr2.22 × 0.1 ms) 5 Vc×0.368 *1 6 When in Trouble * $FWXDOÀOWHUWLPHFRQVWDQW VHWXSYDOXHðPV KDVWKHPD[LPXPDEVROXWHHUURURIPVIRUDWLPH FRQVWDQWEHORZPVDQGWKHPD[LPXPUHODWLYHHUURURIIRUDWLPHFRQVWDQWPVRUPRUH * 6ZLWFKLQJRI3U3RVLWLRQDOFRPPDQGVPRRWKLQJÀOWHULVSHUIRUPHGRQWKHULVLQJHGJHRIWKHFRPPDQG ZLWK WKH QXPEHU RI FRPPDQG SXOVHV PV LV FKDQJHG IURP WR D YDOXH RWKHU WKDQ ZKLOH WKH positioning complete is being output. ,IWKHÀOWHUWLPHFRQVWDQWLVGHFUHDVHGDQGSRVLWLRQLQJFRPSOHWHUDQJHLVLQFUHDVHGDQGDPDQ\QXPEHU RISOXVVHVDUHDFFXPXODWHGLQWKHÀOWHU WKHDUHDHTXLYDOHQWRI´YDOXHRISRVLWLRQDOFRPPDQGÀOWHUYDOXH RISRVLWLRQDOFRPPDQGDIWHUÀOWHUµLQWHJUDWHGRYHUWKHWLPH DWWKHWLPHRIVZLWFKLQJWKHVHSXOVHVDUH GLVFKDUJHGDWDKLJKHUUDWHFDXVLQJWKHPRWRUWRUHWXUQWRWKHSUHYLRXVSRVLWLRQWKHPRWRUUXQVDWD speed higher than the command speed for a short time. * (YHQ LI 3U 3RVLWLRQDO FRPPDQG VPRRWKLQJ ILOWHU LV FKDQJHG LW LV QRW DSSOLHG LPPHGLDWHO\ ,I WKH VZLWFKLQJDVGHVFULEHGLQ*RFFXUVGXULQJWKLVGHOD\WLPHWKHFKDQJHRI3UZLOOEHVXVSHQGHG Adjustment Time 7 Related page $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-23 Supplement Note 1. Details of parameter [Class 2] Damping control 'HIDXOW>@ Pr2.23 Positional command FIR filter Range Unit Default 0 to 10000 0.1ms 0 Related control mode P F 6HWXSWKHWLPHFRQVWDQWRIWKHVWGHOD\ÀOWHULQUHVSRQVHWRWKHSRVLWLRQDOFRPPDQG :KHQDVTXDUHZDYHFRPPDQGRIWKHWDUJHWVSHHG9FLVDSSOLHGVHWXSWKH9&DUULYDO WLPHDVVKRZQLQWKHÀJXUHEHORZ Speed [r/min] Positional command before filter Positional command after filter Filter switching waiting time *2 Vc Positional command smoothing filter setup time [ms] (Pr2.23 × 0.1 ms)*1 Time * 7KHDFWXDODYHUDJHWUDYHOWLPH VHWXSYDOXHðPV KDVWKHPD[LPXPDEVROXWHHUURURIPVIRUD WLPHFRQVWDQWEHORZPVDQGWKHPD[LPXPUHODWLYHHUURURIIRUDWLPHFRQVWDQWPVRUPRUH * :KHQFKDQJLQJ3U3RVLWLRQDOFRPPDQG),5ÀOWHUVWRSWKHFRPPDQGSXOVHDQGZDLWXQWLOWKHÀOWHU VZLWFKLQJZDLWWLPHKDVHODSVHG7KHÀOWHUVZLWFKLQJZDLWWLPH LVWKHVHWXSYDOXHðPVPV ZKHQWKHVHWXSWLPHLVPVDQGVHWXSYDOXHðPVðZKHQWKHVHWXSWLPHLVPVRUPRUH,I 3ULVFKDQJHGZKLOHWKHFRPPDQGSXOVHLVEHLQJLQSXWWKHFKDQJHLVQRWUHÁHFWHGXQWLOWKHFRPPDQG SXOVHOHVVVWDWHKDVFRQWLQXHGIRUWKHÀOWHUVZLWFKLQJZDLWWLPH * (YHQLI3U3RVLWLRQDOFRPPDQG),5ÀOWHULVFKDQJHGLWLVQRWDSSOLHGLPPHGLDWHO\,IWKHVZLWFKLQJDV described in *RFFXUVGXULQJWKLVGHOD\WLPHWKHFKDQJHRI3UZLOOEHVXVSHQGHG Note Related page 4-24 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4 1. Details of parameter Setup [Class 3] Verocity/ Torque/ Full-closed control 1 Pr3.00 6SHHGVHWXS,QWHUQDO([WHUQDOVZLWFKLQJ Unit Default 0 to 3 — 0 Related control mode S 7KLVGULYHULVHTXLSSHGZLWKLQWHUQDOVSHHGVHWXSIXQFWLRQVRWKDW\RXFDQFRQWUROWKHVSHHG ZLWKFRQWDFWLQSXWVRQO\ Setup value Preparation 1 ,QWHUQDOVSHHGFRPPDQGVWWRWKVSHHG 3UWR3U 2 ,QWHUQDOVSHHGFRPPDQGVWWRUGVSHHG 3UWR3U $QDORJVSHHGFRPPDQG 635 3 ,QWHUQDOVSHHGFRPPDQGVWWRWKVSHHG 3UWR3U 3 5HODWLRQVKLSEHWZHHQ3U,QWHUQDOH[WHUQDOVZLWFKLQJVSHHGVHWXSDQGWKH LQWHUQDOFRPPDQGVSHHGVHOHFWLRQDQGDQGVSHHGFRPPDQGWREHVHOHFWHG! 1 2 Selection 2 of internal command speed (INTSPD2) OFF OFF 21 21 OFF OFF 21 21 21 Selection 3 of internal command speed (INTSPD3) 1st speed 2nd speed 3rd speed 4th speed 1st speed 2nd speed 3rd speed $QDORJVSHHG command 1st to 4th speed 5th speed 6th speed 7th speed 8th speed 1RHIIHFW 1RHIIHFW The same as Pr3.00=1 OFF OFF 21 OFF OFF 21 21 21 3 Selection of Speed command OFF 21 21 21 21 4 Setup Selection 1 of internal command speed (INTSPD1) OFF 21 OFF 21 OFF 21 OFF Connection Setup value INTSPD2 Speed command [r/min] open COMï open COMï 4th open INTSPD2 open INTSPD3 open 3rd 1st Speed command [r/min] COMï COMï 8th 4th 1st 2nd 6th 6 5th 3rd 1st Example 2) When Pr3.00=3 Speed command rotational direction selection Range Unit Default 0 to 1 — 0 Related control mode S 6HOHFWWKH3RVLWLYH1HJDWLYHGLUHFWLRQVSHFLI\LQJPHWKRG Setup value 1 Speed command direction (VC-SIGN) 1RHIIHFW 1RHIIHFW OFF 21 7 Position command direction Supplement [0] Select speed command sign (1st to 8th speed) ï Sign has no effect. Sign has no effect. When in Trouble Example 1) When Pr3.00=1 or 2 Pr3.01 COMï 7th 2nd 1st INTSPD1 5 Adjustment ,QWHUQDO FRPPDQG VSHHG VZLWFKLQJ SDWWHUQ VKRXOG EH VR DUUDQJHG DV VKRZQ EHORZ that single input signals are selected alternately. If 2 or more input signals are selected VLPXOWDQHRXVO\ XQVSHFLÀHG LQWHUQDOFRPPDQGVSHHGPD\EHDGYHUWHQWO\ VHOHFWHGZKRVH VHWWLQJYDOXHDQGDFFHOHUDWLRQGHFHOHUDWLRQVHWWLQJZLOOFDXVHXQH[SHFWHGRSHUDWLRQ INTSPD1 2 Speed setup method $QDORJVSHHGFRPPDQG 635 [0] Before Using the Products 'HIDXOW>@ Range 3RVLWLYHGLUHFWLRQ 1HJDWLYHGLUHFWLRQ 3RVLWLYHGLUHFWLRQ 1HJDWLYHGLUHFWLRQ 4-25 1. Details of parameter [Class 3] Verocity/ Torque/ Full-closed control 'HIDXOW>@ Pr3.02 Input gain of speed command Range Unit Default Related control mode 10 to 2000 UPLQ 9 500 S T %DVHGRQWKHYROWDJHDSSOLHGWRWKHDQDORJVSHHGFRPPDQG 635 VHWXSWKHFRQYHUVLRQ gain to motor command speed. UPLQ@ hence input of 6V becomes 3000r/min. Caution 'RQRWDSSO\PRUHWKDQ9WRWKHVSHHGFRPPDQGLQSXW 635 :KHQ\RXFRPSRVHDSRVLWLRQORRSRXWVLGHRIWKHGULYHUZKLOH\RXXVHWKH GULYHULQYHORFLW\FRQWUROPRGHWKHVHWXSRI3UJLYHVODUJHUYDULDQFH WRWKHRYHUDOOVHUYRV\VWHP 3D\DQH[WUDDWWHQWLRQWRRVFLOODWLRQFDXVHGE\ODUJHUVHWXSRI3U Positive direction Speed (r/min) 3000 –10 –6 2 4 6 8 10 Command input voltage (V) Slope at ex-factory –3000 Negative direction Pr3.03 Reversal of speed command input Range Unit Default 0 to 1 — 1 Related control mode S 6SHFLI\WKHSRODULW\RIWKHYROWDJHDSSOLHGWRWKHDQDORJVSHHGFRPPDQG 635 Setup value 0 1RQUHYHUVDO ´9ROWDJHµ ´3RVLWLYHGLUHFWLRQµ´²9ROWDJHµ ´1HJDWLYHGLUHFWLRQµ [1] 5HYHUVDO ´9ROWDJHµ ´1HJDWLYHGLUHFWLRQµ´²9ROWDJHµ ´3RVLWLYHGLUHFWLRQµ Note 'HIDXOW RI WKLV SDUDPHWHU LV DQG WKH PRWRU WXUQV WR &: ZLWK VLJQDO WKLV KDV FRPSDWLELOLW\WRH[LVWLQJ0,1$6VHULHVGULYHU Caution :KHQ \RX FRPSRVH WKH VHUYR GULYH V\VWHP ZLWK WKLV GULYHU VHW WR YHORFLW\ FRQWURO PRGH DQGH[WHUQDOSRVLWLRQLQJXQLWWKHPRWRUPLJKWSHUIRUPDQDEQRUPDODFWLRQLIWKHSRODULW\RI the speed command signal from the unit and the polarity of this parameter setup does not match. Note Related page 4-26 Motor rotating direction $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 'HIDXOW>@ Pr3.04 Pr3.05 Pr3.07 Pr3.08 Pr3.09 2nd speed of speed setup 3rd speed of speed setup 4th speed of speed setup 5th speed of speed setup 6th speed of speed setup 7th speed of speed setup Pr3.11 8th speed of speed setup Default ïWR r/min 0 Range Unit Default ïWR r/min 0 Range Unit Default ïWR r/min 0 Range Unit Default ïWR r/min 0 Range Unit Default ïWR r/min 0 Range Unit Default ïWR r/min 0 Range Unit Default ïWR r/min 0 Range Unit Default ïWR r/min 0 Related control mode S Related control mode S S Related control mode S Related control mode S Related control mode S Related control mode S Deceleration time setup 4 Range Unit Default 0 to 10000 ms/ (1000r/min) 0 Range Unit Default 0 to 10000 ms/ (1000r/min) 0 Related control mode S Related control mode S Stepwise input speed command Speed command after acceleration/deceleration process 5 Adjustment Set up acceleration/deceleration processing time in response to the speed command input. 6HWWKHWLPHUHTXLUHGIRUWKHVSHHGFRPPDQG VWHSZLVHLQSXW WRUHDFKUPLQWR3U $FFHOHUDWLRQWLPHVHWXS$OVRVHWWKHWLPHUHTXLUHGIRUWKHVSHHGFRPPDQGWRUHDFKIURP UPLQWRUPLQWR3U'HFHOHUDWLRQWLPHVHWXS $VVXPLQJWKDW WKH WDUJHW YDOXHRI WKH VSHHGFRPPDQGLV9F UPLQ WKH WLPH UHTXLUHGIRU DFFHOHUDWLRQGHFHOHUDWLRQFDQEHFRPSXWHGIURPWKHIRUPXODVKRZQEHORZ $FFHOHUDWLRQWLPH PV 9Fð3UðPV 'HFHOHUDWLRQWLPH PV 9Fð3UðPV Speed [r/min] Setup Pr3.13 Acceleration time setup 3 S Related control mode 6HWXSLQWHUQDOFRPPDQGVSHHGVVWWRWK Pr3.12 2 Related control mode Connection Pr3.10 Unit Preparation Pr3.06 1st speed of speed setup Range Before Using the Products [Class 3] Verocity/ Torque/ Full-closed control 6 1000r/min When in Trouble Time Pr3.12×1ms Caution Related page :KHQ WKH VSHHG GLIIHUHQFH EHWZHHQ WKH VSHHG FRPPDQG EHLQJ VHOHFWHG DQG WKH VSHHG command after acceleration/deceleration indicates the same direction as that of the speed FRPPDQGDSSOLHGDIWHUDFFHOHUDWLRQGHFHOHUDWLRQUHVXOWLV´DFFHOHUDWLRQµDQGLIWKHUHYHUVH GLUHFWLRQWKHUHVXOWLV´GHFHOHUDWLRQµ $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-27 7 Supplement Note Pr3.13×1ms 1. Details of parameter [Class 3] Verocity/ Torque/ Full-closed control 'HIDXOW>@ Pr3.14 Sigmoid acceleration/ deceleration time setup Range Unit Default 0 to 1000 ms 0 Related control mode S 6HW6FXUYHWLPHIRUDFFHOHUDWLRQGHFHOHUDWLRQSURFHVVZKHQWKHVSHHGFRPPDQGLVDSSOLHG $FFRUGLQJ WR 3U$FFHOHUDWLRQ WLPH VHWXS DQG 3U 'HFHOHUDWLRQ WLPH VHWXS VHW XS VLJPRLGWLPHZLWKWLPHZLGWKFHQWHULQJWKHLQÁHFWLRQSRLQWRIDFFHOHUDWLRQGHFHOHUDWLRQ ts Speed [r/min] Target speed (Vc) ts Speed command after acceleration/deceleration process ta = Vc/1000 × Pr3.12 × 1ms td = Vc/1000 × Pr3.13 × 1ms ts = Pr3.14 × 1ms * Use with the setup of ta/2 > ts, td/2 > ts ts ts Time ta Pr3.15 td Speed zero-clamp function selection Range Unit Default Related control mode 0 to 3 — 0 S T You can set up the function of the speed zero clamp input. Setup value [0] Function of ZEROSPD (Pin-26) ,QYDOLG6SHHG]HURFODPSLQSXWLVLJQRUHG 1 6SHHGFRPPDQGLVIRUFHGWRZKHQWKHVSHHG]HURFODPS =(5263' LQSXWVLJQDO LVWXUQHG21 *1. 2 6SHHGFRPPDQGLVIRUFHGWRZKHQWKHVSHHG]HURFODPS =(5263' LQSXWVLJQDO LVWXUQHG21 *1$QGZKHQWKHDFWXDOPRWRUVSHHGGURSVWR3U6SHHG]HURFODPS OHYHORUEHORZWKHSRVLWLRQFRQWUROLVVHOHFWHGDQGVHUYRORFNLVDFWLYDWHGDWWKLVSRLQW 7KHIXQGDPHQWDORSHUDWLRQVH[FHSWIRUWKLVIXQFWLRQ VZLWFKLQJWRWKHSRVLWLRQFRQWURO DUHLGHQWLFDOWRWKRVHZKHQVHWXSYDOXHLV 3 :KHQWKHVSHHG]HURFODPS =(5263' LQSXWVLJQDOLV21 *1 and speed command is EHORZ3U 6SHHG]HURFODPSOHYHO²UPLQWKHQWKHSRVLWLRQFRQWUROLVVHOHFWHGDQGVHUYRORFN LVDFWLYDWHGDWWKDWSRLQW 7KH GHIDXOW ORJLF LV EFRQWDFW WKH IXQFWLRQ LV HQDEOHG ZKLOH WKH WHUPLQDO LV RSHQ LQSXW VLJQDO LV 21 5HIHUWR3&RQWUROLQSXW Pr3.16 Speed zero clamp level Range Unit Default Related control mode 10 to 20000 r/min 30 S T 6HOHFWWKHWLPLQJDWZKLFKWKHSRVLWLRQFRQWUROLVDFWLYDWHGDVWKH3U6SHHG]HURFODPS function selection is set to 2 or 3. ,I3U WKHQK\VWHUHVLVRIUPLQLVSURYLGHGIRUGHWHFWLRQ Note Related page 4-28 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 'HIDXOW>@ Pr3.17 Selection of torque command Range Unit Default 0 to 2 — 0 Related control mode T You can select the input of the torque command and the speed limit. Torque command input Velocity limit input [0] $QDORJLQSXW *1 $,ELWUHVROXWLRQ 3DUDPHWHUYDOXH 3U 1 $QDORJLQSXW $,ELWUHVROXWLRQ $QDORJLQSXW $,ELWUHVROXWLRQ 2 $QDORJLQSXW *1 $,ELWUHVROXWLRQ 3DUDPHWHUYDOXH 3U3U 2 Preparation Setup value * )RU3U&RQWUROPRGHVHWXS YHORFLW\WRUTXHFRQWURO WKHWRUTXHFRPPDQGLQSXW LVWKHDQDORJLQSXW $,ELWUHVROXWLRQ Torque command direction selection Range Unit Default 0 to 1 — 0 Related control mode T 6HOHFWWKHGLUHFWLRQSRVLWLYHQHJDWLYHGLUHFWLRQRIWRUTXHFRPPDQG Setup value [0] 1 3 Connection Pr3.18 Before Using the Products [Class 3] Verocity/ Torque/ Full-closed control Designation 6SHFLI\WKHGLUHFWLRQZLWKWKHVLJQRIWRUTXHFRPPDQG ([DPSOH7RUTXHFRPPDQGLQSXW IRUSRVLWLYHGLUHFWLRQ ² IRUQHJDWLYHGLUHFWLRQ 4 6SHFLI\WKHGLUHFWLRQZLWKWRUTXHFRPPDQGVLJQ 7&6,*1 2))3RVLWLYHGLUHFWLRQ211HJDWLYHGLUHFWLRQ Setup Pr3.19 Input gain of torque command Range Unit Default 10 to 100 0.1V/100% 30 Related control mode T %DVHG RQ WKH YROWDJH 9 DSSOLHG WR WKH DQDORJ WRUTXH FRPPDQG 7545 VHW XS WKH FRQYHUVLRQJDLQWRWRUTXHFRPPDQG DQGVHWXSLQSXWYROWDJHQHFHVVDU\WR Default produce the rated torque. 'HIDXOWVHWXSRIUHSUHVHQWV9 Positive direction Adjustment torque 300[%] 8QLWRIWKHVHWXSYDOXHLV>9@ Rated 200 torque 100 –10V –8 –6 –4 –2 2 4 100 6 8 10V command input v 300[%] Negative direction Input reversal of torque command Range Unit Default 0 to 1 — 0 Related control mode T 6HWXSWKHSRODULW\RIWKHYROWDJHDSSOLHGWRWKHDQDORJWRUTXHFRPPDQG 7545 Direction of motor output torque [0] 1RQUHYHUVDO ´9ROWDJHµ ´3RVLWLYHGLUHFWLRQµ´²9ROWDJHµ ´1HJDWLYHGLUHFWLRQµ 1 5HYHUVDO ´9ROWDJHµ ´1HJDWLYHGLUHFWLRQµ´²9ROWDJHµ ´3RVLWLYHGLUHFWLRQµ 7 Supplement Setup value 6 When in Trouble 200 Pr3.20 5 4-29 1. Details of parameter [Class 3] Verocity/ Torque/ Full-closed control 'HIDXOW>@ Pr3.21 Speed limit value 1 Range Unit Default 0 to 20000 r/min 0 Related control mode T Set up the speed limit used for torque controlling. 'XULQJWKHWRUTXHFRQWUROOLQJWKHVSHHGVHWE\WKHVSHHGOLPLWYDOXHFDQQRWEHH[FHHGHG :KHQ3U WKHVSHHGOLPLWLVDSSOLHGXSRQUHFHLYLQJSRVLWLYHGLUHFWLRQFRPPDQG Pr3.22 Speed limit value 2 Range Unit Default 0 to 20000 r/min 0 Related control mode T 6SHHGOLPLWYDOXHRIQHJDWLYHGLUHFWLRQFRPPDQGZKHQ3U Pr3.17 Pr3.21 Pr3.22 Pr3.15 0 0 0 to 20000 1RHIIHFW 1 to 3 0 to 20000 0 to 20000 2 Pr3.23 * 0 Speed zero clamp Analog torque (ZEROSPD) command direction 1RHIIHFW 3UVHWXSYDOXH OFF 1RHIIHFW 3UVHWXSYDOXH 21 0 1RHIIHFW 0 to 20000 0 to 20000 1 to 3 OFF 0 to 20000 0 to 20000 1 to 3 21 ([WHUQDOVFDOHVHOHFWLRQ Speed limit value 3RVLWLYHGLUHFWLRQ 3UVHWXSYDOXH 1HJDWLYHGLUHFWLRQ 3UVHWXSYDOXH 3RVLWLYHGLUHFWLRQ 3UVHWXSYDOXH 1HJDWLYHGLUHFWLRQ 3UVHWXSYDOXH 1RHIIHFW 0 Range Unit Default 0 to 2 — 0 Related control mode F 6HOHFWWKHW\SHRIH[WHUQDOVFDOH Setup value ([WHUQDOVFDOHW\SH Compatible scale Compatible speed to 4Mpps DIWHUTXDGUXSOHG $%SKDVHRXWSXWW\SH*1 ([WHUQDOVFDOHRI$%SKDVHRXWSXWW\SH 1 Serial communication type LQFUHPHQWDOYHUVLRQ *1 0DJQHVFDOH&R/WG 65656/6/ to 400Mpps 2 Serial communication type DEVROXWHYHUVLRQ *1 Mitsutoyo Corp. $767$67$ 0DJQHVFDOH&R/WG 6565 to 400Mpps [0] * &RQQHFW WKH H[WHUQDO VFDOH VR WKDW LW LQFUHPHQWV WKH FRXQW DV WKH PRWRU VKDIW WXUQV SRVLWLYH GLUHFWLRQ DQG GHFUHPHQWV DV WKH VKDIW WXUQV QHJDWLYH GLUHFWLRQ ,I WKLV FRQQHFWLRQDUUDQJHPHQWLVLPSRVVLEOHGXHWRLQVWDOODWLRQFRQGLWLRQHWFXVHWKHFRXQW UHYHUVHIXQFWLRQRI3U5HYHUVDORIGLUHFWLRQRIH[WHUQDOVFDOH Caution Note Related page 4-30 :KHQ WKH VHWXS YDOXH LV RU ZKLOH WKH$ % SKDVH RXWSXW W\SH LV FRQQHFWHG (UU ([WHUQDO VFDOH ZLULQJ HUURU SURWHFWLRQ RFFXUV DQG LI WKH VHWXS YDOXH LV ZKLOH WKH VHULDO FRPPXQLFDWLRQW\SHLVFRQQHFWHG(UURU$SKDVH%SKDVHRU=SKDVHZLULQJHUURU SURWHFWLRQZLOORFFXU $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ3´3URWHFWLYH)XQFWLRQµ 1. Details of parameter 1 Pr3.24 * 1XPHUDWRURIH[WHUQDOVFDOHGLYLVLRQ Range Unit Default WR — 0 Related control mode F 6HWXSWKHQXPHUDWRURIWKHH[WHUQDOVFDOHGLYLGLQJVHWXS :KHQVHWXSYDOXH HQFRGHUUHVROXWLRQLVXVHGDVQXPHUDWRURIWKHGLYLVLRQ 'HQRPLQDWRURIH[WHUQDOVFDOHGLYLVLRQ 2 Range Unit Default Related control mode WR — 10000 F Pr3.24 1048576 Pr3.25 100000 Caution Encoder resolution per one motor revolution [pulse] External scale resolution per one motor revolution [pulse] ,IWKLVUDWLRLVZURQJWKHGLIIHUHQFHEHWZHHQWKHSRVLWLRQFDOFXODWHGEDVHGRQWKHHQFRGHU SXOVHVDQGWKHSRVLWLRQFDOFXODWHGEDVHGRQWKHH[WHUQDOVFDOHSXOVHVEHFRPHVODUJHRYHUD ORQJWUDYHOGLVWDQFHDQGZLOODFWLYDWHWKHH[FHVVK\EULGGHYLDWLRQHUURUSURWHFWLRQ 5HYHUVDORIGLUHFWLRQRIH[WHUQDOVFDOH Range Unit Default 0 to 1 — 0 Related control mode F 4 Setup Pr3.26 * = 3 Connection &KHFNWKHQXPEHURIHQFRGHUIHHGEDFNSOXVHVSHURQHPRWRUUHYROXWLRQDQGWKHQXPEHURI H[WHUQDOVFDOHSXOVHVSHURQHPRWRUUHYROXWLRQDQGWKHQVHWXSWKHQXPHUDWRURIH[WHUQDO VFDOHGLYLVLRQ 3U DQGWKHGHQRPLQDWRURIH[WHUQDOVFDOHGLYLVLRQ 3U WRHVWDEOLVK WKHH[SUHVVLRQVKRZQEHORZ :LWK3UVHWDWWKHHQFRGHUUHVROXWLRQLVDXWRPDWLFDOO\XVHGDVQXPHUDWRU ([DPSOH:KHQEDOOVFUHZSLWFKLVPPVFDOHBPSXOVHHQFRGHUUHVROXWLRQELWV SXOVHV Preparation Pr3.25 * Before Using the Products [Class 3] Verocity/ Torque/ Full-closed control 5HYHUVHWKHGLUHFWLRQRIH[WHUQDOVFDOHIHHGEDFNFRXQWHU Setup value [0] 1 Pr3.27 * 5 &RXQWYDOXHRIH[WHUQDOVFDOHFDQEHXVHGDVLWLV 6LJQ SRVLWLYHQHJDWLYH RIFRXQWYDOXHRIH[WHUQDOVFDOHVKRXOGEHLQYHUWHG )RUVHWWLQJPHWKRGRIWKLVSDUDPHWHUUHIHUWR3)XOOFORVHGFRQWUROPRGH ([WHUQDOVFDOH=SKDVHGLVFRQQHFWLRQ detection disable Range Unit Default 0 to 1 — 0 Related control mode F (QDEOHGLVDEOH=SKDVHGLVFRQQHFWLRQGHWHFWLRQZKHQ$%SKDVHRXWSXWW\SHH[WHUQDOVFDOH is used. Content [0] Valid 1 ,QYDOLG 6 When in Trouble Setup value Adjustment Note Content 7 Related page $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-31 Supplement Note 1. Details of parameter [Class 3] Verocity/ Torque/ Full-closed control 'HIDXOW>@ Pr3.28 * +\EULGGHYLDWLRQH[FHVVVHWXS Range Unit WR Command unit Default Related control mode 16000 F @ Pr4.10 * SO1 output selection Range Unit 0 to 00FFFFFFh — Default Related control mode 00030303h P S T F $VVLJQIXQFWLRQVWR62RXWSXWV 7KHVHSDUDPHWHUVDUHSUHVHQWHGLQKH[DGHFLPDOV*1 +H[DGHFLPDOSUHVHQWDWLRQLVIROORZHGE\DVSHFLÀFFRQWUROPRGHGHVLJQDWLRQ 0 0 – – – – * * K SRVLWLRQIXOOFORVHGFRQWURO 0 0 – – * * ² ² K YHORFLW\FRQWURO 0 0 * * ² ² ² ² K WRUTXHFRQWURO Replace * *ZLWKWKHIXQFWLRQQXPEHU )RUWKHIXQFWLRQQXPEHUVHHWKHWDEOHEHORZ/RJLFDOVHWXSLVDOVRDIXQFWLRQQXPEHU ,QYDOLG 6HUYR5HDG\RXWSXW ([WHUQDOEUDNHUHOHDVHsignal Positioning complete output $WVSHHGRXWSXW Torque in-limit signal output Zero-speed detection output signal Speed coincidence output $ODUPRXWSXW $ODUPRXWSXW 3RVLWLRQDOFRPPDQG212))RXWSXW Positioning complete 2 Speed in-limit output $ODUPDWWULEXWHRXWSXW 6SHHGFRPPDQG212))RXWSXW ï S-RDY BRK-OFF ,13 $7633(' TLC ZSP 9&2,1 :$51 :$51 P-CMD ,13 V-LIMIT $/0$7% V-CMD Note )RURXWSXWSLQDVVLJQPHQWZLWK GHIDXOWVHWWLQJDOVRUHIHUWR3 2XWSXWVLJQDOV FRPPRQ and their functions. Related page P.3-52 ([DPSOHRIFKDQJH! To change the default setting ´([WHUQDOEUDNHUHOHDVHVLJQDOµ LQDOOPRGHV WR´$ODUPRXWSXW µVHWWKHLQSXWWRK )RUHDVLHUVHWWLQJXVHWKH VHWXSVXSSRUWVRIWZDUH 3$1$7(50 3 4 Setup Symbol Connection Caution Title 2 Preparation Setup value 00h 02h 03h 04h 05h 06h 07h 08h 09h $K 0Bh 0Ch 0Dh 0Eh 0Fh Before Using the Products [Class 4] I/F monitor setting Same function can be assigned to 2 or more output signals. &RQWURORXWSXWSLQVHWWRLQYDOLGDOZD\VKDVWKHRXWSXWWUDQVLVWRUWXUQHG2)) 5 'RQRWFKDQJHWKHVHWXSYDOXHVKRZQLQWKHWDEOH *1RWHWKDWWKHVHWXSYDOXHVDUHGLVSOD\HGLQGHFLPDORQWKHIURQWSDQHO Pr4.12 * Pr4.14 * Pr4.15 * SO3 output selection SO4 output selection SO5 output selection SO6 output selection 0 to 00FFFFFFh — Range Unit 0 to 00FFFFFFh — Range Unit 0 to 00FFFFFFh — Range Unit 0 to 00FFFFFFh — Range Unit 0 to 00FFFFFFh — Default Related control mode 00020202h P S T F Default Related control mode 00010101h P S T F Default Related control mode 00050504h P S T F Default Related control mode 00070707h P S T F Default Related control mode 00060606h P S T F 7 Supplement $VVLJQIXQFWLRQVWR62WR62RXWSXWV 7KHVHSDUDPHWHUVDUHSUHVHQWHGLQKH[DGHFLPDOV Setup procedure is the same as described for Pr4.10. 6 When in Trouble Pr4.13 * SO2 output selection Unit Adjustment Pr4.11 * Range 4-35 1. Details of parameter [Class 4] I/F monitor setting 'HIDXOW>@ Pr4.16 Type of analog monitor 1 Range Unit Default Related control mode 0 to 21 — 0 P S T F Select the type of monitor for analog monitor 1. *6HHWKHWDEOHVKRZQRQWKHQH[WSDJH Pr4.17 Analog monitor 1 output gain Range Unit Default Related control mode 0 to 214748364 [Monitor unit in Pr4.16] / V 0 P S T F Set up the output gain of analog monitor 1. )RU3U 0RWRUVSHHG9LVRXWSXWDWWKHPRWRUVSHHG>UPLQ@ 3UVHWXSYDOXH Pr4.18 Type of analog monitor 2 Range Unit Default Related control mode 0 to 21 — 4 P S T F Select the type of monitor for analog monitor 2. *6HHWKHWDEOHVKRZQRQWKHQH[WSDJH Pr4.19 Analog monitor 2 output gain Range Unit Default Related control mode 0 to 214748364 [Monitor unit in Pr4.16] / V 0 P S T F Set up the output gain of analog monitor 2. )RU3U 7RUTXHFRPPDQG9LVRXWSXWDWWKHWRUTXHFRPPDQG>@ 3UVHWXSYDOXH Pr4.20 Type of digital monitor Range Unit Default Related control mode 0 to 3 — 0 P S T F Select type of the digital monitor. Note Related page 4-36 Digital signal output Setup value Type of monitor L output H output [0] Positioning complete condition 1RWFRPSOHWHG Completed 1 Positional command :LWKRXWFRPPDQG :LWKFRPPDQG 2 $ODUP 1RWJHQHUDWHG Generated 3 Gain selected 1st gain 2nd gain LQFOXGLQJUGJDLQ $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXW 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKGLJLWDOPRQLWRURXWSXW 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 Unit Output gain for setting Pr4.17/Pr4.19 = 0 0 Motor speed r/min 500 1 Positional command speed *3 r/min 500 2 Internal positional command speed *3 r/min 500 3 Velocity control command r/min 500 4 Torque command % 33 SXOVH &RPPDQGXQLW 3000 5 &RPPDQGSRVLWLRQDOGHYLDWLRQ 6 (QFRGHUSRVLWLRQDOGHYLDWLRQ*4 SXOVH (QFRGHUXQLW 3000 7 )XOOFORVHGGHYLDWLRQ*4 SXOVH ([WHUQDOVFDOHXQLW 3000 8 +\EULGGHYLDWLRQ SXOVH &RPPDQGXQLW 3000 9 9ROWDJHDFURVV31 V 80 10 5HJHQHUDWLYHORDGIDFWRU % 33 11 2YHUORDGIDFWRU % 33 12 3RVLWLYHGLUHFWLRQWRUTXHOLPLW % 33 13 1HJDWLYHGLUHFWLRQWRUTXHOLPLW % 33 14 6SHHGOLPLWYDOXH r/min 500 15 Inertia ratio % 500 16 $QDORJLQSXW *2 V 1 17 $QDORJLQSXW*2 V 1 18 *2 V 1 $QDORJLQSXW *5 Encoder temperature ʝ 10 20 'ULYHUWHPSHUDWXUH ʝ 10 21 Encoder single-turn data *1 SXOVH (QFRGHUXQLW 110000 4 7KHHQFRGHUURWDWLRQGDWD&&:LVDOZD\VSRVLWLYHYDOXHUHJDUGOHVVRI3U5RWDWLRQDOGLUHFWLRQVHWXS 7KHGLUHFWLRQRIRWKHUPRQLWRUGDWDEDVLFDOO\IROORZV3U5RWDWLRQDOGLUHFWLRQVHWXS $QDORJLQSXWVDQGDOZD\VRXWSXWWHUPLQDOYROWDJHUHJDUGOHVVRIXVDJHRIDQDORJLQSXWIXQFWLRQ 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXWV )RUWKHFRPPDQGSXOVHLQSXWWKHVSHHGEHIRUHWKHFRPPDQGÀOWHU VPRRWKLQJ),5ÀOWHU LVGHÀQHGDVSRVLWLRQDO FRPPDQGVSHHGDQGVSHHGDIWHUÀOWHULVGHÀQHGDVLQWHUQDOFRPPDQGVSHHG Command division/ multiplication process Command pulse input Positional command filter + Position control – Encoder feedback/ external scale feedback 6 Command division/ multiplication – Command division/multiplication reverse conversion + – Positional control 7 Encoder feedback/ external scale feedback Supplement + Positional command filter When in Trouble * &RPPDQGSRVLWLRQDOGHYLDWLRQLVWKHGHYLDWLRQZLWKUHVSHFWWRWKHFRPPDQGSXOVHLQSXWDQGWKHHQFRGHUSRVLWLRQDO GHYLDWLRQIXOOFORVHGSRVLWLRQDOGHYLDWLRQLVWKHGHYLDWLRQDWWKHLQSXWVHFWLRQRIWKHSRVLWLRQDOFRQWURODVGHVFULEHGLQ WKHÀJXUHEHORZ Encoder positional deviation (encoder unit) / Full-closed deviation (external unit) Command pulse input 5 Adjustment Positional command Internal position speed [r/min] command speed [r/min] Setup 19 3 Connection * * * *4 2 Preparation Type of monitor Pr4.16/Pr4.18 Before Using the Products [Class 4] I/F monitor setting Positional command deviation (command unit) * 7HPSHUDWXUHLQIRUPDWLRQIURPWKHHQFRGHULQFOXGHVYDOXHRQO\ZKHQLWLVDELWLQFUHPHQWDOHQFRGHU2WKHUZLVH WKHYDOXHLVDOZD\V 4-37 1. Details of parameter [Class 4] I/F monitor setting 'HIDXOW>@ Pr4.21 Analog monitor output setup Range Unit Default Related control mode 0 to 2 — 0 P S T F Select output format of the analog monitor. Setup value Signed data output –10 V to 10 V 1 $EVROXWHYDOXHGDWDRXWSXW 9WR9 2 'DWDRXWSXWZLWKRIIVHW 9WR9 9DWFHQWHU [0] Pr4.22 Output format Analog input 1 (AI1) offset setup Range Unit Default Related control mode ïWR 0.359mV 0 P S T F 6HWXSWKHRIIVHWFRUUHFWLRQYDOXHDSSOLHGWRWKHYROWDJHIHGWRWKHDQDORJLQSXW Pr4.23 Analog input 1 (AI1) filter Range Unit Default Related control mode 0 to 6400 0.01ms 0 P S T F 6HWXSWKHWLPHFRQVWDQWRIVWGHOD\ÀOWHUWKDWGHWHUPLQHVWKHODJWLPHEHKLQGWKHYROWDJH applied to the analog input 1. Pr4.24 Analog input 1 (AI1) overvoltage setup Range Unit Default Related control mode 0 to 100 0.1V 0 P S T F 6HW XS WKH H[FHVVLYH OHYHO RI WKH LQSXW YROWDJH RI DQDORJ LQSXW E\ XVLQJ WKH YROWDJH DVVRFLDWHGZLWKRIIVHW Pr4.25 Analog input 2 (AI2) offset setup Range Unit Default Related control mode ïWR 5.86mV 0 P S T F 6HWXSWKHRIIVHWFRUUHFWLRQYDOXHDSSOLHGWRWKHYROWDJHIHGWRWKHDQDORJLQSXW Pr4.26 Analog input 2 (AI2) filter Range Unit Default Related control mode 0 to 6400 0.01ms 0 P S T F 6HWXSWKHWLPHFRQVWDQWRIVWGHOD\ÀOWHUWKDWGHWHUPLQHVWKHODJWLPHEHKLQGWKHYROWDJH applied to the analog input 2. Pr4.27 Analog input 2 (AI2) overvoltage setup Range Unit Default Related control mode 0 to 100 0.1V 0 P S T F 6HW XS WKH H[FHVVLYH OHYHO RI WKH LQSXW YROWDJH RI DQDORJ LQSXW E\ XVLQJ WKH YROWDJH DVVRFLDWHGZLWKRIIVHW Pr4.28 Analog input 3 (AI3) offset setup Range Unit Default Related control mode ïWR 5.86mV 0 P S T F 6HWXSWKHRIIVHWFRUUHFWLRQYDOXHDSSOLHGWRWKHYROWDJHIHGWRWKHDQDORJLQSXW Note Related page 4-38 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 Pr4.29 Analog input 3 (AI3) filter Range Unit Default Related control mode 0 to 6400 0.01ms 0 P S T F 6HWXSWKHWLPHFRQVWDQWRIVWGHOD\ÀOWHUWKDWGHWHUPLQHVWKHODJWLPHEHKLQGWKHYROWDJH applied to the analog input 3. Analog input 3 (AI3) overvoltage setup Range Unit Default Related control mode 0 to 100 0.1V 0 P S T F 6HW XS WKH H[FHVVLYH OHYHO RI WKH LQSXW YROWDJH RI DQDORJ LQSXW E\ XVLQJ WKH YROWDJH DVVRFLDWHGZLWKRIIVHW Pr4.31 Positioning complete (In-position) range Range Unit Default 0 to 262144 Command unit 10 Related control mode P Pr4.32 The command unit is used as the default unit but can be replaced by the encoder unit by XVLQJ 3U 3RVLWLRQLQJ XQLW VHOHFWLRQ 1RWH WKDW ZKHQ WKH HQFRGHU XQLW LV XVHG XQLW RI 3U3RVLWLRQDOGHYLDWLRQH[FHVVVHWXSLVDOVRFKDQJHG )RUGHVFULSWLRQRI´FRPPDQGXQLWµDQG´HQFRGHUXQLWµUHIHUWR3´3Uµ 4 Range Unit Default 0 to 3 — 0 Related control mode P F 6HOHFWWKHFRQGLWLRQWRRXWSXWWKHSRVLWLRQLQJFRPSOHWHVLJQDO ,13 Action of positioning complete signal [0] 7KHVLJQDOZLOOWXUQRQZKHQWKHSRVLWLRQDOGHYLDWLRQLVVPDOOHUWKDQ3U 3RVLWLRQLQJ FRPSOHWHUDQJH 1 7KH VLJQDO ZLOO WXUQ RQ ZKHQ WKHUH LV QR SRVLWLRQ FRPPDQG DQG WKH SRVLWLRQDO GHYLDWLRQLVVPDOOHUWKDQ3U 3RVLWLRQLQJFRPSOHWHUDQJH 2 7KHVLJQDOZLOOWXUQRQZKHQWKHUHLVQRSRVLWLRQFRPPDQGWKH]HURVSHHGGHWHFWLRQVLJQDO LV21DQGWKHSRVLWLRQDOGHYLDWLRQLVVPDOOHUWKDQ3U 3RVLWLRQLQJFRPSOHWHUDQJH 3 7KHVLJQDOZLOOWXUQRQZKHQWKHUHLVQRSRVLWLRQFRPPDQGDQGWKHSRVLWLRQDOGHYLDtion LVVPDOOHUWKDQ3U 3RVLWLRQLQJFRPSOHWHUDQJH 7KHQKROGV21VWDWXVXQWLOWKH QH[WSRVLWLRQFRPPDQGLVHQWHUHG6XEVHTXHQWO\21VWDWHLVPDLQWDLQHGXQWLO3U ,13KROGWLPHKDVHODSVHG$IWHUWKHKROGWLPH,13RXWSXWZLOOEHWXUQHG212))DFFRUGLQJWRWKHFRPLQJSRVLWLRQDOFRPPDQGRUFRQGLWLRQRIWKHSRVLWLRQDOGHYLDWLRQ Range Unit Default 0 to 30000 1ms 0 6 Related control mode P F 6HWXSWKHKROGWLPHZKHQ3U3RVLWLRQLQJFRPSOHWHRXWSXWVHWXS Setup value [0] 1 to 30000 Related page State of positioning complete signal 7KHKROGWLPHLVPDLQWDLQHGGHÀQLWHO\NHHSLQJ21VWDWHXQWLOWKHQH[WSRVLWLRQDO FRPPDQGLVUHFHLYHG 7 21VWDWHLVPDLQWDLQHGIRUVHWXSWLPH PV EXWVZLWFKHGWR2))VWDWHDVWKHSRVLWLRQDO FRPPDQGLVUHFHLYHGGXULQJKROGWLPH $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-39 Supplement Note When in Trouble INP hold time 5 Adjustment Pr4.33 Setup value Setup Positioning complete (In-position) output setup Connection Note 3 F 6HWXSWKHWLPLQJRISRVLWLRQDOGHYLDWLRQDWZKLFKWKHSRVLWLRQLQJFRPSOHWHVLJQDO ,13 LVRXWSXW Caution 2 Preparation Pr4.30 Before Using the Products [Class 4] I/F monitor setting 1. Details of parameter [Class 4] I/F monitor setting 'HIDXOW>@ Pr4.34 Zero-speed Range Unit Default Related control mode 10 to 20000 r/min 50 P S T F UPLQ@ Positive direction speed (Pr4.34+10)r/min (Pr4.34–10)r/min Negative direction ON ZSP Pr4.35 Speed coincidence range Range Unit Default Related control mode 10 to 20000 r/min 50 S T 6HWWKHVSHHGFRLQFLGHQFH 9&2,1 RXWSXWGHWHFWLRQWLPLQJ 2XWSXWWKHVSHHGFRLQFLGHQFH 9&2,1 ZKHQWKHGLIIHUHQFHEHWZHHQWKHVSHHGFRPPDQG DQGWKHPRWRUVSHHGLVHTXDOWRRUVPDOOHUWKDQWKHVSHHGVSHFLÀHGE\WKLVSDUDPHWHU Speed [r/min] Speed command Speed command after acceleration/deceleration process Pr4.35 *1 (Speed coincidence range) Pr4.35 *1 (Speed coincidence range) Motor speed Time Pr4.35 *1 (Speed coincidence range) Speed coincidence output V-COIN ON OFF ON OFF *1 %HFDXVHWKHVSHHGFRLQFLGHQFHGHWHFWLRQLVDVVRFLDWHGZLWKUPLQK\VWHUHVLVDFWXDO GHWHFWLRQUDQJHLVDVVKRZQEHORZ Speed coincidence output OFF 21WLPLQJ 3U² UPLQ 6SHHGFRLQFLGHQFHRXWSXW21 2))WLPLQJ 3U UPLQ Note Related page 4-40 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 'HIDXOW>@ Pr4.36 At-speed (Speed arrival) Range Unit Default Related control mode 10 to 20000 r/min 1000 S T Speed [r/min] Pr4.36+10 3Uï Motor speed Time ï 3Uï ï 3U Pr4.37 OFF ON OFF Mechanical brake action at stalling setup 3 ON Connection the speed arrival output AT-SPEED Range Unit Default Related control mode 0 to 10000 1ms 0 P S T F @ Pr4.39 Brake release speed setup Range Unit Default Related control mode 30 to 3000 r/min 30 P S T F Set up the speed timing of brake output checking during operation. Pr4.40 Selection of alarm output 1 Pr4.41 Selection of alarm output 2 Range Unit Default Related control mode 0 to 10 — 0 P S T F Range Unit Default Related control mode 0 to 10 — 0 P S T F Select the type of alarm issued as the alarm output 1 or 2. Setup value Alarm — [0] Content ORed output of all alarms. 1 2YHUORDGSURWHFWLRQ /RDGIDFWRULVRUPRUHWKHSURWHFWLRQOHYHO 2 2YHUUHJHQHUDWLRQDODUP 5HJHQHUDWLYHORDGIDFWRULVRUPRUHWKHSURWHFWLRQOHYHO 3 Battery alarm %DWWHU\YROWDJHLV9RUORZHU 4 Fan alarm Fan has stopped for 1 sec. *1 5 Encoder communication alarm 7KHQXPEHURIVXFFHVVLYHHQFRGHUFRPPXQLFDWLRQHUURUV H[FHHGVWKHVSHFLÀHGYDOXH 6 (QFRGHURYHUKHDWDODUP 7KHHQFRGHUGHWHFWVRYHUKHDWDODUP 7 Oscillation detection alarm 2VFLOODWLRQRUYLEUDWLRQLVGHWHFWHG 8 Lifetime detection alarm /LIHH[SHFWDQF\RIFDSDFLWRURUIDQEHFRPHVVKRUW 9 ([WHUQDOVFDOHHUURUDODUP 7KHH[WHUQDOVFDOHGHWHFWVWKHDODUP 10 ([WHUQDOVFDOH communication alarm 7KHQXPEHURIVXFFHVVLYHH[WHUQDOVFDOHFRPPXQLFDWLRQ HUURUVH[FHHGVWKHVSHFLÀHGYDOXH 7KHXSSHUIDQRQWKH+IUDPHGULYHUVWRSVGXULQJVHUYR2))WRVDYHHQHUJ\7KLVLVQRUPDO Related page Pr4.42 )RUGHWDLOHGGHVFULSWLRQRIDODUPW\SHVUHIHUWR3 2nd Positioning complete (In-position) range Range Unit Default 0 to 262144 Command unit 10 Related control mode P F 7KH,13WXUQV21ZKHQHYHUWKHSRVLWLRQDOGHYLDWLRQLVORZHUWKDQWKHYDOXHVHWXSLQWKLV SDUDPHWHUZLWKRXWEHLQJDIIHFWHGE\3U3RVLWLRQLQJFRPSOHWHRXWSXWVHWXS 3UHVHQFH DEVHQFHRISRVLWLRQDOFRPPDQGLVQRWUHODWHGWRWKLVMXGJPHQW Caution Note )RUGHVFULSWLRQRI´FRPPDQGXQLWµDQG´HQFRGHUXQLWµUHIHUWR3´3Uµ Note $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU Related page 4-42 The command unit is used as the default unit but can be replaced by the encoder unit by XVLQJ 3U 3RVLWLRQLQJ XQLW VHOHFWLRQ 1RWH WKDW ZKHQ WKH HQFRGHU XQLW LV XVHG XQLW RI 3U3RVLWLRQDOGHYLDWLRQH[FHVVVHWXSLVDOVRFKDQJHG 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter Setup [Class 5] Enhancing setting 1 'HIDXOW>@ Pr5.00 Pr5.01 Unit Default 0 to 230 — 0 Range 3rd numerator of electronic gear 30 0 to 2 Range 4th numerator of electronic gear 30 0 to 2 Related control mode P Unit Default — 0 P Unit Default — 0 F Related control mode F P F Denominator of pulse output division Range Unit Default Related control mode 0 to 262144 — 0 P S T F )RUGHWDLOVUHIHUWR3 4 Over-travel inhibit input setup Range Unit Default Related control mode 0 to 2 — 1 P S T F Setup Pr5.04 * 3 Connection 6HW WKH QG WR WK QXPHUDWRU RI GLYLVLRQPXOWLSOLFDWLRQ RSHUDWLRQ PDGH DFFRUGLQJ WR WKH command pulse input. 7KLVVHWXSLVHQDEOHGZKHQ3UFRPPDQGSXOVHFRXQWVSHURQHPRWRUUHYROXWLRQ RU full closed controlling. :KHQ WKH VHWWLQJ YDOXH LV IRU SRVLWLRQLQJ FRQWUROOLQJ HQFRGHU UHVROXWLRQ LV VHW DV D numerator. :KHQWKHVHWWLQJYDOXHLVIRUIXOOFORVHGFRQWUROOLQJERWKQXPHUDWRUDQGGHQRPLQDWRUDUH set to 1. Pr5.03 * 2 Related control mode Preparation Pr5.02 2nd numerator of electronic gear Range Before Using the Products 4 6HWXSWKHRSHUDWLRQRIWKHUXQLQKLELWLRQ 327127 LQSXWV Setup value 0 5 'LVDEOH327127 [1] 327RU127LQSXWDFWLYDWHV(UU5XQLQKLELWLRQLQSXWSURWHFWLRQ Sequence at over-travel inhibit Range Unit Default Related control mode 0 to 2 — 0 P S T F :KHQ3U2YHUWUDYHOLQKLELWLRQ VSHFLI\WKHVWDWXVGXULQJGHFHOHUDWLRQDQGVWRSDIWHU DSSOLFDWLRQRIWKHRYHUWUDYHOLQKLELWLRQ 327127 Pr5.04 0 Related page During deceleration After stalling Deviation counter content [0] Dynamic brake action Torque command=0 WRZDUGVLQKLELWHGGLUHFWLRQ Hold 1 Torque command=0 WRZDUGVLQKLELWHGGLUHFWLRQ Torque command=0 WRZDUGVLQKLELWHGGLUHFWLRQ Hold 2 Emergency stop Command=0 WRZDUGVLQKLELWHGGLUHFWLRQ Clears before/ after deceleration 7 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ3´3URWHFWLYH)XQFWLRQµ 4-43 Supplement Note Pr5.05 6 When in Trouble 'HWDLOVRI3U 6HTXHQFHDWRYHUWUDYHOLQKLELW ! Adjustment 2 Pr5.05 * Operation POT ,QKLELWSRVLWLYHGLUHFWLRQWUDYHO 127 ,QKLELWQHJDWLYHGLUHFWLRQWUDYHO 1. Details of parameter [Class 5] Enhancing setting 'HIDXOW>@ Pr5.06 Sequence at Servo-Off Range Unit Default Related control mode 0 to 9 — 0 P S T F 6SHFLI\WKHVWDWXVGXULQJGHFHOHUDWLRQDQGDIWHUVWRSDIWHUVHUYRRII Setup value During deceleration *3 After stalling Positional deviation/ H[WHUQDOVFDOH deviation [0] '\QDPLF%UDNH '% DFWLRQ '\QDPLF%UDNH '% DFWLRQ Clear *4 1 )UHHUXQ '%2)) '\QDPLF%UDNH '% DFWLRQ Clear *4 2 '\QDPLF%UDNH '% DFWLRQ )UHHUXQ '%2)) Clear *4 3 )UHHUXQ '%2)) )UHHUXQ '%2)) Clear *4 4 '\QDPLF%UDNH '% DFWLRQ '\QDPLF%UDNH '% DFWLRQ Hold *2 5 )UHHUXQ '%2)) '\QDPLF%UDNH '% DFWLRQ Hold *2 6 '\QDPLF%UDNH '% DFWLRQ )UHHUXQ '%2)) Hold *2 7 )UHHUXQ '%2)) )UHHUXQ '%2)) Hold *2 8 Emergency stop *1 '\QDPLF%UDNH '% DFWLRQ Clear *4 9 Emergency stop *1 )UHHUXQ '%2)) Clear *4 * (PHUJHQF\VWRSUHIHUVWRDFRQWUROOHGLPPHGLDWHVWRSZLWKVHUYRRQ 7KHWRUTXHFRPPDQGYDOXHLVOLPLWHGGXULQJWKLVSURFHVVE\3U(PHUJHQF\VWRSWRUTXHVHWXS * ,IWKHSRVLWLRQDOFRPPDQGLVNHSWDSSOLHGRUWKHPRWRULVNHSWUXQQLQJZLWKVHUYRRIIFRQGLWLRQSRVLWLRQDO GHYLDWLRQ LV DFFXPXODWHG FDXVLQJ (UU ([FHVV SRVLWLRQDO GHYLDWLRQ SURWHFWLRQ WR EH LVVXHG ,I WKH VHUYRLVWXUQHG21ZKLOHWKHSRVLWLRQRUH[WHUQDOVFDOHLVVLJQLÀFDQWO\GHYLDWLQJWKHPRWRUPD\UDSLGO\ RSHUDWH WR UHGXFH WKH GHYLDWLRQ WR 5HPHPEHU WKHVH UHTXLUHPHQWV LI \RX ZDQW WR PDLQWDLQ WKH SRVLWLRQDOGHYLDWLRQH[WHUQDOVFDOHGHYLDWLRQ * 'HFHOHUDWLRQ SHULRG LV WKH WLPH UHTXLUHG IRU WKH UXQQLQJ PRWRU WR VSHHG GRZQ WR UPLQ 2QFH WKH PRWRUVSHHGGURSVEHORZUPLQLWLVWUHDWHGDVLQVWRSVWDWHUHJDUGOHVVRILWVVSHHG * 3RVLWLRQDOGHYLDWLRQH[WHUQDOVFDOHGHYLDWLRQLVDOZD\VFOHDUHGWR Caution ,IDQHUURURFFXUVGXULQJVHUYRRIIIROORZ3U6HTXHQFHDWDODUP,IWKHPDLQSRZHULV WXUQHGRIIGXULQJVHUYRRIIIROORZ3U6HTXHQFHGXULQJPDLQSRZHULQWHUUXSWLRQ Related page 5HIHU WR 3 7LPLQJ &KDUW6HUYR212)) DFWLRQ ZKLOH WKH PRWRU LV DW VWDOO RI 3UHSDUDWLRQDVZHOO Pr5.07 6HTXHQFHDWPDLQSRZHU2)) Range Unit Default Related control mode 0 to 9 — 0 P S T F 6SHFLI\WKHVWDWXVGXULQJGHFHOHUDWLRQDIWHUPDLQSRZHULQWHUUXSWRUDIWHUVWRSSDJH 7KH UHODWLRQVKLS EHWZHHQ WKH VHWXS YDOXH RI 3U DQG WKH RSHUDWLRQ DQG SURFHVV DW GHYLDWLRQFRXQWHUVLVWKHVDPHDVWKDWIRU3U VHTXHQFHDWPDLQSRZHU2)) Caution Note Related page 4-44 ,I DQ HUURU RFFXUV ZLWK WKH PDLQ SRZHU VXSSO\ WXUQHG RII 3U 6HTXHQFH DW DODUP LV applied to the operation. :KHQ WKH PDLQ SRZHU VXSSO\ LV WXUQHG RII ZLWK VHUYRRQ VWDWH (UU 0DLQ SRZHU XQGHUYROWDJH HUURU RFFXUV LI 3U /9 WULS VHOHFWLRQ ZLWK PDLQ SRZHU RII DQG WKH RSHUDWLRQIROORZV3U6HTXHQFHDWDODUP $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 'HIDXOW>@ Pr5.08 /9WULSVHOHFWLRQDWPDLQSRZHU2)) Range Unit Default Related control mode 0 to 1 — 1 P S T F @ Pr5.11 Torque setup for emergency stop Range Unit Default Related control mode 0 to 500 % 0 P S T F Set up the torque limit at emergency stop. Note Pr5.12 :KHQVHWXSYDOXHLVWKHWRUTXHOLPLWIRUQRUPDORSHUDWLRQLVDSSOLHG Over-load level setup Range Unit Default Related control mode 0 to 500 % 0 P S T F @E\VHWWLQJXSWKLV to 0. 8VHWKLVZLWKVHWXSLQQRUPDORSHUDWLRQ6HWXSRWKHUYDOXHRQO\ZKHQ\RXQHHGWRORZHU WKHRYHUORDGOHYHO 7KHVHWXSYDOXHRIWKLVSDUDPHWHULVOLPLWHGE\>@RIWKHPRWRUUDWLQJ Pr5.13 Over-speed level setup Range Unit Default Related control mode 0 to 20000 r/min 0 P S T F ,IWKHPRWRUVSHHGH[FHHGVWKLVVHWXSYDOXH(UU2YHUVSHHGSURWHFWLRQRFFXUV 7KHRYHUVSHHGOHYHOEHFRPHVWLPHVRIWKHPRWRUPD[VSHHGE\VHWWLQJXSWKLVWR Pr5.14 0RWRUZRUNLQJUDQJHVHWXS Range Unit Default Related control mode 0 to 1000 UHYROXWLRQ 10 P S T F @ Pr5.16 * Alarm clear input setup Range Unit Default Related control mode 0 to 1 — 0 P S T F 6HOHFWDODUPFOHDULQSXW $&/5 UHFRJQLWLRQWLPH 2 Setup value Recognition time [0] 120ms 1 7R3U,)UHDGLQJÀOWHU Counter clear input mode Range Unit Default 0 to 4 — 3 Related control mode P F You can set up the clearing conditions of the counter clear input signal. 0 ,QYDOLG 1 &OHDUDWDOHYHO QRUHDGLQJÀOWHU 2 &OHDUDWDOHYHO ZLWKUHDGLQJÀOWHU [3] &OHDUDWDQHGJH QRUHDGLQJÀOWHU 4 &OHDUDWDQHGJH ZLWKUHDGLQJÀOWHU 3 4 )RUVLJQDOZLGWKWLPLQJUHTXLULQJWKHGHYLDWLRQFRXQWHULQSXWUHIHUWR3 Invalidation of command pulse inhibit input Range Unit Default 0 to 1 — 1 Related control mode P F Setup Pr5.18 Clear condition Connection Note Setup value Preparation Pr5.17 Before Using the Products [Class 5] Enhancing setting Select command pulse inhibit input enable/disable. Setup value 0 Valid [1] ,QYDOLG 5 Command pulse inhibit input reading setup Range Unit Default 0 to 4 — 0 Related control mode P F 6HOHFWFRPPDQGSXOVHLQKLELWLQSXWHQDEOHGLVDEOHVLJQDOUHDGLQJSHULRG :KHQ WKH VWDWXV RI VHYHUDOVLJQDOVUHDGGXULQJWKHSUHGHWHUPLQHGUHDGLQJSHULRGDUHVDPHXSGDWHWKHVLJQDOVWDWXV Related page [0] 0.166ms 1 0.333ms 2 1ms 3 1.666ms 4 PV QRFKHFNIRUPXOWLSOHFRLQFLGHQFH 6 Longer reading period protects against operation error due to noise but decreases response to input signal. $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ3´3URWHFWLYH)XQFWLRQµ 4-47 7 Supplement Note Signal reading period When in Trouble Caution Setup value Adjustment Pr5.19 * INH input 1. Details of parameter [Class 5] Enhancing setting Pr5.20 * Position setup unit select Range Unit Default 0 to 1 — 0 Related control mode P F 6SHFLI\ WKH XQLW WR GHWHUPLQH WKH UDQJH RI SRVLWLRQLQJ FRPSOHWH DQG H[FHVVLYH SRVLWLRQDO GHYLDWLRQ Note Setup value Unit [0] Command unit 1 Encoder unit 7KHFRPPDQGXQLWGHÀQHVFRPPDQGSXOVHIURPWKHKLJKHUOHYHOGHYLFHDVVHWWLQJYDOXH ZKLOHWKHHQFRGHUXQLWGHÀQHVHQFRGHUSXOVHDVVHWWLQJYDOXH :KHQWKHHOHFWURQLFJHDUUDWLRVHWE\XVLQJWKHFRPPDQGGLYLVLRQDQGPXOWLSOLFDWLRQIXQFWLRQ HOHFWURQLFJHDU LV5WKHIROORZLQJUHODWLRQVKLSLVREWDLQHG Command unit × R = encoder unit )RUH[DPSOHLIELWHQFRGHULVXVHGZLWKWKHGHIDXOWVHWWLQJ R= Pr5.21 220 220 WKHQFRPPDQGXQLW = encoder unit. 10000 10000 Selection of torque limit Range Unit Default 0 to 6 — 1 Related control mode P S F You can set up the torque limiting method. Setup value Positive direction 0 3$7/ WR9 Negative direction 1$7/ ïWR9 VWWRUTXHOLPLW 3U [1] 2 VWWRUTXHOLPLW 3U QGWRUTXHOLPLW 3U TL-SEL OFF VWWRUTXHOLPLW 3U 7/6(/21 QGWRUTXHOLPLW 3U 3 4 3$7/ WR9 5 1$7/ WR9 3$7/ WR9 TL-SEL OFF VWWRUTXHOLPLW 3U 6 QGWRUTXHOLPLW 3U 7/6(/21 ([WHUQDOLQSXWSRVLWLYHGLUHFWLRQWRUTXH OLPLW 3U Pr5.22 2nd torque limit ([WHUQDOLQSXWQHJDWLYHGLUHFWLRQWRUTXH OLPLW 3U Range Unit Default 0 to 500 % 500 Related control mode P S F @ Pr5.23 7RUTXHOLPLWVZLWFKLQJVHWXS Range Unit Default 0 to 4000 ms/100% 0 Related control mode P S F 6SHFLI\WKHUDWHRIFKDQJH VORSH IURPVWWRQGGXULQJWRUTXHOLPLWVZLWFKLQJ 7RUTXHOLPLWVZLWFKLQJVHWXS Range Unit Default 0 to 4000 ms/100% 0 2 Related control mode P S F 6SHFLI\WKHUDWHRIFKDQJH VORSH IURPQGWRVWGXULQJWRUTXHOLPLWVZLWFKLQJ Pr5.25 ([WHUQDOLQSXWSRVLWLYHGLUHFWLRQ torque limit Range Unit Default 0 to 500 % 500 Related control mode P S F Note Pr5.26 )RUGHWDLOVRIWRUTXHOLPLWYDOXHUHIHUWR3 ([WHUQDOLQSXWQHJDWLYHGLUHFWLRQ torque limit Range Unit Default 0 to 500 % 500 Related control mode P S F Note Pr5.27 4 Setup 6HWXSQHJDWLYHGLUHFWLRQWRUTXHOLPLWXSRQUHFHLYLQJ7/6(/ZLWK3U6HOHFWLRQRIWRUTXH limit set at 6. 7KHYDOXHRISDUDPHWHULVOLPLWHGWRWKHPD[LPXPWRUTXHRIWKHDSSOLFDEOHPRWRU 3 Connection 6HWXSSRVLWLYHGLUHFWLRQWRUTXHOLPLWXSRQUHFHLYLQJ7/6(/ZLWK3U6HOHFWLRQRIWRUTXH limit set at 6. 7KHYDOXHRISDUDPHWHULVOLPLWHGWRWKHPD[LPXPWRUTXHRIWKHDSSOLFDEOHPRWRU Preparation Pr5.24 Before Using the Products [Class 5] Enhancing setting )RUGHWDLOVRIWRUTXHOLPLWYDOXHUHIHUWR3 Input gain of analog torque limit Range Unit Default 10 to 100 0.1V/100% 30 Related control mode P S F Adjustment )URPWKHYROWDJH>9@DSSOLHGWRWKHDQDORJWRUTXHOLPLWLQSXW 3$7/1$7/ VHWFRQYHUVLRQ gain to torque limit [%]. 5 6 When in Trouble 7 Related page $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´6HWXSRI7RUTXH/LPLWµ3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ3´3URWHFWLYH)XQFWLRQµ 4-49 Supplement Note 1. Details of parameter [Class 5] Enhancing setting 'HIDXOW>@ Pr5.28 * LED initial status Range Unit Default Related control mode 0 to 35 — 1 P S T F (QFRGHUXQLW@ [1] Motor speed 13 $ODUP'LVSOD\ 25 ([WHUQDOVFDOHGHYLDWLRQ>([WHUQDOVFDOHXQLW@ 2 Positional command speed 14 5HJHQHUDWLYHORDGIDFWRU 26 +\EULGGHYLDWLRQ>&RPPDQGXQLW@ 3 Velocity control command 15 2YHUORDGIDFWRU 27 9ROWDJHDFURVV31>9@ 4 Torque command 16 Inertia ratio 28 6RIWZDUHYHUVLRQ 5 Feedback pulse sum 17 Factor of no-motor running 29 'ULYHUVHULDOQXPEHU 6 Command pulse sum 18 1RRIFKDQJHVLQ,2VLJQDOV 30 Motor serial number 8 ([WHUQDOVFDOHIHHGEDFNSXOVHVXP 20 $EVROXWHHQFRGHUGDWD 31 $FFXPXODWHGRSHUDWLRQWLPH 9 Control mode 21 $EVROXWHH[WHUQDOVFDOHSRVLWLRQ 32 $XWRPDWLFPRWRUUHFRJQL]LQJIXQFWLRQ 33 Temperature information 35 Safety condition monitor 10 I/O signal status 22 1RRIHQFRGHUH[WHUQDOVFDOH communication errors monitor 11 $QDORJLQSXWYDOXH 23 &RPPXQLFDWLRQD[LVDGGUHVV Related page Pr5.29 * )RUGHWDLOVRIGLVSOD\UHIHUWR3+RZWR8VHWKH)URQW3DQHORI3UHSDUDWLRQ Baud rate setup of RS232 communication Range Unit Default Related control mode 0 to 6 — 2 P S T F Range Unit Default Related control mode 0 to 6 — 2 P S T F You can set up the communication speed of RS232. Note Pr5.30 * )RUEDXGUDWHVHWXSYDOXHUHIHUWR56VHWXS Baud rate setup of RS485 communication You can set up the communication speed of RS485. Setup value 0 1 [2] 3 Baud rate 2400bps 4800bps 9600bps 19200bps Setup value 4 5 6 Baud rate 38400bps 57600bps 115200bps %DXGUDWHHUURULVIRUWRESVDQGIRUWRESV Note 4-50 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; &RPPXQLFDWLRQFRQQHFWRU 1. Details of parameter 1 Pr5.31 * $[LVDGGUHVV Range Unit Default Related control mode 0 to 127 — 1 P S T F 'XULQJFRPPXQLFDWLRQZLWKWKHKRVW HJ3& WRFRQWUROPXOWLSOHVKDIWVWKHVKDIWEHLQJ DFFHVVHGE\WKHKRVWVKRXOGEHLGHQWLÀHG Note 2 :KHQXVLQJ5656WKHPD[LPXPYDOLGYDOXHLV &RPPDQGSXOVHLQSXWPD[LPXPVHWXS Range Unit Default 250 to 4000 k pulse/s 4000 Related control mode P F 6HWWKHPD[LPXPQXPEHURISXOVHVWREHXVHGDVFRPPDQGSXOVHLQSXW,IWKHQXPEHURI LQSXWSXOVHVH[FHHGVWKHVHWXSYDOXHð(UU&RPPDQGSXOVHLQSXWIUHTXHQF\HUURU protection occurs. Caution Pr5.32 setting range 'LJLWDOÀOWHU 250 to 499 200 ns 2-time reading 500 to 999 100 ns 2-time reading 1000 or more 1RUHDGLQJ WKUX Enable/disable detection of Err28.0 Pulse UHJHQHUDWLYHOLPLWSURWHFWLRQ For manufacturer's use Range Unit Default Related control mode 0 to 1 — 0 P S T F Setup value [0] 1 Content ,QYDOLG Valid 5 Related control mode Range Unit Default — — 4 Range Unit Default Related control mode 0 to 1 — 0 P S T F Adjustment Pr5.34 4 Setup Pulse regenerative output limit setup 3 Connection Pr5.33 * 7KHQXPEHURILQSXWSXOVHVUHFHLYHGE\WKHGULYHULVDOZD\VFKHFNHG,IWKHIUHTXHQF\RIWKH UHFHLYHGSXOVHLVKLJKHUWKDQWKHXSSHUOLPLWRIWKHVHWWLQJLQSXWSXOVHVDUHQRWDFFXUDWHO\ detected. %\ VHOHFWLQJ D YDOXH ORZHU WKDQ D GLJLWDO ILOWHU RI WKH VSHFLILFDWLRQ VKRZQ EHORZ LV enabled against the command pulse input. Preparation Pr5.32 * Before Using the Products [Class 5] Enhancing setting )L[HGWR Pr5.35 * Front panel lock setup When in Trouble Lock the operation on the front panel. 6 Setup value Content 1ROLPLWRQWKHIURQWSDQHORSHUDWLRQ [0] 1 Lock the operation on the front panel 7 Related page $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-51 Supplement Note 4 1. Details of parameter Setup [Class 6] Special setting 'HIDXOW>@ Pr6.00 $QDORJWRUTXHIHHGIRUZDUGFRQYHUVLRQ gain Range Unit Default 0 to 100 0.1V/100% 0 Related control mode P S F 6HWWKHLQSXWJDLQRIDQDORJWRUTXHIHHGIRUZDUG WRDUHLQYDOLG 8VDJHH[DPSOHRI$QDORJWRUTXHIHHGIRUZDUG! 6HWWLQJELWSODFHRI3U)XQFWLRQH[SDQVLRQVHWXSWRHQDEOHVWKHDQDORJWRUTXHIHHG IRUZDUG:KHQWKHDQDORJLQSXWLVXVHGE\DQRWKHUIXQFWLRQ HJDQDORJWRUTXHOLPLW WKH IXQFWLRQEHFRPHVLQYDOLG 7KHYROWDJH 9 DSSOLHGWRWKHDQDORJLQSXWLVFRQYHUWHGWRWKHWRUTXHYLD3U$QDORJ WRUTXHIHHGIRUZDUGFRQYHUVLRQJDLQVHWXSDQGDGGHGWRWKHWRUTXHFRPPDQG LQ&&: GLUHFWLRQLILWLVSRVLWLYHYROWDJHRULQ&:GLUHFWLRQLIQHJDWLYH 7KH FRQYHUVLRQ RI DQDORJ LQSXW LQSXW YROWDJH >9@ WR WKH WRUTXH FRPPDQG >@ WR WKH PRWRUPD\EHH[SUHVVHGPDWKHPDWLFDOO\DVIROORZV 7RUTXHFRPPDQG ðLQSXWYROWDJH 9 3UVHWXSYDOXHð Pr6.02 9HORFLW\GHYLDWLRQH[FHVVVHWXS Range Unit Default 0 to 20000 r/min 0 Related control mode P :KHQWKHVSHHGGHYLDWLRQ GLIIHUHQFHEHWZHHQLQWHUQDOSRVLWLRQDOFRPPDQGDQGDFWXDO VSHHG H[FHHGVWKLVYDOXH(UU6SHHGRYHUGHYLDWLRQSURWHFWLRQRFFXUV 7KLVSURWHFWLRQLVQRWGHWHFWHGZKHQWKHVHWXSYDOXHLV Pr6.04 JOG trial run command speed Range Unit Default Related control mode 0 to 500 r/min 300 P S T F Related control mode 6HWXSWKHFRPPDQGVSHHGXVHGIRU-2*WULDOUXQ YHORFLW\FRQWURO Related page Pr6.05 %HIRUHXVLQJUHIHUWR33UHSDUDWLRQ7ULDO5XQ Position 3rd gain valid time Range Unit Default 0 to 10000 0.1ms 0 P F 6HWXSWKHWLPHDWZKLFKUGJDLQEHFRPHVYDOLG :KHQQRWXVLQJWKLVSDUDPHWHUVHW3UWRDQG3UWR 7KLVLVYDOLGIRURQO\SRVLWLRQFRQWUROIXOOFORVHGFRQWURO Pr6.06 Position 3rd gain scale factor Range Unit Default 50 to 1000 % 100 Related control mode P F 6HWXSWKHUGJDLQE\DPXOWLSO\LQJIDFWRURIWKHVWJDLQ UGJDLQ VWJDLQð Pr6.06/100 Note Related page 4-52 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ3´3URWHFWLYH)XQFWLRQµ 1. Details of parameter 1 'HIDXOW>@ Pr6.07 Torque command additional value Range Unit Default ïWR % 0 Related control mode P S F 6HW XS WKH RIIVHW ORDG FRPSHQVDWLRQ YDOXH XVXDOO\ DGGHG WR WKH WRUTXH FRPPDQG LQ D FRQWUROPRGHH[FHSWIRUWKHWRUTXHFRQWUROPRGH 8SGDWHWKLVSDUDPHWHUZKHQWKHYHUWLFDOD[LVPRGHIRUUHDOWLPHDXWRWXQLQJLVYDOLG Positive direction torque compensation value Range Unit Default ïWR % 0 Related control mode P F 6HWXSWKHG\QDPLFIULFWLRQFRPSHQVDWLRQYDOXHWREHDGGHGWRWKHWRUTXHFRPPDQGZKHQ IRUZDUGSRVLWLRQDOFRPPDQGLVIHG 8SGDWHWKLVSDUDPHWHUZKHQWKHIULFWLRQFRPSHQVDWLRQPRGHIRUUHDOWLPHDXWRWXQLQJLVYDOLG Negative direction torque compensation value Range Unit Default ïWR % 0 Related control mode P F 6HWXSWKHG\QDPLFIULFWLRQFRPSHQVDWLRQYDOXHWREHDGGHGWRWKHWRUTXHFRPPDQGZKHQ QHJDWLYHGLUHFWLRQSRVLWLRQDOFRPPDQGLVIHG 8SGDWHWKLVSDUDPHWHUZKHQWKHIULFWLRQFRPSHQVDWLRQPRGHIRUUHDOWLPHDXWRWXQLQJLVYDOLG Pr6.10 )XQFWLRQH[SDQVLRQVHWXS Range Unit Default Related control mode 0 to 63 — 0 P S T F 4 Setup Set up the function in unit of bit. Function 3 Connection Pr6.09 2 Preparation Pr6.08 Before Using the Products [Class 6] Special setting Setup value [0] 1 Valid bit 0 6SHHGREVHUYHU ,QYDOLG bit 1 'LVWXUEDQFHREVHUYHU ,QYDOLG Valid $OZD\VYDOLG 9DOLGRQO\ZKHQVWJDLQ is selected. Valid 'LVWXUEDQFHREVHUYHURSHUDWLRQVHWXS bit 3 ,QHUWLDUDWLRVZLWFKLQJ ,QYDOLG bit 4 &XUUHQWUHVSRQVHLPSURYHPHQW ,QYDOLG Valid bit 5 $QDORJWRUTXH)) ,QYDOLG Valid Adjustment bit 2 5 * bit 0 = LSB Current response setup Unit Default Related control mode 50 to 100 % 100 P S T F )LQHWXQHWKHFXUUHQWUHVSRQVHZLWKUHVSHFWWRGHIDXOWVHWXS 6 When in Trouble Pr6.11 Range 7 Related page $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-53 Supplement Note 1. Details of parameter [Class 6] Special setting 'HIDXOW>@ Pr6.13 2nd Inertia ratio Range Unit Default Related control mode 0 to 10000 % 250 P S T F Set 2nd inertia ratio. @ Caution Pr6.14 ,IWKHLQHUWLDUDWLRLVFRUUHFWO\VHWWKHVHWXSXQLWRI3UDQG3UEHFRPHV +] :KHQ WKHLQHUWLDUDWLRRI3ULVODUJHUWKDQWKHDFWXDOWKHVHWXSXQLWRIWKHYHORFLW\ORRSJDLQ EHFRPHVODUJHUDQGZKHQWKHLQHUWLDUDWLRRI3ULVVPDOOHUWKDQWKHDFWXDOWKHVHWXSXQLW RIWKHYHORFLW\ORRSJDLQEHFRPHVVPDOOHU Emergency stop time at alarm Range Unit Default Related control mode 0 to 1000 1ms 200 P S T F 6HWXSWKHWLPHDOORZHGWRFRPSOHWHHPHUJHQF\VWRSLQDQDODUPFRQGLWLRQ([FHHGLQJWKLV time puts the system in alarm state. :KHQVHWXSYDOXHLVLPPHGLDWHVWRSLVGLVDEOHGDQGWKHLPPHGLDWHDODUPVWRSLVHQDEOHG Pr6.15 2nd over-speed level setup Range Unit Default Related control mode 0 to 20000 r/min 0 P S T F :KHQ WKH PRWRU VSHHG H[FHHGV WKLV VHWXS WLPH GXULQJ HPHUJHQF\ VWRS VHTXHQFH LQ DQ DODUPFRQGLWLRQ(UUQGRYHUVSHHGSURWHFWLRQZLOOEHDFWLYDWHG 7KHRYHUVSHHGOHYHOEHFRPHVWLPHVRIWKHPRWRUPD[VSHHGE\VHWWLQJXSWKLVWR Pr6.17 * )URQWSDQHOSDUDPHWHUZULWLQJVHOHFWLRQ Range Unit Default Related control mode 0 to 1 — 0 P S T F 6SHFLI\WKH((3520ZULWLQJSURFHGXUHZKHQSDUDPHWHULVHGLWHGIRUPWKHIURQWSDQHO Setup value Writing [0] 'RQRWZULWHWR((3520DWWKHVDPHWLPH 1 Pr6.18 * :ULWHWR((3520DWWKHVDPHWLPH 3RZHUXSZDLWWLPH Range Unit Default Related control mode 0 to 100 0.1s 0 P S T F 6HWXSWKHVWDQGDUGLQLWLDOL]DWLRQWLPH Vњ DIWHUSRZHUXS Note Related page 4-54 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´((3520:ULWLQJ0RGHµ3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 'HIDXOW>@ Pr6.19 * Encoder Z phase setup Range Unit Default Related control mode 0 to 32767 pulse 0 P S T F ,IWKHQXPEHURIRXWSXWSXOVHVSHURQHPRWRUUHYROXWLRQDIWHUGLYLVLRQRISXOVHRXWSXWLVQRW DQLQWHJHUÀQHDGMXVWWKHZLGWKRIHQFRGHU=SKDVH =SKDVHVHWXSRIH[WHUQDOVFDOH Range Unit Default 0 to 400 ѥV 0 2 Related control mode F 6HWXSWKH=SKDVHUHJHQHUDWLYHZLGWKRIH[WHUQDOVFDOHLQXQLWRIWLPH(YHQLIWKHZLGWKRI =SKDVHVLJQDOFDQQRWEHGHWHFWHGEHFDXVHWKHZLGWKHTXLYDOHQWRIWKHWUDYHOGLVWDQFHIURP WKHH[WHUQDOVFDOHLVWRRVKRUWWKH=SKDVHVLJQDOZLOOEHRXWSXWIRUDWOHDVWWKHSHULRGVHWWR this parameter. 6HULDODEVROXWHH[WHUQDOVFDOH=SKDVH setup Range Unit Default 0 to 228 pulse 0 Related control mode F )XOOFORVHGFRQWUROXVLQJVHULDODEVROXWHH[WHUQDOVFDOH:KHQRXWSXWWLQJSXOVHVE\XVLQJWKH H[WHUQDOVFDOHDVWKHVRXUFHRIWKHRXWSXWVHWWKH=SKDVHRXWSXWLQWHUYDOLQXQLWVRI$SKDVH RXWSXWSXOVHVRIWKHH[WHUQDOVFDOH EHIRUHPXOWLSOLHGE\ Setup value 4 Content 2XWSXW=SKDVHRQO\DWDEVROXWHSRVLWLRQRIH[WHUQDOVFDOH [0] $IWHUWKHSRZHULVIHGWRWKHGULYHUWKH=SKDVHDVLWFURVVHVWKH]HURDW WKHDEVROXWHSRVLWLRQRIH[WHUQDOVFDOHLVRXWSXWLQV\QFKURQRXVZLWKWKH $SKDVH6XEVHTXHQWO\WKH=SKDVHLVRXWSXWDWWKH$SKDVHRXWSXWSXOVH LQWHUYDOVVHWWRWKLVSDUDPHWHU $%SKDVHH[WHUQDOVFDOHSXOVHRXWSXW method selection Range Unit Default 0 to 1 — 0 Setup 1 to 268435456 Pr6.22 * Related control mode F Setup value 1 Pr6.23 5 Adjustment 6HOHFWWKHSXOVHUHJHQHUDWLRQPHWKRGRI$%DQG=SDUDOOHOH[WHUQDOVFDOH [0] 3 Connection Pr6.21 * Preparation Pr6.20 * Before Using the Products [Class 6] Special setting Regenerating method 'LUHFWO\RXWSXWWKHVLJQDOVIURP$%DQG=SDUDOOHOH[WHUQDOVFDOHV 2XWSXW$DQG%SKDVHVLJQDOVUHFRYHUHGIURP$%DQG=SDUDOOHOH[WHUQDOVFDOHV Z-phase is output directly. Disturbance torque compensating gain Unit Default ïWR % 0 Related control mode P S 6HWXSWRFRPSHQVDWLQJJDLQDJDLQVWGLVWXUEDQFHWRUTXH $IWHUVHWWLQJXS3ULQFUHDVH3U 7KH GLVWXUEDQFH VXSSUHVVLQJ FDSDELOLW\ LQFUHDVHV E\ LQFUHDVLQJ WKH JDLQ EXW LW LV DVVRFLDWHGZLWKLQFUHDVLQJYROXPHRIRSHUDWLRQQRLVH 7KLVPHDQVWKDWZHOOEDODQFHGVHWXSFDQEHREWDLQHGE\DGMXVWLQJ3UDQG3U 6 When in Trouble Range 7 Related page $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 4-55 Supplement Note 1. Details of parameter [Class 6] Special setting 'HIDXOW>@ Pr6.24 Disturbance observer filter Range Unit Default 0 to 2500 0.01ms 53 Related control mode P S 6HWXSWKHÀOWHUWLPHFRQVWDQWDFFRUGLQJWRWKHGLVWXUEDQFHWRUTXHFRPSHQVDWLRQ )LUVW VHW XS 3U WR D ODUJHU YDOXH DQG FKHFN WKH RSHUDWLRQ ZLWK 3U 'LVWXUEDQFH WRUTXHFRPSHQVDWLQJJDLQVHWWRDORZYDOXHDQGWKHQJUDGXDOO\GHFUHDVHWKHVHWXSYDOXH RI3U$ORZÀOWHUVHWXSYDOXHDVVXUHVGLVWXUEDQFHWRUTXHHVWLPDWLRQZLWKVPDOOGHOD\ DQGHIIHFWLYHO\VXSSUHVVHVHIIHFWVRIGLVWXUEDQFH+RZHYHUWKLVUHVXOWVLQODUJHURSHUDWLRQ QRLVH:HOOEDODQFHGVHWXSLVUHTXLUHG Pr6.27 * Alarm latch time selection Range Unit Default Related control mode 0 to 10 — 5 P S T F Range Unit Default Related control mode 0 to 3 — 1 P S T F Set up the latch time. Setup value Content 0 /DWFKWLPHLQÀQLWH 1 1 [s] 2 2 [s] 3 3 [s] 4 4 [s] [5] 6 Pr6.31 Latch time 5 [s] 6 [s] 7 7 [s] 8 8 [s] 9 9 [s] 10 10 [s] Real time auto tuning estimation speed 6HWXSWKHORDGFKDUDFWHULVWLFVHVWLPDWLRQVSHHGZLWKWKHUHDOWLPHDXWRWXQLQJEHLQJYDOLG$ KLJKHUVHWXSYDOXHDVVXUHVIDVWHUUHVSRQVHWRDFKDQJHLQORDGFKDUDFWHULVWLFVEXWLQFUHDVHV YDULDWLRQV LQ GLVWXUEDQFH HVWLPDWLRQ 5HVXOW RI HVWLPDWLRQ LV VDYHG WR ((3520 HYHU\ minutes. Setup value Mode Description 0 1RFKDQJH [1] $OPRVWFRQVWDQW Stop estimation of load characteristics. 5HVSRQVHWRFKDQJHVLQORDGFKDUDFWHULVWLFVLQHYHU\PLQXWH 2 6ORZHUFKDQJH 5HVSRQVHWRFKDQJHVLQORDGFKDUDFWHULVWLFVLQHYHU\VHFRQG 3* Faster change Obtain best suitable estimation in response to changes in load characteristics. * ,IWKHDXWRPDWLFRVFLOODWLRQGHWHFWLRQLVHQDEOHGE\WKHVXSSRUWVRIWZDUH3$1$7(50WKH VHWXSYDOXHLVXVHG Note Related page 4-56 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 7KHVHWXSVXSSRUWVRIWZDUH3$1$7(50FDQEHGRZQORDGHGIURPRXUZHEVLWH 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Details of parameter 1 Pr6.32 Real time auto tuning custom setup Range Unit Default Related control mode ïWR — 0 P S T F :KHQWKHRSHUDWLRQPRGHRIUHDOWLPHDXWRWXQLQJLVVHWWRWKHFXVWRPL]H 3U VHW WKHDXWRPDWLFDGMXVWLQJIXQFWLRQDVVKRZQEHORZ Bit Content Preparation Load characteristics estimation * Setup value [0] 1 Function Disable Enable * ,I WKH ORDG FKDUDFWHULVWLFV HVWLPDWLRQ LV GLVDEOHG WKH FXUUHQW VHWXS FDQQRWEHFKDQJHGHYHQLIWKHLQHUWLDUDWLRLVXSGDWHGDFFRUGLQJWR WKHHVWLPDWHGYDOXH:KHQWKHWRUTXHFRPSHQVDWLRQLVXSGDWHGE\ WKHHVWLPDWHGYDOXHLWLVFOHDUHGWR LQYDOLG Inertia ratio update Setup value [0] 1 Function Use the current setup. 8SGDWHE\WKHHVWLPDWHGYDOXH 6 to 4 Torque compensation Compensation setup Pr6.07 Pr6.08 Pr6.09 0 clear 0 clear 0 clear Update 0 clear 0 clear /RZ /RZ Update Middle Middle Update High High 5 Adjustment Update 4 Setup Set up the update to be made according to the results of load FKDUDFWHULVWLFVHVWLPDWLRQRI3U7RUTXHFRPPDQGDGGLWLRQDOYDOXH 3U SRVLWLYH GLUHFWLRQ WRUTXH FRPSHQVDWLRQ YDOXH DQG 3U QHJDWLYHGLUHFWLRQWRUTXHFRPSHQVDWLRQYDOXH Setup value Function Use current setup [0] 1 Disable torque compensation 2 9HUWLFDOD[LVPRGH Friction compensation 3 ORZ Friction compensation 4 PLGGOH Friction compensation 5 KLJK 3 Connection Set up update to be made based on result of the load characteristics estimation of Pr0.04 Inertia ratio. 3 to 2 2 Description Enable/disable the load characteristics estimation function. 1 to 0 Before Using the Products [Class 6] Special setting Enable/disable the basic gain setup to be made according to Pr0.03 Real time auto tuning mechanical stiffness selection. Stiffness setup 8 )L[HG parameter setup Setup value [0] 1 6 Function Disable Enable (QDEOHGLVDEOHWKHFKDQJHRISDUDPHWHUWKDWLVQRUPDOO\VHWDWDÀ[HGYDOXH Setup value [0] 1 Function Use the current setup. 6HWWRDÀ[HGYDOXH 7 6HOHFWWKHJDLQVZLWFKLQJUHODWHGSDUDPHWHUWREHXVHGZKHQWKHUHDO time auto tuning is enabled. Gain VZLWFKLQJ setup Setup value [0] 1 2 Function Use the current setup. 'LVDEOHJDLQVZLWFKLQJ (QDEOHJDLQVZLWFKLQJ Supplement 10 to 9 When in Trouble 7 FRQWLQXHG 4-57 1. Details of parameter [Class 6] Special setting 'HIDXOW>@ Caution 7KLVSDUDPHWHUVKRXOGEHVHWXSELWE\ELW7RSUHYHQWVHWWLQJHUURUXVHRIWKHVHWXSVXSSRUW VRIWZDUHLVUHFRPPHQGHGZKHQHGLWLQJSDUDPHWHU 6HWXSSURFHGXUHRIELWZLVHSDUDPHWHU! :KHQVHWWLQJSDUDPHWHUWRDYDOXHRWKHUWKDQFDOFXODWHWKHVHWXSYDOXHRI3ULQWKH IROORZLQJSURFHGXUH ,GHQWLI\WKH/6%RIWKHVHWXS ([DPSOH/6%RIWKHWRUTXHFRPSHQVDWLRQIXQFWLRQLV 0XOWLSO\WKHVHWXSYDOXHE\SRZHURI /6% ([DPSOH7RVHWWKHWRUTXHFRPSHQVDWLRQIXQFWLRQWRIULFWLRQFRPSHQVDWLRQ PLGGOH 24ð 3HUIRUPVWHSV DQG IRUHYHU\VHWXSVVXPXSWKHYDOXHVZKLFKDUHWREH3UVHWXSYDOXH ([DPSOH/RDG FKDUDFWHULVWLFV PHDVXUHPHQW HQDEOH LQHUWLD UDWLR XSGDWH HQDEOH WRUTXHFRPSHQVDWLRQ IULFWLRQFRPSHQVDWLRQ PLGGOH VWLIIQHVVVHWXS HQDEOH À[HGSDUDPHWHU VHWWRDÀ[HGYDOXHJDLQVZLWFKLQJVHWXS HQDEOHWKHQ 20ð2ð4ð7ð8ð9ð Pr6.34 Hybrid vibration suppression gain Range Unit Default 0 to 30000 0.1/s 0 Related control mode F 6HWXSWKHK\EULGYLEUDWLRQVXSSUHVVLRQJDLQIRUIXOOFORVHGFRQWUROOLQJ )LUVWVHWLWWRWKHYDOXHLGHQWLFDOWRWKDWRISRLVRQORRSJDLQDQGWKHQÀQHWXQHDVQHFHVVDU\ Pr6.35 Hybrid vibration suppression filter Range Unit Default 0 to 6400 0.01ms 10 Related control mode F 6HWXSWKHWLPHFRQVWDQWRIWKHK\EULGYLEUDWLRQVXSSUHVVLRQÀOWHUIRUIXOOFORVHGFRQWUROOLQJ :KLOH GULYLQJ XQGHU IXOOFORVHG FRQWURO JUDGXDOO\ LQFUHDVH WKH VHWXS YDOXH DQG FKHFN changes in the response. Pr6.37 Oscillation detecting level Range Unit Default Related control mode 0 to 1000 0.1% 0 P S T F 6HWXSWKHRVFLOODWLRQGHWHFWLQJOHYHO 8SRQ GHWHFWLRQ RI D WRUTXH YLEUDWLRQ ZKRVH OHYHO LV KLJKHU WKDQ WKLV VHWXS YDOXH WKH RVFLOODWLRQGHWHFWLRQDODUPZLOOEHLVVXHG Pr6.38 * Alarm mask setup Range Unit Default Related control mode ïWR — 0 P S T F Set up the alarm detection mask. Placing 1 to the corresponding bit position disables detection of the alarm condition. Pr6.39 For manufacturer's use Range Unit Default — — 0 Related control mode )L[HGWR Note Related page 4-58 $SDUDPHWHULVGHVLJQDWHGDVIROORZVClass Pr0.00 Parameter No. )RUSDUDPHWHUVZKLFK1RKDYHDVXIIL[RI´ * ”FKDQJHGFRQWHQWVZLOOEHYDOLGDWHGZKHQ \RXWXUQRQWKHFRQWUROSRZHU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 2.Trial Run (JOG run) Setup Inspection Before Trial Run 1 Before Using the Products 4 (1) Inspection on wiring 0LVZLULQJ" (VSHFLDOO\SRZHULQSXWDQGPRWRURXWSXW 6KRUWRUJURXQGHG" /RRVHFRQQHFWLRQ" 2 (2) Confirmation of power supply and voltage 5DWHGYROWDJH" Preparation s la Po er s l 3 Connection 4 (3) Fixing of the servo motor 8QVWDEOHPRXQWLQJ" Setup (4) Separation from the PHFKDQLFDOV\VWHP Co e tor (5) Release of the brake 5 e Adjustment ro a otor (6) Turn to Servo-OFF after finishing the trial run by pressing . 6 When in Trouble 7 'HWDLOVRIZLULQJUHIHUWR3´2YHUDOO:LULQJµ 7KHÀJXUHDERYHVKRZVFRQQHFWLRQVRQYHORFLW\SRVLWLRQWRUTXHDQGIXOOFORVHGPRGHGULYHU 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; &RPPXQLFDWLRQFRQQHFWRU ; 6DIHW\ IXQFWLRQFRQQHFWRU ; ([WHUQDOVFDOHFRQQHFWRU 4-59 Supplement Note 4 2.Trial Run (JOG run) Setup Trial Run by Connecting the Connector X4 Trial Run (JOG run) at Position Control Mode &RQQHFWWKH&RQQHFWRU; (QWHUWKHSRZHU '&WR9 WRFRQWUROVLJQDO &20&20² (QWHUWKHSRZHUWRWKHGULYHU &RQÀUPWKHGHIDXOWYDOXHVRISDUDPHWHUV 0DWFKWRWKHRXWSXWIRUPDWRIWKHKRVWFRQWUROOHUZLWK3U &RPPDQGSXOVHLQSXW PRGHVHWXS :ULWHWR((3520DQGWXUQRIIRQWKHSRZHU RIWKHGULYHU &RQQHFW WKH 6HUYR21 LQSXW 65921 DQG &20² &RQQHFWRU ; 3LQ WR EULQJ WKHGULYHUWR6HUYR21VWDWXVDQGHQHUJL]HWKHPRWRU (QWHUORZIUHTXHQF\IURPWKHKRVWFRQWUROOHUWRUXQWKHPRWRUDWORZVSHHG &KHFNWKHPRWRUURWDWLRQDOVSHHGDWPRQLWRUPRGHZKHWKHU URWDWLRQDOVSHHGLVDVSHUWKHVHWXSRUQRWDQG WKHPRWRUVWRSVE\VWRSSLQJWKHFRPPDQG SXOVH RUQRW ,IWKHPRWRUGRHVQRWUXQFRUUHFWO\UHIHUWR3'LVSOD\RI)DFWRUIRU1R0RWRU 5XQQLQJRI3UHSDUDWLRQ :LULQJ'LDJUDP Connector X4 7 29 DC 12V to 24V 41 3 1kї DC 12V 1kї COM+ SRV-ON COMPULS1 4 PULS2 5 SIGN1 6 SIGN2 44 45 46 PULSH1 In case of open collector input 2kї 120ї PULSH2 2kї 2kї SIGNH1 47 SIGNH2 13 GND 20kї 20kї 20kї 120ї 2kї H/L PULS SIGN in case of line receiver input 20kї 3DUDPHWHU Pr No. Title Setup value 0.01 Control mode setup 0 5.04 2YHUWUDYHOLQKLELWLQSXWVHWXS 1 0.05 Selection of command pulse input 0/1 0.07 Command pulse input mode setup 1 5.18 ,QYDOLGDWLRQRIFRPPDQGSXOVHLQKLELWLQSXW 1 5.17 Counter clear input mode 2 ,QSXWVLJQDOVWDWXV No. 0 4-60 Title of signal 6HUYR21 Monitor display $ 2.Trial Run (JOG run) 1 Trial Run (JOG run) at Velocity Control Mode 29 DC 12V to 24V 26 41 15 COM+ SRV-ON ZEROSPD COMï SPR/TRQR/SPL GND Run with ZEROSPD switch close, and Stop with open 5 In case of bi-directional operation (Positive/Negative), provide a bipolar power supply, or use with Pr3.15 = 3. In case of one-directional operation 3DUDPHWHU Title Control mode setup 2YHUWUDYHOLQKLELWLQSXWVHWXS Speed zero-clamp function selection 6SHHGVHWXS,QWHUQDO([WHUQDOVZLWFKLQJ Speed command rotational direction selection Input gain of speed command 5HYHUVDORIVSHHGFRPPDQGLQSXW $QDORJLQSXW $, RIIVHWVHWXS $QDORJLQSXW $, ILOWHU Setup value 1 1 1 6 When in Trouble Pr No. 0.01 5.04 3.15 3.00 3.01 3.02 3.03 4.22 4.23 Set up as required 7 ,QSXWVLJQDOVWDWXV Note Title of signal 6HUYR21 Speed zero clamp Monitor display $ — Supplement No. 0 5 4 Adjustment 14 DC 10V 3 Setup :LULQJ'LDJUDP 7 2 Connection &RQQHFWWKH&RQQHFWRU; (QWHUWKHSRZHU '&WR9 WRFRQWUROVLJQDO &20&20² (QWHUWKHSRZHUWRWKHGULYHU &RQÀUPWKHGHIDXOWYDOXHVRISDUDPHWHUV &RQQHFWWKH6HUYR21LQSXW 65921&RQQHFWRU;3LQ DQG&20² &RQQHFWRU ;3LQ WRWXUQWR6HUYR21DQGHQHUJL]HWKHPRWRU &ORVHWKHVSHHG]HURFODPSLQSXW =(5263' DQGDSSO\'&YROWDJHEHWZHHQYHORFLW\ FRPPDQGLQSXW635 &RQQHFWRU;3LQ DQG*1' &RQQHFWRU;3LQ DQG JUDGXDOO\LQFUHDVHIURP9WRFRQÀUPWKHPRWRUUXQV &RQÀUPWKHPRWRUURWDWLRQDOVSHHGLQPRQLWRUPRGH :KHWKHUWKHURWDWLRQDOVSHHGLVSHUWKHVHWXSRUQRW :KHWKHUWKHPRWRUVWRSVZLWK]HURFRPPDQGRUQRW ,IWKHPRWRUGRHVURWDWHDWDPLFURVSHHGZLWKFRPPDQGYROWDJHRI :KHQ\RXZDQWWRFKDQJHWKHURWDWLRQDOVSHHGDQGGLUHFWLRQVHWXSWKHIROORZLQJSDrameters again. 3U6SHHGVHWXS,QWHUQDO([WHUQDOVZLWFKLQJ 5HIHUWR33DUDP 3U6SHHGFRPPDQGURWDWLRQDOGLUHFWLRQVHOHFWLRQ HWHU6HWXS 3DUDPHWHUVIRU 9HORFLW\7RUTXH&RQWURO 3U5HYHUVDORIVSHHGFRPPDQGLQSXW ,I WKH PRWRU GRHV QRW UXQ FRUUHFWO\ UHIHU WR 3 'LVSOD\ RI )DFWRU IRU 1R0RWRU 5XQQLQJRI3UHSDUDWLRQ Preparation Before Using the Products Trial Run by Connecting the Connector X4 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXW 4-61 2.Trial Run (JOG run) Trial Run by Connecting the Connector X4 Trial Run (JOG run) at Torque Control Mode &RQQHFWWKH&RQQHFWRU; (QWHUWKHSRZHU '&9 WRFRQWUROVLJQDO &20&20² (QWHUWKHSRZHUWRWKHGULYHU &RQÀUPWKHGHIDXOWYDOXHVRISDUDPHWHUV 6HWDORZHUYDOXHWR3U WKVSHHGRIVSHHGVHWXS (QHUJL]H WKH PRWRU E\ FRQQHFWLQJ WKH 6HUYR21 LQSXW 65921 &RQQHFWRU ; 3LQ DQG&20² 3LQRI&RQQHFWRU; WRWXUQWR6HUYR21VWDWXV &RQÀUPWKDWWKHPRWRUUXQVDVSHUWKHVHWXSRI3UE\DSSO\LQJ'&YROWDJH SRVLWLYHQHJDWLYH EHWZHHQWKHWRUTXHFRPPDQGLQSXW 3LQRI&RQQHFWRU; DQG*1' 3LQRI&RQQHFWRU; ,I\RXZDQWWRFKDQJHWKHWRUTXHPDJQLWXGHGLUHFWLRQDQGYHORFLW\OLPLWYDOXHDJDLQVW WKHFRPPDQGYROWDJHVHWXSWKHIROORZLQJSDUDPHWHUV 3UInput gain of torque command 5HIHUWR33DUDPHWHU6HWXS 3DUDPHWHUVIRU9HORFLW\7RUTXH&RQ3U,QSXWUHYersal of torque command WURO 3U6SHHGOLPLWYDOXH ,IWKHPRWRUGRHVQRWUXQFRUUHFWO\UHIHUWR3'LVSOD\RIIDFWRUIRU1RPRWRUUXQQLQJRI3UHSDUDWLRQ :LULQJ'LDJUDP C C N to C or ro re t o al r Pos t e Ne at e ea olar o er s l . P C 0 ase o o e N a r 3DUDPHWHU Pr No. Title Setup value 0.01 Control mode setup 2 5.04 2YHUWUDYHOLQKLELWLQSXWVHWXS 1 3.15 Speed zero-clamp function selection 0 3.17 Selection of torque command 0 3.19 Input gain of torque command 3.20 ,QSXWUHYHUVDORIWRUTXHFRPPDQG Set up as required 3.21 6SHHGOLPLWYDOXH ORZHUYDOXH ,QSXWVLJQDOVWDWXV No. Note 4-62 Title of signal Monitor display 0 6HUYR21 $ 5 Speed zero clamp — 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXW 4 2.Trial Run (JOG run) Setup Setup of Motor Rotational Speed and Input Pulse Frequency Motor rotational speed (r/min) Pr0.08 17-bit 20-bit 17 2 40000 220 40000 500K 3000 217 10000 220 10000 250K 3000 217 5000 220 5000 100K 3000 217 2000 220 2000 500K 1500 217 20000 220 20000 2 Preparation 3000 2M 3 Caution 0D[LQSXWSXOVHIUHTXHQF\YDULHVGHSHQGLQJRQLQSXWWHUPLQDOV 7KHGHVLUHGVHWWLQJFDQEHGHWHUPLQHGE\VHOHFWLQJYDOXHRIQXPHUDWRUDQGGHQRPLQDWRURIHOHFWURQLFJHDU+RZHYHUDQH[FHVVLYHO\KLJKGLYLVLRQRUPXOWLSOLFDWLRQUDWLRFDQQRWJXDUDQWHHWKHRSHUDWLRQ7KHUDWLRVKRXOGEHLQDUDQJHEHWZHHQDQG ([FHVVLYHO\ KLJK PXOWLSOLFDWLRQ UDWLR ZLOO FDXVH (UU FRPPDQG SXOVH PXOWLSOLFDWLRQ HUURUSURWHFWLRQ GXHWRYDU\LQJFRPPDQGSXOVHLQSXWRUQRLVHVHYHQLIWKHRWKHUVHWWLQJVDUHZLWKLQWKHVSHFLÀHGUDQJH 0 ear P lle rat o otal re Command pulse determine parameter Decimal figures 0 1 21 2 22 4 2 2 3 8 24 16 25 32 6 64 2 20-bit 27 128 5840 28 256 67500 To rotate the output shaft by HQWHUWKHFRPPDQGRI 13 SXOVHVIURPWKH host controller. To rotate the output shaft by HQWHUWKHFRPPDQGRI 10000 pulses from the host controller. 365 ð17 × × 18 213 5840 = 108 365 ð20 × × 18 10000 5840 = 67500 5HIHUWR3´6HWXSRIFRPPDQGGLYLVLRQDQGPXOWLSOLFDWLRQUDWLR HOHFWURQLFJHDUUDWLR µRI6XSSOHPHQW 9 2 512 210 1024 211 2048 12 4096 2 213 8192 214 16384 215 32768 216 65536 217 131072 218 262144 219 524288 220 1048576 6 7 Supplement +RZWR 108 2n When in Trouble Pr0.10 5840 5 t o rat o Adjustment Encoder Pr0.09 0 ear rat o :KHQ VHWWLQJ WKH FRPPDQG GLYLVLRQ DQG PXOWLSOLFDWLRQ UDWLR DV QXPHUDWRUGHQRPLQDWRU H[SUHVV LW DV 3U3U ZLWK Pr0.08 = 0. )RU IXOO FORVHG FRQWUROOLQJ VHWWLQJ RI 3U LV LJQRUHGDQGVHWWLQJVRI3UDQG3UDUHDOZD\VDSSOLHG HJ :KHQ\RXZDQWWRURWDWHWKHPRWRUE\ZLWKWKHORDG of total reduction ratio of 18/365. 17-bit 4 Setup :KHQVHWWLQJ3UDQGHQFRGHUUHVROXWLRQLVDXWRPDWLFDOO\VHWXSDVQXPHUDWRUV)RU IXOOFORVHGFRQWUROOLQJVHWWLQJRI3ULVLJQRUHGDQGVHWWLQJVRI3UDQG3UDUH DOZD\VDSSOLHG Connection Note Relation between the motor rotational speed and input pulse counts Before Using the Products Input pulse frequency (pps) 1 4-63 MEMO 4-64 5. Adjustment 1 Before Using the Products 1. Gain Adjustment 2 Outline ........................................................................................................5-2 2. Real-Time Auto-Gain Tuning Preparation Basic ...........................................................................................................5-4 3. Adaptive filter $GDSWLYHÀOWHU ............................................................................................5-10 4. Manual Gain Tuning (Basic) Outline ......................................................................................................5-13 3 $GMXVWPHQWLQ3RVLWLRQ&RQWURO0RGH........................................................5-14 $GMXVWPHQWLQ9HORFLW\&RQWURO0RGH ........................................................5-15 Connection $GMXVWPHQWLQ7RUTXH&RQWURO0RGH .........................................................5-15 $GMXVWPHQWLQ)XOO&ORVHG&RQWURO0RGH ..................................................5-16 Gain Switching Function ...........................................................................5-17 6XSSUHVVLRQRI0DFKLQH5HVRQDQFH ........................................................5-20 5. Manual Gain Tuning (Application) 4 'DPSLQJ&RQWURO .......................................................................................5-24 )HHGIRUZDUGIXQFWLRQ ...............................................................................5-26 Setup ,QVWDQWDQHRXV6SHHG2EVHUYHU ................................................................5-28 'LVWXUEDQFHREVHUYHU................................................................................5-30 UGJDLQVZLWFKLQJIXQFWLRQ .......................................................................5-32 )ULFWLRQWRUTXHFRPSHQVDWLRQ ...................................................................5-34 ,QHUWLDUDWLRVZLWFKLQJIXQFWLRQ ..................................................................5-36 5 +\EULGYLEUDWLRQGDPSLQJIXQFWLRQ ............................................................5-38 6. About Homing Operation Adjustment &DXWLRQRQ+RPLQJ2SHUDWLRQ ..................................................................5-39 Homing with Hit & Stop .............................................................................5-40 3UHVV +ROG&RQWURO ................................................................................5-41 6 When in Trouble 7 Supplement 5-1 5 1. Gain Adjustment Adjustment Outline Purpose ,W LV UHTXLUHG IRU WKH VHUYR GULYHU WR UXQ WKH PRWRU LQ OHDVW WLPH GHOD\ DQG DV IDLWKIXO DV SRVVLEOHDJDLQVWWKHFRPPDQGVIURPWKHKRVWFRQWUROOHU Gain setup : Low [r/min] +2000 Gain setup : High Gain setup : High + feed forward setup 0 Motor actual speed Command Speed -2000 0.0 125 250 375 0.0 125 250 375 0.0 125 250 375 Position loop gain Velocity loop gain : 20 : 100 Position loop gain Velocity loop gain : 100 : 50 Position loop gain Velocity loop gain : 100 : 50 Time constant of V-loop integration : 50 Time constant of V-loop integration : 50 Time constant of V-loop integration : 50 Velocity loop feed forward : 0 Inertia ratio : 100 Velocity loop feed forward : 0 Inertia ratio : 100 Velocity loop feed forward : 500 Inertia ratio : 100 Procedures Start adjustment Automatic adjustment ? No Yes Ready for command input ? Release of auto-adjusting function No Yes (Default) (see P.5-4) Operation by using the trial run function Use the gain setup of autoadjustment ? No (see P.5-17) Gain automatic setup function Real time auto-gain tuning Action O.K.? Yes No Yes Release of auto-adjusting function (see P.5-24) Manual gain tuning Action O.K.? No Yes Writing to EEPROM Finish adjustment Note 5-2 Consult to authorized dealer )RU VDIHW\ RSHUDWLRQ ILUVW DGMXVW WKH JDLQ E\ UHIHUULQJ WR 3 6HWXS SURWHFWLYH IXQFWLRQ EHIRUHJDLQDGMXVWPHQW 1. Gain Adjustment 1 Type Function Explanation Pages to refer $GDSWLYHÀOWHU 5HGXFHVWKHUHVRQDQFHYLEUDWLRQSRLQWE\DXWRPDWLFDOO\VHWWLQJXS WKHQRWFKÀOWHUFRHIÀFLHQWZKLFKUHPRYHVWKHUHVRQDQFHFRPSRQHQWIURPWKHWRUTXHFRPPDQGZKLOHHVWLPDWLQJWKHUHVRQDQFH IUHTXHQF\IURPWKHYLEUDWLQJFRPSRQHQWZKLFKDSSHDUVLQWKHPRWRUVSHHGLQDFWXDORSHUDWLQJFRQGLWLRQ P.5-10 0DQXDOJDLQWXQLQJ EDVLF ([HFXWHWKHPDQXDODGMXVWPHQWRUÀQHWXQLQJZKHQUHDOWLPH DXWRJDLQWXQLQJFDQQRWEHDFWLYDWHGGXHWRWKHOLPLWDWLRQRIRSHUDWLRQRUORDGFRQGLWLRQRUZKHQ\RXZDQWWRREWDLQDQRSWLPXP UHVSRQVHDQGVWDELOLW\XQGHUWKHVHFRQGLWLRQV P.5-13 $GMXVWPHQWRISRVLWLRQFRQWUROPRGH P.5-14 $GMXVWPHQWRIYHORFLW\FRQWUROPRGH P.5-15 $GMXVWPHQWRIWRUTXHFRQWUROPRGH P.5-15 $GMXVWPHQWRIIXOOFORVHGFRQWUROPRGH P.5-16 *DLQVZLWFKLQJIXQFWLRQ UPLQ@RUORZHU $FFHOHUDWLRQGHFHOHUDWLRQLVVORZ >UPLQ@SHU>V@RUORZ $FFHOHUDWLRQGHFHOHUDWLRQ WRUTXH LV VPDOOHU WKDQ XQEDODQFHG ZHLJKWHG YLVFRXVIULFWLRQWRUTXH :KHQ WKH VSHHG FRQGLWLRQ RI >UPLQ@ RU PRUH DQG DFFHOHUDWLRQ GHFHOHUDWLRQ FRQGLWLRQ RI >UPLQ@ SHU >V@ DUH QRW PDLQWDLQHG IRU >PV@ 2. Real-Time Auto-Gain Tuning 1 How to Operate ,ISRZHULVWXUQHGRIIZLWKLQPLQXWHVDIWHUWKHHQGRIWXQLQJSURFHVVWKHUHVXOWRIWKH UHDOWLPHDXWRWXQLQJLVQRWVDYHG,IWKHUHVXOWLVQRWVDYHGPDQXDOO\ZULWHSDUDPHWHUVWR ((3520DQGWKHQWXUQRIISRZHU 5 Adjustment Caution 4 Setup (VWLPDWLRQRIORDGFKDUDFWHULVWLFVVWDUWV :KHQWKHORDGFKDUDFWHULVWLFVDUHGHWHUPLQHG3U,QHUWLDUDWLRLVXSGDWHG ,QDVSHFLÀFPRGHWKHIROORZLQJSDUDPHWHUVDUHFKDQJHG 3U7RUTXHFRPPDQGDGGLWLRQDOYDOXH 3U3RVLWLYHGLUHFWLRQWRUTXHFRPSHQVDWLRQYDOXH 3U1HJDWLYHGLUHFWLRQWRUTXHFRPSHQVDWLRQYDOXH :KHQYDOXHRI3U5HDOWLPHDXWRWXQLQJVWLIIQHVVVHWXSLVLQFUHDVHGWKHPRWRUUHVSRQVLYHQHVVZLOOEHLPSURYHG 'HWHUPLQHWKHPRVWDSSURSULDWHVWLIIQHVVLQUHODWLRQWRWKHSRVLWLRQLQJVHWXSWLPHDQG YLEUDWLRQFRQGLWLRQ 7RVDYHWKHUHVXOWWRPHPRU\ZULWHWKHGDWDWR((3520 3 Connection &RQWUROSDUDPHWHULVDXWRPDWLFDOO\VHWDFFRUGLQJWR3U5HDOWLPHDXWRWXQLQJVWLIIQHVVVHWXS)RUGHWDLOVVHH3DQG 7XUQRQVHUYRDQGVWDUWWKHPDFKLQH 2 Preparation %ULQJWKHPRWRUWRVWDOO 6HUYR2)) 6HWXS3U 6HWXSRIUHDOWLPHDXWRJDLQWXQLQJPRGH WR 'HIDXOWLVVHWWR * 9HORFLW\DQGWRUTXHFRQWUROVDUHWKH Setup Real-time auto-gain tuning value VDPHDVLQWKHVWDQGDUGPRGH * 7RUTXHFRQWUROLVWKHVDPHDVLQWKH 0 Invalid VWDQGDUGPRGH 1 6WDQGDUG * 9HORFLW\FRQWUROLVWKHVDPHDVLQWKH 2 Positioning *1 YHUWLFDOD[LVPRGH7RUTXHFRQWUROLV 3 9HUWLFDOD[LV*2 WKHVDPHDVLQWKHVWDQGDUGPRGH 4 )ULFWLRQFRPSHQVDWLRQ*3 * &HUWDLQIXQFWLRQ V LVQRWDYDLODEOH LQDVSHFLÀFFRQWUROPRGH5HIHUWR 5 /RDGFKDUDFWHULVWLFPHDVXUHPHQW GHVFULSWLRQLQ3U 6 Customize *4 Before Using the Products Basic 6 When in Trouble 7 Related page :KLOHWKHDXWRWXQLQJLVYDOLGSDUDPHWHUVWKDWDUHWREHDXWRPDWLFDOO\DGMXVWHGFDQQRWEH changed. 3´((3520:ULWLQJ0RGHµ3´'HWDLOVRISDUDPHWHUµ 5-5 Supplement Note 2. Real-Time Auto-Gain Tuning Basic Parameters set/changed by real-time auto-gain tuning 3DUDPHWHUVZKLFKDUHXSGDWHG 7KH UHDOWLPH DXWRWXQLQJ IXQFWLRQ XSGDWHV WKH IROORZLQJ SDUDPHWHUV DFFRUGLQJ WR 3U 5HDOWLPH DXWRWXQLQJ VHWXS DQG 3U 5HDOWLPH DXWRWXQLQJ FXVWRP VHWXS DQGE\XVLQJWKHORDGFKDUDFWHULVWLFHVWLPDWHYDOXHV Class No. Title Function 0 04 ,QHUWLDUDWLR 8SGDWHVWKLVSDUDPHWHUZKHQWKHUHDOWLPHDXWR WXQLQJLQHUWLDUDWLRXSGDWHLVHQDEOHG 6 07 7RUTXHFRPPDQG additional value 8SGDWHWKLVSDUDPHWHUZKHQWKHYHUWLFDOD[LVPRGH IRUUHDOWLPHDXWRWXQLQJLVYDOLG 6 08 3RVLWLYHGLUHFWLRQWRUTXH 8SGDWHWKLVSDUDPHWHUZKHQWKHIULFWLRQ compensation value FRPSHQVDWLRQPRGHIRUUHDOWLPHDXWRWXQLQJLVYDOLG 6 09 1HJDWLYHGLUHFWLRQWRUTXH 8SGDWHWKLVSDUDPHWHUZKHQWKHIULFWLRQ compensation value FRPSHQVDWLRQPRGHIRUUHDOWLPHDXWRWXQLQJLVYDOLG Parameters which are updated to setup value corresponding to stiffness setup 7KHUHDOWLPHDXWRWXQLQJIXQFWLRQXSGDWHVWKHIROORZLQJEDVLFJDLQVHWXSSDUDPHWHUV DFFRUGLQJWR3U5HDOWLPHDXWRWXQLQJVWLIIQHVVVHWXS Class No. Title 1 00 VWJDLQRISRVLWLRQORRS 1 01 VWJDLQRIYHORFLW\ORRS 1 02 1 04 1 05 1 06 1 07 QGWLPHFRQVWDQWRIYHORFLW\ ORRSLQWHJUDWLRQ 1 09 QGWLPHFRQVWDQWRIWRUTXHÀOWHU Function VWWLPHFRQVWDQWRIYHORFLW\ORRS :KHQVWLIIQHVVVHWXSLVYDOLGXSGDWHVWKH LQWHJUDWLRQ SDUDPHWHUEDVHGRQWKHVHWXSYDOXH VWWLPHFRQVWDQWRIWRUTXHÀOWHU 5HIHUWR3%DVLFJDLQSDUDPHWHUVHWXS QGJDLQRISRVLWLRQORRS table. QGJDLQRIYHORFLW\ORRS 3DUDPHWHUVZKLFKDUHVHWWRIL[HGYDOXH 5HDOWLPHDXWRWXQLQJIXQFWLRQVHWVWKHIROORZLQJSDUDPHWHUVWRWKHÀ[HGYDOXH Class No. Related page 5-6 Title Setup value when fixed parameter setup is valid. 1 03 VWÀOWHURIVSHHGGHWHFWLRQ 1 08 QGÀOWHURIVSHHGGHWHFWLRQ 1 10 9HORFLW\IHHGIRUZDUGJDLQ 1 11 9HORFLW\IHHGIRUZDUGÀOWHU PV 1 12 7RUTXHIHHGIRUZDUGJDLQ 1 13 7RUTXHIHHGIRUZDUGÀOWHU 3´3Uµ3´3Uµ3´3Uµ 0 0 2. Real-Time Auto-Gain Tuning 1 3DUDPHWHUVZKLFKDUHVHWLQUHVSRQVHWRJDLQVZLWFKLQJVHWXS 7KH UHDOWLPH DXWRWXQLQJ IXQFWLRQ VHWV WKH IROORZLQJ SDUDPHWHUV DV WKH JDLQ LV switched. Class No. Title 2 Function 14 2nd gain setup 6HWVWRLIWKHFXUUHQWVHWWLQJLVQRW maintained. 1 15 0RGHRISRVLWLRQFRQWUROVZLWFKLQJ Sets to 10 to enable the gain switching. Sets to 0 to disable the gain switching. 1 16 'HOD\WLPHRISRVLWLRQFRQWURO switching 1 17 /HYHORISRVLWLRQFRQWUROVZLWFKLQJ 1 18 +\VWHUHVLVDWSRVLWLRQFRQWURO switching 1 19 Position gain switching time 1 20 0RGHRIYHORFLW\FRQWUROVZLWFKLQJ 1 21 'HOD\WLPHRIYHORFLW\FRQWURO switching 1 22 /HYHORIYHORFLW\FRQWUROVZLWFKLQJ 1 23 +\VWHUHVLVDWYHORFLW\FRQWURO switching 1 24 0RGHRIWRUTXHFRQWUROVZLWFKLQJ 1 25 'HOD\WLPHRIWRUTXHFRQWUROVZLWFKLQJ 1 26 /HYHORIWRUTXHFRQWUROVZLWFKLQJ 1 27 +\VWHUHVLVDWWRUTXHFRQWUROVZLWFKLQJ Preparation 1 6HWVWRLIWKHFXUUHQWVHWWLQJLVQRW maintained. 3 Connection 6HWVWRLIWKHFXUUHQWVHWWLQJLVQRW maintained. 4 6HWVWRLIWKHFXUUHQWVHWWLQJLVQRW maintained. Setup 3DUDPHWHUVZKLFKDUHDOZD\VVHWWRLQYDOLG 7KH IROORZLQJ VHWWLQJV DUH DOZD\V VHW WR LQYDOLG ZKHQ 3U 5HDOWLPH DXWRWXQLQJ setup is not 0. Title 10 )XQFWLRQH[SDQVLRQVHWXS 6 13 QG,QHUWLDUDWLR 6 23 'LVWXUEDQFHWRUTXH compensating gain 6 24 'LVWXUEDQFHREVHUYHUÀOWHU ,QVWDQWDQHRXV VSHHG REVHUYHU IXQFWLRQ HQDEOH ELW ELW GLVWXUEDQFHREVHUYHUIXQFWLRQHQDEOH ELW ELW DQG LQHUWLD UDWLR VZLWFKLQJ IXQFWLRQ HQDEOHELW ELW DUHLQWHUQDOO\GLVDEOHG 3 D U D P H W H U V H W X S F D Q E H F K D Q J H G E X W GLVWXUEDQFHREVHUYHULVGLVDEOHG 6 When in Trouble 6 Function 5 Adjustment Class No. Before Using the Products Basic 7 Supplement Related page 3´3Uµ3´3Uµ 5-7 2. Real-Time Auto-Gain Tuning Basic Caution ,PPHGLDWHO\DIWHUWKHÀUVWVHUYRRQXSRQVWDUWXSRUDIWHULQFUHDVLQJ3U 5HDOWLPH DXWRWXQLQJ VWLIIQHVV VHWXS DEQRUPDO VRXQG RU RVFLOODWLRQ PD\ EH JHQHUDWHGXQWLOWKHORDGFKDUDFWHULVWLFVHVWLPDWLRQLVVWDELOL]HG,IVXFKDEQRUPDOLW\ODVWVRU UHSHDWVIRURUPRUHUHFLSURFDWLQJRSHUDWLRQVWDNHWKHIROORZLQJFRXQWHUPHDVXUHV /RZHU WKH VHWXS RI 3U 6HOHFWLRQ RI PDFKLQH VWLIIQHVV DW UHDOWLPH DXWRJDLQ WXQLQJ 6HW3U5HDOWLPHDXWRWXQLQJVHWXSWRWRGLVDEOHWKHUHDOWLPHDXWRWXQLQJ 6HW3U,QHUWLDOUDWLRWRWKHFDOFXODWLRQDOYDOXHRIWKHHTXLSPHQWDQGVHW3U 7RUTXH FRPPDQG DGGLWLRQ YDOXH 3U 3RVLWLYH GLUHFWLRQ FRPSHQVDWLRQ YDOXH DQG3U1HJDWLYHGLUHFWLRQFRPSHQVDWLRQYDOXHWR :KHQ DEQRUPDO QRLVH DQG RVFLOODWLRQ RFFXU 3U ,QHUWLD UDWLR RU 3U 7RUTXH FRPPDQG DGGLWLRQDO YDOXH 3U 3RVLWLYH GLUHFWLRQ WRUTXH FRPSHQVDWLRQ YDOXH 3U 1HJDWLYH GLUHFWLRQ WRUTXH FRPSHQVDWLRQ YDOXH PLJKW KDYH FKDQJHG WR H[WUHPHYDOXHV7DNHWKHVDPHPHDVXUHVDVWKHDERYHLQWKHVHFDVHV $PRQJ WKH UHVXOWV RI UHDOWLPH DXWRJDLQ WXQLQJ 3U ,QHUWLD UDWLR DQG 3U 7RUTXH FRPPDQG DGGLWLRQDO YDOXH 3U 3RVLWLYH GLUHFWLRQ WRUTXH FRPSHQVDWLRQ YDOXH 3U 1HJDWLYH GLUHFWLRQ WRUTXH FRPSHQVDWLRQ YDOXH ZLOO EH ZULWWHQ WR ((3520HYHU\PLQXWHV:KHQ\RXWXUQRQWKHSRZHUDJDLQWKHDXWRJDLQWXQLQJZLOO EHH[HFXWHGXVLQJWKHODWHVWGDWDDVLQLWLDOYDOXHV %HFDXVH WKH FRQWURO JDLQ LV XSGDWHG ZKLOH WKH PRWRU VWRSV FKDQJHG VHWWLQJ YDOXH RI 3U ´5HDOWLPH DXWRWXQLQJ VWLIIQHVV VHWXSµ PD\ QRW EH UHÁHFWHG LI WKH PRWRU FDQQRWVWRSGXHWRH[FHVVLYHO\ORZJDLQRUDSSOLFDWLRQRIDFRPPDQGWKDWGLUHFWVWKH PRWRUWRWXUQLQWKHVDPHGLUHFWLRQFRQWLQXRXVO\,IWKHFKDQJHGVWLIIQHVVVHWWLQJYDOXH LVUHÁHFWHGDIWHUPRWRUVWRSVLWPD\JHQHUDWHDEQRUPDOVRXQGRURVFLOODWH $IWHU FKDQJLQJ VWLIIQHVV VWRS WKH PRWRU DQG FKHFN WR VHH WKDW WKH QHZ VWLIIQHVV VHWWLQJLVPDGHHIIHFWLYH Invalidation of Real-Time Auto-Gain Tuning UPLQ@SHU>V@ $GDSWLYHÀOWHU 1 How to Operate (QWHUWKHDFWLRQFRPPDQGZLWK3U$GDSWLYHÀOWHUPRGHVHWWRDYDOXHRWKHUWKDQ ,IWKHUHVRQDQFHSRLQWDIIHFWVWKHPRWRUVSHHGSDUDPHWHUVRIUGQRWFKÀOWHUDQGRUWK QRWFKÀOWHUVDUHDXWRPDWLFDOO\VHWDFFRUGLQJWRWKHQXPEHURIDGDSWLYHÀOWHUV 00 Function 0 >$GDSWLYHÀOWHULQYDOLG@ 7KHDGDSWLYHÀOWHULVGLVDEOHG3DUDPHWHUVUHODWHGWR WKHUGDQGWKQRWFKÀOWHUKROGWKHFXUUHQWYDOXH 1 >$GDSWLYHÀOWHUÀOWHULVYDOLG@ 2QHDGDSWLYHÀOWHULVHQDEOHG3DUDPHWHUVUHODWHG WRWKHUGQRWFKÀOWHUZLOOEHXSGDWHGEDVHGRQ DGDSWLYHSHUIRUPDQFH 2 >$GDSWLYHÀOWHUÀOWHUVDUHYDOLG@ 7ZRDGDSWLYHÀOWHUVDUHHQDEOHG3DUDPHWHUVUHODWHG WRWKHUGDQGWKQRWFKÀOWHUVZLOOEHXSGDWHGEDVHG RQDGDSWLYHSHUIRUPDQFH 3 >5HVRQDQFHIUHTXHQF\PHDVXUHPHQWPRGH@ 0HDVXUHWKHUHVRQDQFHIUHTXHQF\5HVXOWRI PHDVXUHPHQWFDQEHFKHFNHGZLWK3$1$7(50 3DUDPHWHUVUHODWHGWRWKHUGDQGWKQRWFKÀOWHU KROGWKHFXUUHQWYDOXH 4 >&OHDUUHVXOWRIDGDSWDWLRQ@ 3DUDPHWHUVUHODWHGWRWKHUGDQGWKQRWFKÀOWHU DUHGLVDEOHGDQGUHVXOWVRIDGDSWLYHRSHUDWLRQDUH FOHDUHG $GDSWLYHÀOWHU mode setup Title 2 07 UGQRWFKIUHTXHQF\ 2 08 UGQRWFKZLGWKVHOHFWLRQ 2 09 UGQRWFKGHSWKVHOHFWLRQ 10 WKQRWFKIUHTXHQF\ 2 11 4th notch width selection 2 12 4th notch depth selection Function ,QQRUHVRQDQFHSRLQWLVIRXQGWKHIUHTXHQF\LVVHW to 5000. $XWRPDWLFDOO\VHWZKHQWKHDGDSWLYHILOWHULVDFWLYH 1RWFK IUHTXHQF\ LV DXWRPDWLFDOO\ VHW WR WKH QG UHVRQDQFH IUHTXHQF\ HVWLPDWHG E\ WKH DGDSWLYH ÀOWHU ,QQRUHVRQDQFHSRLQWLVIRXQGWKHIUHTXHQF\LVVHW to 5000. 5 6 When in Trouble 2 4 Adjustment $WWKHVDPHWLPHWKHIROORZLQJSDUDPHWHUVDUHDXWRPDWLFDOO\VHW Class No. 3 Setup Setup value Connection 2 Title 2 Preparation 6HWWKHRSHUDWLRQRIWKHDGDSWLYHÀOWHUWRWKHIROORZLQJSDUDPHWHU Class No. Before Using the Products Adaptive filter $XWRPDWLFDOO\VHWZKHQDGDSWLYHILOWHUVDUHDFWLYH 7 Supplement Related page 3´'HWDLOVRISDUDPHWHUµ 5-11 $GDSWLYHÀOWHU Adaptive filter Caution ,PPHGLDWHO\DIWHUWKHÀUVWVHUYRRQDWVWDUWXSRUDIWHULQFUHDVLQJVWLIIQHVVVHWWLQJZLWK WKH UHDOWLPH DXWRWXQLQJ HQDEOHG DEQRUPDO VRXQG RU RVFLOODWLRQ PD\ EH JHQHUDWHG XQWLOWKHDGDSWLYHÀOWHUVWDELOL]HV,IVXFKDEQRUPDOLW\ODVWVRUUHSHDWVIRURUPRUHUHFLSURFDWLQJRSHUDWLRQVWDNHWKHIROORZLQJFRXQWHUPHDVXUHV :ULWHWKHSDUDPHWHUVZKLFKKDYHJLYHQWKHQRUPDORSHUDWLRQLQWR((3520 /RZHU WKH VHWXS RI 3U 6HOHFWLRQ RI PDFKLQH VWLIIQHVV DW UHDOWLPH DXWRJDLQ WXQLQJ ,QYDOLGDWHWKHDGDSWLYHÀOWHUE\VHWWLQJXS3U 6HWXSRIDGDSWLYHÀOWHUPRGH WR 5HVHWRILQHUWLDFDOFXODWLRQDQGDGDSWLYHDFWLRQ 6HWXSWKHQRWFKÀOWHUPDQXDOO\ $EQRUPDOVRXQGRURVFLOODWLRQPD\H[FHVVLYHO\FKDQJHWKHVHWXSYDOXHRIUGDQGWK QRWFKÀOWHUV,IVXFKFKDQJHRFFXUVGLVDEOHWKHDGDSWLYHÀOWHUDVGHVFULEHGLQVWHS DERYHFKDQJHVHWXSYDOXHRI3UUGQRWFKIUHTXHQF\DQG3UWKQRWFKIUHTXHQF\WR GLVDEOH DQGWKHQHQDEOHWKHDGDSWLYHÀOWHUDJDLQ 7KHUGÀOWHUV 3U3U DQGWKQRWFKÀOWHUV 3U3U DUHZULWWHQWR((3520HYHU\PLQXWHV8SRQSRZHUXSWKHVHGDWDDUHXVHGDVGHIDXOWYDOXHVGXULQJDGDSWLYHSURFHVV Related page 5-12 3´'HWDLOVRISDUDPHWHUµ 4. Manual Gain Tuning (Basic) Adjustment Outline 1 $V H[SODLQHG SUHYLRXVO\ 0,1$6$ VHULHV IHDWXUHV WKH DXWRPDWLF JDLQ WXQLQJ IXQFWLRQ KRZHYHUWKHUHPLJKWEHVRPHFDVHVZKHUHWKLVDXWRPDWLFJDLQWXQLQJFDQQRWEHDGMXVWHGSURSHUO\GHSHQGLQJRQWKHOLPLWDWLRQRQORDGFRQGLWLRQV2U\RXPLJKWQHHGWRUHDGMXVW WKHWXQLQJWRREWDLQWKHRSWLPXPUHVSRQVHRUVWDELOLW\FRUUHVSRQGLQJWRHDFKORDG +HUHZHH[SODLQWKLVPDQXDOJDLQWXQLQJPHWKRGE\HDFKFRQWUROPRGHDQGIXQFWLRQ 3 Connection %\PRQLWRULQJZDYHIRUPVXVLQJWKHZDYHIRUPJUDSKLFIXQFWLRQRIWKHVHWXSVXSSRUWVRIWZDUH3$1$7(50LQVWDOOHGRQWKH3&RUE\PHDVXULQJWKHDQDORJYROWDJHZDYHIRUPZLWK WKHKHOSRIWKHPRQLWRUIXQFWLRQDFFXUDWHDGMXVWPHQWFDQEHSRVLWLYHO\TXLFNO\DQGHDVLO\ GRQHZKHQFRPSDUHGZLWKWKDWSHUIRUPHGRQWKHIURQWSDQHO 1. Analog monitor output 6SHHGOLPLWYDOXH@ 3U>6SHHGOLPLWYDOXH@RU63/LQSXWDVDVSHHGOLPLW+HUHZHH[SODLQWKHVHWXSRI speed limiting value. The torque command selection (Pr3.17) specifies the setup method. Pr3.17 = 0 Set up by using speed limit value 1 (Pr3.21) 5 Pr3.17 = 1 Set up by using analog input (SPL) Pr3.17 = 2 For positive direction, set up by using the speed limit value 1 Adjustment (Pr3.21) For negative direction, set up by using the speed limit value 2 (Pr3.22) Related page 7 Supplement Note 6 When in Trouble :KHQWKHPRWRUVSHHGDSSURDFKHVWRWKHVSHHGOLPLWLQJYDOXHWRUTXHFRQWUROIROORZLQJWKHDQDORJWRUTXHFRPPDQGVKLIWVWRYHORFLW\FRQWUROEDVHGRQWKHVSHHGOLPLWLQJ value. ,QRUGHUWRVWDELOL]HWKHPRYHPHQWXQGHUWKHVSHHGOLPLWLQJ\RXDUHUHTXLUHGWRVHW XSWKHSDUDPHWHUVDFFRUGLQJWRWKHDERYHPHQWLRQHG$GMXVWPHQWLQ9HORFLW\&RQWURO 0RGH :KHQWKHVSHHGOLPLWLQJYDOXHLVWRRORZRUWKHYHORFLW\ORRSJDLQLVWRRORZRUZKHQ WKH WLPH FRQVWDQW RI WKH YHORFLW\ ORRS LQWHJUDWLRQ LV LQYDOLG WKH LQSXW WRWKH WRUTXHOLPLWLQJSRUWLRQRIWKHDERYHÀJEHFRPHVVPDOODQGWKHRXWSXWWRUTXHPD\QRW EHJHQHUDWHGDVWKHDQDORJWRUTXHFRPPDQG 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXW 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 5-15 5 4. Manual Gain Tuning (Basic) Adjustment Adjustment in Full-Closed Control Mode )XOOFORVHG FRQWURO RI 0,1$6$ VHULHV LV GHVFULEHG LQ %ORFN GLDJUDP RI 3 RI )XOO &ORVHG&RQWURO $GMXVWPHQW LQ IXOOFORVHG FRQWURO LV DOPRVW VDPH DV WKDW LQ SRVLWLRQ FRQWURO GHVFULEHG LQ 3´$GMXVWPHQWLQ3RVLWLRQ&RQWURO0RGHµDQGPDNHDGMXVWPHQWVRISDUDPHWHUVSHU WKHSURFHGXUHVH[FHSWFDXWLRQVRI3´2XWOLQHRI)XOO&ORVHG&RQWUROµ GLIIHUHQFHRI FRPPDQGXQLWDQGGLIIHUHQFHRIHOHFWURQLFJHDU +HUH ZH H[SODLQ WKH VHWXS RI IHHGEDFN VFDOH UDWLR DQG K\EULG GHYLDWLRQ H[FHVV RI IXOO FORVHGFRQWURO 1) Setup of external scale ratio Setup the external scale ratio using the numerator of external scale division (Pr3.24) and denominator of external scale division (Pr3.25). &KHFNWKHHQFRGHUIHHGEDFNSXOVHFRXQWVSHURQHPRWRUUHYROXWLRQDQGWKHH[WHUQDO VFDOHSXOVHFRXQWVSHURQHPRWRUUHYROXWLRQWKHQVHWXSWKHQXPHUDWRURIH[WHUQDO VFDOH GLYLVLRQ 3U DQG GHQRPLQDWRU RI H[WHUQDO VFDOH GLYLVLRQ 3U VR WKDW WKHIROORZLQJIRUPXODFDQEHHVWDEOLVKHG Number of encoder feedback pulses per motor rotation Number of external scale pulses per motor rotation Pr3.25 ,IWKLVUDWLRLVLQFRUUHFWDJDSEHWZHHQWKHSRVLWLRQFDOFXODWHGIURPWKHHQFRGHUIHHGEDFNSXOVHFRXQWVDQGWKDWRIFDOFXODWHGIURPWKHH[WHUQDOVFDOHSXOVHFRXQWVZLOOEH HQODUJHG DQG K\EULG GHYLDWLRQ H[FHVV (UU ZLOO EH WULJJHUHG ZKHQ WKH ZRUN RU ORDGWUDYHOVDORQJGLVWDQFH :KHQ\RXVHWXS3UWRWKHHQFRGHUIHHGEDFNSXOVHFRXQWVZLOOEHDXWRPDWLcally set up. Pr3.24 = 2) Setup of hybrid deviation excess Set up the minimum value of hybrid deviation excess (Pr3.28) within the range where the gap between the motor (encoder) position and the load (feedback scale) position will be considered to be an excess. 1RWHWKDWWKHK\EULGGHYLDWLRQH[FHVV (UU PD\EHJHQHUDWHGXQGHURWKHUFRQGLWLRQVWKDQWKHDERYH VXFKDVUHYHUVHGFRQQHFWLRQRIWKHH[WHUQDOVFDOHRUORRVH FRQQHFWLRQRIWKHPRWRUDQGWKHORDG Caution (QWHUWKHFRPPDQGSXOVHVEDVHGRQWKHIHHGEDFNVFDOHUHIHUHQFH 7KHIHHGEDFNVFDOHVWRXVHGIRUIXOOFORVHGFRQWURODUHDVIROORZV :KHQ$DQG%SKDVHSDUDOOHORUVHULDOVFDOH $%667$67$/$7$VHULHVE\0LWVXWR\R&RUS 65656/6/E\0DJQHVFDOH&R/WG 7RSUHYHQWWKHUXQDZD\DQGGDPDJHRIWKHPDFKLQHGXHWRWKHVHWXSRIWKHIHHGEDFN VFDOHVHWXSWKHK\EULGGHYLDWLRQH[FHVV 3U WRWKHDSSURSULDWHYDOXHLQWKHXQLW RIIHHGEDFNVFDOHUHVROXWLRQ Note Related page 5-16 We recommend the external scale as 1/40 external scale ratio 160. (YHQZLWKLQWKLVUDQJHLI\RXVHWXSWKHH[WHUQDOVFDOHUDWLRWRVPDOOHUYDOXHWKDQSRVLWLRQORRSJDLQ 3UDQG \RXPD\QRWEHDEOHWRFRQWUROE\RQHSXOVHXQLW,I \RXVHWXSWRRODUJHH[WHUQDOVFDOHUDWLR\RXPD\H[SHFWODUJHUQRLVHLQPRYHPHQW 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; )RUH[WHUQDOVFDOHFRQQHFWRU 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ3´3URWHFWLYH)XQFWLRQµ 4. Manual Gain Tuning (Basic) Adjustment Gain Switching Function 1 Action Command speed Status Gain Stop (Servo-Lock) Low gain (1st gain) Run High gain (2nd gain) Stop (Servo-Lock) Time Low gain (1st gain) 3 )ROORZLQJLVWKHH[DPSOHZKHQ\RXZDQWWRUHGXFHWKHQRLVHDWPRWRULQVWDOO 6HUYR/RFN E\VHWWLQJXSWRORZHUJDLQDIWHUWKHPRWRUVWRSV 0DNHDGMXVWPHQWUHIHUULQJWRWKHEDVLFJDLQSDUDPHWHUVHWXSWDEOH 3 DVZHOO Parameter No. (Pr ) 1.01 1.02 1.03 1.04 1.10 1.11 1.06 1.07 1.08 1.09 1.14 1.15 1.16 1.18 1.19 0.04 630 350 270 160 0 65 84 5 300 50 630 350 160 0 65 0 1 6 7 30 0 0 0 (QWHUWKHNQRZQ value from load calculation 0HDVXUHWKH inertia ratio by executing nor mal auto-gain tuning 'HIDXOWLV 7 Supplement Related page Inertia ration 4 When in Trouble 1.17 Adjust Pr1.01 and 1.04 at stopping (1st gain) Adjustment 1.05 1st gain of position loop 1st gain of velocity loop 1st time constant of velocity integration 1st filter of velocity detection 1st time constant of torque filter Velocity feed forward Filter of velocity feed forward 2nd gain of position loop 2nd gain of velocity loop 2nd time constant of velocity integration 2nd filter of velocity detection 2nd time constant of torque filter time Action setup of 2nd gain 1st mode of control switching 1st delay time of control switching 1st level of control switching 1st hysteresis of control switching Switching time of position gain Set up Pr1.14 to 1.19 (Gain switching condition) Setup 1.00 Title of parameter Set up the same value as Pr1.05 to 1.09 (2nd gain) to Pr1.00 to 1.04 (1st gain) Connection 1ms 2ms Suppress the vibration by lowering the gain. Execute manual gain-tuning without gain switching 2 Preparation %\VHOHFWLQJDSSURSULDWHJDLQEDVHGRQLQWHUQDOGDWDRUH[WHUQDOVLJQDOWKHIROORZLQJHIIHFWVFDQEHREWDLQHG 'HFUHDVHWKHJDLQDWWKHWLPHRIVWRSSDJH VHUYRORFN WRUHGXFHYLEUDWLRQ ,QFUHDVHWKHJDLQDWWKHWLPHRIVWRSSDJH VHWWLQJ WRVKRUWHQWKHVHWWOLQJWLPH ,QFUHDVHWKHJDLQGXULQJRSHUDWLRQWRLPSURYHFRPPDQGFRPSOLDQFH %DVHGRQFRQGLWLRQRIWKHHTXLSPHQWFKDQJHWKHJDLQZLWKH[WHUQDOVLJQDO Before Using the Products 5 3´'HWDLOVRISDUDPHWHUµ 5-17 4. Manual Gain Tuning (Basic) Gain Switching Function Setup of Gain Switching Condition 3RVLWLQJFRQWUROPRGH)XOOFORVHGFRQWUROPRGH Setup parameters at position control, full-closed control Setup of gain switching condition Pr1.15 0 Switching condition to 2nd gain : Corresponding parameter is valid, – : invalid) Fig. )L[HGWRVWJDLQ Delay time *1 Level Hysteresis *2 Pr1.16 Pr1.17 Pr1.18 – – – 1 )L[HGWRQGJDLQ – – – 2 Gain switching input – – – 3 7RUTXHFRPPDQG >@ >@ 4 Invalid )L[HGWRVWJDLQ – – 5 Speed command C >UPLQ@ >UPLQ@ 6 Position deviation D *3 *3 A – >SXOVH@ >SXOVH@ 7 3RVLWLRQFRPPDQGH[LVWV E – – 8 1RWLQSRVLWLRQLQJFRPSOHWH F – – 9 Speed C >UPLQ@ >UPLQ@ 10 &RPPDQGH[LVWVYHORFLW\ G >UPLQ@ *5 >UPLQ@ *5 9HORFLW\FRQWUROPRGH Setup parameters at velocity control mode Setup of gain switching condition Pr1.20 0 Switching condition to 2nd gain Fig. )L[HGWRVWJDLQ Delay time *1 Level Hysteresis *2 Pr1.16, 1.21 Pr1.17, 1.22 Pr1.18, 1.23 – – – 1 )L[HGWRQGJDLQ – – – 2 Gain switching input – – – 3 7RUTXHFRPPDQG A >@ >@ 4 9DULDWLRQRIVSHHGFRPPDQGLV ODUJH B *4 *4 5 Speed command C >UPLQ@ >UPLQ@ > UPLQ V@ – > UPLQ V@ 7RUTXHFRQWUROPRGH Setup parameters at torque control mode Setup of gain switching condition Pr1.24 Switching condition to 2nd gain Fig. Delay time *1 Level Hysteresis *2 Pr1.18, 1.27 Pr1.16, 1.25 Pr1.17, 1.26 0 )L[HGWRVWJDLQ – – – 1 )L[HGWRQGJDLQ – – – 2 *DLQVZLWFKLQJLQSXW*$,121 – – – 3 9DULDWLRQRIWRUTXHFRPPDQGLV ODUJH >@ >@ A *'HOD\WLPH 3UDQG ZLOOEHYDOLGRQO\ZKHQUHWXUQLQJIURPQGWRVW gain. *+\VWHUHVLV 3UDQG LVGHÀQHGDVWKHÀJEHORZVKRZV *'HVLJQDWHZLWKHLWKHUWKHHQFRGHUUHVROXWLRQRUWKHH[WHUQDOVFDOHUHVROXWLRQGHSHQGLQJRQWKHFRQWUROPRGH Hysteresis H *:KHQ\RXPDNHLWDFRQGLWLRQWKDWWKHUH (Pr1.18, 1.23, 1.27) LV VSHHG YDULDWLRQ RI UPLQ LQ V VHW Level up the value to 1. L Pr1.17 Pr1.22 *:KHQ 3U WKH PHDQLQJV RI GHPr1.26 0 OD\WLPHOHYHODQGK\VWHUHVLVDUHGLIIHUHQWIURPWKHQRUPDO UHIHUWR)LJ* ( 5-18 ) 4. Manual Gain Tuning (Basic) 1 Fig.A speed N Fig. B command speed S 2 уS level switching level Preparation level switching level delay 1st 1st gain 2nd 2nd 1st 1st Before Using the Products Gain Switching Function 1st gain 2nd 2nd 1st 3 Fig. C motor speed or commanded speed S level Fig. D delay 1st 2nd gain Connection speed N deviation pulse 1st level 4 delay 1st 2nd gain Fig. F Setup Fig. E 1st speed N command speed S 5 delay 1st 2nd gain 1st Adjustment COIN delay 1st 2nd gain 1st Fig. G at stall 1st gain no command pulse × Pr1.16,delay time in action 2nd gain | actual speed | < Pr1.17 level at settling proximity of stall 2nd gain 2nd gain for velocity integrating only and 1st gain for others 6 When in Trouble command pulse exists. | actual speed | < (Pr1.17 level - Pr1.18 hysteresis) 7 | actual speed | < (Pr1.17 level - Pr1.178 hysteresis) $ERYH)LJGRHVQRWUHÁHFWDWLPLQJODJRIJDLQVZLWFKLQJGXHWRK\VWHUHVLV 3UDQG 5-19 Supplement Caution 5 4. Manual Gain Tuning (Basic) Adjustment Suppression of Machine Resonance ,QFDVHRIDORZPDFKLQHVWLIIQHVV\RXFDQQRWVHWXSDKLJKHUJDLQEHFDXVHYLEUDWLRQDQG QRLVHRFFXUGXHWRRVFLOODWLRQFDXVHGE\D[LVGLVWRUWLRQRURWKHUFDXVHV%\VXSSUHVVLQJ WKHUHVRQDQFHSHDNDWWKHQRWFKÀOWHUKLJKHUJDLQFDQEHREWDLQHGRUWKHOHYHORIYLEUDWLRQFDQEHORZHUHG 7RUTXHFRPPDQGÀOWHU 3UDQG3U 6HWVXSWKHÀOWHUWLPHFRQVWDQWVRDVWRGDPSWKHIUHTXHQF\DWYLFLQLW\RIUHVRQDQFH IUHTXHQF\ G%@ ï5 ï10 ï15 ï20 ï25 ï30 10 100 Frequency [Hz] 5-22 1000 4. Manual Gain Tuning (Basic) 1 How to Check the Resonance Frequency of the Machine Note 3 Connection Remarks 2 Preparation 6WDUWXSWKH6HWXS6XSSRUW6RIWZDUH3$1$7(50DQGEULQJWKHIUHTXHQF\FKDUDFWHULVWLFVPHDVXUHPHQWVFUHHQ 6HWXSWKHSDUDPHWHUVDQGPHDVXUHPHQWFRQGLWLRQV )ROORZLQJYDOXHVDUHVWDQGDUG 6HWXS3U VWJDLQRIYHORFLW\ORRS WRRUVR WRORZHUWKHJDLQDQGPDNHLW HDV\WRLGHQWLI\WKHUHVRQDQFHIUHTXHQF\ 6HWXSWKHDPSOLWXGHWR UPLQ RUVR QRWWRVDWXUDWHWKHWRUTXH 0DNHWKHRIIVHWWR UPLQ RUVR WRLQFUHDVHWKHVSHHGGHWHFWLQJGDWDDQGWR DYRLGWKHPHDVXUHPHQWHUURULQWKHYLFLQLW\RIVSHHG]HUR 3RODULW\LVPDGHSRVLWLYHGLUHFWLRQZLWKDQGQHJDWLYHGLUHFWLRQZLWK² 6HWXSWKHVDPSOLQJUDWHWR VHWXSUDQJHWREHWR ([HFXWHWKHIUHTXHQF\FKDUDFWHULVWLFDQDO\VLV Before Using the Products Suppression of Machine Resonance 4 :KHQ\RXVHWDODUJHUYDOXHRIRIIVHWWKDQWKHDPSOLWXGHVHWXSDQGPDNHWKHPRWRUUXQ WRWKHRQHGLUHFWLRQDWDOOWLPH\RXFDQREWDLQDEHWWHUPHDVXUHPHQWUHVXOW 6HWXSDVPDOOHUVDPSOLQJUDWHZKHQ\RXPHDVXUHDKLJKIUHTXHQF\EDQGDQGDODUJHU VDPSOLQJUDWHZKHQ\RXPHDVXUHDORZIUHTXHQF\EDQGLQRUGHUWRREWDLQDEHWWHUPHDVXUHPHQWUHVXOW :KHQ\RXVHWDODUJHUDPSOLWXGH\RXFDQREWDLQDEHWWHUPHDVXUHPHQWUHVXOWEXW QRLVHZLOOEHODUJHU6WDUWDPHDVXUHPHQWIURP>UPLQ@DQGJUDGXDOO\LQFUHDVHLW 5 6 When in Trouble ,QRUGHUWRHQKDQFHWKHPDFKLQHVWLIIQHVV ,QVWDOOWKHEDVHRIWKHPDFKLQHÀUPO\DQGDVVHPEOHWKHPZLWKRXWORRVHQHVV 8VHDFRXSOLQJGHVLJQHGH[FOXVLYHO\IRUVHUYRDSSOLFDWLRQZLWKKLJKVWLIIQHVV 8VHDZLGHUWLPLQJEHOW%HOWWHQVLRQWREHZLWKLQWKHSHUPLVVLEOHORDGWRWKHPRWRU VKDIW 8VHDJHDUUHGXFHUZLWKVPDOOEDFNODVK ,QKHUHQWYLEUDWLRQ UHVRQDQFHIUHTXHQF\ RIWKHPDFKLQHV\VWHPKDVDODUJHHIIHFW WRWKHJDLQDGMXVWPHQWRIWKHVHUYR +]@ 33´'HWDLOVRISDUDPHWHUµ3´2XWOLQHRI6HWXSVXSSRUWVRIWZDUH´3$1$7(50µ 5. Manual Gain Tuning (Application) 1 How to Use 4 Setup Caution 3 Connection (2) Setup of damping filter (1st: Pr2.15, 2nd: Pr2.17, 3rd: Pr2.19, 4th: Pr2.21)) )LUVWVHWXS XQLWRIFRPPDQG@ FRPPDQGVSHHG>XQLWRIFRPPDQGV@ SRVLWLRQDOORRSJDLQ>V@ð YHORFLW\IHHGIRUZDUGJDLQ>@ Positional deviation Velocity feed forward gain 0[%] Motor speed Command speed Positional deviation within the constant speed range will reduce as the velocity forward gain is increased. 50[%] 80[%] Time 5-26 5. Manual Gain Tuning (Application) 1 :LWKWKHJDLQVHWDWFDOFXODWRU\SRVLWLRQDOGHYLDWLRQLVEXWVLJQLÀFDQWRYHUVKRRW RFFXUVGXULQJDFFHOHUDWLRQGHFHOHUDWLRQ ,I WKH XSGDWLQJ F\FOH RI WKH SRVLWLRQDO FRPPDQG LQSXW LV ORQJHU WKDQ WKH GULYHU FRQWURO F\FOHRUWKHSXOVHIUHTXHQF\YDULHVWKHRSHUDWLQJQRLVHPD\LQFUHDVHZKLOHWKHYHORFLW\ IHHGIRUZDUGLVDFWLYH,IWKLVLVWKHFDVHXVHSRVLWLRQDOFRPPDQGÀOWHU VWGHOD\RU),5 VPRRWKLQJ RULQFUHDVHWKHYHORFLW\IRUZDUGÀOWHUVHWXSYDOXH Velocity feed forward gain = Fixed 100[%] Torque feed forward gain 0[%] Time 4 Positional deviation in the region where acceleration is constant can be reduced by torque feed forward. Setup 50[%] 3 Connection 7RXVHWKHWRUTXHIHHGIRUZDUGFRUUHFWO\VHWWKHLQHUWLDUDWLR 8VHWKHYDOXHWKDWZDVGHWHUPLQHGDWWKHVWDUWRIWKHUHDOWLPHDXWRWXQLQJRUVHWWKH LQHUWLDUDWLRWKDWFDQEHFDOFXODWHGIURPWKHPDFKLQHVSHFLÀFDWLRQWR3U,QHUWLDUDWLR 7KH WRUTXH IHHG IRUZDUG ZLOO EHFRPH HIIHFWLYH DV WKH WRUTXH IHHG IRUZDUG JDLQ LV JUDGXDOO\LQFUHDVHGZLWKWKHWRUTXHIHHGIRUZDUGÀOWHULVVHWDWDSSUR[ PV 3RVLWLRQDO GHYLDWLRQ DW D FRQVWDQW DFFHOHUDWLRQGHFHOHUDWLRQ FDQ EH PLQLPL]HG FORVH WR E\ LQFUHDVLQJ WKH WRUTXH IRUZDUG JDLQ7KLV PHDQV WKDW SRVLWLRQDO GHYLDWLRQ FDQ EHPDLQWDLQHGDWQHDURYHUHQWLUHRSHUDWLRQUDQJHZKLOHGULYLQJLQWUDSH]RLGDOVSHHG SDWWHUQXQGHULGHDOFRQGLWLRQZKHUHGLVWXUEDQFHWRUTXHLVQRWDFWLYH Positional deviation Command speed 2 Preparation Usage example of torque feed forward Motor speed Before Using the Products Feed forward function 100[%] =HURSRVLWLRQDOGHYLDWLRQLVLPSRVVLEOHLQDFWXDOVLWXDWLRQEHFDXVHRIGLVWXUEDQFHWRUTXH $VZLWKWKHYHORFLW\IHHGIRUZDUGODUJHWRUTXHIHHGIRUZDUGÀOWHUWLPHFRQVWDQWGHFUHDVHV WKHRSHUDWLQJQRLVHEXWLQFUHDVHVSRVLWLRQDOGHYLDWLRQDWDFFHOHUDWLRQFKDQJHSRLQW 7 Supplement 7RUTXHFRPPDQG ðLQSXWYROWDJH 9 3UVHWXSYDOXHð Related page 6 When in Trouble 6HWWLQJELWSODFHRI3U)XQFWLRQH[SDQVLRQVHWXSWR Torque command [%] HQDEOHVWKHDQDORJWRUTXHIHHGIRUZDUG:KHQWKHDQDORJ 333 LQSXW LV XVHG E\ DQRWKHU IXQFWLRQ HJ DQDORJ WRUTXH 200 OLPLW WKHIXQFWLRQEHFRPHVLQYDOLG 7KHYROWDJH 9 DSSOLHGWRWKHDQDORJLQSXWLVFRQYHUWHG ï6 ï10 WRWKHWRUTXHYLD3U$QDORJWRUTXHIHHGIRUZDUG 6 10 Input voltage FRQYHUVLRQJDLQVHWXSDQGDGGHGWRWKHWRUTXHFRPPDQG [V] LQ&&:GLUHFWLRQLILWLVSRVLWLYHYROWDJHRULQ&: ï200 GLUHFWLRQLIQHJDWLYH ï333 7KHYROWDJH 9 DSSOLHGWRWKHDQDORJLQSXWLVFRQYHUWHG WRWKHPRWRUWRUTXHFRPPDQG WKURXJKWKHSURFHVVDV VKRZQLQWKHJUDSKEHORZ 7KHVORSHUHSUHVHQWVZKHQ3U 7KHVORSHFKDQJHVDVWKHVHWXSYDOXHFKDQJHV Adjustment Usage example of analog torque feed forward 5 3´'HWDLOVRISDUDPHWHUµ 5-27 5 5. Manual Gain Tuning (Application) Adjustment Instantaneous Speed Observer Outline 7KLVIXQFWLRQHQDEOHVERWKUHDOL]DWLRQRIKLJKUHVSRQVHDQGUHGXFWLRQRIYLEUDWLRQDWVWRSSLQJE\HVWLPDWLQJWKHPRWRUVSHHGXVLQJDORDGPRGHOKHQFHLPSURYLQJWKHDFFXUDF\ RIWKHVSHHGGHWHFWLRQ Velocity command Velocity control Estimated velocity value Torque command Current control Motor current Motor Load Instantaneous speed observer Load model Position control (Total inertia) Motor position Encoder Servo driver Applicable Range 7KLVIXQFWLRQFDQEHDSSOLFDEOHRQO\ZKHQWKHIROORZLQJFRQGLWLRQVDUHVDWLVÀHG Conditions under which the instantaneous speed observer is activated &RQWUROPRGHWREHHLWKHURUERWKSRVLWLRQFRQWURORUDQGYHORFLW\FRQWURO Control mode 3U 3RVLWLRQFRQWURO 3U 9HORFLW\FRQWURO Others 6KRXOGEHLQVHUYRRQFRQGLWLRQ ,QSXW VLJQDOV VXFK DV WKH GHYLDWLRQ FRXQWHU FOHDU DQG FRPPDQG LQSXW LQKLELWDQGSDUDPHWHUVH[FHSWIRUFRQWUROVVXFKDVWRUTXHOLPLWVHWXSDUH FRUUHFWO\VHWDVVXULQJWKDWWKHPRWRUFDQUXQVPRRWKO\ 5HDOWLPHDXWRWXQLQJVKRXOGEHGLVDEOHG 3U Caution 7KLVIXQFWLRQGRHVQRWZRUNSURSHUO\RUQRHIIHFWLVREWDLQHGXQGHUWKHIROORZLQJFRQGLtions. Conditions which obstruct instantaneous speed observer action Load Others Related page 5-28 *DSEHWZHHQWKHHVWLPDWHGWRWDOORDGLQHUWLD PRWRUORDG DQGDFWXDO PDFKLQHLVODUJH HJ /DUJHUHVRQDQFHSRLQWH[LVWVLQIUHTXHQF\EDQGRI>+]@RU EHORZ1RQOLQHDUIDFWRUVXFKDVODUJHEDFNODVKH[LVWV /RDGLQHUWLDYDULHV 'LVWXUEDQFHWRUTXHZLWKKDUPRQLFFRPSRQHQWLVDSSOLHG 6HWWOLQJUDQJHLVYHU\VPDOO 33´'HWDLOVRISDUDPHWHUµ 5. Manual Gain Tuning (Application) 1 Before Using the Products Instantaneous Speed Observer Related Parameter Class No. 6 10 Title )XQFWLRQH[SDQVLRQ setup Function 2 Preparation 6SHHGREVHUYHUHQDEOHELW ELW YDOLGLQYDOLGWKH IXQFWLRQ ELW,QYDOLG9DOLG *ELW /6% How to Use (1) Setup of inertia ratio (Pr0.04) 3 :KHQWKHLQHUWLDUDWLR 3U LVDOUHDG\REWDLQHGWKURXJKUHDOWLPHDXWRJDLQWXQLQJ DQG LV DSSOLFDEOH DW QRUPDO SRVLWLRQ FRQWURO XVH WKLV YDOXH DV 3U VHWXS value. :KHQ WKH LQHUWLD UDWLR LV DOUHDG\ NQRZQ WKURXJK FDOFXODWLRQ HQWHU WKLV FDOFXODWHG value. :KHQWKHLQHUWLDUDWLRLVQRWNQRZQH[HFXWHWKHQRUPDOPRGHDXWRJDLQWXQLQJDQG PHDVXUHWKHLQHUWLDUDWLR 4 5 Adjustment (3) Setup of instantaneous velocity observer (Pr6.10) %\ HQDEOLQJ LQVWDQWDQHRXV VSHHG REVHUYHU IXQFWLRQ WKURXJK IXQFWLRQ H[SDQVLRQ VHWXS 3U WKH VSHHG GHWHFWLRQ PHWKRG FKDQJHV WR WKH LQVWDQWDQHRXV VSHHG REVHUYHU :KHQ\RXH[SHULHQFHDODUJHYDULDWLRQRIWKHWRUTXHZDYHIRUPRUQRLVHUHWXUQWKLV WRDQGUHFRQÀUPWKHDERYHFDXWLRQVDQG :KHQ\RXREWDLQWKHHIIHFWVXFKDVDUHGXFWLRQRIWKHYDULDWLRQRIWKHWRUTXHZDYHIRUP DQG QRLVH VHDUFK DQ RSWLPXP VHWXS E\ PDNLQJ D ÀQH DGMXVWPHQW RI 3U ,QHUWLD UDWLR ZKLOH REVHUYLQJ WKH SRVLWLRQ GHYLDWLRQ ZDYHIRUP DQG DFWXDO VSHHG ZDYHIRUP WR obtain WKH OHDVW YDULDWLRQ ,I \RX FKDQJH WKH SRVLWLRQ ORRS JDLQ DQG YHORFLW\ORRSJDLQWKHRSWLPXPYDOXHRIWKHLQHUWLDUDWLR 3U PLJKWKDYHEHHQ FKDQJHGDQG\RXQHHGWRPDNHDÀQHDGMXVWPHQWDJDLQ Setup (2) Adjustment at normal position control $GMXVWWKHSRVLWLRQORRSJDLQYHORFLW\ORRSJDLQHWF Connection Set up as exact inertia ratio as possible. 6 When in Trouble 7 Supplement 5-29 5 5. Manual Gain Tuning (Application) Adjustment Disturbance observer Outline 7KLVIXQFWLRQXVHVWKHGLVWXUEDQFHWRUTXHGHWHUPLQHGE\WKHGLVWXUEDQFHREVHUYHUWRUHGXFHHIIHFWRIGLVWXUEDQFHWRUTXHDQGYLEUDWLRQ Disturbance torque – Torque command + Added in the direction to cancel the disturbance + Motor + load + Torque command – + Motor speed Load model Gain Set in Pr6.23 Filter Set in Pr6.24 Disturbance observer Estimated disturbance torque value Applicable Range 7KLVIXQFWLRQFDQEHDSSOLFDEOHRQO\ZKHQWKHIROORZLQJFRQGLWLRQVDUHVDWLVÀHG Conditions under which the disturbance observer is activated &RQWUROPRGHWREHHLWKHURUERWKSRVLWLRQFRQWURORUDQGYHORFLW\FRQWURO Control mode 3U 3RVLWLRQFRQWURO 3U 9HORFLW\FRQWURO Others 6KRXOGEHLQVHUYRRQFRQGLWLRQ ,QSXW VLJQDOV VXFK DV WKH GHYLDWLRQ FRXQWHU FOHDU DQG FRPPDQG LQSXW LQKLELWDQGSDUDPHWHUVH[FHSWIRUFRQWUROVVXFKDVWRUTXHOLPLWVHWXSDUH FRUUHFWO\VHWDVVXULQJWKDWWKHPRWRUFDQUXQVPRRWKO\ 5HDOWLPHDXWRWXQLQJVKRXOGEHGLVDEOHG 3U ,QVWDQWDQHRXVVSHHGREVHUYHUVKRXOGEHGLVDEOHG 3UELW Caution (IIHFWPD\QRWEHH[SHFWHGLQWKHIROORZLQJFRQGLWLRQ Conditions which obstruct disturbance observer action Load Related page 5-30 5HVRQDQW IUHTXHQF\ LV ORZHU WKDQ WKH FXWRII IUHTXHQF\ HVWLPDWHG E\ WKH GLVWXUEDQFHREVHUYHU 'LVWXUEDQFHWRUTXHFRQWDLQVPDQ\KLJKIUHTXHQF\FRPSRQHQWV 33´'HWDLOVRISDUDPHWHUµ 5. Manual Gain Tuning (Application) 1 Before Using the Products Disturbance observer Related Parameter Class No. 10 Function Function H[SDQVLRQVHWXS 6HWVELWVUHODWHGWRGLVWXUEDQFHREVHUYHU ELW ,QYDOLG 9DOLG ELW $OZD\VYDOLG alid only when 1st gain is selected. *ELW /6% ([DPSOH 7RXVHWKHGLVWXUEDQFHREVHUYHULQWKHHQDEOHGPRGHRQO\ ZKHQVWJDLQLVVHOHFWHG 6HWXSYDOXH 7RXVHWKHGLVWXUEDQFHREVHUYHUDOZD\VLQWKHHQDEOHG PRGH 6HWXSYDOXH 23 6 24 'LVWXUEDQFH REVHUYHUÀOWHU 3 Connection 6 'LVWXUEDQFH WRUTXHFRPSHQsating gain 2 Preparation 6 Title 6HWXSFRPSHQVDWLQJJDLQDJDLQVWGLVWXUEDQFHWRUTXH 6HWXSWKHÀOWHUWLPHFRQVWDQWDFFRUGLQJWRWKHGLVWXUEDQFH WRUTXHFRPSHQVDWLRQ 4 How to Use Setup :LWK3U)XQFWLRQHQKDQFHPHQWVHWXSVHWREVHUYHUHQDEOHGLVDEOHDQGRSHUDWLRQ PRGH DOZD\VHQDEOHHQDEOHRQO\ZKHQVWJDLQLVVHOHFWHG 2) Setup of Pr6.24 (Disturbance observer filter) )LUVW VHW XS 3U WR D ODUJHU YDOXH DQG FKHFN WKH RSHUDWLRQ ZLWK 3U 'LVWXUEDQFH 3) Setup of Pr6.23 (Disturbance torque compensating gain) $IWHUVHWWLQJXS3ULQFUHDVH3U 7KH GLVWXUEDQFH VXSSUHVVLQJ FDSDELOLW\ LQFUHDVHV E\ LQFUHDVLQJ WKH JDLQ EXW LW LV DVVRFLDWHGZLWKLQFUHDVLQJYROXPHRIRSHUDWLRQQRLVH 7KLVPHDQVWKDWZHOOEDODQFHGVHWXSFDQEHREWDLQHGE\DGMXVWLQJ3UDQG3U 5 Adjustment WRUTXHFRPSHQVDWLQJJDLQVHWWRDORZYDOXHDQGWKHQJUDGXDOO\GHFUHDVHWKHVHWXSYDOXH RI3U$ORZÀOWHUVHWXSYDOXHDVVXUHVGLVWXUEDQFHWRUTXHHVWLPDWLRQZLWKVPDOOGHOD\ DQGHIIHFWLYHO\VXSSUHVVHVHIIHFWVRIGLVWXUEDQFH+RZHYHUWKLVUHVXOWVLQODUJHURSHUDWLRQ QRLVH:HOOEDODQFHGVHWXSLVUHTXLUHG 6 When in Trouble 7 Supplement 5-31 5 5. Manual Gain Tuning (Application) Adjustment 3rd gain switching function Outline ,QDGGLWLRQWRWKHQRUPDOJDLQVZLWFKLQJIXQFWLRQGHVFULEHGRQ3UGJDLQVZLWFKLQJ IXQFWLRQ FDQ EH VHW WR LQFUHDVH WKH JDLQ MXVW EHIRUH VWRSSLQJ7KH KLJKHU JDLQ VKRUWHQV positioning adjusting time. Applicable Range 7KLVIXQFWLRQFDQEHDSSOLFDEOHRQO\ZKHQWKHIROORZLQJFRQGLWLRQVDUHVDWLVÀHG Conditions under which the 3rd gain switching function is activated &RQWUROPRGHWREHHLWKHURUERWKSRVLWLRQFRQWURORUDQGIXOOFORVHG FRQWURO Control mode 3U 3RVLWLRQFRQWURO 3U )XOOFORVHGFRQWURO Others 6KRXOGEHLQVHUYRRQFRQGLWLRQ ,QSXW VLJQDOV VXFK DV WKH GHYLDWLRQ FRXQWHU FOHDU DQG FRPPDQG LQSXW LQKLELWDQGSDUDPHWHUVH[FHSWIRUFRQWUROVVXFKDVWRUTXHOLPLWVHWXSDUH FRUUHFWO\VHWDVVXULQJWKDWWKHPRWRUFDQUXQVPRRWKO\ Related Parameter Class No. Related page 5-32 Title Function 6 5 3RVLWLRQUGJDLQ valid time 6HWXSWKHWLPHDWZKLFKUGJDLQEHFRPHVYDOLG 6 6 3RVLWLRQUGJDLQ VFDOHIDFWRU 6HWXSWKHUGJDLQE\DPXOWLSO\LQJIDFWRURIWKHVWJDLQ UGJDLQ VWJDLQð3U 33´'HWDLOVRISDUDPHWHUµ 5. Manual Gain Tuning (Application) 1 How to Use :KHQWKHJDLQLVVZLWFKHGIURPQGWRVWE\WKHFKDQJHLQSDUDPHWHUWKHUGJDLQSHULRGDSSHDUV ([DPSOH 3U3RVLWLRQFRQWUROVZLWFKLQJPRGH VZLWFKLQJFRQGLWLRQZLWKSRVLWLRQDOFRPPDQG 3 Connection Caution 2 Preparation :KLOHLQWKHFRQGLWLRQXQGHUZKLFKWKHQRUPDOJDLQVZLWFKLQJIXQFWLRQVVHWWKHUGJDLQ DSSOLFDWLRQWLPHWR3U3RVLWLRQUGJDLQHQDEOHWLPHDQGVHWWKHUGJDLQ VFDOHIDFWRUZLWKUHIHUHQFHWRVWJDLQ WR3U3RVLWLRQUGJDLQPDJQLÀFDWLRQUDWLR ,IUGJDLQLVQRWXVHGVHW3UWRDQG3UWR 7KHUGJDLQLVHQDEOHGRQO\IRUSRVLWLRQFRQWURORUIXOOFORVHGFRQWURO 'XULQJWKHUGJDLQSHULRGRQO\SRVLWLRQORRSJDLQVSHHGSURSRUWLRQDOJDLQEHFRPHVUG JDLQGXULQJRWKHUSHULRGVVWJDLQVHWWLQJLVXVHG :KHQWKHQGJDLQVZLWFKLQJFRQGLWLRQLVHVWDEOLVKHGGXULQJUGJDLQSHULRGQGJDLQLV used. 'XULQJ WUDQVLWLRQ IURP QG JDLQ WR UG JDLQ 3U 3RVLWLRQ JDLQ VZLWFKLQJ WLPH LV DSplied. Before Using the Products 3rd gain switching function 4 Position speed command [r/min] Setup Pr6.05×0.1ms 2nd gain Pr1.05 to 1.09 3rd gain 5 1st gain Pr1.00 to 1.04 Adjustment [3rd gain period] Position loop gain = Pr1.00 × Pr6.06/100 Speed proportional gain = Pr1.01 × Pr6.06/100 Time constant of velocity integration, speed detection filter and torque filter directly use the 1st gain value. 6 When in Trouble 7 Supplement 5-33 5 5. Manual Gain Tuning (Application) Adjustment Friction torque compensation Outline 7RUHGXFHHIIHFWRIIULFWLRQUHSUHVHQWHGE\PHFKDQLFDOV\VWHPW\SHVRIIULFWLRQWRUTXH FRPSHQVDWLRQ FDQ EH DSSOLHG RIIVHW ORDG FRPSHQVDWLRQ WKDW FDQFHOV FRQVWDQW RIIVHW WRUTXHDQGWKHG\QDPLFIULFWLRQFRPSHQVDWLRQWKDWYDULHVGLUHFWLRQDVWKHRSHUDWLQJGLUHFWLRQYDULHV Applicable Range 7KLVIXQFWLRQFDQEHDSSOLFDEOHRQO\ZKHQWKHIROORZLQJFRQGLWLRQVDUHVDWLVÀHG Conditions under which the Friction torque compensation is activated Control mode 6SHFLILF WR LQGLYLGXDO IXQFWLRQV 5HIHU WR 5HODWHG SDUDPHWHUV VKRZQ below. Others 6KRXOGEHLQVHUYRRQFRQGLWLRQ ,QSXW VLJQDOV VXFK DV WKH GHYLDWLRQ FRXQWHU FOHDU DQG FRPPDQG LQSXW LQKLELWDQGSDUDPHWHUVH[FHSWIRUFRQWUROVVXFKDVWRUTXHOLPLWVHWXSDUH FRUUHFWO\VHWDVVXULQJWKDWWKHPRWRUFDQUXQVPRRWKO\ Related Parameter &RPELQHWKHIROORZLQJSDUDPHWHUVWRVHWXSDSSURSULDWHIULFWLRQWRUTXHFRPSHQVDWLRQ Class No. 6 6 6 Related page 5-34 Title Function 7 7RUTXH command additional value 6HWXSWKHRIIVHWORDGFRPSHQVDWLRQYDOXHXVXDOO\DGGHGWR WKHWRUTXHFRPPDQGLQDFRQWUROPRGHH[FHSWIRUWKHWRUTXH FRQWUROPRGH 8 Positive GLUHFWLRQWRUTXH compensation value 6HWXSWKHG\QDPLFIULFWLRQFRPSHQVDWLRQYDOXHWREHDGGHG WRWKHWRUTXHFRPPDQGZKHQIRUZDUGSRVLWLRQDOFRPPDQG LVIHG 9 1HJDWLYH GLUHFWLRQWRUTXH compensation value 6HWXSWKHG\QDPLFIULFWLRQFRPSHQVDWLRQYDOXHWREHDGGHG WRWKHWRUTXHFRPPDQGZKHQQHJDWLYHGLUHFWLRQSRVLWLRQDO FRPPDQGLVIHG 3´'HWDLOVRISDUDPHWHUµ 5. Manual Gain Tuning (Application) 1 How to Use 7KH IULFWLRQ WRUTXH FRPSHQVDWLRQ ZLOO EH DGGHG LQ UHVSRQVH WR WKH HQWHUHG SRVLWLRQDO FRPPDQGGLUHFWLRQDVVKRZQEHORZ Before Using the Products Friction torque compensation 2 [Positive direction] [ Pr6.07 Torque command additional value ] Pr6.08 Positive direction torque compensation value Pr6.09 Negative direction torque compensation value [ Preparation Command speed ] [ ] 3 Time Connection [Negative direction] Motor de-energized Motor energized Motor de-energized The friction compensation torque is the sum of the offset load compensation value which is set 4 according to the torque command additional value (always constant) and the dynamic friction compensation torque which is set according to positive/negative direction torque compensation Setup value. The command speed direction is reset upon power-up or when the motor is de-energized. Caution 7 Supplement 5-35 6 When in Trouble 7KHRIIVHWORDGFRPSHQVDWLRQDQGG\QDPLFIULFWLRQFRPSHQVDWLRQFDQEHXVHGLQGLYLGXDOO\RULQFRPELQDWLRQ+RZHYHUVRPHFRQWUROPRGHVLPSRVHOLPLWRQDSSOLFDWLRQ )RUWRUTXHFRQWURO2IIVHWORDGFRPSHQVDWLRQDQGG\QDPLFIULFWLRQFRPSHQVDWLRQDUHVHW DWUHJDUGOHVVRISDUDPHWHUVHWWLQJ )RUYHORFLW\FRQWUROZLWKVHUYRRII2IIVHWORDGFRPSHQVDWLRQSHU3ULVHQDEOHG'\QDPLFIULFWLRQFRPSHQVDWLRQLVVHWDWUHJDUGOHVVRISDUDPHWHUVHWWLQJ )RUSRVLWLRQFRQWURORUIXOOFORVHGFRQWUROZLWKVHUYRRQ3UHYLRXVRIIVHWORDGFRPSHQVDWLRQ DQG G\QDPLF IULFWLRQ FRPSHQVDWLRQ YDOXHV DUH PDLQWDLQHG XQWLO WKH ÀUVW SRVLWLRQDO FRPPDQGLVDSSOLHGZKHUHWKHRIIVHWORDGFRPSHQVDWLRQYDOXHLVXSGDWHGDFFRUGLQJWR 3U7KHG\QDPLFIULFWLRQFRPSHQVDWLRQYDOXHLVXSGDWHGWRSDUDPHWHUV3UDQG 3UGHSHQGLQJRQFRPPDQGGLUHFWLRQ 5 Adjustment 3U >7RUTXH FRPPDQG DGGLWLRQDO YDOXH@ UHGXFHV YDULDWLRQV LQ SRVLWLRQLQJ RSHUDWLRQ SHUIRUPDQFHLVDIIHFWHGE\GLUHFWLRQRIPRYHPHQW 7KHVHYDULDWLRQVRFFXUZKHQFRQVWDQWRIIVHWWRUTXHUHVXOWLQJIURPZHLJKWRQYHUWLFDOD[LVLVDSSOLHGWRWKHPRWRU &HUWDLQ ORDGV VXFK DV EHOW GULYHQ VKDIW UHTXLUHV KLJK G\QDPLF IULFWLRQ WRUTXH ZKLFK OHQJWKHQV SRVLWLRQLQJ VHWWLQJ WLPH RU YDULHV SRVLWLRQLQJ DFFXUDF\7KHVH SUREOHPV FDQ EHPLQLPL]HGE\VHWWLQJWKHIULFWLRQWRUTXHRIHYHU\URWDWLQJGLUHFWLRQLQWRLQGLYLGXDOSDUDPHWHUV 3U >3RVLWLYH GLUHFWLRQ WRUTXH FRPSHQVDWLRQ YDOXH@ DQG 3U >1HJDWLYH GLUHFWLRQWRUTXHFRPSHQVDWLRQYDOXH@FDQEHXVHGIRUWKLVSXUSRVH 5 5. Manual Gain Tuning (Application) Adjustment Inertia ratio switching function Outline ,QHUWLDUDWLRFDQEHVZLWFKHGEHWZHHQ1RDQG1RE\WKHVZLWFKLQJLQSXW -6(/ 7KLV IHDWXUHLVXVHIXOLQDSSOLFDWLRQZKHUHWKHORDGLQHUWLDFKDQJHVLQWZRVWHSV Applicable Range 7KLVIXQFWLRQFDQEHDSSOLFDEOHRQO\ZKHQWKHIROORZLQJFRQGLWLRQVDUHVDWLVÀHG Conditions under which the Inertia ratio switching function is activated &DQEHXVHGLQDOOFRQWUROPRGHV 3U 3RVLWLRQFRQWURO 3U 9HORFLW\FRQWURO 3U 7RUTXHFRQWURO Control mode 3U 3RVLWLRQ9HORFLW\FRQWURO 3U 3RVLWLRQ7RUTXHFRQWURO 3U 9HORFLW\7RUTXHFRQWURO 3U )XOOFORVHGFRQWURO Others 6KRXOGEHLQVHUYRRQFRQGLWLRQ ,QSXW VLJQDOV VXFK DV WKH GHYLDWLRQ FRXQWHU FOHDU DQG FRPPDQG LQSXW LQKLELWDQGSDUDPHWHUVH[FHSWIRUFRQWUROVVXFKDVWRUTXHOLPLWVHWXSDUH FRUUHFWO\VHWDVVXULQJWKDWWKHPRWRUFDQUXQVPRRWKO\ 5HDOWLPHDXWRWXQLQJVKRXOGEHGLVDEOHG 3U $GDSWLYHÀOWHUVKRXOGEHGLVDEOHG 3U ,QVWDQWDQHRXVVSHHGREVHUYHUVKRXOGEHGLVDEOHG 3UELW 'LVWXUEDQFHREVHUYHUVKRXOGEHGLVDEOHG 3U ELW Caution %HVXUHWRFKDQJHWKHLQHUWLDUDWLRZKLOHWKHPRWRULVLQVWRSVWDWH2WKHUZLVHYLEUDWLRQ RURVFLOODWLRQZLOORFFXU ,IWKHGLIIHUHQFHEHWZHHQWKHVWLQHUWLDUDWLRDQGQGLQHUWLDUDWLRLVODUJHYLEUDWLRQHWF PD\RFFXUHYHQLQVWRSPRGH7KHVHSRWHQWLDOSUREOHPVVKRXOGEHLGHQWLÀHGRQWKHDFtual model. Related page 5-36 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ33´'HWDLOVRISDUDPHWHUµ 5. Manual Gain Tuning (Application) 1 Related Parameter &RPELQHWKHIROORZLQJSDUDPHWHUVWRVHWXSDSSURSULDWHLQHUWLDUDWLRVZLWFKLQJIXQFWLRQ Class No. Title 2 Function 04 ,QHUWLDUDWLR 6 13 QG,QHUWLDUDWLR 6HWQGLQHUWLDUDWLR @ 6HW3U+\EULGYLEUDWLRQVXSSUHVVLRQJDLQWRWKHYDOXHHTXDOWRWKDWRISRVLWLRQDOORRS gain. >@ 'ULYLQJXQGHUIXOOFORVHGFRQWUROJUDGXDOO\LQFUHDVHWKHVHWXSYDOXHRI3U +\EULGYLEUDWLRQVXSSUHVVLRQILOWHUZKLOHFKHFNLQJUHVSRQVHFKDQJH :KHQWKHUHVSRQVHLVLPSURYHGDGMXVW3UDQG3UWRGHWHUPLQHWKHFRPELQDWLRQ WKDWSURYLGHVWKHEHVWUHVSRQVH Related page 5-38 3´'HWDLOVRISDUDPHWHUµ 6. About Homing Operation Adjustment Caution on Homing Operation 1 ([DPSOHRI+RPLQJ$FWLRQ 3UR[LPLW\GRJRQ'HFHOHUDWHVDWDQHQWU\RIWKHSUR[LPLW\LQSXWDQGVWRSVDWDQHQWU\ RIWKHÀUVWRULJLQLQSXW =SKDVH proximity dog speed origin input 3 Connection proximity input 2 Preparation ,Q KRPLQJ DFWLRQ E\ XVLQJ WKH KRVW FRQWUROOHU VWRS SRVLWLRQ PLJKW QRW EH VWDELOL]HG LI WKHRULJLQLQSXW =SKDVHRIWKHHQFRGHU LVHQWHUHGZKLOHWKHPRWRULVQRWGHFHOHUDWHG HQRXJKDIWHUWKHSUR[LPLW\LQSXWLVWXUQHGRQ6HWXSWKH21SRVLWLRQVRISUR[LPLW\LQSXW DQGWKHSRVLWLRQRIRULJLQSRLQWFRQVLGHULQJWKHQHFHVVDU\SXOVHFRXQWVIRUGHFHOHUDWLRQ7DNHWKHSRVLWLRQLQJDFWLRQDQGKRPLQJDFWLRQLQWRDFFRXQWZKHQ\RXVHWSXWDFFHOHUDWLRQGHFHOHUDWLRQWLPHZLWKSDUDPHWHUVLQFHWKLVDIIHFWWKHVHDFWLRQDVZHOO For the details of homing, observe the instruction manual of the host controller. Before Using the Products 5 4 encoder Z-phase Setup 3UR[LPLW\GRJRII'HFHOHUDWHVDWDQHQWU\RIWKHSUR[LPLW\LQSXWDQGVWRSVDWDQHQWU\ RIWKHÀUVWRULJLQLQSXW =SKDVH DIWHUWKHLQSXWLVWXQHGRII proximity dog proximity input 5 speed Adjustment origin input encoder Z-phase 6 When in Trouble 7 Supplement 5-39 5 6. About Homing Operation Adjustment Homing with Hit & Stop Error code Attribute Protective function Main Sub 11 12 13 1 14 15 16 1 21 1 23 24 1 26 1 27 2 1 2 3 4 5 6 7 37 38 6-5 6-6 41 42 43 44 6-7 45 47 48 6-8 51 55 87 2 3 6-11 4 6-12 5 6-13 6 When in Trouble 33 6-4 Software limit protection WR EEPROM parameter error pro2 tection WR EEPROM check code error 2 protection Over-travel inhibit input protection Analog input1 excess protection 1 Analog input2 excess protection 2 Analog input3 excess protection Absolute system down error protection Absolute counter over error protection Absolute over-speed error pro tection Initialization failure Absolute single turn counter error protection Absolute multi-turn counter er ror protection Absolute status error protection Encoder Z-phase error protection Encoder CS signal error protection Feedback scale connection er ror protection Feedback scale communication 1 error protection )HHGEDFNVFDOHVWDWXVHUURU protection Feedback scale status 1 error 1 protection Feedback scale status 2 error 2 protection Feedback scale status 3 error 3 protection Feedback scale status 4 error 4 protection Feedback scale status 5 error 5 protection A-phase connection error protection 1 B-phase connection error protection 2 Z-phase connection error protection Compulsory alarm input protection Motor automatic recognition WR error protection Adjustment 28 36 Detail Can be Immediate page History cleared stop Setup 25 34 Attribute Protective function Connection 18 1 Error code Main Sub Preparation Control power supply undervoltage protection Over-voltage protection Main power supply under-voltage protection (between P and N) Main power supply undervoltage protection (AC interception detection) Over-current protection IPM error protection Over-heat protection Over-load protection Over-regeneration load protection Over-regeneration Tr error protection Encoder communication disconnect error protection Encoder communication error protection Encoder communication data error protection Position deviation excess protection Velocity deviation excess protection +\EULGGHYLDWLRQH[FHVVHUURU protection Over-speed protection 2nd over-speed protection Command pulse input frequency error protection Command pulse multiplier error protection Limit of pulse replay error protection 'HYLDWLRQFRXQWHURYHUÁRZ protection Safety detection IF overlaps allocation error 1 protection IF overlaps allocation error 2 protection IF input function number error 1 protection IF input function number error 2 protection IF output function number error 1 protection IF output function number error 2 protection &/ÀWWLQJHUURUSURWHFWLRQ ,1+ÀWWLQJHUURUSURWHFWLRQ Detail Can be Immediate page History cleared stop Before Using the Products Protective Function (What is Error Code ?) Other Other error number +LVWRU\7KHHUURUZLOOEHVWRUHGLQWKHHUURUKLVWRU\ Can be cleared...To cancel the error, use the alarm clear input (A-CLR). If the alarm clear input is not effective, turn off power, remove the cause of the error and then turn on power again. Immediate stop...Instantaneous controlled stop upon occurrence of an error. 6HWWLQJRI´3U6HTXHQFHDWDODUPµLVDOVRUHTXLUHG Note 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK;;; and analog input. 6-3 7 Supplement Note 6 1. When in Trouble When in Trouble Protective function (Detail of error code) Protective function Control power supply undervoltage protection Over-voltage protection Error code No. Main Sub 11 12 0 0 Causes Voltage between P and N of the converter portion of the control power supply has IDOOHQEHORZWKHVSHFLÀHGYDOXH 9YHUVLRQapprox.9'& approx.9$& 9YHUVLRQapprox. 145 VDC (approx.9$& 9YHUVLRQapprox. 15 VDC 1) Power supply voltage is low. Instantaneous power failure has occurred 2) Lack of power capacity...Power supply voltage has fallen down due to inrush current at the main power-on. 3) Failure of servo driver (failure of the circuit) Measure the voltage between lines of connector and terminal block. 99GULYHU/&/& 9GULYHU99 Voltage between P and N of the converter portion of the control power VXSSO\KDVH[FHHGHGWKHVSHFLÀHGYDOXH 9YHUVLRQapprox.9'& approx.9$& 9YHUVLRQapprox.9'& approx.9$& 9YHUVLRQapprox.9'& approx.9$& 1) Power supply voltage has exceeded the permissible input voltage. Voltage surge due to the phase-advancing capacitor or UPS (Uninterruptible Power Supply) have occurred. 2) Disconnection of the regeneration discharge resistor Measure the voltage between lines of connector (L1, L2 and L3). 3) External regeneration discharge resistor is not appropriate and could not absorb the regeneration energy. 4) Failure of servo driver (failure of the circuit) Main power supply undervoltage protection (PN) Main power supply undervoltage protection (AC) 13 0 1 Instantaneous power failure has occurred between L1 and L3 for longer period than WKHSUHVHWWLPHZLWK3U 0DLQSRZHU RIIGHWHFWLQJWLPH ZKLOH3U /9WULS selection at the main power-off) is set to 1. Or the voltage between P and N of the converter portion of the main power VXSSO\KDVIDOOHQEHORZWKHVSHFLÀHG value during Servo-ON. 9YHUVLRQapprox.9'& approx. 55 VAC) 9YHUVLRQapprox.9'& approx. 75 VAC) 9YHUVLRQapprox.9'& approx. 125 VAC) 1) Power supply voltage is low. Instantaneous power failure has occurred 2) Instantaneous power failure has occurred. 3) Lack of power capacity...Power supply voltage has fallen down due to inrush current at the main power-on. 4) Phase lack...3-phase input driver has been operated with single phase input. 5) Failure of servo driver (failure of the circuit) 6-4 Measures 1) Increase the power capacity. Change the power supply. 2) Increase the power capacity. 3) Replace the driver with a new one. 1) Enter correct voltage. Remove a phaseadvancing capacitor. 2) Measure the resistance of the external resistor connected between terminal B1 - B2 of the driver. Replace the external UHVLVWRULIWKHYDOXHLV &KDQJHWRWKHRQHZLWKVSHFLÀHG resistance and wattage. 4) Replace the driver with a new one. Measure the voltage between lines of connector (L1, L2 and L3). 1) Increase the power capacity. Change the power supply. Remove the causes of the shutdown of the magnetic contactor or the main power supply, then re-enter the power. 6HWXSWKHORQJHUWLPHWR3U 0DLQ power off detecting time). Set up each phase of the power correctly. 3) Increase the power capacity. For the capacity, UHIHUWR3'ULYHUDQG/LVWRI$SSOLFDEOH Peripheral Equipments" of Preparation. 4) Connect each phase of the power supply (L1, L2 and L3) correctly. For single phase, 9DQG9GULYHUXVH/DQG/ 5) Replace the driver with a new one. 1. When in Trouble 1 Protective function * Over-current protection Error code No. Main Sub 14 Current through the converter portion has H[FHHGHGWKHVSHFLÀHGYDOXH 1) Failure of servo driver (failure of the circuit, IGBT or other components) 1 2) Short of the motor wire (U, V and W) ,30 Intelligent Power Module 3) Earth fault of the motor wire 4) Burnout of the motor 6) Welding of contact of dynamic braking relay due to frequent servo ON/OFF operations. 7) Timing of pulse input is same as or earlier than Servo-ON. 8) Blowout of thermal fuse due to overheating dynamic brake circuit. (Only F and G frames) 15 0 Temperature of the heat sink or power GHYLFHKDVEHHQULVHQRYHUWKHVSHFLÀHG temperature. 1) Ambient temperature has risen over WKHVSHFLÀHGWHPSHUDWXUH 2) Over-load 2 3 4 Setup * Over-heat protection 1) Turn to Servo-ON, while disconnecting the motor. If error occurs immediately, replace with a new driver. 2) Check that the motor wire (U, V and W) is not shorted, and check the branched out wire out of the connector. Make a correct wiring connection. 3) Measure the insulation resistance between motor wires, U, V and W and earth wire. In case of poor insulation, replace the motor. 4) Check the balance of resister between each motor line, and if unbalance is found, replace the motor. 5) Check the loose connectors. If they are, or SXOOHGRXWÀ[WKHPVHFXUHO\ 6) Replace the servo driver. Do not use Servo-ON/Servo-OFF as a means of staring/stopping the operation. (QWHUWKHSXOVHVPVRUORQJHUDIWHU Servo-ON. 8) Replace the driver. Connection 5) Poor contact of the motor wire. Measures Preparation * IPM error protection 0 Causes Before Using the Products Protective function (Detail of error code) 1) Improve the ambient temperature and cooling condition. 2) Increase the capacity of the driver and motor. Set up longer acceleration/ deceleration time. Lower the load. 5 Adjustment 6 When in Trouble 7 Related page :KHQSURWHFWLYHIXQFWLRQPDUNHGZLWK * in the protective function table is activated, it cannot be disabled by the alarm clear input (A-CLR). To return to the normal operation, turn off power, remove the cause, and then turn on power again. 3´6\VWHP&RQÀJXUDWLRQDQG:LULQJµ3´'HWDLOVRISDUDPHWHUµ 6-5 Supplement Note 1. When in Trouble Protective function (Detail of error code) Protective function Over-load protection Error code No. Main Sub 16 0 Causes Torque command value has exceeded the over-load level set with Pr5.12 (Setup of over-load level) and resulted in overload protection according to the time characteristics (described later) 1) Load was heavy and actual torque has exceeded the rated torque and kept running for a long time. 2) Oscillation and hunching action due to poor adjustment. Motor vibration, abnormal noise. ,QHUWLDUDWLR 3U VHWXSHUURU 3) Miswiring, disconnection of the motor. 4) Machine has collided or the load has gotten heavy. Machine has been distorted. 5) Electromagnetic brake has been kept engaged. 6) While wiring multiple axes, miswiring has occurred by connecting the motor cable to other axis. Measures Check that the torque (current) does not RVFLOODWHVQRUÁXFWXDWHXSDQGRZQYHU\ much on the analog outoput and via communication. Check the over-load alarm display and load factor with the analog outoput and via communication.. 1) Increase the capacity of the driver and motor. Set up longer acceleration/ deceleration time. Lower the load. 2) Make a re-adjustment. 3) Make a wiring as per the wiring diagram. Replace the cables. 4) Remove the cause of distortion. Lower the load. 5) Measure the voltage between brake terminals. Release the brake 6) Make a correct wiring by matching the correct motor and encoder wires. 7KHRYHUORDGSURWHFWLRQWLPHFKDUDFWHULVWLFVDUHGHVFULEHGRQ3 Caution * 18 Overregeneration load protection 0 Regenerative energy has exceeded the capacity of regenerative resistor. Check the load factor of the regenerative resistor from the front panel or via communication. Do not use in the continuous regenerative 1) Due to the regenerative energy during brake application. deceleration caused by a large load 1) Check the running pattern (velocity inertia, converter voltage has risen, monitor). Check the load factor of the and the voltage is risen further due to regenerative resistor and over-regeneration the lack of capacity of absorbing this warning display. Increase the capacity energy of the regeneration discharge of the driver and the motor, and loosen resistor. the deceleration time. Use the external regenerative resistor. 2) Check the running pattern (speed monitor). 2) Regenerative energy has not been Check the load factor of the regenerative DEVRUEHGLQWKHVSHFLÀHGWLPHGXHWRD resistor. Increase the capacity of the driver high motor rotational speed. and the motor, and loosen the deceleration time. Lower the motor rotational speed. Use an external regenerative resistor. 3) Active limit of the external regenerative 6HWXS3UWR UHVLVWRUKDVEHHQOLPLWHGWRGXW\ Caution Note Related page 6-6 2QFHWKLVHUURURFFXUVLWFDQQRWEHFOHDUHGDWOHDVWIRUVHF Install an external protection such as thermal fuse without fail when \RXVHWXS3UWR2WKHUZLVHUHJHQHUDWLYHUHVLVWRUORVHVWKH protection and it may be heated up extremely and may burn out. :KHQSURWHFWLYHIXQFWLRQPDUNHGZLWK * in the protective function table is activated, it cannot be disabled by the alarm clear input (A-CLR). To return to the normal operation, turn off power, remove the cause, and then turn on power again. 3´'HWDLOVRISDUDPHWHUµ 1. When in Trouble 1 Protective function Error code No. Main Sub 18 * Encoder communication disconnection error protection 21 1 0 Regenerative driver transistor on the servo driver is defective. Replace the driver. Communication between the encoder and the driver has been interrupted in certain times, and disconnection detecting function has been triggered. Make a wiring connection of the encoder as per the wiring diagram. Correct the miswiring of the connector pins. 2 3 23 Position deviation excess protection 24 Communication error has occurred in data from the encoder. Mainly data error due to noise. Encoder cables are connected, but communication data has some errors. 0 Data communication between the encoder is normal, but contents of data are not correct. Mainly data error due to noise. Encoder cables are connected, but communication data has some errors. 0 Deviation pulses have exceeded the VHWXSRI3U 1) The motor movement has not followed the command. 1 1) Check that the motor follows to the position command pulses. Check that the output toque has not saturated in torque monitor. Make a gain adjustment. Set up maximum YDOXHWR3UDQG3U0DNHD encoder wiring as per the wiring diagram. Set up the longer acceleration/deceleration time. Lower the load and speed. 6HWXSDODUJHUYDOXHWR3U ,QFUHDVHWKHVHWXSYDOXHRI3U /HQJWKHQWKHDFFHOHUDWLRQGHFHOHUDWLRQ time of internal positional command speed, or improve the follow-up characteristic by adjusting the gain. 'LVDEOHWKHH[FHVVVSHHGGHYLDWLRQ GHWHFWLRQ 3U 5 6 When in Trouble 7 Supplement The difference between the internal positional command speed and actual speed (speed deviation) exceeds the VHWXSYDOHRI3U Note) If the internal positional command VSHHGLVIRUFLEO\VHWWRGXHWR instantaneous stop caused by the FRPPDQGSXOVHLQKLELWLQSXW ,1+ RU CW/CCW over-travel inhibit input, the speed deviation rapidly increases at this PRPHQW3UVHWXSYDOXHVKRXOGKDYH VXIÀFLHQWPDUJLQEHFDXVHWKHVSHHG deviation also largely increases on the rising edge of the internal positional command speed. 4 Adjustment 6HWXSYDOXHRI3U 3RVLWLRQ deviation excess setup) is small. 6HFXUHWKHSRZHUVXSSO\IRUWKHHQFRGHU RI'&9WR9 SD\DQDWWHQWLRQ especially when the encoder cables are long. 6HSDUDWHWKHHQFRGHUFDEOHDQGWKHPRWRU cable if they are bound together. &RQQHFWWKHVKLHOGWR)* Setup * Encoder communication data error protection 1 Connection * Encoder communication error protection Velocity deviation excess protection Measures Preparation * Regenerative transistor error protection Causes Before Using the Products Protective function (Detail of error code) 6-7 1. When in Trouble Protective function (Detail of error code) Protective function * Hybrid deviation excess error protection Error code No. Main Sub 25 0 Causes Measures 3RVLWLRQRIORDGE\WKHH[WHUQDOVFDOH and position of the motor by the encoder slips larger than the setup pulses with Pr3.28 (Setup of hybrid deviation excess) at full-closed control. &KHFNWKHFRQQHFWLRQEHWZHHQWKHPRWRU and the load. &KHFNWKHFRQQHFWLRQEHWZHHQWKHH[WHUQDO scale and the driver. &KHFNWKDWWKHYDULDWLRQRIWKHPRWRU position (encoder feedback value) and the load position (external scale feedback value) is the same sign when you move the load. Check that the numerator and denominator of the external scale division (Pr3.24 and 3.25) and reversal of external scale direction (Pr3.26) are correctly set. 'RQRWFKDQJHFRPPDQGGLYLVLRQ multiplication during full closed control. 'XULQJIXOOFORVHGFRQWUROQXPHUDWRU of command division/multiplication is changed or switched over. Over-speed protection 26 2nd Overspeed protection Command pulse input frequency error protection 27 Electronic gear error protection Pulse regeneration limit protection 6-8 28 0 The motor rotational speed has exceeded the setup value of Pr5.13. 1 The motor rotational speed has exceeded the setup value of Pr6.15. 'RQRWJLYHDQH[FHVVLYHVSHHGFRPPDQG &KHFNWKHFRPPDQGSXOVHLQSXWIUHTXHQF\ and division/multiplication ratio. 0DNHDJDLQDGMXVWPHQWZKHQDQRYHUVKRRW has occurred due to a poor gain adjustment. 0DNHDZLULQJFRQQHFWLRQRIWKHHQFRGHUDV per the wiring diagram. 0 The frequency of command pulse input is more than 1.2 times the setting in Pr5.32. Check the command pulse input for frequency. 2 Division and multiplication ratio which are set up with the command pulse counts per single turn and the1st and the 4th numerator/denominator of the electronic gear are not appropriate. 7KHFRPPDQGSXOVHVSHUPV multiplied by the command division and PXOWLSOLFDWLRQUDWLRH[FHHGV0SSV 7KHFRPPDQGSXOVHLQSXWÁXFWXDWHV Noises mixed with the command pulse input cause counting error. 6HWWKHFRPPDQGGLYLVLRQDQGPXOWLSOLFDWLRQ ratio to a value as small as possible e.g. EHWZHHQDQG &KHFNWKHVHWXSYDOXHRIHOHFWURQLFJHDU ,ISRVVLEOHXVHWKHOLQHGULYHU,) 6HW3U VHWWLQJRIPD[FRPPDQGSXOVH LQSXW WRDYDOXHOHVVWKDQDQGHQDEOH GLJLWDOÀOWHU 0 The output frequency of pulse regeneration has exceeded the limit. &KHFNWKHVHWXSYDOXHVRI3UDQG 7RGLVDEOHWKHGHWHFWLRQVHW3UWR 1. When in Trouble 1 Protective function Error code No. Main Sub 0 Measures Positional deviation of encoder pulse reference has exceeded 2 &KHFNWKDWWKHPRWRUUXQVDVSHUWKH position command pulses. &KHFNWKDWWKHRXWSXWWRTXHKDVQRW saturated in torque monitor. 0DNHDJDLQDGMXVWPHQW 6HWXSPD[LPXPYDOXHWR3UDQG Pr5.22. 0DNHDZLULQJFRQQHFWLRQRIWKHHQFRGHUDV per the wiring diagram. Safety input protection 30 0 Input photocoupler of both or one of safety input 1 and 2 is OFF. Check wiring of safety input 1 and 2. * I/F input duplicated allocation error 1 protection 33 0 Input signals (SI1, SI2, SI3, SI4, SI5) are assigned with two functions. Allocate correct function to each connector pin. * I/F input duplicated allocation error 2 protection 1 ,QSXWVLJQDOV 6,6,6,6,6, are assigned with two functions. * I/F input function number error 1 protection 2 Input signals (SI1, SI2, SI3, SI4, SI5) are DVVLJQHGZLWKXQGHÀQHGQXPEHU * I/F input function number error 2 protection 3 ,QSXWVLJQDOV 6,6,6,6,6, DUHDVVLJQHGZLWKXQGHÀQHGQXPEHU * I/F output function number error 1 protection 4 Output signals (SO1, SO2, SO3) are DVVLJQHGZLWKXQGHÀQHGQXPEHU * I/F output function number error 2 protection 5 2 3 4 Setup 29 Connection Deviation counter RYHUÁRZ protection Preparation Causes Before Using the Products Protective function (Detail of error code) 5 Adjustment 6 When in Trouble Output signals (SO4, SO5, SO6) are DVVLJQHGZLWKXQGHÀQHGQXPEHU 7 :KHQSURWHFWLYHIXQFWLRQPDUNHGZLWK * in the protective function table is activated, it cannot be disabled by the alarm clear input (A-CLR). To return to the normal operation, turn off power, remove the cause, and then turn on power again. 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK;DQGDQODRJLQSXW Supplement Note 1. When in Trouble Protective function (Detail of error code) Protective function * CL assignment error Error code No. Main Sub 33 * INH assignment error Software limit protection 34 Causes 6 Counter clear function is assigned to a signal number other than SI7. 7 Command pulse inhibit input function is assigned to a signal number other than 6, 0 When a position command within the VSHFLÀHGLQSXWUDQJHLVJLYHQWKHPRWRU operates outside its working range VSHFLÀHGLQ3U 1) Gain is not appropriate. 2) Pr5.14 setup value is low. Allocate correct function to each connector pin. 1) Check the gain (balance between position loop gain and speed loop gain) and inertia ratio. 2) Increase the setup value of Pr5.14. Or, 6HW3UWRWRGLVDEOHWKHSURWHFWLYH function. Data in parameter storage area has been damaged when reading the data from EEPROM at power-on. 6HWXSDOOSDUDPHWHUVDJDLQ ,IWKHHUURUSHUVLVWVUHSODFHWKHGULYHU LW may be a failure.) Return the product to the dealer or manufacturer. 'DWDIRUZULWLQJFRQÀUPDWLRQWR((3520 has been damaged when reading the data from EEPROM at power-on. Replace the driver. (it may be a failure). Return the product to a dealer or manufacturer. 0 :LWK3URYHUWUDYHOLQKLELWLQSXW VHWXS ERWKSRVLWLYHDQGQHJDWLYH over-travel inhibit inputs (POT/NOT) have been ON. :LWK3U SRVLWLYHRUQHJDWLYH over-travel inhibit input has turned ON. Check that there are not any errors in switches, wires or power supply which are connected to positive direction/ negative direction over-travel inhibit input. Check that the rising time of the control power supply (DC12 to 24V) is not slow. 0 +LJKHUYROWDJHKDVEHHQDSSOLHGWRWKH analog input 1 than the value that has been set by Pr4.24. 6HWXS3UFRUUHFWO\&KHFNWKH FRQQHFWLQJFRQGLWLRQRIWKHFRQQHFWRU; 6HWXS3UWRDQGLQYDOLGDWHWKH protective function. Analog input 2 (AI2) excess protection 1 +LJKHUYROWDJHKDVEHHQDSSOLHGWRWKH analog input 2 than the value that has been set by Pr4.27. 6HWXS3UFRUUHFWO\&KHFNWKH FRQQHFWLQJFRQGLWLRQRIWKHFRQQHFWRU; 6HWXS3UWRDQGLQYDOLGDWHWKH protective function. Analog input 3 (AI3) excess protection 2 +LJKHUYROWDJHKDVEHHQDSSOLHGWRWKH analog input 3 than the value that has EHHQVHWE\3U 6HWXS3UFRUUHFWO\&KHFNWKH FRQQHFWLQJFRQGLWLRQRIWKHFRQQHFWRU; 6HWXS3UWRDQGLQYDOLGDWHWKH protective function. * EEPROM parameter error protection 36 * EEPROM check code error protection 37 * Over-travel inhibit input protection 38 Analog input 1 (AI1) excess protection 39 Note Measures 0 1 2 0 1 2 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWKDQDORJLQSXW 1. When in Trouble 1 Protective function Absolute system down error protection Error code No. Main Sub 40 0 Causes Voltage of the built-in capacitor has fallen EHORZWKHVSHFLÀHGYDOXHEHFDXVHWKH power supply or battery for the absolute encoder has been down. 41 * 0 Absolute counter over error protection 42 0 After connecting the power supply for the battery, clear the absolute encoder. Once this error occurs, the alarm cannot be cleared until the absolute encoder is reset. Multi-turn counter of the absolute HQFRGHUKDVH[FHHGHGWKHVSHFLÀHG value. 6HW3UWRWRLJQRUHWKHPXOWLWXUQ counter over. /LPLWWKHWUDYHOIURPWKHPDFKLQHRULJLQ within 32767 revolutions. The motor speed has exceeded the VSHFLÀHGYDOXHZKHQRQO\WKHVXSSO\ from the battery has been supplied to 17-bit encoder during the power failure. &KHFNWKHVXSSO\YROWDJHDWWKHHQFRGHU VLGH 9 &KHFNWKHFRQQHFWLQJFRQGLWLRQRIWKH FRQQHFWRU; Caution 2 3 Connection Absolute overspeed error protection Measures Once this error occurs, the alarm cannot be cleared until the absolute encoder is reset. 43 0 Encoder initialization error was detected. Replace the motor. * Absolute single turn counter error protection *1 44 0 $EVROXW single turn counter error protection LQFUHPHQWDO single turn counter error protection Replace the motor. * Absolute multi-turn counter error protection *1 45 0 $EVROXW multi-turn counter error protection LQFUHPHQWDO single turn counter error protection Replace the motor. * Absolute status error protection *1 47 0 Encoder has been running at faster VSHHGWKDQWKHVSHFLÀHGYDOXHDWSRZHU on. Arrange so as the motor does not run at power-on. * Encoder Z-phase error protection*1 48 0 Missing pulse of Z-phase of serial incremental encoder has been detected. The encoder might be a failure. Replace the motor. 4 Setup * Encoder initialization error protection *1 Preparation Caution Before Using the Products Protective function (Detail of error code) 5 Adjustment 6 When in Trouble 7 :KHQSURWHFWLYHIXQFWLRQPDUNHGZLWK * in the protective function table is activated, it cannot be disabled by the alarm clear input (A-CLR). To return to the normal operation, turn off power, remove the cause, and then turn on power again. 6-11 Supplement Note 1. When in Trouble Protective function (Detail of error code) Protective function Error code No. Main Sub Measures * Encoder CS signal error protection*1 49 0 CS signal logic error of serial incremental encoder has been detected. The encoder might be a failure. Replace the motor. * Feedback scale wiring error protection 50 0 Communication between the external scale and the driver has been interrupted in certain times, and disconnection detecting function has been triggered. 0DNHDZLULQJFRQQHFWLRQRIWKHH[WHUQDO scale as per the wiring diagram. &RUUHFWWKHPLVZLULQJRIWKHFRQQHFWRUSLQV 1 Communication error has occurred in data from the external scale. Mainly data error due to noise. External scale cables are connected, but communication date has some error. 6HFXUHWKHSRZHUVXSSO\IRUWKHH[WHUQDO VFDOHRI'& WR9 SD\ attention especially when the external scale cables are long. 6HSDUDWHWKHH[WHUQDOVFDOHFDEOHDQGWKH motor cable if they are bound together. &RQQHFWWKHVKLHOGWR)*UHIHUWRZLULQJ diagram. 0 %LWRIWKHH[WHUQDOVFDOHHUURUFRGH (ALMC) has been turned to 1. &KHFNWKHVSHFLÀFDWLRQVRIWKHH[WHUQDO scale. Remove the causes of the error, then clear the external scale error from the front panel. And then, shut off the power to reset. * External scale status 1 error protection *1 1 Bit 1 of the external scale error code (ALMC) has been turned to 1. &KHFNWKHVSHFLÀFDWLRQVRIWKHH[WHUQDO scale. * External scale status 2 error protection *1 2 Bit 2 of the external scale error code (ALMC) has been turned to 1. &KHFNWKHVSHFLÀFDWLRQVRIWKHH[WHUQDO scale. * External scale status 3 error protection *1 3 Bit 3 of the external scale error code (ALMC) has been turned to 1. &KHFNWKHVSHFLÀFDWLRQVRIWKHH[WHUQDO scale. * External scale status 4 error protection *1 4 Bit 4 of the external scale error code (ALMC) has been turned to 1. &KHFNWKHVSHFLÀFDWLRQVRIWKHH[WHUQDO scale. * External scale status 5 error protection *1 5 Bit 5 of the external scale error code (ALMC) has been turned to 1. &KHFNWKHVSHFLÀFDWLRQVRIWKHH[WHUQDO scale. * External communication data error protection * External scale status 0 error protection *1 Note 6-12 Causes 51 :KHQSURWHFWLYHIXQFWLRQPDUNHGZLWK * in the protective function table is activated, it cannot be disabled by the alarm clear input (A-CLR). To return to the normal operation, turn off power, remove the cause, and then turn on power again. 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 1. When in Trouble 1 Protective function * A-phase wiring error protection Error code No. Main Sub 55 0 Causes Before Using the Products Protective function (Detail of error code) Measures A-phase wiring in the external scale is defective, e.g. discontinued. Check the A-phase wiring connection. 2 1 B-phase wiring in the external scale is defective, e.g. discontinued. Check the B-phase wiring connection. * Z-phase wiring error protection 2 Z-phase wiring in the external scale is defective, e.g. discontinued. Check the Z-phase wiring connection. Preparation * B-phase wiring error protection 3 Forced alarm input (E-STOP) is applied. 87 * Motor automatic recognition error protection 95 0 to 4 The motor and the driver has not been matched. * Other error 99 0 Check the wiring of forced alarm input (E-STOP). Connection Forced alarm input protection Replace the motor which matches to the driver. 4 7XUQRIIWKHSRZHURQFHWKHQUHHQWHU ,IHUURUUHSHDWVWKLVPLJKWEHDIDLOXUH Stop using the products, and replace the motor and the driver. Return the products to the dealer or manufacturer. $GMXVWWKHFRQGLWLRQRIWKHVDIHW\LQSXW safety input 2 and then start the alarm clear. Control circuit has malfunctioned due to excess noise or other causes. Some error has occurred inside of the driver while triggering self-diagnosis function of the driver. 7XUQRIIWKHSRZHURQFHWKHQUHHQWHU ,IHUURUUHSHDWVWKLVPLJKWEHDIDLOXUH Stop using the products, and replace the motor and the driver. Return the products to the dealer or manufacturer. 5 Adjustment Excessive noise or the like is detected as an abnormal signal. This type of error will occur if the alarm clear is attempted while the safety input 1/safety input 2 is not in normal state (input photocoupler is ON). Setup Other No. 0 6 When in Trouble 7 Supplement 6-13 1. When in Trouble Protective function (Detail of error code) Time characteristics of Err16.0 (Overload protection) Overload protection time characteristics Motor Type: M * MD MSMD 50W MSMD 100W(100V) Time [s] 100 MSMD 100W(200V) MSMD MHMD MSMD MHMD 200W 200W 400W 400W MSMD 750W MHMD 750W * Only for position control type. 10 1 0.1 115 100 200 300 400 500 Torque [%] Motor Type: M * ME MSME 50W MSME 100W(100V) Time [s] 100 MSME 100W(200V) MSME 200W MSME 400W 10 MSME 750W(200V) MSME 750W(400V), 1.0kW to 5.0kW MDME 400W(400V), 600W(400V), 1.0kW to 15.0kW MFME 1.5kW to 4.5kW MHME 1.0kW to 7.5kW MGME 0.9kW to 6.0kW 1 0.1 115 100 200 300 400 500 Torque [%] * MDME 7.5kW to 15.0kW, MHME 7.5kW and MGME 6.0kW is less than 300%. * Only for position control type is not provided with MSME 50W to 750W(200V), 750W(400V), MDME 400W(400V), 600W(400V), 7.5kW to 15.0kW, MFME, MHME 7.5kW and MGME 4.5kW, 6.0kW. Caution 6-14 Use the motor so that actual torque stays in the continuous running range shown in “S-T characteristic” of the motor. For the S-T characteristics, see P.7-55 Motor characteristics (S-T characteristics). 1. When in Trouble 1 Software Limit Function (Err34.0) Conditions under which the software limit works Control mode 3 3RVLWLRQFRQWURO)XOOFORVHGFRQWURO 6KRXOGEHLQVHUYRRQFRQGLWLRQ ,QSXWVLJQDOVVXFKDVWKHGHYLDWLRQFRXQWHUFOHDUDQGFRPPDQGLQSXW inhibit, and parameters except for controls such as torque limit setup, are correctly set, assuring that the motor can run smoothly. 4 Setup 3) Cautions 7KLVIXQFWLRQLVQRWDSURWHFWLRQDJDLQVWWKHDEQRUPDOSRVLWLRQFRPPDQG :KHQWKLVVRIWZDUHOLPLWSURWHFWLRQLVDFWLYDWHGWKHPRWRUGHFHOHUDWHVDQGVWRSVDFFRUGLQJWR3U VHTXHQFHDWDODUP The work (load) may collide to the machine end and be damaged depending on the load during this deceleration, hence set up the range of Pr5.14 including the deceleration movement. 7KLV VRIWZDUH OLPLW SURWHFWLRQ ZLOO EH LQYDOLGDWHG GXULQJ WKH WULDO UXQ DQG IUHTXHQF\ characteristics functioning of the PANATERM. Connection Others 2 Preparation 1) Outline UPLQ@LQRSHUDWLQJFRQGLWLRQ Factor in ( ) is margin to prevent frequent activation of over-speed protection. When running the motor at a low speed during initial adjustment stage, setup the overspeed protection by multiplying the adjusting speed by a certain margin to protect the motor against possible oscillation. Related page P.4-46 (Pr5.13) (Continued ...) 6-18 2. Setup of gain pre-adjustment protection 1 2 Preparation During the position control or full-closed control, this function detects potential excesVLYHGLIIHUHQFHEHWZHHQWKHSRVLWLRQDOFRPPDQGDQGPRWRUSRVLWLRQDQGLVVXHV(UU Excess positional deviation protection. ([FHVV SRVLWLRQDO GHYLDWLRQ OHYHO FDQ EH VHW WR 3U 6HWXS RI SRVLWLRQDO GHYLDWLRQ excess. The deviation can be detected through command positional deviation [pulse (command unit)] and encoder positional deviation [pulse (encoder unit)], and one of ZKLFKFDQEHVHOHFWHGE\3U3RVLWLRQVHWXSXQLWVHOHFW 6HHWKHFRQWUROEORFNGLDgram.) 'HIDXOWVHWWLQJLV>SXOVH FRPPDQGXQLW @ Because the positional deviation during normal operation depends on the operating VSHHGDQGJDLQVHWWLQJÀOOWKHHTXDWLRQEHORZEDVHGRQ\RXURSHUDWLQJFRQGLWLRQDQG LQSXWWKHUHVXOWLQJYDOXHWR3U Before Using the Products 4) Setup of the excess positional deviation protection 3 Connection :KHQ3U GHWHFWLRQWKURXJKFRPPDQGSRVLWLRQDOGHYLDWLRQ 3U6HWXSRISRVLWLRQDOGHYLDWLRQH[FHVV 9FNSð WR 9FPD[LPXPIUHTXHQF\RISRVLWLRQDOFRPPDQGSXOVH>SXOVH FRPPDQGXQLW V@ .SSRVLWLRQORRSJDLQ>V@ Factor in ( ) is margin to prevent frequent activation of excess positional deviation 4 protection. 3U6HWXSRISRVLWLRQDOGHYLDWLRQH[FHVV 9H.S× WR 9HPD[LPXPRSHUDWLRQIUHTXHQF\>SXOVHV@LQHQFRGHUXQLWRUIXOOFORVHGXQLW .SSRVLWLRQORRSJDLQ>V@ Note 3) When switching position loop gain Kp, select the smallest value for calculation. 1RWH :KHQ3U VHWXSVRISRVLWLRQDOFRPPDQGILOWHUDQGGDPSLQJFRQWUROKDYH 3 3U 3 3U 5) Setup of motor working range During the position control or full-closed control, this function detects the motor position which exceeds the revolutions set to Pr5.14 Motor working range setup, and isVXHV(UUSoftware limit protection. P.4-46 (Pr5.14) 7 Supplement Related page 6 When in Trouble no effect. Related page 5 Adjustment :KHQ3U GHWHFWLRQWKURXJKHQFRGHUSRVLWLRQDOGHYLDWLRQ full-closed positional deviation) Setup Note 1) When switching position loop gain Kp, select the smallest value for calculation. Note 2) When using the positional command filter and damping control, add the following values. 3RVLWLRQDOFRPPDQGVPRRWKLQJILOWHU9F× filter time constant [s] 3RVLWLRQDOFRPPDQG),5ILOWHU9F× filter time constant [s]/2 'DPSLQJFRQWURO9F ×GDPSLQJIUHTXHQF\>+]@ 2. Setup of gain pre-adjustment protection 6) Setup of hybrid deviation excess error protection At the initial operation with full-closed control, operation failure may occur due to reverse connection of external scale or wrong external scale division ratio. 7R LQGLFDWH WKLV W\SH RI GHIHFW (UU +\EULG GHYLDWLRQ H[FHVV HUURU SURWHFWLRQ LV LVsued when the deviation of motor position (encoder unit) and load position (external scale unit) exceed Pr3.28 Setup of hybrid deviation excess. 'HIDXOWVHWWLQJLVSXOVH FRPPDQGXQLW %HFDXVHWKHGHYLDWLRQLQQRUPDORSHUDtion varies with the operation speed and gain setup. Add a margin to this setting according to your operating condition. Related page P.4-32 (Pr3.28) 3. Troubleshooting When in Trouble Motor Does Not Run 1 :KHQWKHPRWRUGRHVQRWUXQUHIHUWR3'LVSOD\RI)DFWRURI1R0RWRU5XQQLQJRI3UHSDUDWLRQ as well. &ODVVLÀFDWLRQ Parameter 2 Check that the present control mode is correct with monitor mode of the front panel. 6HWXS3UDJDLQ 2) Check that the input to control mode switching &02'( RIWKH&QQHFWRU;LVFRUUHFWZKHQ 3ULVVHWWRWR Selection of torque limit is not correct Check that the external analog input (N-ATL/ P-ATL) is not used for the torque limit. 6HWXS3UWRDQGDSSO\>9@WR1$7/DQG >9@WR3$7/ZKHQ\RXXVHWKHH[WHUQDOLQSXW 6HWXS3UWRDQGVHWXSWKHPD[YDOXHWR 3UZKHQ\RXXVHWKHSDUDPHWHUYDOXH Setup of electronic gear is not correct. (Position/Fullclosed) Check that the motor moves by expected revolution against the command pulses. &KHFNWKHVHWXSVRI3U3UDQG3UWR 3UDJDLQ 2) Connect the electronic gear switching input (DIV) of &RQQHFWRU;WR&20²RULQYDOLGDWHWKHGLYLVLRQ multiplication switching by setting up the same YDOXHWR3UDQG3U Servo-ON input of Connector ; 65921 LV open. In the front panel monitor mode, is the Pin No. corresponding to SRVON in “ - ” state? Check and make a wiring so as to connect the SRV21LQSXWWR&20² Positive/negative direction overtravel inhibit input RI&RQQHFWRU; (NOT/POT) is open. In the front panel monitor mode, is the Pin No. corresponding to NOT/ POT in “ A ” state? 1) Check and make a wiring so as to connect both 127327LQSXWVWR&20² 6HWXS3UWR LQYDOLG DQGUHVHWWKHSRZHU Command pulse input setup is incorrect. (Position/Fullclosed) Check that the input pulse counts and variation of command pulse sum does not slips, with monitor mode of the front panel. 1) Check that the command pulses are entered FRUUHFWO\WRWKHGLUHFWLRQVHOHFWHGZLWK3U 2) Check that the command pulses are entered FRUUHFWO\LQWKHIRUPDWVHOHFWHGZLWK3U Command pulse input LQKLELWLRQ ,1+ RI &RQQHFWRU;LV open. (Position/ Full-closed) In the front panel monitor mode, is the Pin No. FRUUHVSRQGLQJWR,1+LQ “ A ” state? &KHFNDQGPDNHDZLULQJVRDVWRFRQQHFWWKH,1+ LQSXWWR&20² 2) Set up Pr5.18 to 1 (invalid). Counter clear input (CL) of &RQQHFWRU; is connected to &20² 3RVLWLRQ Full-closed) In the front panel monitor mode, is the Pin No. corresponding to CL in “ A ” state? 1) Check and make wiring so as to open the CL input 6HWXS3UWR LQYDOLG 3 4 Setup Setup of the control mode is not correct Connection 5 Adjustment 6 When in Trouble 7 Supplement Related page Measures Preparation Wiring Causes Before Using the Products 6 3´+RZWR8VHWKH)URQW3DQHOµ3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 3´'HWDLOVRISDUDPHWHUµ 6-21 3. Troubleshooting Motor Does Not Run :KHQWKHPRWRUGRHVQRWUXQUHIHUWR3'LVSOD\RI)DFWRURI1R0RWRU5XQQLQJRI3UHSDUDWLRQ as well. &ODVVLÀFDWLRQ Wiring Installation Related page 6-22 Causes Measures Speed command is invalid (Velocity) Check that the velocity command input method (external analog command/internal velocity command) is correct. &KHFNWKHVHWXSVRI3UWR3UDJDLQE\ VHWWLQJXS3UWRZKHQ\RXXVHWKHH[WHUQDO analog command. 6HWXS3UWR3UDQG3UWR3UE\ VHWWLQJXS3UWRHLWKHURQHRIRUZKHQ you use the internal speed command. Speed zero clamp input (ZEROSPD) of &RQQHFWHU;LV open. (Velocity/Torque) In the front panel monitor mode, is the Pin No. corresponding to ZEROSPD in “ A ” state? 1) Check and make wiring so as to connect speed ]HURFODPSLQSXWWR&20² 2) Set up Pr3.15. Torque command is invalid (Torque) Check that the torque command input method (SPR/TRQR input, P-ATL/TRQR input) is correct. 1) Check that the input voltage is applied correctly by VHWWLQJXS3UWRZKHQ\RXXVH6357545 input. 2) Check that the input voltage is applied correctly by setting up Pr3.17 to 1, when you use the P-ATL/ TRQR input. Velocity control is invalid (Torque) Check that the velocity limit input method (parameter velocity, SPR/ TRQR/SPL input) is correct. 1) Set up the desired value to Pr3.21 by setting up 3UWRZKHQ\RXXVHWKHSDUDPHWHUVSHHG 2) Check that the input voltage is applied correctly by setting up Pr3.17 to 1, when you use the SPR/ TRQR/SPL input. Main power is shut off. In the front panel monitor mode, is the Pin No. FRUUHVSRQGLQJWR65'< in “ - ” state? Check the wiring/voltage of main power of the driver (L1, L2 and L3). The motor shaft drags, the motor does not run. 1)Check that you can turn the motor shaft, after turning off the power and separate it from the machine. 2)Check that you can turn the motor shaft while applying DC24V to the brake in case of the motor with electromagnetic brake. If you cannot turn the motor shaft, consult with the dealer for repair. 3´'HWDLOVRISDUDPHWHUµ3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 6 &ODVVLÀFDWLRQ Adjustment Unstable Rotation (Not Smooth), Motor Runs Slowly Even with Speed Zero at Velocity Control Mode Causes Setup of the control mode is not correct. Measures ,I\RXVHWXS3UWR 9HORFLW\FRQWUROPRGH E\PLVWDNHDW position control mode, the motor runs slowly at servo-ON due to VSHHGFRPPDQGRIIVHW&KDQJHWKHVHWXSRI3UWR 2 Velocity and position command are not stable. &KHFNWKHPRWRUPRYHPHQWZLWKFRQQHFWRU;RIWKHIURQWSDQHO or the waveform graphic function of the PANATERM. Review the wiring, connector contact failure and controller. Each input signal of Connector ;LVFKDWWHULQJ 1) Servo-ON signal &KHFNWKHZLULQJDQGFRQQHFWLRQEHWZHHQ3LQDQGRIWKH &RQQHFWRU;XVLQJWKHGLVSOD\IXQFWLRQRI,2VLJQDOVWDWXV Correct the wiring and connection so that the Servo-ON signal can be turned on normally. Review the controller. 2) Check the wiring and connection between Pin-18 and 17, 16 and RIWKH&RQQHFWRU;XVLQJWHVWHURURVFLOORVFRSH&RUUHFWWKH wiring and connection so that Positive/Negative direction torque limit input can be entered normally. &KHFNWKHZLULQJDQGFRQQHFWLRQEHWZHHQ3LQDQGRIWKH &RQQHFWRU;XVLQJGLVSOD\IXQFWLRQRI,2VLJQDOVWDWXV&RUUHFW the wiring and connection so that the deviation counter input can be turned on normally. Review the controller. 4) Check the wiring and connection between Pin-26 and 41of the &RQQHFWRU;XVLQJ'LVSOD\IXQFWLRQRI,2VLJQDOVWDWXV&RUUHFW the wiring and connection so that the speed zero clamp input can be entered normally. Review the controller. 5) Check the wiring and connection between Pin-33 and 41of the &RQQHFWRU;XVLQJGLVSOD\IXQFWLRQRI,2VLJQDOVWDWXV&RUUHFW the wiring and connection so that the command pulse inhibition input can be entered normally. Review the controller. 2) Positive/Negative direction torque limit input signal 3) Deviation counter input signal 4) Speed zero clamp signal 5) Command pulse inhibition input 8VHDVKLHOGFDEOHIRUFRQQHFWLQJFDEOHWRWKH&RQQHFWRU; 6HSDUDWHWKHSRZHUOLQHDQGVLJQDOOLQH FPRUORQJHU LQWKH separate duct. Slip of offset Check the voltage between Pin-14 and 15 (speed command input) using a tester or an oscilloscope. Noise is on the position command. 8VHDVKLHOGFDEOHIRUFRQQHFWLQJFDEOHWRWKH&RQQHFWRU; 6HSDUDWHWKHSRZHUOLQHDQGVLJQDOOLQH FPRUORQJHU LQWKH separate duct. 4 5 Adjustment Noise is on the velocity command. 3 Setup ,QFUHDVHWKHVHWXSRI3UVWYHORFLW\ORRSJDLQ(QWHUWRUTXH ÀOWHURI3UDQGLQFUHDVHWKHVHWXSRI3UDJDLQ Connection Gain adjustment is not proper. Preparation Wiring Before Using the Products When in Trouble Parameter 1 3. Troubleshooting 6 When in Trouble 7 Supplement Related page 3´'HWDLOVRISDUDPHWHUµ3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 3´2XWOLQHRI6HWXSVXSSRUWVRIWZDUH´3$1$7(50µ 6-23 6 3. Troubleshooting When in Trouble Positioning Accuracy Is Poor &ODVVLÀFDWLRQ Causes Position command is not correct. (Amount of command pulse) Count the feedback pulses with a monitor function of the PANATERM or feedback pulse monitor mode of the console while repeating the movement of the same distance. If the value does not return to the same value, review the controller. Make a noise measure to command pulse. Captures the positioning complete signal at the edge. Monitor the deviation at positioning complete signal reception ZLWKWKH&RQQHFWRU;RUWKHZDYHIRUPJUDSKLFIXQFWLRQRIWKH PANATERM. Make the controller capture the signal not at the edge but with some time allowance. Shape or width of the command pulse is not per the VSHFLÀFDWLRQV If the shape of the command pulse is broken or narrowed, review the pulse generating circuit. Make a noise measure. Noise is superposed on deviation counter clear input CL &RQQHFWRU;3LQ Make a noise measure to external DC power supply and make no wiring of the unused signal lines. Adjustment Position loop gain is small. Check the position deviation with the monitor function of the PANATERM or at the monitor mode of the console. ,QFUHDVHWKHVHWXSRI3UZLWKLQWKHUDQJHZKHUHQRRVFLOODWLRQ occurs. Parameter Setup of the positioning complete range is large. Lower the setup of Pr4.31 within the range where no chattering of complete signal occurs. Command pulse frequency have H[FHHGHGNSSVRU0SSV Lower the command pulse frequency. Change the division/ multiplication ratio of 1st and 2nd numerator of command division/ PXOWLSOLFDWLRQ3UDQG3U8VHDSXOVHOLQHLQWHUIDFH exclusive to line driver when pulse line interface is used. Setup of the division/ multiplication is not correct. Check if the repetition accuracy is same or not. If it does not change, use a larger capacity motor and driver. Velocity loop gain is proportion action at motor in stall. 6HWXS3UDQG3URIWLPHFRQVWDQWRIYHORFLW\ORRS LQWHJUDWLRQWRRUVPDOOHU 5HYLHZWKHZLULQJDQGFRQQHFWLRQVRWKDWWKHFRQQHFWLRQEHWZHHQ Pin-27 and 41 of the gain switching input connector, Connector ;EHFRPHVRIIZKLOH\RXVHWXS3URIQGJDLQVHWXSWR Each input signal of Connector ;LVFKDWWHULQJ 1) Servo-ON signal &KHFNWKHZLULQJDQGFRQQHFWLRQEHWZHHQ3LQDQGRIWKH FRQQHFWRU&RQQHFWRU;XVLQJWKHGLVSOD\IXQFWLRQRI,2VLJQDO status. Correct the wiring and connection so that the servo-On signal can be turned on normally. Review the controller. &KHFNWKHZLULQJDQGFRQQHFWLRQEHWZHHQ3LQDQGRIWKH FRQQHFWRU&RQQHFWRU;XVLQJGLVSOD\IXQFWLRQRI,2VLJQDO status. Correct the wiring and connection so that the deviation counter clear input can be turned on normally. Review the controller. 3 Check the wiring and connection between Pin-18 and 17, 16 and RIWKHFRQQHFWRU&RQQHFWRU;XVLQJWHVWHURURVFLOORVFRSH Correct the wiring and connection so that Positive/Negative direction torque limit input can be entered normally. 4) Check the wiring and connection between Pin-33 and 41of the FRQQHFWRU&RQQHFWRU;XVLQJGLVSOD\IXQFWLRQRI,2VLJQDO status. Correct the wiring and connection so that the command pulse inhibition input can be entered normally. Review the controller. System Wiring 2) Deviation counter clear input signal 3) Positive/Negative direction torque limit input signal 4) Command pulse inhibition input Installation Related page 6-24 Measures Load inertia is large. Check the overshoot at stopping with graphic function of the PANATERM. If no improvement is obtained, increase the driver and motor capacity. 3´'HWDLOVRISDUDPHWHUµ3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 3´2XWOLQHRI6HWXSVXSSRUWVRIWZDUH´3$1$7(50µ 3. Troubleshooting When in Trouble Origin Point Slips &ODVVLÀFDWLRQ System Measures Z-phase is not detected. Check that the Z-phase matches to the center of proximity dog. Execute the homing matching to the controller correctly. +RPLQJFUHHSVSHHGLVIDVW Lower the homing speed at origin proximity. Or widen the origin sensor. Chattering of proximity sensor (proximity dog sensor) output . Check the dog sensor input signal of the controller with oscilloscope. Review the wiring near to proximity dog and make a noise measure or reduce noise. Noise is on the encoder line. 5HGXFHQRLVH LQVWDOODWLRQRIQRLVHÀOWHURUIHUULWHFRUH VKLHOG treatment of I/F cables, use of a twisted pair or separation of power and signal lines. 2 Check the Z-phase signal with oscilloscope. Check that the PinRIWKHFRQQHFWRUFRQQHFWRU;LVFRQQHFWHGWRWKHHDUWKRIWKH controller. Connect the earth of the controller because the open collector interface is not insulated. Replace the motor and driver. Request for repair. Miswiring of Z-phase output. Check the wiring to see only one side of the line driver is connected or not. Use a CZ output (open collector if the controller is not differential input. 3 Connection No Z-phase signal output. Preparation Wiring Causes 1 Before Using the Products 6 4 Setup 6 3. Troubleshooting When in Trouble Abnormal Motor Noise or Vibration Causes Measures Wiring Noise is on the speed command. Measure the speed command inputs of Pin-14 and 15 of the connector, &RQQHFWRU; with an oscilloscope. Reduce noise LQVWDOODWLRQRIQRLVHÀOWHURUIHUULWHFRUH VKLHOGWUHDWPHQWRI,) cables, use of a twisted pair, separation of power and signal lines. Adjustment Gain setup is large. /RZHUWKHJDLQE\VHWWLQJXSORZHUYDOXHVWR3UDQGRI YHORFLW\ORRSJDLQDQG3UDQG3URISRVLWLRQORRSJDLQ Installation Resonance of the machine and the motor. 5HDGMXVW3UDQG Check if the machine resonance exists or not with frequency characteristics analyzing function of the PANATERM. Set up the QRWFKIUHTXHQF\WR3U3U3URU3ULIUHVRQDQFH exists. Motor bearing Check the noise and vibration near the bearing of the motor while running the motor with no load. Replace the motor to check. Request for repair. Electro-magnetic sound, gear noise, rubbing noise at brake engagement, hub noise or rubbing noise of encoder. Check the noise of the motor while running the motor with no load. Replace the motor to check. Request for repair. Adjustment &ODVVLÀFDWLRQ 5 6 When in Trouble Supplement 6-25 7 6 3. Troubleshooting When in Trouble &ODVVLÀFDWLRQ Causes Measures Adjustment Gain adjustment is not proper. Check with graphic function of PANATERM or monitor (connector ; 0DNHDFRUUHFWJDLQDGMXVWPHQW5HIHUWR´$GMXVWPHQWµ Installation Load inertia is large. Check with graphic function of PANATERM or monitor (Connector ; 0DNHDQDSSURSULDWHDGMXVWPHQW,QFUHDVHWKHPRWRUDQG driver capacity and lower the inertia ratio. Use a gear reducer. Looseness or slip of the machine. Review the mounting to the machine. Ambient temperature, environment. Lower the temperature with cooling fan if the ambient temperature exceeds the predications. Stall of cooling fan, dirt of fan ventilation duct. Check the cooling fans of the driver and the machine. Replace the GULYHUIDQRUUHTXHVWIRUUHSDLU 7KHXSSHUIDQRQWKH+IUDPHGULYHU stops during servo OFF to save energy. This is normal.) Mismatching of the driver and the motor. Check the name plates of the driver and the motor. Select a correct combination of them referring to the instruction manual or catalogue. Failure of motor bearing. Check that the motor does not generate rumbling noise while turning it by hand after shutting off the power. Replace the motor and request for repair if the noise is heard. Electromagnetic brake is kept engaged (left un-released). Check the voltage at brake terminals. Apply the power (DC24V) to release the brake. Motor failure (oil, water or others) Avoid the installation place where the motor is subject to high temperature, humidity, oil, dust or iron particles. Motor has been turned by external force while dynamic brake has been engaged. Check the running pattern, working condition and operating status, and inhibit the operation under the condition of the left. 6 3. Troubleshooting When in Trouble &ODVVLÀFDWLRQ Motor Speed Does Not Reach to the Setup, Motor Revolutions (Travel) Is Too Large or Small Causes Measures Parameter Velocity command input gain is not correct. &KHFNWKDWWKHVHWXSRI3UVSHHGFRPPDQGLQSXWJDLQLV PDGHVRDVWRPDNHWKHVHWXSRIPDNHVUPLQ9 Adjustment Position loop gain is low. 6HWXS3UDQG3USRVLWLRQORRSJDLQWRDSSUR[ Division/Multiplication is not proper. 6HWXSFRUUHFWYDOXHVWR3UVWQXPHUDWRURIHOHFWURQLF JHDU3UQXPHUDWRUPXOWLSOLHURIHOHFWURQLFJHDUDQG3U denominator of electronic gear. Refer to parameter setup at each mode. Related page 6-26 Overshoot/Undershoot, Overheating of the Motor (Motor Burn-Out) 3´'HWDLOVRISDUDPHWHUµ3´2XWOLQHRI6HWXSVXSSRUWVRIWZDUH´3$1$7(50µ 3. Troubleshooting When in Trouble Parameter Returns to Previous Setup &ODVVLÀFDWLRQ Causes Parameter No writing to EEPROM has been carried out before turning off the power. 1 Before Using the Products 6 Measures 5HIHUWR3´((3520:ULWLQJ0RGHµRI3UHSDUDWLRQ 2 Preparation 3 Connection 4 Setup 5 Adjustment 6 When in Trouble 7 Supplement 6-27 MEMO 6-28 7. Supplement 1 Before Using the Products 1. Safety function Outline ........................................................................................................7-2 Input & output signals .................................................................................7-3 2 Preparation Safety Circuit Block Diagram ......................................................................7-5 Timing Chart ...............................................................................................7-6 Example of connection ...............................................................................7-8 2. Absolute system Outline ......................................................................................................7-10 &RQÀJXUDWLRQ ............................................................................................7-11 Battery (for Backup) Installation ................................................................7-12 Setup (Initialization) of Absolute Encoder .................................................7-16 Transferring absolute data ........................................................................7-16 Transferring external scale absolute data .................................................7-21 Display of Battery Alarm ...........................................................................7-25 3 Connection 3.Outline of Setup Support Software, “PANATERM” Setup on the PC .......................................................................................7-26 4. Communication Outline ......................................................................................................7-27 6SHFLÀFDWLRQV............................................................................................7-28 List of Communication Command .............................................................7-39 4 Details of Communication Command .......................................................7-40 Setup 5. Motor Characteristics (S-T Characteristics) Motor .........................................................................................................7-55 6. Dimensions Driver A-frame, B-frame .........................................................................7-73 C-frame, D-frame (200 V) ............................................................7-74 D-frame (400 V), E-frame (200 V) ................................................7-75 E-frame (400 V), F-frame .............................................................7-76 5 Adjustment G-frame ........................................................................................7-77 H-frame ........................................................................................7-78 Motor .........................................................................................................7-79 7. Options Noise Filter ................................................................................................7-94 6 When in Trouble Surge Absorber .........................................................................................7-98 Noise Filter for Signal Lines ......................................................................7-99 Junction Cable for Encoder ....................................................................7-100 Junction Cable for Motor (Without brake) ...............................................7-103 Junction Cable for Motor (With brake) ....................................................7-106 Junction Cable for Brake ........................................................................7-108 Connector Kit ..........................................................................................7-109 Battery For Absolute Encoder .................................................................7-118 Mounting Bracket ....................................................................................7-119 Reactor ...................................................................................................7-120 External Regenerative Resistor ..............................................................7-122 7 Supplement Recommended components(Surge absorber for motor brake) ..............7-124 List of Peripheral Equipments .................................................................7-125 7-1 7 1. Safety function Supplement Outline Outline description of safe torque off (STO) The safe torque off (STO) function is a safety function that shuts the motor current and turns off motor output torque by forcibly turning off the driving signal of the servo driver internal power transistor. For this purpose, the STO uses safety input signal and hardware (circuit). When STO function operates, the servo driver turns off the servo ready output signal (S-RDY) and enters safety state. This is an alarm condition and the 7-seg LED on the front panel displays the error code number. Safety precautions When using the STO function, be sure to perform equipment risk assessment to ensure that the system conforms to the safety requirements. Even while the STO function is working, the following potential safety hazards exist. Check safety in risk assessment. The motor may move when external force (e.g. gravity force on vertical axis) is exerted on it. Provide an external brake, etc., as necessary to secure the motor. Note that the purpose of motor with brake is holding and it cannot be used for braking application. When parameter Pr5.10 Sequence at alarm is set to free run (disable dynamic brake), the motor is free run state and requires longer stop distance even if no external force is applied. Make sure that this does not cause any problem. When power transistor, etc., becomes defective, the motor will move to the extent equivalent of 180 electrical angle (max.). Make sure that this does not cause any problem. The STO turns off the current to the motor but does not turn off power to the servo driver and does not isolate it. When starting maintenance service on the servo driver, turn off the driver by using a different disconnecting device. External device monitor (hereafter EDM) output signal is not a safety signal. Do not use it for an application other than failure monitoring. Dynamic brake and external brake release signal output are not related to safety function. When designing the system, make sure that the failure of external brake release during STO condition does not result in danger condition. When using STO function, connect equipment conforming to the safety standards. Note Related page 7-2 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 6DIHW\IXQFWLRQFRQQHFWRU 3´&RQIRUPDQFHWRLQWHUQDWLRQDOVWDQGDUGVµ3´+RZWR8VHWKH)URQW3DQHOµ 3´,QSXWVDQGRXWSXWVRQFRQQHFWRU;µ 1. Safety function Supplement Input & output signals 1 Before Using the Products 7 Safety input signal For list of connector pin numbers, refer to P.2-53, Signal SF1+ 4 6)ï 3 SF2+ 6 6)ï 5 Safety input 1 Safety input 2 Control mode Contents Input 1 that triggers STO function. This input turns off the upper arm drive signal of power transistor. When using the function, connect this pin in a way so that the photocoupler of this input circuit turns off to activate STO function. Input 2 that triggers STO function. This input turns off the lower arm drive signal of power transistor. When using the function, connect this pin in a way so that the photocoupler of this input circuit turns off to activate STO function. Compatible all control mode Safety input 1 or 2 enables STO to operate: within 5 ms of response time, the motor output torque will be turned off. Caution 2 4 Setup 6DIHW\HTXLSPHQWVHOIGLDJQRVLV/SXOVH Safety output signal from the safety controller and safety sensor may include L pulse for self-diagnosis. To prevent the L pulse from mis-triggering STO function, the safety input circuit has EXLOWLQÀOWHUWKDWUHPRYHVWKHVHOIGLDJQRVLV/SXOVH Therefore, if the off period of safety input signal less than 1 ms, the safety input circuit GRHVQRWGHWHFWWKLV´RIIµHYHQW 7RYDOLGDWHWKLV´RIIµSHULRGWXUQRIIWKHLQSXWVLJQDOIRUPRUHWKDQPV 3 Connection Pin No. Preparation Symbol 5 L pulse for self-diagnosis 5 ms or more 1 ms or shorter Servo driver Operate Adjustment Safety input signal 5 ms or shorter Response time 6 STO state When in Trouble 7 Supplement Note 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 6DIHW\IXQFWLRQFRQQHFWRU 7-3 1. Safety function Input & output signals External device monitor (EDM) output signal The monitor output signal is used by the external device to monitor the state of the safety input signal. Connect the monitor output to the external device monitor terminal of the safety devices such as safety controller and safety sensor. Signal Control mode Symbol Pin No. Contents EDM+ 8 Outputs monitor signal that is used to check the EDM output safety function. ('0ï 7 Caution This output signal is not a safety output. Compatible all control mode /RJLFDOUHODWLRQVKLSEHWZHHQVDIHW\LQSXWVLJQDODQG('0RXWSXWVLJQDO When both safety input 1 and 2 are off, i.e. when STO function of 2 safety input channels are active, the photocoupler in EDM output circuit turns on. Signal Safety input EDM output Symbol SF1 Photocoupler logic ON ON OFF OFF SF2 ON EDM OFF OFF ON OFF OFF OFF ON By monitoring the logics (all 4 states) of photocoupler shown in the table above, the external device can determine the status (normal or abnormal) of safety input circuit and EDM output circuit. 7-4 Note Maximum delay time from input of safety 1 and 2 signals to output of EDM signal is 6 ms. Note 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 6DIHW\IXQFWLRQFRQQHFWRU 7 1. Safety function Supplement Safety Circuit Block Diagram μC analog input SF2+ 6 LPF(3ms) μC analog input 5 EDM+ 8 +5V +5V I_SF2 +5V +5V in N O_EDM 7 PC 5V μC port 3.3V level shifter ('0ï 3 PC Connection 6)ï ASIC IL_ERR1 +5V Power section interface +5V Preparation IL_EMG I_SF1 3 Before Using the Products Control Circuit X3 4 6)ï 2 Power +5V +5V SF1+ 1 5V +5V out +5V PS Voltage Monitor 4 Motor Setup M 5 Adjustment 6 When in Trouble 7 Supplement Note 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 6DIHW\IXQFWLRQFRQQHFWRU 7-5 7 1. Safety function Supplement Timing Chart Operating timing for safety status Servo-ON input (SRV-ON) input coupler OFF (Servo-OFF command) input coupler ON (Servo-ON command) Safety input 1 Safety input 2 *3 input coupler OFF (STO) input coupler ON max 5ms Motor energization energized not-energized max 6ms EDM output output coupler ON output coupler OFF 0.5 to 5ms Dynamic brake *2 released Servo-Ready output (S-RDY) Servo-Alarm output (ALM) External brake release output (BRK-OFF) engaged output coupler OFF (not ready) output coupler ON (ready) output coupler ON (not Alarm) output coupler ON (Break release) output coupler OFF (Alarm) Setup value of Pr4.38 output coupler OFF (Break engage) t1*1 motor speed Setup value of Pr4.39 Setup value of Pr4.38 when setup value of Pr4.38 is shorter, output coupler OFF (Break engage) output coupler ON (Break release) t1*1 motor speed Setup value of Pr4.39 when time to fall below value of Pr4.39 is shorter, *1 t1 is the value set to Pr4.38 Setup of mechanical brake action at running or the time at which the motor revolution speed drops below the time set to Pr4.39 Brake release speed setup, whichever comes first. *2 Dynamic brake operates to the setting of Pr5.10 Sequence at alarm. *3 When safety input 1 or 2 turns off, the state changes to STO condition. Note Related page 7-6 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 6DIHW\IXQFWLRQFRQQHFWRU 3´3U3Uµ3´3Uµ 1. Safety function 1 Before Using the Products Timing Chart Return timing from safety state input coupler OFF (Servo-OFF command) Servo-ON input (SEV-ON) *1 input coupler OFF input coupler ON Motor energization 2 Preparation Safety input 1 Safety input 2 input coupler ON (Servo-ON command) not-energized max 6ms EDM output released/engaged *2 generated alarm Servo-Ready output (S-RDY) Servo-Clear intput (ALM) *1 input coupler OFF output coupler OFF (Alarm) External brake release output (BRK-OFF) released/engaged *3 Servo-OFF output coupler ON (ready) Once the servo on command is input, the operation proceeds in synchronous with normal servo on/off timing. (Refer to P.2-61 “Timing Chart”) 3 4 input coupler ON Setup Servo-Alarm output (ALM) output coupler OFF (not ready) output coupler OFF Connection Dynamic brake output coupler ON output coupler ON (not Alarm) output coupler OFF (Break engage) 5 Adjustment 6 When in Trouble *1 Photocouplers for safety input 1 and 2 should be turned on again with servo-on input turned off. Otherwise, alarm occurs, and should be cleared. Alarm clear should be performed after the safety input 1 and 2 have been turned back to on. Otherwise, alarm occurs. *2 This is an alarm condition and the dynamic brake operates according to Pr5.10 Sequence at alarm. *3 This is normal servo-off condition and the dynamic brake operates according to Pr5.06 Sequence at servo-off. 7 Related page Supplement Note 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 6DIHW\IXQFWLRQFRQQHFWRU 3´3Uµ3´3Uµ 7-7 7 1. Safety function Supplement Example of connection Example of connection to safety switch 24V Safety switch Servo driver Contact output SF1+ Safety input 6)ï M Safety input SF2+ 6)ï 0V EDM output EDM+ EDMï Example of connection to safety sensor Safety sensor Sefety output (source) Servo driver Control output 1 SF1+ Safety input 6)ï M Control output 2 Safety input SF2+ 0V 6)ï 24V EDM+ EDM input EDMï EDM output Example of connection to safety controller Safety controller Contact output T31 Servo driver T33 SF1+ Safety input 6)ï M SF2+ A2 S14 6)ï S24 EDM+ EDMï Sefety output (source) Note 7-8 EDM output 0V 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 6DIHW\IXQFWLRQFRQQHFWRU 1. Safety function 1 Before Using the Products Example of connection Example of connection when using multiple axes Safety sensor Sefety output (source) 2 Control output 1 Servo driver Preparation Control output 2 SF1+ 6)ï M 0V SF2+ 24V 6)ï 3 EDM input EDM+ EDMï Connection EDM output Servo driver SF1+ 4 6)ï M SF2+ Setup 6)ï EDM+ EDMï EDM output 5 Servo driver Adjustment SF1+ 6)ï M SF2+ 6)ï 6 EDM+ EDM output Capacity requirement per safety output (source) channel: 50 × No. of connected axes (mA) 24 VDC supply allowable voltage: 24 V±15% Maximum No. of connectable axes: 8 7 Supplement Note When in Trouble EDMï 2QO\IRUSRVLWLRQFRQWUROW\SHLVQRWSURYLGHGZLWK; 6DIHW\IXQFWLRQFRQQHFWRU 7-9 7 2. Absolute system Supplement Outline Outline of Absolute System When you compose an absolute system using an absolute encoder, you are not required to carry out homing operation at the power-on, and this function suits very well to such an application as a robot. &RQQHFWWKHKRVWFRQWUROOHUZLWKWKH0,1$6$ZLWKDEVROXWHVSHFLÀFDWLRQV PRWRUZLWK absolute encoder and driver with absolute spec) and set up the parameter, Pr0.15 to 0 or 2, then connect the battery for absolute encoder to compose an absolute system with which you can capture the exact present position information after the power-ON. Shift the system to origin once after installing the battery and clear the multi-turn data by clearing the absolute encoder, then you can detect the absolute position without carrying out homing operation. Via RS232 or RS485 communication, the host controller can connect up to 32 MINAS-A5 and capture the present position information as serial data to obtain the absolute position of each axis by processing. each data. Applicable Mode UPLQ@ 2XWSXWYDOXHLQELW 6SHHGZLOOEH²IRUQHJDWLYHGLUHFWLRQDQGIRUSRVLWLYHGLUHFWLRQ 5HDGRXWRISUHVHQWWRUTXHRXWSXW 5HFHSWLRQGDWD 0 axis 5 7UDQVPLVVLRQGDWD 3 axis 2 5 4 &RPPDQGHUURU 56HUURU 3 2 When in Trouble checksum (UURUFRGH ELW 1RUPDO (UURU 6 5 2 'DWD SUHVHQWWRUTXH / + HUURUFRGH checksum 0 7 Supplement 5HDGVRXWWKHSUHVHQWWRUTXHRXWSXW 8QLW&RQYHUWHGZLWK5DWHGPRWRUWRUTXH 2XWSXWYDOXHLQELW 7RUTXHFRPPDQGZLOOEH²YDOXHIRUQHJDWLYHGLUHFWLRQDQGYDOXHIRUSRVLWLYHGLUHFWLRQ 7-43 4. Communication Details of Communication Command command 2 mode 6 5HDGRXWRISUHVHQWSRVLWLRQDOFRPPDQGGHYLDWLRQ 5HFHSWLRQGDWD 0 axis 6 7UDQVPLVVLRQGDWD 5 axis 2 6 checksum 2 GDWD GHYLDWLRQ / H Error code checksum (UURUFRGH bit7 0 : Normal 1 : Error 6 5 4 Command error 56HUURU 3 2 1 0 5HDGVRXWWKHSUHVHQWSRVLWLRQDOFRPPDQGGHYLDWLRQ 8QLW>FRPPDQGXQLW@ 2XWSXWYDOXHLQELW %HFRPHVZKHQWKHHQFRGHULVORFDWHGDWQHJDWLYHGLUHFWLRQDJDLQVWSRVLWLRQFRPPDQGDQG²ZKHQLWLVORFDWHG at positive direction. command 2 mode 7 5HDGRXWRILQSXWVLJQDO 5HFHSWLRQGDWD 0 axis 7 7UDQVPLVVLRQGDWD 5 axis 2 7 checksum 2 data L data H Error code checksum (UURUFRGH bit7 0 : Normal 1 : Error 6 5 4 Command error 56HUURU 3 2 1 0 'DWD 6 5 bit7 For 6ZLWFKLQJRI 6SHHG]HUR manufacturer's use electronic gear 1 clamp 4 Control mode switching bit15 14 13 Internal speed For For command manufacturer's use manufacturer's use selection 2 Internal speed command selection 1 bit23 22 21 Damping control Torque limit 6ZLWFKLQJRI electronic gear 2 switching 2 switching Internal speed command selection 3 12 20 31 29 bit31 For For For 6DIHW\LQSXW manufacturer's use manufacturer's use manufacturer's use 2 1 3 CCW over-travel CW over-travel Alarm clear inhibit inhibit 0 6HUYR21 11 10 For Counter clear manufacturer's use Command pulse input inhibition 9 Gain switching 19 17 16 Damping control For For For switching 1 manufacturer's use manufacturer's use manufacturer's use 27 6DIHW\LQSXW 26 25 Torque For manufacturer's use command sign 24 6SHHG command sign Logic of input signal is based on assignment set in the parameter. Because of the internal logical data after conversion of input, it does not directly correspond to the input signal from the connector X5. CW over-travel inhibit input and CCW over-travel inhibit input will change according to the input logic, even if they have been disabled by the parameter, 7-44 4. Communication 1 command 2 mode 8 Before Using the Products Details of Communication Command 5HDGRXWRIRXWSXWVLJQDO 5HFHSWLRQGDWD 0 axis 8 7UDQVPLVVLRQGDWD 7 axis 2 8 checksum 2 2 data L Preparation data H alarm data L H error code checksum HUURUFRGH bit7 0 : Normal 1 : Error 6 5 4 Command error RS485 error 3 2 1 0 3 'DWD 5 Torque in-limit bit15 Excite motor 13 11 12 Dynamic brake Control inrush Control regeneration engagement suppression relay brake bit23 6DIHW\('0 14 &RQWUROSRZHU latch 22 Speed command ON/OFF 21 Alarm attribute output 4 Zero speed detection 20 Speed in-limit output 3 Mechanical brake released 2 Positioning complete (In-position) 10 Full-closed positioning complete 19 18 2nd positioning Positional command complete ON/OFF (In-position) 1 Servo-Alarm 0 Servo-Ready 9 At-speed 8 For PDQXIDFWXUHU VXVH 17 Alarm output 2 16 Alarm output 1 4 6 Fan alarm Setup 31 29 28 27 26 25 24 bit31 For For For For For For For For PDQXIDFWXUHU VXVH PDQXIDFWXUHU VXVH PDQXIDFWXUHU VXVH PDQXIDFWXUHU VXVH PDQXIDFWXUHU VXVH PDQXIDFWXUHU VXVH PDQXIDFWXUHU VXVH PDQXIDFWXUHU VXVH DODUPGDWD bit7 Overload protection Connection bit7 6 For In-speed PDQXIDFWXUHU VXVH 4 3 5 2 1 0 Over-regeneration Encoder Encoder overheat /LIHWLPH For Battery communication alarm alarm detection alarm PDQXIDFWXUHU VXVH alarm alarm bit15 14 13 For For For PDQXIDFWXUHU VXVH PDQXIDFWXUHU VXVH PDQXIDFWXUHU VXVH 12 11 10 9 External scale Oscillation communication detection alarm alarm 8 External scale error alarm 5 0 Servo-Not Ready Normal Positioning not completed Mechanical brake engaged Zero speed not detected Torque not in-limit Not at-speed(Speed not arrived) Not in-speed(Speed not coincided) Full-closed positioning not completed 7XUQRIIUHJHQHUDWLRQ7U Release inrush suppression relay Dynamic brake released 5HOHDVHSRZHUODWFK Energize motor 1 At Servo-Ready At Servo-Alarm Positioning in-complete Mechanical brake released Zero speed detected Torque in-limit Speed arriving In-speed (Speed coincided) Full-closed positioning completed Turn on regeneration Tr Operate inrush suppression relay Dynamic brake engaged 3RZHUDEQRUPDOODWFKLQJ 6HUYRIUHH 6 When in Trouble Signal title Servo-Ready Servo-Alarm Positioning completed Mechanical brake released Zero speed detection Torque in-limit At-speed (Speed arrival) In-speed (Speed coincidence) Full-closed positioning complete Control regeneration brake Control inrush suppression relay Dynamic brake engagement &RQWUROSRZHUODWFK Excite motor Adjustment 7KHWDEOHEHORZVKRZVWKHUHODWLRQRIWKHVLJQDOVDQGDFWLRQV 7 Supplement %HFDXVHRIWKHLQWHUQDOORJLFDOGDWDEHIRUHRXWSXWFRQYHUVLRQLWGRHVQRWGLUHFWO\FRUUHVSRQGWRWKHRXWSXWVLJQDOWRWKH FRQQHFWRU; 1DPHVDQGIXQFWLRQVVKRZQDERYHDUHIRU0,1$6$ JHQHUDOSXUSRVHPRGHO 6RPHRILQSXWVLJQDOVZLOOKDYH GLIIHUHQWPHDQLQJIRUGLIIHUHQWVHULHV 7-45 4. Communication Details of Communication Command command 2 mode 9 5HDGRXWRISUHVHQWVSHHGWRUTXHDQGSRVLWLRQDOFRPPDQGGHYLDWLRQ 5HFHSWLRQGDWD 0 axis 9 7UDQVPLVVLRQGDWD 9 axis 2 9 (UURUFRG ELW 1RUPDO (UURU 2 GDWD/ VSHHG + GDWD/ WRUTXH + GDWD/ checksum GHYLDWLRQ + HUURUFRGH checksum 6 5 4 &RPPDQGHUURU 56HUURU 3 2 1 0 2XWSXWYDOXHRIVSHHGDQGWRUTXHDUHLQELWDQGGHYLDWLRQLQELW 8QLWDQGVLJQRIWKHRXWSXWGDWDLVDVVDPHDVWKDWRIFRPPDQG1R FRPPDQG PRGH PRGH DQG PRGH command 2 mode A 5HDGRXWRIVWDWXVLQSXWVLJQDODQGRXWSXWVLJQDO 7UDQVPLVVLRQGDWD 'K axis 5HFHSWLRQGDWD 0 axis A 2 A checksum 2 FRQWUROPRGH VWDWXV LQSXWVLJQDO/ LQSXWVLJQDO+ RXWSXWVLJQDO/ RXWSXWVLJQDO+ DODUPGDWD/ DODUPGDWD+ HUURUFRGH checksum (UURUFRG ELW 1RUPDO (UURU 6 5 4 &RPPDQGHUURU 56HUURU 3 2 1 0 0HDQLQJRIHDFKELWRIFRQWUROPRGHVWDWXVLQSXWVLJQDORXWSXWVLJQDODQGDODUPGDWDLVDVVDPHDVWKDWRIFRPPDQG 1R FRPPDQG PRGH PRGH DQG PRGH 7-46 4. Communication 1 command 2 mode C Before Using the Products Details of Communication Command 5HDGRXWRIIHHGEDFNVFDOH 5HFHSWLRQGDWD 0 axis C 7UDQVPLVVLRQGDWD %K axis C 2 2 2 Preparation encoder ID (L) (H) status (L) (H) (L) checksum DEVROXWHSRVLWLRQGDWD ELW (H) error code checksum 3 (QFRGHU,' Encoder ID (H) 32h 31h Connection Encoder ID (L) $GGUHVVGDWDRI((3520 $GGUHVVGDWDRI((3520 ST771 $7VHULHV &RPPDQGHUURURFFXUVDWRWKHUFRQWUROPRGHVWKDQIXOOFORVHGFRQWURO 67 6WDWXV / bit7 Thermal alarm 6WDWXV + bit7 0 4 5 6 Signal intensity Signal intensity Transducer error error alarm 1 Initialization error 4 3 2 1 Encoder 0 0 0 error *2 *2 bit4 : logical sum of bit6 and bit 7 of status (L) 4 CPU, memory error 3 &DSDFLW\DQG SKRWRHOHFWULF error 2 Encoder non-matching error 1 Initialization error 4 3 2 1 Encoder 0 0 0 alarm *4 *4 bit4 : logical sum of bit6 and bit 7 of status (L) 5 4 Command error 56HUURU 3 2 1 0 2YHUVSHHG 4 0 0 0 2YHUVSHHG 5 0 0 Adjustment 6 2 Hardware error Setup 5 Encoder error *1 *1 bit5 : Logical sum of bit0 to bit 5 of status (L) $7VHULHV 6WDWXV / bit7 6 5 Thermal alarm 0 Communication error 6WDWXV + bit7 6 5 0 0 Encoder error *3 *3 bit5 : Logical sum of bit0 to bit 5 of status (L) (UURUFRGH bit7 0 : Normal 1 : Error 6 0 3 $%6GHWHFWLRQ error 0 $EVROXWHSRVLWLRQGDWD ELW WR)))))))))))K 6 When in Trouble 7 Supplement 7-47 4. Communication Details of Communication Command command 2 mode D 5HDGRXWRIDEVROXWHHQFRGHU 5HFHSWLRQGDWD 0 axis D 7UDQVPLVVLRQGDWD %K axis D 2 (QFRGHU,' / 3 ELWDEVROXWH 6WDWXV / ELW %DWWHU\DODUP 6\VWHPGRZQ 0XOWLWXUQHUURU 2 HQFRGHU,' / + VWDWXV / + / VLQJOHWXUQGDWD + PXOWLWXUQGDWD / + 0 (UURUFRGH checksum checksum (QFRGHU,' + K 3 &RXQWHU RYHUIORZ 0 2 &RXQWHUURU )XOODEVROXWH VWDWXV 0 2YHUVSHHG 6WDWXV + ELW6\VWHPGRZQ ELW%DWWHU\DODUPPXOWLWXUQHUURUFRXQWHURYHUIORZFRXQWHUURUIXOODEVROXWHVWDWXVDQGORJLFDOVXPRIRYHUVSHHG (UURUFRGH ELW 1RUPDO (UURU &RPPDQGHUURU 56HUURU 3 2 0 &RPPDQGHUURUZLOORFFXUZKHQ\RXXVHWKHDERYHHQFRGHURUDEVROXWHHQFRGHUDVDQLQFUHPHQWDOHQFRGHU 6LQJOHWXUQGDWD ELW KWR))))K 0XOWLWXUQGDWD ELW KWR))))K command 2 mode ( 5HDGRXWRIH[WHUQDOVFDOHGHYLDWLRQDQGVXPRISXOVHV 5HFHSWLRQGDWD 0 axis ( 7UDQVPLVVLRQGDWD 9 axis ( 2 / H[WHUQDOVFDOH )%SXOVHVXP + / H[WHUQDOVFDOHGHYLDWLRQ 2 checksum (UURUFRGH ELW 1RUPDO (UURU + HUURUFRGH checksum &RPPDQGHUURU 56HUURU 3 2 0 ([WHUQDOVFDOH)%SXOVHVXPZLOOUHWXUQWKHSUHVHQWSRVLWLRQRIWKHH[WHUQDOVFDOHFRXQWHULQDEVROXWHFRRUGLQDWHVIURP WKHVWDUWLQJSRLQW ([WHUQDOVFDOH)%SXOVHVXPZLOOEHIRUQHJDWLYHGLUHFWLRQDQGIRUSRVLWLYHGLUHFWLRQ ([WHUQDOVFDOHGHYLDWLRQEHFRPHVZKHQWKHH[WHUQDOVFDOHLVSRVLWLRQHGDWQHJDWLYHGLUHFWLRQDJDLQVWSRVLWLRQ FRPPDQGDQG²ZKHQLWLVSRVLWLRQHGDWSRVLWLYHGLUHFWLRQ 7-48 4. Communication 1 command 7 mode Before Using the Products Details of Communication Command ,QGLYLGXDOUHDGRXWRISDUDPHWHU 5HFHSWLRQGDWD D[LV 7UDQVPLVVLRQGDWD 5 D[LV 7 2 7 L SDUDPHWHUYDOXH Preparation SDUDPHWHUW\SH SDUDPHWHU1R FKHFNVXP H error code FKHFNVXP (UURUFRGH ELW 1RUPDO (UURU 6 5 4 Command error 56HUURU 1R(UURU 1 3 command 7 mode 1 Connection ,IWKHSDUDPHWHUW\SHRUWKHSDUDPHWHU1RLVRXWVLGHWKHUDQJHUHWXUQV1RHUURU 3DUDPHWHUYDOXHLVVLJQH[WHQGHGWRELWVDQGUHWXUQHG ,QGLYLGXDOZULWLQJRISDUDPHWHU 5HFHSWLRQGDWD 6 D[LV 1 7UDQVPLVVLRQGDWD 1 D[LV 7 1 SDUDPHWHUW\SH SDUDPHWHU1R L SDUDPHWHUYDOXH 4 7 error code FKHFNVXP Setup H FKHFNVXP (UURUFRGH ELW 1RUPDO (UURU 6 'DWD(UURU 5 4 Command error 56HUURU 1R(UURU 1 5 command 7 mode 6 :ULWLQJRISDUDPHWHUWR((3520 7 FKHFNVXP (UURUFRGH ELW 1RUPDO (UURU 6 'DWD(UURU 5 4 Command error 56HUURU When in Trouble 7UDQVPLVVLRQGDWD 1 D[LV 5HFHSWLRQGDWD D[LV 7 error code FKHFNVXP Adjustment ,IWKHSDUDPHWHUW\SHRUWKHSDUDPHWHU1RLVRXWVLGHWKHUDQJHUHWXUQV1RHUURU 7KLVFRPPDQGFKDQJHSDUDPHWHUVRQO\WHPSRUDULO\,I\RXZDQWWRZULWHLQWR((3520H[HFXWHWKHSDUDPHWHUZULWLQJ WR((3520 PRGH 6HWXSSDUDPHWHUVQRWLQXVHWRZLWKRXWIDLORULWOHDGVWRGDWDHUURU'DWDHUURUDOVRRFFXUVZKHQWKHSDUDPHWHUYDOXH H[FHHGVWKHVHWXSUDQJH 3DUDPHWHUYDOXHVKRXOGEHVLJQH[WHQGHGWRELWVEHIRUHEHLQJWUDQVPLWWHG 1 Control LV 7 Supplement :ULWHVWKHSUHVHWSDUDPHWHUVWR((3520 7UDQVPLVVLRQGDWDZLOOEHUHWXUQHGDIWHU((3520ZULWLQJFRPSOHWHV,WPD\WDNHPD[VHFIRU((3520ZULWLQJ ZKHQDOOSDUDPHWHUVKDYHEHHQFKDQJHG 'DWDHUURUZLOORFFXUZKHQZULWLQJIDLOV :KHQXQGHUYROWDJHRFFXUVHUURUFRGHRIFRQWURO/9ZLOOEHUHWXUQHGLQVWHDGRIH[HFXWLQJZULWLQJ 7-49 4. Communication Details of Communication Command command 7 mode 6 ,QGLYLGXDOUHDGRXWRIXVHUSDUDPHWHU 5HFHSWLRQGDWD 2 D[LV 6 7UDQVPLVVLRQGDWD 17 (11h) D[LV 6 7 parameter type parameter No. checksum 7 parameter type parameter No. (L) parameter value (H) (L) 0,1 value (H) (L) 0$; value (H) Property L H Error code checksum 3URSHUW\ bit7 Parameter not in use 6 Display inhibited 5 bit15 14 13 (UURUFRGH bit7 0 : Normal 1 : Error 6 4 Change at initialization 12 5 4 Command error RS485 error 3 2 1 11 10 9 3 No.Error 2 1 ,IWKHSDUDPHWHUW\SHRUWKHSDUDPHWHU1RLVRXWVLGHWKHUDQJHUHWXUQV1RHUURU 3DUDPHWHUYDOXH0,1YDOXHDQG0$;YDOXHVKRXOGEHVLJQH[WHQGHGWRELWVEHIRUHEHLQJWUDQVPLWWHG 7-50 0 8 Read only 0 4. Communication 1 command 7 mode 7 Before Using the Products Details of Communication Command 5HDGRXWRIWZRRUPRUHXVHUSDUDPHWHU 5HFHSWLRQGDWD K(16) D[LV 7 7UDQVPLVVLRQGDWD K) D[LV 7 7 SDUDPHWHUW\SH SDUDPHWHU1R SDUDPHWHUW\SH SDUDPHWHU1R SDUDPHWHUW\SH SDUDPHWHU1R FKHFNVXP 2 7 SDUDPHWHUW\SH SDUDPHWHU1R / SDUDPHWHUYDOXH 0,1YDOXH + / 0$;YDOXH + / Preparation 3 Connection + 3URSHUW\ /) +) SDUDPHWHUW\SH SDUDPHWHU1R 4 3URSHUW\ /) +) HUURUFRGH FKHFNVXP ELW 5 14 6 4 &KDQJHDW LQLWLDOL]DWLRQ 5 4 &RPPDQGHUURU 56HUURU 1 11 10 9 1R(UURU 1 0 8 5HDGRQO\ 5 0 Adjustment (UURUFRGH ELW 1RUPDO (UURU 6 'LVSOD\ LQKLELWHG Setup 3URSHUW\ ELW 3DUDPHWHU QRWLQXVH ,IWKHSDUDPHWHUW\SHRUWKHSDUDPHWHU1RLVRXWVLGHWKHUDQJHUHWXUQV1RHUURU 3DUDPHWHUYDOXH0,1YDOXHDQG0$;YDOXHVKRXOGEHVLJQH[WHQGHGWRELWVEHIRUHEHLQJWUDQVPLWWHG 6 When in Trouble 7 Supplement 7-51 4. Communication Details of Communication Command command 7 mode 8 :ULWLQJRIWZRRUPRUHXVHUSDUDPHWHU 5HFHSWLRQGDWD 30h(48) axis 8 7UDQVPLVVLRQGDWD 17(11h) axis 8 7 (1) parameter type (1) parameter No. (L) (1) parameter value 7 (1) parameter type (1) parameter No. (2) parameter type (2) parameter No. (H) (8) parameter type (8) parameter No. Error code checksum (8) parameter type (8) parameter No. (L) (8) parameter value (H) checksum (UURUFRGH ELW 0 : Normal 1 : Error Data Error 5 4 Command error RS485 error 3 No.Error 2 1 0 6HWWRXQXVHGSDUDPHWHU2WKHUZLVHGDWDHUURURFFXUV:KHQGDWDRXWVLGHWKHVSHFLILHGVHWWLQJUDQJHLVVHQWGDWD error occurs. ,IWKHSDUDPHWHUW\SHRUWKHSDUDPHWHU1RLVRXWVLGHWKHUDQJHUHWXUQV1RHUURU command 9 mode 0 5HDGRXWRISUHVHQWDODUPGDWD 5HFHSWLRQGDWD 0 axis 0 7UDQVPLVVLRQGDWD 3 axis 9 0 checksum (UURUFRGH ELW 0 : Normal 1 : Error 5 4 Command error RS485 error 9 alarm No. (Main) DODUP1R 6XE error code checksum 3 2 ,IQRDODUPRFFXUVDODUP1REHFRPHV )RUDODUP1RUHIHUWR33URWHFWLYHIXQFWLRQ :KDWLVDODUPFRGH" RI:KHQLQ7URXEOH 7-52 1 0 4. Communication 1 command 9 mode 2 %DWFKUHDGRXWRIDODUPKLVWRU\ 5HFHSWLRQGDWD 0 axis 2 7UDQVPLVVLRQGDWD 'K axis 9 2 VWODWHVW checksum 3 DODUP1R 0DLQ DODUP1R 6XE HUURUFRGH checksum 2 3 1 0 Connection 5 4 &RPPDQGHUURU &RPPDQGHUURU Preparation WKODWHVW 6 2 9 DODUP1R 0DLQ DODUP1R 6XE DODUP1R 0DLQ DODUP1R 6XE QGODWHVW (UURUFRGH ELW 1RUPDO (UURU Before Using the Products Details of Communication Command @ 0.5 (0.4) 3HDNUXQQLQJUDQJH 0.25 * Continuous torque vs. ambient temp. 95 0.5 50 0.25 3000 4000 5000 VSHHG>UPLQ@ 0 20 30 40 (3600) 0 2000 3000 ambient temp. >&@ 4000 5000 VSHHG>UPLQ@ 0 20 MSMD011 * 1 * ,QSXWYROWDJHWRGULYHU$&9 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH ,QSXWYROWDJHWRGULYHU$&9 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH * Continuous torque vs. ambient temp. torque >1ÃP@ ratio vs. rated torque >@ 95 0.5 Continuous running range 0 2000 3000 75 70 50 3HDNUXQQLQJUDQJH without EUDNH ZLWKEUDNH Continuous running range 4000 5000 0 VSHHG>UPLQ@ 20 30 40 0 2000 3000 ambient temp. >&@ 4000 5000 0 20 VSHHG>UPLQ@ MSMD012 * 1 * Input voltage to driver: AC2009 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH Input voltage to driver: AC2009 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH * Continuous torque vs. ambient temp. 2000 3000 75 70 50 3HDNUXQQLQJUDQJH 0.5 Continuous running range 0 50 0.5 without EUDNH ZLWKEUDNH Adjustment ratio vs. rated torque >@ 95 3HDNUXQQLQJUDQJH 5 * Continuous torque vs. ambient temp. ratio vs. rated torque >@ 40 ambient temp. >&@ MSMD012 * 1 * torque >1ÃP@ 30 4 Setup 0.5 ratio vs. rated torque >@ (0.6) 50 40 * Continuous torque vs. ambient temp. torque >1ÃP@ (0.8) 3HDNUXQQLQJUDQJH (0.6) 30 ambient temp. >&@ MSMD011 * 1 * (0.8) 3 ZLWKEUDNH Connection 2000 70 60 50 3HDNUXQQLQJUDQJH Continuous running range (3600) without EUDNH (0.4) Continuous running range 0 ratio vs. rated torque >@ torque >1ÃP@ Preparation MSMD5AZ * 1 * torque >1ÃP@ 1 Before Using the Products 7 Continuous running range 4000 5000 VSHHG>UPLQ@ 0 20 30 40 0 2000 ambient temp. >&@ 3000 4000 5000 VSHHG>UPLQ@ 0 20 30 40 ambient temp. >&@ When in Trouble * These are subject to change. Contact us when you use these values for your machine design. * 5DWLRWRWKHUDWHGWRUTXHDWDPELHQWWHPSHUDWXUHRIÝ&LVLQFDVHRIZLWKRXWRLOVHDOZLWKRXWEUDNH :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque 6 7 5XQQLQJUDQJH 7RUTXHOLPLWVHWXS Continuous running range speed 7-55 Supplement 5XQQLQJUDQJH 7RUTXHOLPLWVHWXS 5XQQLQJUDQJH 7RUTXHOLPLWVHWXS 7 5. Motor Characteristics (S-T Characteristics ) Supplement MSMD series : MSMD series (200W) Without oil seal With oil seal MSMD021 * 1 * MSMD021 * 1 * Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 100 2.0 Peak running range 1.0 Continuous running range 1000 2000 3000 4000 5000 speed [r/min] 0 80 70 50 1.0 (0.9) (0.5) 10 20 30 40 0 (3600) 1000 2000 3000 30 ratio vs. rated torque [%] 100 2.0 (1.5) (1.2) 40 1.0 Continuous running range 80 70 50 Peak running range with brake Continuous running range (4500) 3000 without brake 100 2.0 (1.5) (1.2) 50 Peak running range 2000 20 ambient temp. [°C] * Continuous torque vs. ambient temp. ratio vs. rated torque [%] 1000 10 Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 0 0 4000 5000 speed [r/min] MSMD022 * 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 1.0 with brake Continuous running range ambient temp. [°C] MSMD022 * 1 * without brake 100 Peak running range 50 (3600) ratio vs. rated torque [%] 2.0 (0.9) (0.5) 0 * Continuous torque vs. ambient temp. torque [N·m] 4000 5000 speed [r/min] 0 10 20 30 40 0 (4500) 1000 2000 ambient temp. [°C] 3000 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] * These are subject to change. Contact us when you use these values for your machine design. :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque Running range (Torque limit setup : 300%) Running range (Torque limit setup : 200%) Running range (Torque limit setup : 100%) Continuous running range speed 7-56 5. Motor Characteristics (S-T Characteristics ) Supplement MSMD series :WR: MSMD series (400W to 750W) Without oil seal With oil seal MSMD041 * 1 * MSMD041 * 1 * Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) 2 Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. * Continuous torque vs. ambient temp. ratio vs. rated torque [%] torque [N·m] ratio vs. rated torque [%] 4.0 100 90 4.0 100 50 2.0 Preparation torque [N·m] 75 Peak running range 2.0 (1.3) (0.6) (1.3) Continuous running range 0 (0.6) (2800) (3200) 1000 2000 3000 4000 5000 回転速度 [r/min] 0 10 20 30 40 Peak running range 50 Continuous running range 0 周囲温度 [°C] MSMD042 * 1 * (2800) (3200) 1000 2000 0 3000 4000 5000 回転速度 [r/min] 10 * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 4.0 100 90 4.0 100 50 2.0 Peak running range (1.7) (1.3) 75 50 4 Continuous running range (3400)(3800) 3000 Peak running range (1.7) (1.3) Continuous running range 4000 5000 speed [r/min] 0 10 20 30 40 0 (3400)(3800) 1000 2000 3000 ambient temp. [°C] 0 4000 5000 speed [r/min] 10 20 30 40 ambient temp. [°C] Setup MSMD082 * 1 * MSMD082 * 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] torque [N·m] ratio vs. rated torque [%] 8.0 100 8.0 100 Peak running range Peak running range 50 4.0 5 50 4.0 (3.0) (3.0) Continuous running range (3200)(3600) 1000 2000 3000 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] 0 (3200)(3600) 1000 2000 3000 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] Adjustment Continuous running range 0 3 Connection * Continuous torque vs. ambient temp. 2000 40 Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) ratio vs. rated torque [%] 1000 30 周囲温度 [°C] torque [N·m] 0 20 MSMD042 * 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 2.0 1 Before Using the Products 7 * These are subject to change. Contact us when you use these values for your machine design. 6 When in Trouble 7 Supplement 7-57 7 5. Motor Characteristics (S-T Characteristics ) Supplement MSME series :WR: MSME series (50W to 100W) Without oil seal With oil seal MSME5AZ * 1 * MSME5AZ * 1 * ,QSXWYROWDJHWRGULYHU$&9 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH ,QSXWYROWDJHWRGULYHU$&9 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH * Continuous torque vs. ambient temp. ratio vs. rated torque >@ torque >1ÃP@ 0.5 0 0.5 50 0.25 3HDNUXQQLQJUDQJH 0.25 * Continuous torque vs. ambient temp. Continuous running range 2000 3000 4000 5000 6000 0 ratio vs. rated torque >@ torque >1ÃP@ 20 30 40 0 MSME5AZ * 1 * Continuous running range 2000 3000 4000 5000 6000 * Continuous torque vs. ambient temp. 20 50 0 20 30 40 0 ZLWKEUDNH 70 60 50 Continuous running range 2000 3000 4000 5000 6000 0 VSHHG>UPLQ@ ambient temp. >&@ VSHHG>UPLQ@ 20 MSME011 * 1 * ,QSXWYROWDJHWRGULYHU$&9 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH ,QSXWYROWDJHWRGULYHU$&9 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH * Continuous torque vs. ambient temp. torque >1ÃP@ ratio vs. rated torque >@ ratio vs. rated torque >@ 75 70 0.5 50 3HDNUXQQLQJUDQJH 50 0.5 Continuous running range 2000 3000 4000 5000 6000 VSHHG>UPLQ@ 0 20 30 40 0 ambient temp. >&@ without EUDNH ZLWKEUDNH 3HDNUXQQLQJUDQJH Continuous running range 2000 3000 4000 5000 6000 VSHHG>UPLQ@ 0 20 MSME012 * 1 * Input voltage to driver: AC2009 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH Input voltage to driver: AC2009 'RWWHGOLQHUHSUHVHQWVWRUTXHDWOHVVYROWDJH * Continuous torque vs. ambient temp. ratio vs. rated torque >@ 0 3HDNUXQQLQJUDQJH 50 0.5 0 20 30 40 ambient temp. >&@ 0 without EUDNH ZLWKEUDNH Continuous running range 2000 3000 4000 5000 6000 VSHHG>UPLQ@ ratio vs. rated torque >@ 3HDNUXQQLQJUDQJH 0.5 75 70 50 Continuous running range 2000 3000 4000 5000 6000 VSHHG>UPLQ@ 0 20 30 40 ambient temp. >&@ * These are subject to change. Contact us when you use these values for your machine design. * 5DWLRWRWKHUDWHGWRUTXHDWDPELHQWWHPSHUDWXUHRIÝ&LVLQFDVHRIZLWKRXWRLOVHDOZLWKRXWEUDNH 7-58 40 * Continuous torque vs. ambient temp. torque >1ÃP@ 30 ambient temp. >&@ MSME012 * 1 * torque >1ÃP@ 40 * Continuous torque vs. ambient temp. torque >1ÃP@ 30 ambient temp. >&@ MSME011 * 1 * 0 40 without EUDNH 3HDNUXQQLQJUDQJH 0.25 Continuous running range 2000 3000 4000 5000 6000 ratio vs. rated torque >@ 0.5 3HDNUXQQLQJUDQJH 0.25 30 ambient temp. >&@ * Continuous torque vs. ambient temp. torque >1ÃP@ 0.5 0 Input voltage to driver: AC2009 ratio vs. rated torque >@ torque >1ÃP@ 0 VSHHG>UPLQ@ MSME5AZ * 1 * Input voltage to driver: AC2009 ZLWKEUDNH 70 60 50 3HDNUXQQLQJUDQJH ambient temp. >&@ VSHHG>UPLQ@ without EUDNH 5. Motor Characteristics (S-T Characteristics ) Supplement MSME series : MSME series (200W) Without oil seal With oil seal MSME021 * 1 * MSME021 * 1 * Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 100 Peak running range 1.0 50 0 (0.32) (2600) (3100) 1000 2000 3000 4000 5000 6000 speed [r/min] 0 50 (0.8) Continuous running range 10 20 30 40 Continuous running range 0 ambient temp. [°C] MSME022 * 1 * (2600) (3100) 20 30 40 ambient temp. [°C] 3 100 (1.3) (1.1) 50 (0.32) 1000 2000 3000 4000 5000 6000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] 0 without brake with brake 100 80 70 Peak running range 50 1.0 Continuous running range (4600) ratio vs. rated torque [%] 2.0 Peak running range 1.0 * Continuous torque vs. ambient temp. torque [N·m] Connection ratio vs. rated torque [%] 2.0 0 10 Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] (0.32) 0 1000 2000 3000 4000 5000 6000 speed [r/min] MSME022 * 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (1.3) (1.1) without brake with brake 100 80 70 2.0 Peak running range 1.0 (0.8) (0.32) ratio vs. rated torque [%] Preparation ratio vs. rated torque [%] 2.0 2 Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 1 Before Using the Products 7 4 Continuous running range (4600) 1000 2000 3000 4000 5000 6000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] Setup * These are subject to change. Contact us when you use these values for your machine design. 5 Adjustment 6 When in Trouble :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque 7 Running range (Torque limit setup : 100%) Continuous running range speed 7-59 Supplement Running range (Torque limit setup : 300%) Running range (Torque limit setup : 200%) 7 5. Motor Characteristics (S-T Characteristics ) Supplement MSME series :WR: MSME series (400W to 750W) Without oil seal With oil seal MSME041 * 1 * MSME041 * 1 * Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 4.0 * Continuous torque vs. ambient temp. torque [N·m] 100 90 4.0 50 2.0 Peak running range (1.7) 75 (0.32) (2600) (3100) 1000 2000 3000 4000 5000 6000 speed [r/min] 0 50 (1.7) Continuous running range 0 100 Peak running range 2.0 (0.32) ratio vs. rated torque [%] 10 20 30 40 Continuous running range (2600) (3100) 0 ambient temp. [°C] MSME042 * 1 * * Continuous torque vs. ambient temp. 4.0 40 100 4.0 50 2.0 ratio vs. rated torque [%] 100 75 Peak running range (1.7) (0.64) (3100)(3600) 1000 2000 3000 4000 5000 6000 speed [r/min] 0 50 (1.7) Continuous running range 10 20 30 40 Continuous running range (3100)(3600) 0 0 1000 2000 3000 4000 5000 6000 speed [r/min] ambient temp. [°C] MSME082 * 1 * 10 20 30 40 ambient temp. [°C] MSME082 * 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 8.0 * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 8.0 100 Peak running range 100 Peak running range 4.0 (3.4) 4.0 (3.4) 50 (3.0) 0 30 * Continuous torque vs. ambient temp. torque [N·m] Peak running range 2.0 (0.6) 20 ambient temp. [°C] Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) ratio vs. rated torque [%] torque [N·m] 0 10 MSME042 * 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (0.64) 0 1000 2000 3000 4000 5000 6000 speed [r/min] (0.6) (3200)(3600) 1000 2000 3000 4000 5000 6000 speed [r/min] 0 50 (3.0) Continuous running range 10 20 30 40 Continuous running range 0 (3200)(3600) 0 1000 2000 3000 4000 5000 6000 ambient temp. [°C] 10 speed [r/min] 20 30 40 ambient temp. [°C] MSME084 * 1 * Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 8.0 100 Peak running range 4.0 (2.6) (1.6) 0 50 Continuous running range (3500)(3800) 1000 2000 3000 4000 5000 6000 speed [r/min] * These are subject to change. Contact us when you use these values for your machine design. 7-60 0 10 20 30 40 ambient temp. [°C] 5. Motor Characteristics (S-T Characteristics ) Supplement MSME series N:WRN: MSME series (1.0kW to 2.0kW) With oil seal 060(* 1 * 060(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 100 100 Peak running range (6.0) 50 5 ratio vs. rated torque [%] 10 Peak running range (6.0) * Continuous torque vs. ambient temp. torque [N·m] 50 5 (4.0) (4.0) Continuous running range Continuous running range (1.9) 0 (1.9) 1000 2000 3000 (3800) (4200) 0 4000 5000 speed [r/min] 10 20 30 40 0 1000 2000 3000 ambient temp. [°C] 060(* 1 * (3800) (4200) 15 (4.0) Continuous running range (3200) (3600) 3000 4000 5000 speed [r/min] 0 100 85 3 10 20 30 0 40 without brake with brake Peak running range 50 4 Continuous running range 1000 2000 (3200) (3600) 3000 ambient temp. [°C] 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] Setup 060(* 1 * 060(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 20 Peak running range without brake * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 20 100 85 70 10 100 85 70 Peak running range with brake 10 50 (7.0) without brake 5 with brake 50 (7.0) Continuous running range 1000 2000 (2.0) (3300) (3700) 3000 4000 5000 speed [r/min] 0 10 20 30 0 40 Continuous running range 1000 2000 ambient temp. [°C] (3300) (3700) 3000 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] Adjustment 0 40 * Continuous torque vs. ambient temp. 7.5 50 2000 30 ratio vs. rated torque [%] torque [N·m] with brake Peak running range 7.5 without brake 15 100 85 1000 20 ambient temp. [°C] Connection * Continuous torque vs. ambient temp. 0 10 Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) ratio vs. rated torque [%] torque [N·m] (4.0) 0 4000 5000 speed [r/min] 060(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (2.0) Preparation ratio vs. rated torque [%] 10 2 Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 1 Before Using the Products 7 * These are subject to change. Contact us when you use these values for your machine design. 6 When in Trouble :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque 7 Running range (Torque limit setup : 100%) Continuous running range speed 7-61 Supplement Running range (Torque limit setup : 300%) Running range (Torque limit setup : 200%) 7 5. Motor Characteristics (S-T Characteristics ) Supplement MSME series N:WRN: MSME series (3.0kW to 5.0kW) With oil seal 060( * 1 * 060( * 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. ratio vs. rated torque [%] torque [N·m] 100 90 85 30 1000 (3100) (3400) 2000 3000 4000 5000 speed [r/min] 50 (12) (8.0) (5.7) 0 10 20 30 Continuous running range 0 40 1000 (3100) (3400) 2000 3000 ambient temp. [°C] 060(* 1 * 4000 5000 speed [r/min] ratio vs. rated torque [%] 100 90 85 40 without brake (10) Continuous running range 2000 (2800) (3100) 3000 4000 5000 speed [r/min] 100 90 85 40 0 10 20 30 with brake 50 Continuous running range 0 40 without brake Peak running range 20 1000 2000 (2800) (3100) 3000 ambient temp. [°C] 060(* 1 * 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] 060(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 50 100 50 25 70 50 25 Peak running range (15) ratio vs. rated torque [%] 100 70 50 Peak running range (15) Continuous running range 0 30 ratio vs. rated torque [%] 40 50 1000 20 ambient temp. [°C] * Continuous torque vs. ambient temp. torque [N·m] with brake Peak running range 0 10 Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] (10) 0 060(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 20 without brake with brake Peak running range 15 Continuous running range 0 100 90 85 30 50 (12) (8.0) (5.7) * Continuous torque vs. ambient temp. ratio vs. rated torque [%] torque [N·m] with brake Peak running range 15 without brake 1000 Continuous running range (2800) (3200) 2000 3000 4000 5000 speed [r/min] 0 10 20 30 40 0 1000 (2800) (3200) 2000 ambient temp. [°C] 3000 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] * These are subject to change. Contact us when you use these values for your machine design. :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque Running range (Torque limit setup : 300%) Running range (Torque limit setup : 200%) Running range (Torque limit setup : 100%) Continuous running range speed 7-62 5. Motor Characteristics (S-T Characteristics ) Supplement MDME series :WRN: MDME series (400W to 2.0kW) With oil seal 0'0(* * 0'0(* * Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) 4 (3.5) 0 Peak running range 50 5 Continuous running range 1000 2000 3000 speed [r/min] 0 100 Peak running range 50 (4.5) (1.9) (2400) (2700) ratio vs. rated torque [%] 10 100 2 (1.3) * Continuous torque vs. ambient temp. トルク torque [N·m] 10 20 30 40 0 Continuous running range 1000 ambient temp. [°C] 0'0(* * (2100)(2400) 50 Peak running range 50 4 5 (4.0) (3.2) Continuous running range 1000 (2200) 2000 3000 speed [r/min] 0 10 20 30 40 0 Continuous running range 1000 ambient temp. [°C] (2200) 10 20 30 40 ambient temp. [°C] Setup Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 20 * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] ratio vs. rated torque [%] 20 100 Peak running range 5 100 Peak running range 50 10 2000 3000 speed [r/min] 0 10 20 30 40 0 Continuous running range 1000 ambient temp. [°C] 0'0(* * (2300) 0 2000 3000 speed [r/min] 10 20 30 40 ambient temp. [°C] Adjustment (2300) 50 10 (6.0) (4.8) Continuous running range 0'0(* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] * Continuous torque vs. ambient temp. torque [N·m] 100 30 50 15 Peak running range ratio vs. rated torque [%] 100 Peak running range 15 (11) (11) (6.4) (6.4) Continuous running range (2200) 2000 3000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] 0 50 Continuous running range 1000 (2200) 2000 3000 speed [r/min] 0 10 20 30 40 6 When in Trouble 30 1000 0 2000 3000 speed [r/min] 0'0(* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 1000 3 100 (6.0) 0'0(* * 0 40 Connection 10 Peak running range 5 0 30 ratio vs. rated torque [%] 15 100 (6.0) (6.0) (4.8) 20 ambient temp. [°C] * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 15 0 10 Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] (4.0) (3.2) 0 2000 3000 speed [r/min] 0'0(* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 10 Preparation ratio vs. rated torque [%] 6 2 Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 1 Before Using the Products 7 ambient temp. [°C] * These are subject to change. Contact us when you use these values for your machine design. 7 Supplement 7-63 7 5. Motor Characteristics (S-T Characteristics ) Supplement MDME series N:WRN: MDME series (3.0kW to 5.0kW) With oil seal 0'0(* 1 * 0'0(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 50 (28) 25 Peak running range (9.5) 0 (28) 50 25 1000 (9.5) 0 2000 3000 speed [r/min] 100 Peak running range 50 (20) Continuous running range (2200)(2400) ratio vs. rated torque [%] 50 100 (20) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 10 20 30 40 Continuous running range 0 (2200)(2400) 1000 0'0(* 1 * 50 100 Peak running range 50 25 Continuous running range (1900)(2100) 0 2000 3000 speed [r/min] 50 25 (13) 10 20 30 40 Continuous running range 0 (1900)(2100) 1000 20 30 40 ambient temp. [°C] Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] without brake with brake 100 90 85 70 Peak running range 2000 3000 speed [r/min] (3) 10 20 30 40 without brake with brake 100 90 85 70 (20) 0 ratio vs. rated torque [%] 50 35 Continuous running range (1900)(2100) * Continuous torque vs. ambient temp. torque [N·m] Peak running range 50 35 1000 10 0'0(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 0 0 2000 3000 speed [r/min] ambient temp. [°C] 0'0(* 1 * (3) 40 ratio vs. rated torque [%] 50 100 Peak running range (20) 30 * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 1000 20 ambient temp. [°C] Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 0 10 0'0(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (13) 0 2000 3000 speed [r/min] ambient temp. [°C] Continuous running range 0 (1900)(2100) 1000 2000 3000 speed [r/min] ambient temp. [°C] 0 10 20 30 40 ambient temp. [°C] * These are subject to change. Contact us when you use these values for your machine design. :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque Running range (Torque limit setup : 300%) Running range (Torque limit setup : 200%) Running range (Torque limit setup : 100%) Continuous running range speed 7-64 5. Motor Characteristics (S-T Characteristics ) Supplement MDME series N:WRN: 0'0(series(N:WRN:) :LWKRLOVHDO 0'0(* * 0'0(* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (60) 50 50 100 90 100 Peak running range Peak running range 50 50 (47.8) (47.8) Continuous running range 0 1000 (1500) (12) (2200) (2500) 2000 3000 speed [r/min] 0 10 20 30 40 Continuous running range 0 150 20 30 40 ambient temp. [°C] ratio vs. rated torque [%] 150 3 100 (130) Peak running range Peak running range 50 75 (1500)(1700) 2000 3000 speed [r/min] 0 50 75 (70) (52.5) Continuous running range 10 20 30 40 0 4 Continuous running range 1000 (1500)(1700) 0 2000 3000 speed [r/min] ambient temp. [°C] 10 20 30 40 ambient temp. [°C] Setup 0'0(&* * 0'0(&* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] (224) 200 * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] (224) 200 100 90 Peak running range 5 100 90 Peak running range 50 100 2000 3000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] 0 Continuous running range 1000 (1500)(1700) 2000 3000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] Adjustment (1500)(1700) 50 100 (95.5) (57) Continuous running range 1000 10 * Continuous torque vs. ambient temp. torque [N·m] (175) 100 (130) 0 0 Connection ratio vs. rated torque [%] (175) 1000 (2200) (2500) 2000 3000 speed [r/min] Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 0 (1500) 0'0(&* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (70) (52.5) 1000 ambient temp. [°C] 0'0(&* * (95.5) (57) ratio vs. rated torque [%] (119) 100 90 100 (12) * Continuous torque vs. ambient temp. torque [N·m] Preparation ratio vs. rated torque [%] (119) (60) 2 Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 1 Before Using the Products 7 * These are subject to change. Contact us when you use these values for your machine design. 6 When in Trouble 7 Supplement 7-65 7 5. Motor Characteristics (S-T Characteristics ) Supplement MFME series (1.5kW to 4.5kW) MFME series (1.5kW to 4.5kW) With oil seal 0)0(* 1 * 0)0(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] (21.5) (14) Peak running range 0 100 20 (14) 10 ratio vs. rated torque [%] (21.5) 100 20 (7.16) (4.8) * Continuous torque vs. ambient temp. torque [N·m] 50 Continuous running range (2200) (2600) 1000 Peak running range 10 (7.16) (4.8) 2000 3000 speed [r/min] 0 10 20 30 40 Continuous running range 0 (2200) (2600) 1000 20 30 40 ambient temp. [°C] Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] * Continuous torque vs. ambient temp. torque [N·m] (30.4) ratio vs. rated torque [%] (30.4) 100 30 100 30 Peak running range Peak running range 50 15 (11.9) Continuous running range Continuous running range (5) 1000 50 15 (11.9) (5) (1800) 2000 3000 speed [r/min] 0 10 20 30 40 0 (1800) 1000 0 2000 3000 speed [r/min] ambient temp. [°C] 0)0(* 1 * 10 20 30 40 ambient temp. [°C] 0)0(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] * Continuous torque vs. ambient temp. torque [N·m] (54.9) ratio vs. rated torque [%] (54.9) 100 50 100 50 Peak running range Peak running range 50 25 50 25 (21.5) (21.5) (10) (10) Continuous running range 0 10 0)0(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 0 0 2000 3000 speed [r/min] ambient temp. [°C] 0)0(* 1 * 50 1000 Continuous running range (1800) 2000 3000 speed [r/min] 0 10 20 30 40 0 (1800) 1000 2000 3000 speed [r/min] ambient temp. [°C] 0 10 20 30 40 ambient temp. [°C] * These are subject to change. Contact us when you use these values for your machine design. :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque Running range (Torque limit setup : 300%) Running range (Torque limit setup : 200%) Running range (Torque limit setup : 100%) Continuous running range speed 7-66 5. Motor Characteristics (S-T Characteristics ) Supplement MGME series N:WRN: 0*0(VHULHV(N:WRN:) :LWKRLOVHDO 0*0$* * 0*0$* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) ratio vs. rated torque [%] 20 torque [N·m] 50 (8) (4.3) 1000 Peak running range 10 50 (8) (4.3) Continuous running range 0 100 (14) Peak running range 10 ratio vs. rated torque [%] 20 100 (14) * Continuous torque vs. ambient temp. Continuous running range (1600)(1800) 2000 3000 speed [r/min] 0 10 20 30 40 0 1000 (1600)(1800) 50 Peak running range (18) (9.6) 2000 3000 speed [r/min] 0 Peak running range 50 25 Continuous running range 10 20 30 40 4 Continuous running range 0 (1400)(1600) 1000 0 2000 3000 speed [r/min] ambient temp. [°C] 10 20 30 40 ambient temp. [°C] Setup 0*0$* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 70 ratio vs. rated torque [%] 70 Peak running range (40) 50 35 * Continuous torque vs. ambient temp. torque [N·m] 100 100 5 Peak running range 50 35 (1400)(1600) 2000 3000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] 0 1000 (1400)(1600) 2000 3000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] Adjustment (20) (14) Continuous running range (20) (14) Continuous running range 1000 3 100 (28) 50 (1400)(1600) ratio vs. rated torque [%] 50 0*0$* * 0 40 * Continuous torque vs. ambient temp. torque [N·m] 100 25 (40) 30 Connection ratio vs. rated torque [%] 1000 20 ambient temp. [°C] Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 0 10 0*0$* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (18) (9.6) 0 2000 3000 speed [r/min] ambient temp. [°C] 0*0$* * (28) Preparation torque [N·m] 2 Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. 1 Before Using the Products 7 * These are subject to change. Contact us when you use these values for your machine design. 6 When in Trouble 7 Supplement 7-67 7 5. Motor Characteristics (S-T Characteristics ) Supplement MGME series N:WRN: 0'0(series (N:WRN:) With oil seal 0*0(* 1 * 0*0(* 1 * Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] * Continuous torque vs. ambient temp. torque [N·m] (107) (107) 100 100 100 100 Peak running range Peak running range (70) (70) 50 50 (43) (22) ratio vs. rated torque [%] (22) Continuous running range 0 1000 (1500)(1700) 2000 3000 speed [r/min] 0 50 50 (43) 10 20 30 40 Continuous running range 0 1000 (1500)(1700) 20 30 40 ambient temp. [°C] Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 150 * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 150 100 (143) 100 (143) (100) (100) 50 75 Peak running range 0 10 0*0(* 1 * 0*0(* 1 * (57.3) (28) 0 2000 3000 speed [r/min] ambient temp. [°C] Continuous running range 1000 (1500)(1700) 2000 3000 speed [r/min] 0 50 75 Peak running range (57.3) (28) 10 20 30 40 Continuous running range 0 1000 (1500)(1700) 2000 3000 speed [r/min] ambient temp. [°C] 0 10 20 30 40 ambient temp. [°C] * These are subject to change. Contact us when you use these values for your machine design. :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque Running range (Torque limit setup : 300%) Running range (Torque limit setup : 200%) Running range (Torque limit setup : 100%) Continuous running range speed 7-68 5. Motor Characteristics (S-T Characteristics ) Supplement MHMD series : MHMD series (200W) Without oil seal With oil seal 0+0'* * 0+0'* * Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) ratio vs. rated torque [%] 2.0 100 Peak running range 1.0 (0.5) torque [N·m] 0 (0.5) 1000 2000 3000 4000 5000 speed [r/min] 0 Peak running range 1.0 10 20 30 40 Continuous running range 0 1000 2000 (3600) 3000 4000 2.0 100 30 40 * Continuous torque vs. ambient temp. torque [N·m] Peak running range 3 Continuous running range without brake 100 80 70 Peak running range 1.0 50 3000 ratio vs. rated torque [%] 2.0 (1.5) (1.2) 1.0 2000 20 ambient temp. [°C] with brake 50 4 Continuous running range (4500) 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] 0 1000 2000 Connection ratio vs. rated torque [%] 1000 10 Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 0 0 5000 speed [r/min] 0+0'* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (1.5) (1.2) with brake 50 ambient temp. [°C] 0+0'* * without brake 100 80 70 (0.9) Continuous running range (3600) ratio vs. rated torque [%] 2.0 50 (0.9) * Continuous torque vs. ambient temp. Preparation torque [N·m] 2 Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. 1 Before Using the Products 7 3000 (4500) 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] Setup * These are subject to change. Contact us when you use these values for your machine design. 5 Adjustment 6 When in Trouble 7 Supplement 7-69 7 5. Motor Characteristics (S-T Characteristics ) Supplement MHMD series :WR: MHME series (400W to 750W) Without oil seal With oil seal 0+0'* * 0+0'* * Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC100V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] torque [N·m] 4.0 100 90 4.0 50 2.0 ratio vs. rated torque [%] 100 75 Peak running range 2.0 Peak running range (1.3) Continuous running range (0.6) 0 1000 2000 50 (1.3) Continuous running range (0.6) (2800) (3200) 3000 4000 5000 0 10 speed [r/min] 20 30 40 0 1000 2000 (2800) (3200) 3000 ambient temp. [°C] 0+0'* * 4000 0 5000 10 speed [r/min] 20 30 40 ambient temp. [°C] 0+0'* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] torque [N·m] 4.0 100 90 4.0 ratio vs. rated torque [%] 100 75 Peak running range Peak running range 50 2.0 50 2.0 (1.7) (1.3) (1.7) (1.3) Continuous running range 0 1000 2000 Continuous running range (3400) (3800) 3000 4000 5000 speed [r/min] 0 10 20 30 40 0 1000 2000 (3400) (3800) 3000 ambient temp. [°C] 0+0'* * 4000 ratio vs. rated torque [%] 8.0 30 40 * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 8.0 100 Peak running range 100 Peak running range 4.0 4.0 50 (3.0) Continuous running range (3200) (3600) 3000 50 (3.0) Continuous running range 2000 20 ambient temp. [°C] Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 1000 10 0+0'* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 0 0 5000 speed [r/min] 4000 5000 speed [r/min] 0 10 20 30 40 0 1000 2000 ambient temp. [°C] (3200) (3600) 3000 4000 5000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] * These are subject to change. Contact us when you use these values for your machine design. :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque Running range (Torque limit setup : 300%) Running range (Torque limit setup : 200%) Running range (Torque limit setup : 100%) Continuous running range speed 7-70 5. Motor Characteristics (S-T Characteristics ) Supplement MHME series N:WRN: 0+0(series (N:WRN:) With oil seal 0+0(* * 0+0(* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) ratio vs. rated torque [%] 15 10 torque [N·m] 10 Peak running range 50 100 Peak running range 50 (6.0) 5 0 ratio vs. rated torque [%] 15 100 (6.0) (4.0) (3.2) * Continuous torque vs. ambient temp. 5 (4.0) (3.2) Continuous running range 1000 (2200) 2000 3000 speed [r/min] 0 10 20 30 40 0 Continuous running range 1000 ambient temp. [°C] 0+0(* * (2200) 20 100 Continuous running range (2300) 2000 3000 speed [r/min] 0 50 10 (6.0) (4.8) 10 20 30 40 0 1000 (2300) 10 20 30 40 ambient temp. [°C] Setup Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 30 * Continuous torque vs. ambient temp. torque [N·m] 100 30 50 15 Peak running range ratio vs. rated torque [%] 100 5 Peak running range 15 (2200) 2000 3000 speed [r/min] 0 10 20 30 40 0 50 Continuous running range 1000 ambient temp. [°C] 0+0(* * (2200) 0 2000 3000 speed [r/min] 10 20 30 40 ambient temp. [°C] Adjustment (6.4) Continuous running range 0+0(* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 50 100 Peak running range 100 Peak running range 50 25 (20) (9.5) Continuous running range (2400) 2000 3000 speed [r/min] 0 50 25 (20) 10 20 30 40 ambient temp. [°C] 0 Continuous running range 1000 (2400) 2000 3000 speed [r/min] 0 10 20 30 40 6 When in Trouble 50 1000 0 2000 3000 speed [r/min] 0+0(* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) 0 4 Continuous running range ambient temp. [°C] 0+0(* * (9.5) 3 Peak running range 50 1000 40 ratio vs. rated torque [%] 20 100 10 0 30 * Continuous torque vs. ambient temp. torque [N·m] Peak running range (6.4) 20 ambient temp. [°C] Connection ratio vs. rated torque [%] 1000 10 Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] 0 0 2000 3000 speed [r/min] 0+0(* * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (6.0) (4.8) Preparation torque [N·m] 2 Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. 1 Before Using the Products 7 ambient temp. [°C] * These are subject to change. Contact us when you use these values for your machine design. 7 Supplement 7-71 7 5. Motor Characteristics (S-T Characteristics ) Supplement MHME series N:WRN: 0+0(series (N:WRN:) With oil seal 0+0(* 1 * 0+0(* 1 * Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. * Continuous torque vs. ambient temp. torque [N·m] torque [N·m] ratio vs. rated torque [%] 50 50 100 100 Peak running range Peak running range (13) Continuous running range 0 (1900) (2100) 1000 50 25 50 25 (13) ratio vs. rated torque [%] 0 2000 3000 speed [r/min] 10 20 30 40 Continuous running range 0 (1900) (2100) 1000 0+0(* 1 * ratio vs. rated torque [%] 100 90 85 70 Peak running range without brake 30 40 * Continuous torque vs. ambient temp. torque [N·m] ratio vs. rated torque [%] 70 100 90 85 with brake Peak running range 50 35 without brake with brake 50 35 (20) (20) Continuous running range (3) 0 1000 Continuous running range (3) (1900) (2100) 2000 3000 speed [r/min] 0 10 20 30 40 0 (1900) (2100) 1000 0 2000 3000 speed [r/min] ambient temp. [°C] 0+0(* 1 * 10 20 30 40 ambient temp. [°C] 0+0(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. ratio vs. rated torque [%] torque [N·m] * Continuous torque vs. ambient temp. ratio vs. rated torque [%] torque [N·m] (119) (119) 100 100 100 100 Peak running range (60) 50 50 Peak running range 50 50 (47.8) 0 20 ambient temp. [°C] Input voltage to driver: AC400V (Dotted line represents torque at 10% less voltage.) * Continuous torque vs. ambient temp. torque [N·m] (12) 10 0+0(* 1 * Input voltage to driver: AC200V (Dotted line represents torque at 10% less voltage.) (60) 0 2000 3000 speed [r/min] ambient temp. [°C] (47.8) Continuous running range 1000 (1500) (12) (2200) (2500) 2000 3000 speed [r/min] 0 10 20 30 40 Continuous running range 0 1000 (1500) ambient temp. [°C] (2200) (2500) 2000 3000 speed [r/min] 0 10 20 30 40 ambient temp. [°C] * These are subject to change. Contact us when you use these values for your machine design. :KHQ\RXORZHUWKHWRUTXHOLPLWVHWXS 3DQG running range at high speed might be lowered as well. torque Running range (Torque limit setup : 300%) Running range (Torque limit setup : 200%) Running range (Torque limit setup : 100%) Continuous running range speed 7-72 6. Dimensions Supplement Driver 1 Before Using the Products 7 A-frame 2 (22.4) 40 7 2.5 20.4 Mounting bracket (Option) .2 (18) ø5 (20) Preparation 40 3.5 ø5 .2 125 140 5.2 2.5 7 4.5 Rack mount type Option : Front-end mounting ( 3 Mounting bracket (Option) 5 180 5 24 Connection Name plate 170 150 150 (27) 5.2 28 130 (70) 6 Base mount type Standard: Back-end mounting ) ( ) 4 Mass: 0.8kg Setup B-frame 5 55 55 7 2.5 20.4 Mounting bracket (Option) .2 (18) ø5 (20) Adjustment (22.4) 47 3.5 ø5 .2 125 140 24 2.5 4.5 7 Rack mount type Option : Front-end mounting ( Mounting bracket (Option) 5.2 43 6 130 (70) ) Base mount type Standard: Back-end mounting ( ) 3´'ULYHUµ3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ 7-73 7 Supplement Mass: 1.0kg Related page When in Trouble Name plate 5.2 6 5 180 170 150 150 (27) 6. Dimensions Driver C-frame 65 65 40 (22.4) 20.4 (22) 20 2.5 Mounting bracket (Option) 2 (15) ø5. 4 ø5 .2 120 140 180 170 150 150 (27) Name plate 24 5 5.2 2.5 4.5 20 Mounting bracket (Option) 5.2 50 170 Rack mount type Option : Front-end mounting ( 7.5 Base mount type Standard: Back-end mounting (70) 40 5 (18) ( ) ) Mass: 1.6kg 'IUDPH 9 (86) (86) 85 (22.4) 60 10 (22) 40 2.5 20.4 Mounting bracket (Option) (15) 2-ø5.2 4 ø5 .2 120 140 180 170 150 150 (27) Name plate 24 5 (18) Direction of air flowing from the internal cooling fan 5.2 5.2 40 60 10 Rack mount type Option : Front-end mounting ( 2.5 4.5 Mounting bracket (Option) 5.2 70 170 (70) ) R2 .6 8.5 Base mount type Standard: Back-end mounting ( ) Mass: 1.8kg Related page 7-74 3´'ULYHUµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ 6. Dimensions 1 Before Using the Products Driver 'IUDPH 9 2 (92) 85 60 (22) 40 2-ø5.2 (15) 10 (22.4) 20.4 Preparation (92) 2.5 Mounting bracket (Option) 4 4 ø5 .2 120 3 140 24 180 170 150 150 (27) Name plate Connection Direction of air flowing from the internal cooling fan 10 5.2 40 4.5 5.2 Mounting bracket(Option) 5.2 170 7.5 (70) Rack mount type Option : Front-end mounting ( 2.5 5 (18) 70 Base mount type Standard: Back-end mounting ( ) ) Setup Mass: 1.9kg 4 (IUDPH 9 5 85 17.5 50 42.5 (33.1) 31.7 2.5 Mounting bracket (deviation from shipping specification) (3.5) .2 Mounting bracket (29) ø5 5.2 (22) (to shipping specification) 6 130 198 188 168 When in Trouble 168 (32) Name plate 24 (18) 5.2 42.5 17.5 ø5.2 50 85 5.2 7 Mounting bracket (to shipping specification) Mounting bracket 2.5 (deviation from shipping specification) 193 Supplement Direction of air flowing from the internal cooling fan Adjustment (86) (86) Mass: 2.7kg 7-75 6. Dimensions Driver (IUDPH 9 94 85 94 17.5 50 42.5 .2 5.2 2.5 Mounting bracket (deviation from shipping specification) Mounting bracket (29) ø5 5.2 (33.1) 31.7 (22) (to shipping specification) 130 198 188 168 168 (32) Name plate 24 (18) ø5.2 5.2 42.5 Direction of air flowing from the internal cooling fan 17.5 Mounting bracket (to shipping specification) Mounting bracket 5.2 2.5 50 (deviation from shipping specification) 193 Mass: 2.7kg )IUDPH 9 130 214 (22) 5.2 42.7 2.5 Mounting bracket (deviation from shipping specification) Mounting bracket (to shipping specification) (23) ø5 65 5.2 .2 130 100 15 125 (32) Mass: 4.8kg [200V] 4.7kg [400V] 7-76 5.2 65 15 ø5.2 Direction of air flowing from the internal cooling fan 100 130 5.2 Name plate 250 240 220 220 24 Mounting bracket (to shipping specification) Mounting bracket 2.5 (deviation from shipping specification) (3.5) (3.5) 6. Dimensions 1 Before Using the Products Driver *IUDPH 9 2 ワヤ L1 ヹヒ ロヒヤ Preparation ヹビ L2 ロ ビヤ ヹピ L3 ワヤ ワヤ B1 ヹフ ュャヒ B2 ュャビ NC ワヤ ヹブ U ワヤ ヹプ ュャピ V ュャフ W 3 ワヤ ヤラモンヨユ Connection Direction of air flowing from the internal cooling fan 233 210 12 90 27 90 (22) 5.2 ø5 5.2 ø5 Mounting bracket 52 2.5 (deviation from shipping specification) .2 .2 Mounting bracket (23) 5.2 334 90 72 (to shipping specification) 3.5 4 Handle 125 Setup ワヤ L1 (32) ヹヒ ロヒヤ ヹビ L2 ロ ビヤ ヹピ L3 24 ワヤ ュャヒ B2 250 ヹフ 220 235 ワヤ B1 ュャビ NC 5 Name plate ワヤ ヹブ U ワヤ ヹプ ュャピ V ュャフ W ワヤ ヤラモンヨユ 90 Adjustment 2 2 27 Mounting bracket 5.2 2.5 (to shipping specification) Mounting bracket (deviation from shipping specification) 90 72 12 5.2 ø5. ø5. 5.2 90 210 6 When in Trouble 7 Related page 3´'ULYHUµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ 7-77 Supplement Mass: 13.5kg 6. Dimensions Driver +IUDPH 9 261 21 270 30.5 200 4 ø7 ø7 125 (32) 435 450 Name plate 7 7 30.5 200 Direction of air flowing from the internal cooling fan 7.5 Name plate Base mount type (Back-end mounting) 266 4 Mount Mount Related page 7-78 3´'ULYHUµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ Mass: 21.0kg 6. Dimensions Supplement Motor 1 Before Using the Products 7 060':WR: 2 Brake connector RH RH 90 °± 1° LW LK 3 ѮLBh7 Connection 4-ѮLZ ѮLA (Key way with center tap shaft) LW KW LK KH □LC LH (7) (D-cut shaft) Motor connector ѮSh6 (7) Shaft end spec. 200 230 LF LR LE TP RH LL Preparation Encoder connector LN 4 Setup * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. 060'VHULHV /RZLQHUWLD 50W 5A * * 1□ * 72 102 100W 01 * * 1 * 92 122 5 25 8 45 30 38 3 6 32 26.3 Adjustment 6 46.5 Key way dimensions 3.4 25 20 7.5 14 12.5 3h9 3 6.2 M3 depth 6 When in Trouble カット 寸法 7 0.32 0.47 0.53 0.68 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ Supplement Motor output Motor model MSMD Without brake LL With brake LR S LA LB LC LE LF LH LN LZ LW D LK RH LW LK KW KH RH TP Without brake Mass (kg) With brake &RQQHFWRUVSHFLÀFDWLRQV 7-79 6. Dimensions Motor 060':WR: Encoder connector Shaft end spec. Brake connector (D-cut shaft) LW 1° LK RH °± Motor connector 4-ѮLZ □LC ѮLBh7 LH ѮLA (Key way with center tap shaft) LW KW LK KH (7) ѮSh6 (7) 200 220 90 LF LR LE RH LL RH TP * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. 060'VHULHV /RZLQHUWLD 200W 02 * * 1□ * 79.5 116 400W 04 * * 1□ * 99 135.5 30 11 14 70 50 60 750W 08 * * 1□ * 112.2 149.2 35 19 90 70 80 3 6.5 43 4.5 30 22 カット 寸法 Motor output Motor model MSMD Without brake LL With brake LR S LA LB LC LE LF LH LZ LW D LK RH LW LK KW KH RH TP Without brake Mass (kg) With brake &RQQHFWRUVSHFLÀFDWLRQV Key way dimensions 10 20 18 4h9 4 8.5 M4 depth 8 0.82 1.3 12.5 25 22.5 5h9 5 11 M5 depth 10 1.2 1.7 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 8 53 6 35 25 17.5 25 22 6h9 6 15.5 2.3 3.1 Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-80 6. Dimensions 1 Before Using the Products Motor 060(:WR: Encoder connector Motor connector LL LM LT 2 LR LC Shaft end spec. (Key way with center tap shaft) LH KW KH ѮLA ѮLBh7 LN LW LK 4-ѮLZ ѮSh6 LE Preparation LF RH TP 3 [With brake] LL LM LT LR LC Shaft end spec. (Key way with center tap shaft) LH ѮLA ѮLBh7 LN LW LK 4-ѮLZ KW KH LE ѮSh6 LF 4 RH TP Setup * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. 060(VHULHV /RZLQHUWLD 50W 5A * * 1 * 72 102 100W 01 * * 1 * 92 122 200W 02 * * 1 * 79.5 116 400W 04 * * 1 * 99 135.5 30 11 14 70 50 60 750W 082 * 1 * 112.2 148.2 35 19 90 70 80 5 Adjustment 25 8 45 30 38 3 — 46.6 6.5 52.5 64.8 94.8 43 27.2 3.4 14 12.5 3h9 3 6.2 M3 depth 6 72.5 109 — 26.5 4.5 20 25 18 22.5 4h9 5h9 4 5 8.5 11 M4 depth 8 M5 depth 10 0.46 0.78 1.2 0.66 1.2 1.6 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3WR´67&KDUDFWHULVWLFVµ 6 6 25 22 6h9 6 15.5 7 2.3 3.1 Supplement 0.31 0.51 53 89.5 — 8 61.6 85.7 121.7 — When in Trouble 44.8 74.8 23 Key way dimensions Motor output Motor model MSME Without brake LL With brake LR S LA LB LC LE LF LH Without brake LM With brake LN LT LZ LW LK KW KH RH TP Without brake Mass (kg) With brake &RQQHFWRUVSHFLÀFDWLRQV Connection Encoder connector Brake connector Motor connector 7-81 6. Dimensions Motor 060(: 9 N:WRN: 'HVLJQ2UGHU LL Motor/Brake connector 44 LC LR LM Shaft end spec. (Key way shaft) LF LE LH KW KH ѮSh6 D ѮL ѮLBh7 LG M3 through LW LK 4-ѮLZ ѮL A RH Encoder connector * All sizes are identical to those of MSME 1.0 to 2.0 kW versions except for LF. LF * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. 060(VHULHV /RZLQHUWLD Motor output Motor model LL MSME Without brake With brake 750W 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 084 * 1 * 10 * * 1 * 15 * * 1 * 20 * * 1 * 30 * * 1 * 40 * * 1 * 50 * * 1 * 131.5 141 159.5 178.5 190 208 243 158.5 168 186.5 205.5 215 233 LR 55 S 19 LA 115 LB 95 LC 100 LD 135 LE 22 110 120 130 162 165 6 10 12 LG 60 LH 101 113 118 Without brake 87.5 97 115.5 134.5 146 164 199 With brake 114.5 124 142.5 161.5 171 189 224 LZ Key way dimensions Mass (kg) 24 145 3 LF LM 268 65 9 LW 45 LK 42 KW 6h9 KH 6 RH 15.5 55 41 51 8h9 7 18 20 Without brake 3.1 3.5 4.4 5.3 8.3 11.0 14.0 With brake 4.1 4.5 5.4 6.3 9.4 12.6 16.0 &RQQHFWRUVSHFLÀFDWLRQV 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-82 6. Dimensions 1 Before Using the Products Motor 060(N:WRN: 'HVLJQ2UGHU& LL Motor/Brake connector 46 □LC LR 2 LM Shaft end spec. (Key way shaft) LF LE LH KH ѮL A KW RH ѮSh6 D ѮL ѮLBh7 LG M3 through LW LK 4-ѮLZ Preparation Encoder connector 3 Connection * All sizes are identical to those of MSME 1.0 to 2.0 kW versions except for LF. LF 4 * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. Setup 060(VHULHV /RZLQHUWLD Motor output Motor model LL MSME Without brake With brake 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 10 * * C * 15 * * C * 20 * * C * 30 * * C * 40 * * C * 50 * * C * 143 161.5 180.5 192 210 245 170 188.5 207.5 217 235 LR 55 19 115 LB 95 LC 100 LD 135 LE 22 110 130 162 165 6 12 6 84 LH 101 113 118 97 115.5 134.5 146 164 199 124 142.5 161.5 171 189 224 Key way dimensions When in Trouble Without brake With brake LZ Mass (kg) 120 10 LG LM 24 145 3 LF 5 Adjustment S LA 270 65 9 LW 45 LK 42 KW 6h9 KH 6 RH 15.5 55 41 51 8h9 7 18 7 20 3.5 4.4 5.3 8.3 11.0 14.0 With brake 4.5 5.4 6.3 9.4 12.6 16.0 &RQQHFWRUVSHFLÀFDWLRQV Supplement Without brake 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-83 6. Dimensions Motor 0'0(:WRN: 'HVLJQ2UGHU Encoder connector Motor/Brake connector LL 44 LR LC LM Shaft end spec. (Key way shaft) LE 4-ѮLZ KW KH ѮLBh7 ѮSh6 ѮLD ѮLA RH LG M3 through LW LK LH LF * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. MDME series (Middle inertia) Motor output 600W 1.0kW 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 044 * 1 * 064 * 1 * 10 * * 1 * 15 * * 1 * 20 * * 1 * 30 * * 1 * 40 * * 1 * 50 * * 1 * Without brake 131.5 141 138 155.5 173 208 177 196 With brake 158.5 168 163 180.5 198 233 202 Motor model LL 400W MDME LR 55 S 19 22 24 35 LA 115 145 200 95 110 114.3 LC 100 130 176 LD 135 165 233 LE 3 6 3.2 LF 10 12 18 60 LH 101 116 118 140 Without brake 87.5 97 94 111.5 129 164 133 152 With brake 114.5 124 119 136.5 155 189 158 177 LZ 9 LW 13.5 45 55 Key way dimensions LK 42 KW 6h9 8h9 10h9 KH 6 7 8 RH Mass (kg) 70 LB LG LM 221 65 41 15.5 18 Without brake 3.1 3.5 With brake 4.1 4.5 &RQQHFWRUVSHFLÀFDWLRQV 51 50 20 30 5.2 6.7 8.0 11.0 15.5 18.6 6.7 8.2 9.5 12.6 18.7 21.8 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-84 6. Dimensions 1 Before Using the Products Motor 0'0(:WRN: 'HVLJQ2UGHU& 2 Encoder connector Motor/Brake connector LR □LC Preparation LL 46 LM Shaft end spec. (Key way shaft) LE 4-ѮLZ KH KW ѮLA 3 ѮLD RH ѮSh6 M3 through LW LK Connection ѮLBh7 LG LH LF * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. 4 MDME series (Middle inertia) Motor output 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 15 * * C * 20 * * C * 30 * * C * 40 * * C * 50 * * C * 140 157.5 175 210 179 198 With brake 165 182.5 200 235 204 MDME LR 55 65 35 LA 145 200 LB 110 114.3 LC 130 176 LD 165 233 LE 6 3.2 LF 12 18 84 116 118 140 94 111.5 129 164 133 152 With brake 119 136.5 155 189 158 177 9 Key way dimensions LW 45 LK 41 13.5 55 51 50 KW 8h9 10h9 KH 7 8 RH 18 20 7 30 5.2 6.7 8.0 11.0 15.5 18.6 With brake 6.7 8.2 9.5 12.6 18.7 21.8 Supplement Without brake &RQQHFWRUVSHFLÀFDWLRQV 6 When in Trouble Without brake LZ Mass (kg) 5 Adjustment 22 LH LM 223 70 S LG Setup 10 * * C * Without brake Motor model LL 1.0kW 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-85 6. Dimensions Motor 0'0(N:WRN: LL LM 44 □LC 43.5 43.5 LR Eye bolt (Thread 10) 48 Shaft end spec. (Key way shaft) LW LK 4-ѮLZ M4 through KW KH LH ѮLBh7 LG ѮSh6 LF LE D ѮL ѮL A RH Encoder connector Motor connector Brake connector LL LM 44 □LC 57 57 LR Shaft end spec. Eye bolt (Thread 10) (Key way shaft) LE KH M5 through D ѮL ѮL A RH LG LW LK 4-ѮLZ LH LF ѮSm6 ѮLBh7 48 * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. MDME series (Middle inertia) Key way dimensions Motor output Motor model MDME Without brake LL With brake LR S LA LB LC LD LE LF LG LH Without brake LM With brake LZ LW LK KW KH RH Without brake With brake &RQQHFWRUVSHFLÀFDWLRQV Mass (kg) 7.5kW 75 * * 1 * 312 337 113 42 200 114.3 176 233 3.2 24 11.0kW C1 * * 1 * 316 364 15.0kW C5 * * 1 * 348 432 116 55 235 200 220 268 4 32 60 184 268 293 96 90 12h9 8 37 ï0 36.4 40.4 205 272 320 13.5 340 388 98 90 16h9 10 49 0 ï 52.7 58.9 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 70.2 76.3 Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-86 KW 6. Dimensions 1 Before Using the Products Motor MFME 1.5kW to 4.5kW 2 Encoder connector Motor/Brake connector LL LM □LC LR Preparation 44 Shaft end spec. (Key way shaft) LE 4-ѮLZ LW LK M3 through KH LH D ѮL ѮL A KW 3 Connection RH ѮLBh7 LG ѮSh6 LF * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. 4 MFME series (Middle inertia) Motor output 2.5kW 4.5kW 25 * * 1 * 45 * * 1 * 142 136 156 With brake 167 169 189 MFME LR 70 S 35 200 235 LB 114.3 200 LC 176 220 LD 233 266 LE 3.2 4 LF 18 16 LG 60 LH LM 140 162 98 91 111 With brake 123 124 144 6 Key way dimensions When in Trouble Without brake LZ 176 LW 55 LK 50 KW 10h9 KH 8 RH Mass (kg) 5 Adjustment LA Setup 15 * * 1 * Without brake Motor model LL 1.5kW With brake 12.5 13.1 18.2 17.2 23.1 Supplement 9.5 &RQQHFWRUVSHFLÀFDWLRQV 7 30 Without brake 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-87 6. Dimensions Motor 0*0(:WRN: 'HVLJQ2UGHU Encoder connector Motor/Brake connector LL 44 LR LC LM Shaft end spec. (Key way shaft) LE 4-ѮLZ LW LK KH M3 through ѮLD ѮLA RH ѮLBh7 LG ѮSh6 LH LF * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. MGME series (Middle inertia) Motor output 2.0kW 3.0kW 09 * * 1 * 20 * * 1 * 30 * * 1 * Without brake 155.5 163.5 209.5 With brake 180.5 188.5 Motor model LL 900W MGME 70 80 S 22 35 LA 145 200 LB 110 114.3 LC 130 176 LD 165 233 LE 6 3.2 LF 12 18 LG 60 LH LM 116 140 Without brake 111.5 119.5 165.5 With brake 136.5 144.5 190.5 LZ Key way dimensions 9 13.5 LW 45 55 LK 41 50 KW 8h9 10h9 KH 7 8 RH Mass (kg) 234.5 LR 18 Without brake 6.7 With brake 8.2 &RQQHFWRUVSHFLÀFDWLRQV 30 14.0 20.0 17.5 23.5 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-88 KW 6. Dimensions 1 Before Using the Products Motor 0*0(:WRN: 'HVLJQ2UGHU& 2 Encoder connector Motor/Brake connector LR □LC Preparation LL LM 46 Shaft end spec. (Key way shaft) LE 4-ѮLZ M3 throug LH LW LK KH 3 ѮLD RH ѮLA Connection ѮLBh7 LG ѮSh6 LF * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. 4 MGME series (Middle inertia) Motor output 2.0kW 3.0kW 20 * * C * 30 * * C * 157.5 165.5 211.5 With brake 182.5 190.5 MGME 80 S 22 35 LA 145 200 LB 110 114.3 LC 130 176 LD 165 233 LE 6 3.2 LF 12 18 84 116 140 111.5 119.5 165.5 With brake 136.5 144.5 190.5 Key way dimensions 9 13.5 LW 45 55 LK 41 50 KW 8h9 10h9 KH 7 8 RH 18 6.7 With brake 8.2 &RQQHFWRUVSHFLÀFDWLRQV 7 30 14.0 20.0 17.5 23.5 Supplement Without brake 6 When in Trouble Without brake LZ Mass (kg) 5 Adjustment 70 LH LM 236.5 LR LG Setup 09 * * C * Without brake Motor model LL 900W 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-89 6. Dimensions Motor 0*0(N:N: Motor/Brake connector LR □LC 43.5 43.5 Eye bolt (Thread 10) Shaft end spec. (Key way shaft) LF LE KH D ѮL Motor connector Brake connector LL LM 44 ѮL A Shaft end spec. (Key way shaft) LW LK 4-ѮLZ LH ѮLBh7 LG ѮSh6 LF LE D ѮL ѮL A * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. MGME series (Middle inertia) Key way dimensions Motor output Motor model MGME Without brake LL With brake LR S LA LB LC LD LE LF LG LH Without brake LM With brake LZ LW LK KW KH RH Without brake Mass (kg) With brake &RQQHFWRUVSHFLÀFDWLRQV 4.5kW 45 * * 1 * 266 291 6.0kW 60 * * 1 * 312 337 113 42 200 114.3 176 233 3.2 24 60 140 222 247 184 268 293 13.5 96 90 12h9 8 0 37 ï 29.4 36.4 33.0 40.4 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-90 KW □LC 43.5 43.5 LR Eye bolt (Thread 10) 48 M4 through M4 through KH Encoder connector LH ѮSh6 ѮLBh7 LG LW LK 4-ѮLZ RH LL LM 44 RH Encoder connector KW 6. Dimensions 1 Before Using the Products Motor 0+0':WR: 2 ±1 ° RH 3 LH 4-ѮLZ (Key way with center tap shaft) LW KW LK Connection ѮSh6 □LC KH 200 (7) 220 (7) LK RH LF (D-cut shaft) LW LR LE 90 ° LL Shaft end spec. Motor connector Preparation Encoder connector Brake connector ѮLBh7 ѮLA RH TP 4 Setup * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. MHMD series (High inertia) 200W 02 * * 1 * 99 135.5 400W 04 * * 1 * 118.5 155 750W 08 * * 1 * 164.2 127.2 35 19 90±0.2 70 80 14 70 50 60 5 Adjustment 30 11 3 Key way dimensions 12.5 25 22.5 5h9 5 11 6 7 M5 depth 10 1.4 1.8 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 2.5 3.3 Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ Supplement 10 20 18 4h9 4 8.5 M4 depth 8 0.96 1.4 8 53 6 35 25 17.5 25 22 6h9 6 15.5 When in Trouble 6.5 43 4.5 30 22 カット 寸法 Motor output Motor model MHMD Without brake LL With brake LR S LA LB LC LE LF LH LZ LW D LK RH LW LK KW KH RH TP Without brake Mass (kg) With brake &RQQHFWRUVSHFLÀFDWLRQV 7-91 6. Dimensions Motor 0+0(N:WRN: 'HVLJQ2UGHU Motor/Brake connector LL 44 Encoder connector LR □LC LM Shaft end spec. (Key way shaft) LE 4-ѮLZ LW LK KH KW ѮLD ѮLA Motor connector LL LM 44 LR □LC 43.5 43.5 Brake connector Shaft end spec. (Key way shaft) Eye bolt (Thread 10) LF LE M4 through KW KH LH ѮLBh7 LG LW LK 4-ѮLZ D ѮL ѮL A RH 48 ѮSh6 Encoder connector M3 through RH LG ѮSh6 ѮLBh7 LH LF * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. MHME series (High inertia) 1.0kW 10 * * 1 * 173 198 &RQQHFWRUVSHFLÀFDWLRQV 1.5kW 15 * * 1 * 190.5 215.5 2.0kW 20 * * 1 * 177 202 3.0kW 30 * * 1 * 196 221 70 22 145 110 130 165 6 12 4.0kW 40 * * 1 * 209.5 234.5 5.0kW 50 * * 1 * 238.5 263.5 80 35 200 114.3 176 233 3.2 18 24 116 129 154 140 146.5 171.5 133 158 152 177 9 45 41 8h9 7 18 6.7 8.1 165.5 190.5 13.5 194.5 219.5 55 50 10h9 184 313 338 96 90 12h9 8 30 8.6 10.1 12.2 15.5 16.0 19.2 18.6 21.8 23.0 26.2 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-92 7.5kW 75 * * 1 * 357 382 113 42 60 Key way dimensions Motor output Motor model MHME Without brake LL With brake LR S LA LB LC LD LE LF LG LH Without brake LM With brake LZ LW LK KW KH RH Without brake Mass (kg) With brake 0 37 ï 42.3 46.2 6. Dimensions 1 Before Using the Products Motor 0+0(N:WRN: 'HVLJQ2UGHU& 2 Encoder connector Motor/Brake connector Preparation LL 46 □LC LR LM Shaft end spec. (Key way shaft) LE 4-ѮLZ LW LK KW KH ѮLA M3 through RH ѮLD 3 Connection ѮLBh7 ѮSh6 LG LH LF * Dimensions are subject to change without notice. Contact us or a dealer for the latest information. 4 MHME series (High inertia) Motor output 1.5kW 2.0kW 3.0kW 4.0kW 5.0kW 15 * * C * 20 * * C * 30 * * C * 40 * * C * 50 * * C * 175 192.5 179 198 211.5 240.5 With brake 200 217.5 204 223 236.5 265.5 MHME 70 80 S 22 35 LA 145 200 LB 110 114.3 LC 130 176 LD 165 233 LE 6 3.2 LF 12 18 LG 84 LH LM 116 140 129 146.5 133 152 165.5 194.5 With brake 154 171.5 158 177 190.5 219.5 Key way dimensions 9 13.5 LW 45 55 LK 41 50 KW 8h9 10h9 KH 7 8 RH 18 7 30 6.7 8.6 12.2 16.0 18.6 23.0 With brake 8.1 10.1 15.5 19.2 21.8 26.2 Supplement Without brake &RQQHFWRUVSHFLÀFDWLRQV 6 When in Trouble Without brake LZ Mass (kg) 5 Adjustment LR Setup 10 * * C * Without brake Motor model LL 1.0kW 5HIHUWR3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Caution Reduce the moment of inertia ratio if high speed response operation is required. Related page 3´&KHFNRIWKH0RGHOµ3´&KHFNRIWKH&RPELQDWLRQRIWKH'ULYHUDQGWKH0RWRUµ 3´67&KDUDFWHULVWLFVµ 7-93 7 7. Options Supplement Noise Filter :KHQ\RXLQVWDOORQHQRLVHÀOWHUDWWKHSRZHUVXSSO\IRUPXOWLD[HVDSSOLFDWLRQFRQWDFWWR DPDQXIDFWXUHRIWKHQRLVHÀOWHU,IQRLVHPDUJLQLVUHTXLUHGFRQQHFWÀOWHUVLQVHULHVWR emphasize effectiveness. 2SWLRQV 9ROWDJH specifications for driver Single phase 100V, 200V Option part No. DV0P4170 100.0 ± 2.0 88.0 75.0 7.0 5.0 Manufacturer's part No. Applicable driver (frame) Manufacturer 683(.(5 A and B-frame Okaya Electric Ind. Terminal cover (transparent) 53.1±1.0 IN Circuit diagram L 12.0 50.0 60.0 1 2.0 6 – M4 9ROWDJH specifications for driver 3-phase 200V Option part No. DV0PM20042 3 Cx 2 2 – ø4.5 2 – ø4.5 x 6.75 Cy Cx Cy 10.0 Label R OUT L Single phase 100V, 200V 3-phase 200V (11.6) (13.0) 4 [Unit: mm] Manufacturer's part No. Applicable driver (frame) A and B-frame 683+8(5 C-frame Okaya Electric Ind. DV0P4220 Single/3-phase 200V 683+8(5 D-frame DV0PM20043 3-phase 200V 683+8(5 E-frame [DV0PM20042, DV0P4220] Manufacturer [DV0PM20043] A B C H A B C H Earth terminal M4 Label D E F 10 Label E D F Earth terminal M4 Screw for cover M3 M4 Screw for cover M3 M5 Cover G G Cover Body Body Circuit diagram [Size] [Unit: mm] A B C D E F G H DV0PM20042 115 105 95 70 43 10 52 5.5 DV0P4220 145 135 125 70 50 10 52 5.5 DV0PM20043 165 136 165 90 80 40 54 5.5 IN 7-94 4 2 5 3 6 For single phase application, use 2 terminals among 3 terminals, leaving the remaining terminal unconnected. Related page OUT L1 1 3´&RQIRUPDQFHWRLQWHUQDWLRQDOVWDQGDUGVµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ R Cx1 Cx1 Cy1 7. Options 1 Before Using the Products Noise Filter Option part No. 9ROWDJH specifications for driver Manufacturer's part No. Applicable driver (frame) Manufacturer DV0P3410 3-phase 200V 683+/(5% F-frame Okaya Electric Ind. Circuit diagram 2-ø5.5 x 7 150 2-ø5.5 (13) (18) 90±1.0 120 6-6M Label IN OUT 1 4 2 5 3 6 [Unit: mm] 3 5HFRPPHQGHGFRPSRQHQWV RTHN-5010 Current rating Applicable driver (A) (frame) 10 Single phase 100V, 200V 3-phase 200V RTHN-5030 RTHN-5050 [RTHN-5010] Connection 9ROWDJH specifications for driver Part No. Manufacturer A, B, C-frame 30 D-frame 50 E, F-frame TDK-Lambda Corp. 4 [RTHN-5030] 210±2 195±1 M4 4.5 6-M4 M4 10±1 18.5±1 18.5±1 105±2 85±1 4.5±1 18.5±1 18.5±1 10±1 240±2 225±1 Setup 95±2 78±1 4.5±1 2 Preparation 286±3.0 270 255±1.0 240 6-M4 4.5 55±2 50±2 5 Adjustment [RTHN-5050] 12.5±1 21±1 21±1 128±2 102±1 5.5±1 300±2 280±1 M4 6 6-M5 5.5 68±2 Use options correctly after reading operation manuals of the options to better understand the precautions. Take care not to apply excessive stress to each optional part. 7-95 7 Supplement Caution 6HOHFWDQRLVHÀOWHURIFDSDFLW\WKDWH[FHHGVWKHFDSDFLW\RIWKHSRZHUVRXUFH DOVR check for load condition). )RUGHWDLOHGVSHFLÀFDWLRQRIWKHÀOWHUFRQWDFWWKHPDQXIDFWXUHU When in Trouble Remarks 7. Options Noise Filter 9ROWDJH specifications for driver part No. FS5559-60-34 Current rating Applicable driver (A) (frame) 60 G-frame 80 H-frame FN258L-16-07 16 D, E-frame FN258L-30-07 30 F-frame FS5559-80-34 FN258-42-07 3-phase 200V 3-phase 400V 42 FN258-42-33 Manufacturer Schaffner G, H-frame 42 [FS5559-60-34, FS5559-80-34] C 1.5 25 95 [Unit: mm] A [Size] 25 M8 50 B 140 50 6.5 D FS5559-60-34 FS5559-80-34 A 410 460 B 170 180 C 370 420 D 388 438 Circuit diagram L1 L1' L2 L2' L3 L3' PE LINE LOAD [FN258L-16-07] [FN258L-30-07] 275 300`10 305 400`10 9 M5 150 142 9 Litze AWG14 M5 Litze AWG10 60 290 55 35 30 6.5 6.5 320 L2' L2 L3 L3' E 3x1,5μF(X2) 47nF(Y2) E LINE L2 3x1,35mH 3x0,65mH L2' L1 L1' 3x2,2μF(X2)SH E 3x1,5MOhm 3x2,2μF(X2)SH L3' 3x2,2μF(X2)SH 47nF(Y2)SH E LOAD Circuit diagram LOAD LINE 3x1,5MOhm 3x2,2μF(X2) L3 3x2,2μF(X2) 7-96 3x1mH L1' L1 [Unit: mm] 344.5 Circuit diagram 3x2mH 335 [Unit: mm] 305 7. Options 1 [FN258-42-07] [FN258-42-33] 300 1.5 1.5 45 6.5 45 6.5 70 314 70 Preparation 314 329 2 185 500±10 12 185 300 Before Using the Products Noise Filter 329 [Unit: mm] 350 [Unit: mm] Circuit diagram 3 L1' L2 L2' L3 L3' E Connection L1 E LINE LOAD 4 Setup 5 Adjustment 6 When in Trouble Remarks Use options correctly after reading operation manuals of the options to better understand the precautions. Take care not to apply excessive stress to each optional part. 7-97 7 Supplement Caution 6HOHFWDQRLVHÀOWHURIFDSDFLW\WKDWH[FHHGVWKHFDSDFLW\RIWKHSRZHUVRXUFH DOVR check for load condition). )RUGHWDLOHGVSHFLÀFDWLRQRIWKHÀOWHUFRQWDFWWKHPDQXIDFWXUHU 7 7. Options Supplement Surge Absorber 3URYLGHDVXUJHDEVRUEHUIRUWKHSULPDU\VLGHRIQRLVHÀOWHU Option part No. 9ROWDJH specifications for driver Manufacturer's part No. DV0P1450 3-phase 200V R・A・9%;= DV0PM20050 3-phase 400V R・A・9%;= Manufacturer 5.5±1 11±1 Okaya Electric Ind. [Unit: mm] Circuit diagram (1) 28±1 1 2 3 (1) (3) UL-1015 AWG16 4.5±0.5 +30 200 -0 28.5±1 Ѯ4.2±0.2 41±1 9ROWDJH specifications for driver Single phase 100V, 200V Option part No. 5.5±1 11±1 DV0P4190 Manufacturer R・A・V-781BWZ-4 Okaya Electric Ind. [Unit: mm] Circuit diagram (1) (2) UL-1015 AWG16 4.5±0.5 1 2 28±1 +30 200 -0 28.5±1 Ѯ4.2±0.2 Manufacturer's part No. 41±1 Remarks Take off the surge absorber when you execute a dielectric test to the machine or equipment, or it may damage the surge absorber. Related page 3´&RQIRUPDQFHWRLQWHUQDWLRQDOVWDQGDUGVµ 3´'ULYHUDQG/LVWRI$SSOLFDEOH3HULSKHUDO(TXLSPHQWVµ 7-98 7 7. Options Supplement 1RLVH)LOWHUIRU6LJQDO/LQHV 1 2SWLRQV <24 V 3RZHUFDEOH0RWRUFDEOH(QFRGHUFDEOH,QWHUIDFHFDEOH86%FDEOH> Manufacturer's part No. Manufacturer DV0P1460 ZCAT3035-1330 TDK Corp. 39±1 Remarks 34±1 To connect the noise filter to the connector XB connection cable, adjust the sheath length at the tip of the cable, as required. Mass: 62.8g 30±1 13±1 2 Preparation Option part No. 3 Connection [Unit: mm] 5HFRPPHQGHGFRPSRQHQWV Part No. Applicable driver (frame) RJ8035 E-frame 200 V, F-frame 200 V Manufacturer 4 KK-CORP.CO.JP RJ8095 Before Using the Products IQVWDOOQRLVHÀOWHUVIRUVLJQDOOLQHVWRDOOFDEOHV SRZHUFDEOHPRWRUFDEOHHQFRGHUFDEOH and interface cable) G-frame, H-frame D1 D2 Setup 5 A B C Adjustment F E 'LPHQVLRQ>8QLWPP@ Manufacturer's part No. Current value 100kHz ѥ+ A B C RJ8035 35A 9.9±3 170 150 23 80 53 24 R3.5 7 RJ8095 95A 7.9±3 200 180 34 130 107 35 R3.5 7 D1 D2 Core thikness E F 6 Part No. Applicable driver (frame) Manufacturer T400-61D G-frame, H-frame MICROMETALS When in Trouble Remarks Supplement 33 ø57.2 ø102 7 [Unit: mm] )L[WKHVLJQDOOLQHQRLVHÀOWHULQSODFHWRHOLPLQDWHH[FHVVLYHVWUHVVWRWKHFDEOHV 7-99 7 7. Options Supplement Junction Cable for Encoder Compatible motor output 0)(&$* * ($0 Part No. MSMD 50W to 750W, MHMD 200W to 750W Specifications For 20-bit incremental encoder (Without battery box) (11.8) (ø6.5) L (4) (14) (4) Title Part No. Connector (Driver side) 3E206-0100 KV Shell kit 3E306-3200-008 Connector (Motor side) 172160-1 Connector pin 170365-1 Cable 0.20mm2×3P (6-wire type) Manufacturer Sumitomo 3M *1 Tyco Electronics / P Part No. 3 MFECA0030EAM 5 MFECA0050EAM 10 MFECA0100EAM 20 MFECA0200EAM Oki Electric Cable Co., Ltd. *1 Old model number: 55100-0670 (Japan Molex Inc.) 0)(&$ * * 0-' (Highly bendable type, Direction of motor shaft) 0)(&$ * * 0.' (Highly bendable type, Opposite direction of motor shaft) Part No. Compatible motor output 0)(&$ * * 7-' 50W to 750W (200V) (Standard bendable type, Direction of motor shaft) 0)(&$ * * 7.' (Standard bendable type, Opposite direction of motor shaft) Specifications For 20-bit incremental encoder (Without battery box) * Also for 17-bit version. L (ø5.5) Direction of motor shaft Opposite direction of motor shaft Identification label Title Part No. Connector (Driver side) 3E206-0100 KV Shell kit 3E306-3200-008 Connector JN6FR07SM1 Manufacturer Sumitomo 3M *1 Connector pin LY10-C1-A1-10000 Japan Aviation Electronics Ind. Cable AWG24×4P, AWG22×2P Hitachi Cable, Ltd. *1 Old model number: 55100-0670 (Japan Molex Inc.) Caution Option cable does not conform to IP65 and IP67. Related page 3´-XQFWLRQFDEOHIRUPRWRUµ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 7-100 / P Part No. 3 MFECA0030MJD 5 MFECA0050MJD 10 MFECA0100MJD 20 MFECA0200MJD 7. Options 1 Before Using the Products Junction Cable for Encoder 0)(&$ * * 0-( (Highly bendable type, Direction of motor shaft) 0)(&$ * * 0.( (Highly bendable type, Opposite direction of motor shaft) Part No. 0)(&$ * * 7-( Compatible motor output 50W to 750W (200V) 2 (Standard bendable type, Direction of motor shaft) Preparation 0)(&$ * * 7.( (Standard bendable type, Opposite direction of motor shaft) Specifications For 17-bit absolute encoder (With battery box) L Direction of motor shaft 300 3 (ø5.5) 110 Connection Opposite direction of motor shaft Identification label Part No. 3E206-0100 KV Manufacturer Shell kit 3E306-3200-008 Connector ZMR-02 Connector pin SMM-003T-P0.5 Connector JN6FR07SM1 Connector pin LY10-C1-A1-10000 Japan Aviation Electronics Ind. Cable AWG24 ×4P, AWG22×2P Hitachi Cable, Ltd. Sumitomo 3M *1 J.S.T Mfg. Co., Ltd. / P Part No. 3 MFECA0030MJE 5 MFECA0050MJE 10 MFECA0100MJE 20 MFECA0200MJE *1 Old model number: 55100-0670 (Japan Molex Inc.) 5 Compatible motor output 400W (400V), 600W (400V), 750W (400V), 0.9kW to 15.0kW Adjustment 0)(&$ * * (7' Part No. 4 Setup Title Connector (Driver side) Specifications For 20-bit incremental encoder (Without battery box), Design order: 1 L ø20 (ø6) 6 Part No. Connector (Driver side) 3E206-0100 KV Shell kit 3E306-3200-008 Connector JN2DS10SL1-R Connector pin JN1-22-22S-PKG100 Cable 2 0.2mm ×3P Manufacturer Sumitomo 3M *1 Japan Aviation Electronics Ind. / P Part No. 3 MFECA0030ETD 5 MFECA0050ETD 10 MFECA0100ETD 20 MFECA0200ETD When in Trouble Title 7 Oki Electric Cable Co., Ltd. Supplement *1 Old model number: 55100-0670 (Japan Molex Inc.) Caution Option cable does not conform to IP65 and IP67. Related page 3´-XQFWLRQFDEOHIRUPRWRUµ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 7-101 7. Options Junction Cable for Encoder Part No. 0)(&$* * (6' Compatible motor output 0.9kW to 5.0kW (IP65 Motor) Specifications For 20-bit incremental encoder (Without battery box), Design order: C ø37.3 (ø6.5) L Title Connector (Driver side) Shell kit Connector (Motor side) Cable clamp Cable Part No. 3E206-0100 KV 3E306-3200-008 N/MS3106B20-29S N/MS3057-12A 0.2mm2 ×3P (6-wire type) Manufacturer / P 3 5 10 20 Sumitomo 3M *1 Japan Aviation Electronics Ind. Oki Electric Cable Co., Ltd. Part No. MFECA0030ESD MFECA0050ESD MFECA0100ESD MFECA0200ESD *1 Old model number: 55100-0670 (Japan Molex Inc.) Part No. 0)(&$ * * (7( 400W (400V), 600W (400V), 750W (400V), 0.9kW to 15.0kW Compatible motor output Specifications For 17-bit absolute encoder (With battery box), Design order: 1 L 300 ø20 (ø6) 110 Title Connector (Driver side) Shell kit Connector Connector pin Connector Connector pin Cable Part No. 3E206-0100 KV 3E306-3200-008 ZMR-02 SMM-003T-P0.5 JN2DS10SL1-R JN1-22-22S-PKG100 0.2mm2 ×3P Manufacturer / P 3 5 10 20 Sumitomo 3M *1 J.S.T Mfg. Co., Ltd. Part No. MFECA0030ETE MFECA0050ETE MFECA0100ETE MFECA0200ETE Japan Aviation Electronics Ind. Oki Electric Cable Co., Ltd. *1 Old model number: 55100-0670 (Japan Molex Inc.) Part No. 0)(&$* * (6( Compatible motor output 0.9kW to 5.0kW (IP65 Motor) Specifications For 17-bit absolute encoder (With battery box), Design order: C L 300 ø37.3 (ø8) 110 Title Connector (Driver side) Shell kit Connector (Motor side) Cable clamp Cable Part No. 3E206-0100 KV 3E306-3200-008 N/MS3106B20-29S N/MS3057-12A 0.2mm2 ×4P (8-wire type) Manufacturer Sumitomo 3M *1 Japan Aviation Electronics Ind. Oki Electric Cable Co., Ltd. *1 Old model number: 55100-0670 (Japan Molex Inc.) Caution 7-102 Option cable does not conform to IP65 and IP67. / P 3 5 10 20 Part No. MFECA0030ESE MFECA0050ESE MFECA0100ESE MFECA0200ESE 7 7. Options Supplement Junction Cable for Motor (Without brake) Before Using the Products Applicable MSMD 50W to 750W, MHMD 200W to 750W model 0)0&$* * ((' Part No. 1 (50) (50) 2 (4) Preparation Ѯ L (4) Title Part No. Connector 172159-1 Manufacturer Tyco Electronics 170366-1 Rod terminal AI0.75-8GY Phoenix Contact Nylon insulated round terminal N1.25-M4 J.S.T Mfg. Co., Ltd. Cable ROBO-TOP 600V 0.75mm2 4-wire type Daiden Co.,Ltd. Part No. 3 MFMCA0030EED 5 MFMCA0050EED 10 MFMCA0100EED 20 MFMCA0200EED 3 Connection Connector pin / P 0)0&$ * * 1-' (Highly bendable type, Direction of motor shaft) 4 0)0&$ * * 1.' (Highly bendable type, Opposite direction of motor shaft) Part No. 0)0&$ * * 5-' Applicable MSME 50W to 750W model Setup (Standard bendable type, Direction of motor shaft) 0)0&$ * * 5.' (Standard bendable type, Opposite direction of motor shaft) (28.8) L (50) 5 (ø6) Direction of motor shaft Adjustment Opposite direction of motor shaft Identification label Caution Motor cable for opposite direction of motor shaft cannot be used with a motor 50W and 100W. Part No. JN8FT04SJ1 Manufacturer / P Part No. MFMCA0030NJD ST-TMH-S-C1B-3500 Japan Aviation Electronics Ind. 3 Connector pin 5 MFMCA0050NJD Rod terminal AI0.75-8GY Phoenix Contact 10 MFMCA0100NJD 20 MFMCA0200NJD Nylon insulated round terminal N1.25-M4 J.S.T Mfg. Co., Ltd. Cable AWG18×4P Hitachi Cable, Ltd. Option cable does not conform to IP65 and IP67. Related page 3´-XQFWLRQFDEOHIRUPRWRUµ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 7 Supplement Caution When in Trouble Title Connector 6 7-103 7. Options Junction Cable for Motor (Without brake) MSME 750W (400V), 1.0kW to 2.0kW, 0)0&' * * 2ECD Part No. Applicable MDME 1.0kW to 2.0kW, MHME 1.0kW to 1.5kW, model MGME 0.9kW (50) ø37.3 (Ѯ12.5) L Title Part No. Manufacturer / P Part No. Connector JL04V-6A20-4SE-EB-R 3 MFMCD0032ECD 5 MFMCD0052ECD 10 MFMCD0102ECD 20 MFMCD0202ECD Cable clamp JL04-2022CK(14)-R Japan Aviation Electronics Ind. Rod terminal 178% J.S.T Mfg. Co., Ltd. Nylon insulated round terminal N2-M4 J.S.T Mfg. Co., Ltd. Cable ROBO-TOP 600V 2.0mm2 Daiden Co.,Ltd. 0)0&( * * 2ECD Part No. Applicable MHME 2.0kW model (50) ø40.5 L Title Part No. Manufacturer / P Part No. Connector JL04V-6A22-22SE-EB-R 3 MFMCE0032ECD 5 MFMCE0052ECD 10 MFMCE0102ECD 20 MFMCE0202ECD Cable clamp JL04-2022CK(14)-R Japan Aviation Electronics Ind. Rod terminal 178% J.S.T Mfg. Co., Ltd. Nylon insulated round terminal N2-M4 J.S.T Mfg. Co., Ltd. Cable ROBO-TOP 600V 2.0mm2 Daiden Co.,Ltd. 0)0&$ * * 3ECT Part No. Applicable MSME 3.0kW to 5.0kW, MDME 3.0kW to 5.0kW model MHME 3.0kW to 5.0kW, MGME 2.0kW to 3.0kW (50) ø40.5 (Ѯ14) L Title Part No. Connector JL04V-6A22-22SE-EB-R Cable clamp Nylon insulated round terminal Cable Manufacturer / P Part No. MFMCA0033ECT JL04-2022CK(14)-R Japan Aviation Electronics Ind. 3 5 MFMCA0053ECT N5.5-5 J.S.T Mfg. Co., Ltd. 10 MFMCA0103ECT 20 MFMCA0203ECT ROBO-TOP 600V 3.5mm 2 Daiden Co.,Ltd. Caution Option cable does not conform to IP65 and IP67. Related page 3´-XQFWLRQFDEOHIRUPRWRUµ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 7-104 7. Options 1 0)0&$ * * 2ECD Part No. Before Using the Products Junction Cable for Motor (Without brake) Applicable MFME 1.5kW (200V) model (50) 2 Preparation ø37.3 (Ѯ12.5) L Title Part No. Manufacturer / P Part No. Connector JL04V-6A20-18SE-EB-R 3 MFMCA0032ECD Cable clamp JL04-2022CK(14)-R Japan Aviation Electronics Ind. 5 MFMCA0052ECD Rod terminal $,%8 Phoenix Contact 10 MFMCA0102ECD 20 MFMCA0202ECD N2-M4 J.S.T Mfg. Co., Ltd. Cable ROBO-TOP 600V 2.0mm2 Daiden Co.,Ltd. 0)0&) * * 2ECD Part No. Applicable MFME 1.5kW (400V), 2.5kW model (50) 4 ø43.7 L 3 Connection Nylon insulated round terminal Setup Title Part No. Manufacturer / P Part No. Connector JL04V-6A24-11SE-EB-R MFMCF0032ECD JL04-2428CK(14)-R Japan Aviation Electronics Ind. 3 Cable clamp 5 MFMCF0052ECD Rod terminal 178% Phoenix Contact 10 MFMCF0102ECD 20 MFMCF0202ECD N2-M4 J.S.T Mfg. Co., Ltd. Cable ROBO-TOP 600V 2.0mm2 Daiden Co.,Ltd. 0)0&' * * 3ECT Part No. Applicable MFME 4.5kW model (50) 6 ø43.7 When in Trouble (Ѯ14) L Title Part No. Manufacturer / P 3 MFMCA0033ECT 5 MFMCA0053ECT 10 MFMCA0103ECT 20 MFMCA0203ECT Connector JL04V-6A24-11SE-EB-R Cable clamp JL04-2428CK(17)-R Japan Aviation Electronics Ind. Nylon insulated round terminal N5.5-5 J.S.T Mfg. Co., Ltd. ROBO-TOP 600V 3.5mm Part No. Daiden Co.,Ltd. Caution Option cable does not conform to IP65 and IP67. Related page 3´-XQFWLRQFDEOHIRUPRWRUµ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 7 Supplement Cable 2 5 Adjustment Nylon insulated round terminal 7-105 7 7. Options Supplement Junction Cable for Motor (With brake) MSME MDME Applicable MFME model MHME MGME 0)0&$ * * 2FCD Part No. 1.0kW to 2.0kW (200V) 1.0kW to 2.0kW (200V) 1.5kW (200V) 1.0kW to 1.5kW (200V) 0.9kW (200V) (50) (ø 9 .8) ø37.3 (ø12.5) L L (50 ) Title Part No. Manufacturer / P Part No. Connector JL04V-6A20-18SE-EB-R MFMCA0032FCD JL04-2022CK(14)-R Japan Aviation Electronics Ind. 3 Cable clamp 5 MFMCA0052FCD Rod terminal 178% J.S.T Mfg. Co., Ltd. 10 MFMCA0102FCD 20 MFMCA0202FCD Nylon insulated round terminal Earth N2-M4 Brake N1.25-M4 ROBO-TOP 600V 0.75mm2 and ROBO-TOP 600V 2.0mm2 Cable 0)0&( * * 2FCD Part No. J.S.T Mfg. Co., Ltd. Daiden Co.,Ltd. MSME MDME Applicable MFME model MGME MHME 750W to 2.0kW (400V) 400W to 2.0kW (400V) 1.5kW (400V), 2.5kW 0.9kW (400V) 1.0kW (400V), 1.5kW (400V), 2.0kW (50) ø43.7 L L (50 ) Title Part No. Connector JL04V-6A24-11SE-EB-R Cable clamp Rod terminal Nylon insulated round terminal Cable Manufacturer / P Part No. MFMCE0032FCD JL04-2428CK(17)-R Japan Aviation Electronics Ind. 3 5 MFMCE0052FCD 178% J.S.T Mfg. Co., Ltd. Earth N2-M4 Brake N1.25-M4 ROBO-TOP 600V 0.75mm2 and ROBO-TOP 600V 2.0mm2 J.S.T Mfg. Co., Ltd. Daiden Co.,Ltd. Caution Option cable does not conform to IP65 and IP67. Related page 3´-XQFWLRQFDEOHIRUPRWRUµ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 7-106 10 MFMCE0102FCD 20 MFMCE0202FCD 7. Options 1 0)0&$ * * 3FCT Part No. Before Using the Products Junction Cable for Motor (With brake) MSME 3.0kW to 5.0kW, MDME 3.0kW to 5.0kW MHME 3.0kW to 5.0kW MGME 2.0kW to 4.5kW Applicable MFME 4.5kW, model L 2 (ø9 .8) Preparation ø43.7 (ø14) (50) L (50 ) Part No. JL04V-6A24-11SE-EB-R Cable clamp JL04-2428CK(17)-R Nylon insulated round terminal Cable Earth N5.5-5 Brake N1.25-M4 ROBO-TOP 600V 0.75mm2 and ROBO-TOP 600V 3.5mm2 Manufacturer / P Part No. Japan Aviation Electronics Ind. 3 MFMCA0033FCT 5 MFMCA0053FCT J.S.T Mfg. Co., Ltd. 10 MFMCA0103FCT 20 MFMCA0203FCT Connection Title Connector 3 4 Daiden Co.,Ltd. Setup 5 Adjustment 6 When in Trouble 7 Option cable does not conform to IP65 and IP67. Related page 3´-XQFWLRQFDEOHIRUPRWRUµ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ Supplement Caution 7-107 7 7. Options Supplement Junction Cable for Brake 0)0&%* * *(7 Part No. Applicable MSMD 50W to 750W, MHMD 200W to 750W model Ѯ L Title Part No. Connector 172157-1 Connector pin 170366-1, 170362-1 Manufacturer Tyco Electronics Nylon insulated round terminal N1.25-M4 J.S.T Mfg. Co., Ltd. Cable ROBO-TOP 600V 0.75mm2 ×2-wire type Daiden Co.,Ltd. / P Part No. 3 MFMCB0030GET 5 MFMCB0050GET 10 MFMCB0100GET 20 MFMCB0200GET 0)0&% * * 3-7 (Highly bendable type, Direction of motor shaft) 0)0&% * * 3.7 (Highly bendable type, Opposite direction of motor shaft) Part No. 0)0&% * * 6-7 Applicable MSME 50W to 750W model (Standard bendable type, Direction of motor shaft) 0)0&% * * 6.7 (Standard bendable type, Opposite direction of motor shaft) (26.6) L (50) (ø4.3) Direction of motor shaft Opposite direction of motor shaft Identification label Title Part No. Connector JN4FT02SJMR Manufacturer / P Part No. MFMCB0030PJT ST-TMH-S-C1B-3500 Japan Aviation Electronics Ind. 3 Connector pin 5 MFMCB0050PJT Nylon insulated round terminal N1.25-M4 J.S.T Mfg. Co., Ltd. 10 MFMCB0100PJT 20 MFMCB0200PJT Cable AWG22 Hitachi Cable, Ltd. Caution Option cable does not conform to IP65 and IP67. Related page 3´-XQFWLRQFDEOHIRUPRWRUµ3´6SHFLÀFDWLRQVRI0RWRUFRQQHFWRUµ 7-108 7. Options Supplement &RQQHFWRU.LW 1 Before Using the Products 7 &RQQHFWRU.LWIRU,QWHUIDFH '93 Part No. 2 &RPSRQHQWV Title Number Connector 10150-3000PE equivalent 1 Connector cover 10350-52A0-008 equivalent 1 Manufacturer Note Sumitomo 3M *1 )RU&RQQHFWRU; (50-pins) *1 Old model number: Connector 54306-5019, Connector cover 54331-0501 (Japan Molex Inc.) Preparation Part No. Pin disposition (50 pins) (viewed from the soldering side) 26 SI3 28 SI5 29 SI6 32 SI9 31 SI8 34 SO2– 33 SI10 1 3 5 7 OPC1 PULS1 SIGN1 COM 2 4 6 8 OPC2 PULS2 SIGN2 SI1 9 SI2 36 SO3– 35 SO2+ 37 SO3+ 11 SO1+ 10 SO1– 38 SO4– 39 SO4+ 13 GND 12 SO5 40 SO6 41 COM 15 GND 14 SPR/ SPL 42 IM 44 46 48 PULSH1 SIGNH1 OB 43 SP 17 GND 3 50 FG 45 47 49 PULSH2 SIGNH2 OB 19 CZ 21 OA 16 18 20 P-ATL N-ATL NC /TRQR 23 OZ 22 OA Connection 27 SI4 30 SI7 25 GND 24 OZ 4 Setup 1) Check the stamped pin-No. on the connector body while making a wiring. 2) For the function of each signal title or its symbol, refer to the wiring example of the connector X4. 3) Do not connect anything to NC pins in the above table. Interface Cable '93 Connector cover: 10350-52A0-008 Sumitomo 3M or equivalent 12.7 50 26 52.4 50 +10 0 25 39 Adjustment 2000+200 0 5 Connector: 10150-3000PE Sumitomo 3M or equivalent 1 Part No. 18 7DEOHIRUZLULQJ color Pin No. Orange (Red1) 11 Orange (Black1) 12 Gray (Red1) 13 Gray (Black1) 14 White (Red1) 15 White (Black1) 16 Yellow (Red1) 17 Pink (Red1) 18 Pink (Black1) 19 Orange (Red2) 20 color Pin No. Orange (Black2) 21 Yellow (Black1) 22 Gray (Red2) 23 Gray (Black2) 24 White (Red2) 25 Yellow (Red2) 26 Yel (Blk2)/Pink (Blk2) 27 Pink (Red2) 28 White (Black2) 29 – 30 color Pin No. Orange (Red3) 31 Orange (Black3) 32 Gray (Red3) 33 Gray (Black3) 34 White (Red3) 35 White (Black3) 36 Yellow (Red3) 37 Yellow (Black3) 38 Pink (Red3) 39 Pink (Black3) 40 color Pin No. Orange (Red4) 41 Orange (Black4) 42 Gray (Red4) 43 White (Red4) 44 White (Black4) 45 Yellow (Red4) 46 Yellow (Black4) 47 Pink (Red4) 48 Pink (Black4) 49 Gray (Black4) 50 color Orange (Red5) Orange (Black5) Gray (Red5) White (Red5) White (Black5) Yellow (Red5) Yellow (Black5) Pink (Red5) Pink (Black5) Gray (Black5) Color designation of the cable e.g.) Pin-1 Cable color : Orange (Red1) : One red dot on the cable The shield of this cable is connected to the connector shell but not to the terminal. 7-109 7 Supplement Pin No. 1 2 3 4 5 6 7 8 9 10 When in Trouble This 2 m connector cable contains AWG28 conductors. 6 7. Options &RQQHFWRU.LW &RQQHFWRU.LWIRU&RPPXQLFDWLRQ&DEOH IRU5656 Part No. '930 &RPSRQHQWV Title Part No. Manufacturer Note Connector 2040008-1 Tyco Electronics )RU&RQQHFWRU; SLQV 5.2 GND TXD (Viewed from cable) ï ï 8 (1.5) Shell: FG 8 6 4 2 7 5 3 1 7.3 10.7 RXD NC (ø6.7) 485+ 485+ 11 3LQGLVSRVLWLRQRIFRQQHFWRUFRQQHFWRU; 'LPHQVLRQV (33) (11) &RQQHFWRU.LWIRU6DIHW\ Part No. '930 &RPSRQHQWV Title Part No. Manufacturer Note Connector 2013595-1 Tyco Electronics )RU&RQQHFWRU; SLQV 5.2 NC 6)ï ('0ï 6)ï 8 (1.5) Shell: FG 8 6 4 2 7 5 3 1 7.3 10.7 SF1+ NC (ø6.7) SF2+ EDM+ 11 3LQGLVSRVLWLRQRIFRQQHFWRUFRQQHFWRU; 'LPHQVLRQV (33) (Viewed from cable) (11) &RQQHFWRU.LWIRU([WHUQDO6FDOH Part No. '930 &RPSRQHQWV Title Part No. Manufacturer Note Connector 08)3..; J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU; Remarks 3 2 5 4 7 6 EXA 9 8 10 EXZ EXB (Viewed from cable) 18.5 11.9 10.4 1 E0V PS EXB EXZ EXA 13.6 PS E5V 7.1 3LQGLVSRVLWLRQRIFRQQHFWRUFRQQHFWRU; 'LPHQVLRQV (10.5) (32) &RQQHFWRU;XVHZLWKFRPPHUFLDOO\DYDLODEOHFDEOH &RQÀJXUDWLRQRIFRQQHFWRU;86%PLQL% )RUFULPSWRROHWFQHFHVVDU\WRSURGXFHDFDEOHDFFHVVWKHZHEVLWHRIWKHPDQXIDFWXUHU or consult with the manufacturer for details. For inquiries of manufacturer, refer to P.7-125 "List of Peripheral Equipments". 7-110 7. Options 1 Before Using the Products &RQQHFWRU.LW &RQQHFWRU.LWIRU(QFRGHU '930 Part No. 2 &RPSRQHQWV Title Part No. 3E206-0100 KV Shell kit 3E306-3200-008 Note Sumitomo 3M *1 )RU&RQQHFWRU; Preparation Connector (Driver side) Manufacturer *1 Old model number: 55100-0670 (Japan Molex Inc.) 3LQGLVSRVLWLRQRIFRQQHFWRUFRQQHFWRU; 'LPHQVLRQV 6 PS 0.8 2.4 13.7 18.2 37.4 7.1 PS 1.7 5.4 5.8 4.5 12.0 Shell: FG (Viewed from cable) 3 2.0 2.0 5 11.0 NC 10.1 E0V 4 18.8 2 NC 7.8 E5V 3 Connection 1 18.8 33.0 &RQQHFWRU.LWIRU$QDORJ0RQLWRU6LJQDO 4 '930 Part No. Title Part No. Number Connector 510040600 1 Connector pin 500118100 6 Setup &RPSRQHQWV Manufacturer Note Molex Inc )RU&RQQHFWRU; SLQV 5 DM 5 14±0.3 NC 6 5.3±0.3 4 Adjustment 3 GND AM2 1 AM1 2 0.8 3LQGLVSRVLWLRQRIFRQQHFWRUFRQQHFWRU; 'LPHQVLRQV NC MX 12.9±0.3 3.35±0.3 6 1 &RQQHFWRU.LWIRUPower Supply Input When in Trouble '930 (For A to D-frame: Single row type) Part No. &RPSRQHQWV Title Part No. Number Connector -)$76$;*) 1 Handle lever J-FAT-OT 2 Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;$ 7 )RUFULPSWRROHWFQHFHVVDU\WRSURGXFHDFDEOHDFFHVVWKHZHEVLWHRIWKHPDQXIDFWXUHU or consult with the manufacturer for details. For inquiries of manufacturer, refer to P.7-125 "List of Peripheral Equipments". 7-111 Supplement Remarks Manufacturer 7. Options &RQQHFWRU.LW Part No. '930 (For A to D-frame: double row type) &RPSRQHQWV Title Part No. Number Connector -)$76$;*6$& 1 Handle lever J-FAT-OT 2 Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;$ Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;$ 'LPHQVLRQV B 2 3 5 4 5 4 26 1 2 1 2 1 3 A 5 Part No. 4 3 27.6 39.3 '930 (For E-frame 200 V) &RPSRQHQWV Part No. Title Part No. Number Connector -)$76$;*6$/ 1 Handle lever J-FAT-OT-L 2 '930 (For D-frame 400 V, E-frame 400 V and 24 V Input power) &RPSRQHQWV Part No. Title Part No. Number Connector 02MJFAT-SAGF 1 Handle lever MJFAT-OT 2 Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;' Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;$ Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;$ '930 (For D-frame 400 V) &RPSRQHQWV Part No. Title Part No. Number Connector 03JFAT-SAYGSA-M 1 Handle lever J-FAT-OT-L 2 '930 (For E-frame 400 V) &RPSRQHQWV 7-112 Title Part No. Number Connector 03JFAT-SAYGSA-L 1 Handle lever J-FAT-OT-L 2 7. Options 1 Before Using the Products &RQQHFWRU.LW &RQQHFWRU.LWIRU5HJHQHUDWLYH5HVLVWRU&RQQHFWLRQ (E-frame) Part No. '930 (For E-frame) 2 &RPSRQHQWV Part No. Number Connector -)$76$;*6$/ 1 Handle lever J-FAT-OT-L 2 Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;& Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;& Preparation Part No. Title '930 (For D-frame 400 V) &RPSRQHQWV Part No. Number Connector -)$76$;*6$0 1 Handle lever J-FAT-OT-L 2 3 Connection Title &RQQHFWRU.LWIRU0RWRU&RQQHFWLRQ Part No. 4 '930 (For A to D-frame) &RPSRQHQWV Part No. Number Connector -)$76$;*) 1 Handle lever J-FAT-OT 2 Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;% Setup Part No. Title '930 (For E-frame) 5 &RPSRQHQWV Part No. Number Connector -)$76$;*6$/ 1 Handle lever J-FAT-OT-L 2 Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;% Adjustment Part No. Title '930 (For D-frame 400 V) 6 &RPSRQHQWV Part No. Number Connector -)$76$;*6$0 1 Handle lever J-FAT-OT-L 2 Manufacturer Note J.S.T Mfg. Co., Ltd. )RU&RQQHFWRU;% When in Trouble Title 7 Supplement 7-113 7. Options &RQQHFWRU.LW &RQQHFWRU.LWIRU0RWRU(QFRGHU&RQQHFWLRQ Applicable MSMD 50W to 750W, MHMD 200W to 750W model (incremental encoder type) '93 Part No. &RPSRQHQWV Title Connector (Driver side) Shell kit Connector Connector pin Connector Connector pin Part No. 3E206-0100 KV 3E306-3200-008 172160-1 170365-1 172159-1 170366-1 Number 1 1 1 6 1 4 Manufacturer Note Sumitomo 3M *1 )RU&RQQHFWRU; SLQV For Encoder cable (6-pins) For Motor cable (4-pins) Tyco Electronics Tyco Electronics *1 Old model number: 55100-0670 (Japan Molex Inc.) 3LQGLVSRVLWLRQRIFRQQHFWRU FRQQHFWRU; 1 E5V 2 E0V 3 NC* 4 NC* 5 PS 6 PS ( Case FG ) *NC: None Connect 3LQGLVSRVLWLRQRIFRQQHFWRU for motor cable 1 2 3 1 2 NC PS PS U V 4 5 6 3 4 E5V E0V FG W E Applicable MSME 50W to 750W model '930 Part No. 3LQGLVSRVLWLRQRIFRQQHFWRU for encoder cable &RPSRQHQWV Title Connector (Driver side) Shell kit Encoder plug connector Socket contact Motor plug connector Socket contact Part No. 3E206-0100 KV 3E306-3200-008 JN6FR07SM1 LY10-C1-A1-10000 JN8FT04SJ1 ST-TMH-S-C1B-3500 Number 1 1 1 7 1 4 Manufacturer Sumitomo 3M Note *1 )RU&RQQHFWRU; SLQV Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. For Encoder cable (7-pins) For Motor cable (4-pins) *1 Old model number: 55100-0670 (Japan Molex Inc.) 3LQGLVSRVLWLRQRIFRQQHFWRU FRQQHFWRU; 1 E5V 3 NC *1 5 PS (Case FG ) 2 E0V 4 NC *1 6 PS 3LQGLVSRVLWLRQRIFRQQHFWRU 3LQGLVSRVLWLRQRIFRQQHFWRU for encoder cable for motor cable [Direction of motor shaft] 4 PS 3 E0V 2 BAT– 1 FG 5 PS 2 U V 3 W 1 Gasket E5V BAT+ PE E [Opposite direction of motor shaft] 5 6 Secure the gasket in place without removing it from the connector. Otherwise, the degree of protection of IP67 will not be guaranteed. 7 6 *1 NC: None Connect Remarks Gasket 7 BAT+ E5V PS Gasket 1 FG PE 2 BAT– 3 E W 3 E0V 2 V 4 PS 1 U Gasket * Pins 2 and 5 are left unused (NC) with an incremental encoder. Caution :KHQ,3RU,3DUHQHFHVVDU\WKHFXVWRPHUPXVWJLYHDSSURULDWHSURFHVVLQJ Remarks )RUFULPSWRROHWFQHFHVVDU\WRSURGXFHDFDEOHDFFHVVWKHZHEVLWHRIWKHPDQXIDFWXUHU or consult with the manufacturer for details. For inquiries of manufacturer, refer to P.7-125 "List of Peripheral Equipments". 7-114 7. Options 1 Part No. '930 Specifications Design order: 1 MSME 750W (400V), 1.0kW to 2.0kW, Applicable MDME 400W (400V), 600W (400V), 1.0kW to 2.0kW model MHME 1.0kW to 1.5kW, MGME 0.9kW Without brake 2 &RPSRQHQWV Part No. 3E206-0100 KV 3E306-3200-008 JN2DS10SL1-R JN1-22-22S-PKG100 JL04V-6A-20-4SE-EB-R JL04-2022CK(14)-R Number 1 1 1 5 1 1 Manufacturer Sumitomo 3M *1 Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. Note )RU&RQQHFWRU; SLQV For Encoder cable For Motor cable *1 Old model number: 55100-0670 (Japan Molex Inc.) Part No. '93 3 Applicable MSME 1.0kW to 2.0kW, MDME 1.0kW to 2.0kW model MHME 1.0kW to 1.5kW, MGME 0.9kW Without brake &RPSRQHQWV Title Connector (Driver side) Shell kit Encoder connector Cable clamp Motor connector Cable clamp Part No. 3E206-0100 KV 3E306-3200-008 N/MS3106B20-29S N/MS3057-12A N/MS3106B20-4S N/MS3057-12A Number 1 1 1 1 1 1 Manufacturer Note Sumitomo 3M *1 )RU&RQQHFWRU; SLQV Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. For Encoder cable Setup '930 Specifications Design order: 1 Applicable MSME 3.0kW to 5.0kW, MDME 3.0kW to 5.0kW model MHME 2.0kW to 5.0kW, MGME 2.0kW to 3.0kW Without brake 5 &RPSRQHQWV Part No. 3E206-0100 KV 3E306-3200-008 JN2DS10SL1-R JN1-22-22S-PKG100 JL04V-6A22-22SE-EB-R JL04-2022CK(14)-R Number 1 1 1 5 1 1 Manufacturer Note Sumitomo 3M *1 )RU&RQQHFWRU; SLQV Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. For Encoder cable Adjustment Title Connector (Driver side) Shell kit Encoder connector Connector pin Motor connector Cable clamp 4 For Motor cable *1 Old model number: 55100-0670 (Japan Molex Inc.) Part No. Connection Specifications Design order: C Preparation Title Connector (Driver side) Shell kit Encoder connector Connector pin Motor connector Cable clamp Before Using the Products &RQQHFWRU.LW For Motor cable *1 Old model number: 55100-0670 (Japan Molex Inc.) Part No. '93 Without brake &RPSRQHQWV Part No. 3E206-0100 KV 3E306-3200-008 N/MS3106B20-29S N/MS3057-12A N/MS3106B22-22S N/MS3057-12A Number 1 1 1 1 1 1 Manufacturer Sumitomo 3M *1 Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. Note )RU&RQQHFWRU; SLQV For Encoder cable 7 For Motor cable Supplement Title Connector (Driver side) Shell kit Encoder connector Cable clamp Motor connector Cable clamp When in Trouble Specifications Design order: C 6 Applicable MSME 3.0kW to 5.0kW, MDME 3.0kW to 5.0kW model MHME 2.0kW to 5.0kW, MGME 2.0kW to 3.0kW *1 Old model number: 55100-0670 (Japan Molex Inc.) Caution :KHQ,3RU,3DUHQHFHVVDU\WKHFXVWRPHUPXVWJLYHDSSURULDWHSURFHVVLQJ Remarks )RUFULPSWRROHWFQHFHVVDU\WRSURGXFHDFDEOHDFFHVVWKHZHEVLWHRIWKHPDQXIDFWXUHU or consult with the manufacturer for details. For inquiries of manufacturer, refer to P.7-125 "List of Peripheral Equipments". 7-115 7. Options &RQQHFWRU.LW Part No. '930 Specifications Design order: 1 MSME 1.0kW to 2.0kW (200V), Applicable MDME 1.0kW to 2.0kW (200V), model MFME 1.5kW (Common to with/without brake) (200V), With brake MHME 1.0kW to 1.5kW (200V), MGME 0.9kW (200V) &RPSRQHQWV Title Connector (Driver side) Shell kit Encoder connector Connector pin Motor connector Cable clamp Part No. 3E206-0100 KV 3E306-3200-008 JN2DS10SL1-R JN1-22-22S-PKG100 JL04V-6A20-18SE-EB-R JL04-2022CK(14)-R Number 1 1 1 5 1 1 Manufacturer Note Sumitomo 3M *1 )RU&RQQHFWRU; SLQV Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. For Encoder cable For Motor cable *1 Old model number: 55100-0670 (Japan Molex Inc.) Part No. '93 Specifications Design order: C Applicable MSME 1.0kW to 2.0kW, MDME 1.0kW to 2.0kW model MHME 1.0kW to 1.5kW, MGME 0.9kW With brake &RPSRQHQWV Title Connector (Driver side) Shell kit Encoder connector Cable clamp Motor connector Cable clamp Part No. 3E206-0100 KV 3E306-3200-008 N/MS3106B20-29S N/MS3057-12A N/MS3106B20-18S N/MS3057-12A Number 1 1 1 1 1 1 Manufacturer Note Sumitomo 3M *1 )RU&RQQHFWRU; SLQV Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. For Encoder cable For Motor cable *1 Old model number: 55100-0670 (Japan Molex Inc.) Part No. '930 Specifications Design order: 1 MSME MDME Applicable MFME model MHME MGME 750W to 2.0kW (400V), 3.0kW to 5.0kW 400W to 2.0kW (400V), 3.0kW to 5.0kW With 1.5kW (400V), 2.5kW to 4.5kW (Common to with/without brake) brake 1.0kW to 1.5kW (400V), 2.0kW to 5.0kW 0.9kW (400V), 2.0kW to 4.5kW &RPSRQHQWV Title Connector (Driver side) Shell kit Encoder connector Connector pin Motor connector Cable clamp Part No. 3E206-0100 KV 3E306-3200-008 JN2DS10SL1-R JN1-22-22S-PKG100 JL04V-6A24-11SE-EB-R JL04-2428CK(17)-R Number 1 1 1 5 1 1 Manufacturer Note Sumitomo 3M *1 )RU&RQQHFWRU; SLQV Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. For Encoder cable For Motor cable *1 Old model number: 55100-0670 (Japan Molex Inc.) Part No. '93 Specifications Design order: C Applicable MSME 3.0kW to 5.0kW, MDME 3.0kW to 5.0kW model MHME 2.0kW to 5.0kW, MGME 2.0kW to 3.0kW With brake &RPSRQHQWV Title Connector (Driver side) Shell kit Encoder connector Cable clamp Motor connector Cable clamp Part No. 3E206-0100 KV 3E306-3200-008 N/MS3106B20-29S N/MS3057-12A N/MS3106B24-11S N/MS3057-16A Number 1 1 1 1 1 1 Manufacturer Note Sumitomo 3M *1 )RU&RQQHFWRU; SLQV Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. For Encoder cable For Motor cable *1 Old model number: 55100-0670 (Japan Molex Inc.) Caution :KHQ,3RU,3DUHQHFHVVDU\WKHFXVWRPHUPXVWJLYHDSSURULDWHSURFHVVLQJ Remarks )RUFULPSWRROHWFQHFHVVDU\WRSURGXFHDFDEOHDFFHVVWKHZHEVLWHRIWKHPDQXIDFWXUHU or consult with the manufacturer for details. For inquiries of manufacturer, refer to P.7-125 "List of Peripheral Equipments". 7-116 7. Options 1 Part No. '930 Specifications Design order: 1 Applicable MDME 7.5kW to 15.0kW model MGME 6.0kW, MHME 7.5kW Without brake 2 &RPSRQHQWV Part No. 3E206-0100 KV 3E306-3200-008 JN2DS10SL1-R JN1-22-22S-PKG100 JL04V-6A32-17SE-EB-R JL04-32CK(24)-R *2 Number 1 1 1 5 1 1 Manufacturer Note Sumitomo 3M *1 )RU&RQQHFWRU; SLQV Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. For Encoder cable Preparation Title Connector (Driver side) Shell kit Encoder connector Connector pin Motor connector Cable clamp Before Using the Products &RQQHFWRU.LW For Motor cable *1 Old model number: 55100-0670 (Japan Molex Inc.) *2 &DEOHFRYHUVL]HєWRє&DEOHFRUHPDWHULDOLVQRWVSHFLILHG7KHXVHUFDQVHOHFWWKHFDEOHFRPSDWLEOHZLWKWKHFRQQHFWRUWREHXVHG '930 Specifications Design order: 1 Applicable MDME 7.5kW to 15.0kW model MGME 6.0kW, MHME 7.5kW With brake &RPSRQHQWV Part No. 3E206-0100 KV 3E306-3200-008 JN2DS10SL1-R JN1-22-22S-PKG100 JL04V-6A32-17SE-EB-R JL04-32CK(24)-R *2 N/MS3106B14S-2S N/MS3057-6A Number 1 1 1 5 1 1 1 1 Manufacturer Sumitomo 3M *1 Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. Japan Aviation Electronics Ind. Note )RU&RQQHFWRU; SLQV For Encoder cable For Motor cable 4 Setup Title Connector (Driver side) Shell kit Encoder connector Connector pin Motor connector Cable clamp Brake connector Cable clamp Connection Part No. 3 For Brake cable *1 Old model number: 55100-0670 (Japan Molex Inc.) *2 &DEOHFRYHUVL]HєWRє&DEOHFRUHPDWHULDOLVQRWVSHFLILHG7KHXVHUFDQVHOHFWWKHFDEOHFRPSDWLEOHZLWKWKHFRQQHFWRUWREHXVHG 5 &RQQHFWRU.LWIRU0RWRU%UDNH&RQQHFWLRQ Adjustment Part No. '930 &RPSRQHQWV Title Part No. Number Manufacturer Connector JN4FT02SJM-R 1 Socket contact ST-TMH-S-C1B-3500 2 Japan Aviation Electronics Ind. Note 6 %UDNH %UDNH Remarks *DVNHW %UDNH When in Trouble 3LQGLVSRVLWLRQRIFRQQHFWRUIRUEUDNHFDEOH >'LUHFWLRQRIPRWRUVKDIW@ >2SSRVLWHGLUHFWLRQRIPRWRUVKDIW@ *DVNHW %UDNH 7 6HFXUHWKHJDVNHWLQSODFHZLWKRXWUHPRYLQJLWIURPWKHFRQQHFWRU2WKHUZLVHWKHGHJUHHRI SURWHFWLRQRI,3ZLOOQRWEHJXDUDQWHHG :KHQ,3RU,3DUHQHFHVVDU\WKHFXVWRPHUPXVWJLYHDSSURULDWHSURFHVVLQJ Remarks )RUFULPSWRROHWFQHFHVVDU\WRSURGXFHDFDEOHDFFHVVWKHZHEVLWHRIWKHPDQXIDFWXUHU or consult with the manufacturer for details. For inquiries of manufacturer, refer to P.7-125 "List of Peripheral Equipments". 7-117 Supplement Caution 7 7. Options Supplement Battery For Absolute Encoder Battery For Absolute Encoder Part No. '93 /LWKLXPEDWWHU\9P$K 84 Lead wire length 50mm DV0P2990 00090001 ZHR-2 (J.S.T Mfg. Co., Ltd.) 14.5 1 2 BAT+ BAT– 18 Paper insulator Caution This battery is categorized as hazardous substance, and you may be required to present an application of hazardous substance when you transport by air (both passenger and cargo airlines). Battery Box For Absolute Encoder Part No. '93 &RPSRQHQWV (112) (110) DV0P4430 (27) P04090001* (31) R5 Related page 7-118 3´$EVROXWHV\VWHPµ 7 7. Options Supplement Mounting Bracket 15 40 3 B-frame 17 9.5 2-R 1 15 10 R1 ss le or 2.5 R2 5.2 2.5 R2 2 R 2 R .2 5 18 ± 0.2 R1 ss le or 10 9.5 2.5 Connection 18 ± 0.2 Bottom side Upper side Dimensions ø5 2-M4, Pan head 5 C 2- 5 C 2- 2-M4, Pan head 24 M4 × L6 Pan head 4pcs Mounting screw 2.5 Frame symbol of applicable driver '930 17 ss le or 33 40 15 2.5 R2 R1 7 Part No. 5.2 2-R 1 2.5 17 9.5 11 ± 0.2 10 10 R1 ss le or 2.5 17 9.5 R2 5 2 R .2 2 Preparation 2.5 Bottom side 2 R ø5 2-M4, Pan head 5 C 2- 5 C 2- Upper side Dimensions 11 ± 0.2 M4 × L6 Pan head 4pcs Mounting screw 2-M4, Pan head 24 15 A-frame Before Using the Products Frame symbol of applicable driver '930 Part No. 1 7 4 40 47 47 Setup 9.5 17 15 2.5 40 17 15 2.5 .2 ø5 2- 10 R1 ss le or 2 R 2 R R2 19 5.2 36 ± 0.2 5.2 1 4-R 2.5 R2 R1 10 9.5 2.5 Bottom side 36 ± 0.2 2-M4, Pan head 9.5 2-M4, Pan head 40 ± 0.2 60 M4 × L6 Pan head 4pcs 10 6 When in Trouble 17 Mounting screw 5 C 2- 5 C 2- Upper side Dimensions 15 D-frame ss le or 2.5 Frame symbol of applicable driver '930 10 ss le or 20 40 5 2.5 R2 R1 20 Part No. 5.2 10 9.5 10 R1 ss le or 30 ± 0.2 2-R 1 Adjustment R2 5 2 R 15 2-M4, Pan head 5 C 2- 2 R .2 2.5 Bottom side Upper side Dimensions 30 ± 0.2 ø5 M4 × L6 Pan head 4pcs Mounting screw 2-M4, Pan head 5 C 2- 17 C-frame 2.5 Frame symbol of applicable driver '930 Part No. 7 40 ± 0.2 60 For E, F and G-frame, you con make a front end and back end mounting by changing the mounting direction of L-shape bracket (attachment). Related page 3´'LPHQVLRQVRIGULYHUµ 7-119 Supplement Caution 7 7. Options Supplement Reactor Fig.1 X Y Z NP R S T 6-I E A A 4-H (Mounting pitch) F F: Center-to-center distance on outer circular arc (Mounting pitch) B Fig.2 G 2-I E A A 4-H (Mounting pitch) F F: Center-to-center distance on slotted hole (Mounting pitch) G B Fig.2 Part No. A B C D E (Max) F G H I '93 '93 '93 '93 '93 '93 '93 '93 '930 65±1 60±1 60±1 60±1 60±1 60±1 55±0.7 55±0.7 55±0.7 125±1 150±1 150±1 150±1 150±1 150±1 80±1 80±1 80±1 (93) (113) (113) (113) (113) (113) 66.5±1 66.5±1 66.5±1 136Max 155Max 155Max 155Max 160Max 160Max 110Max 110Max 110Max 155 130 140 150 155 170 90 95 105 ï ï ï ï ï ï 41±2 46±2 56±2 85±2 75±2 85±2 95±2 100±2 115±2 55±2 60±2 70±2 Ѯð Ѯð Ѯð Ѯð Ѯð Ѯð Ѯð Ѯð Ѯð M4 M4 M4 M4 M5 M5 M4 M4 M4 Motor series Power supply Rated output Part No. MSME Single phase, 100V 50W to 100W DV0P227 MSME 200W to 400W DV0P228 MDME MSME Single phase, 200V 50W to 200W DV0P227 MHME 400W to 750W DV0P228 MGME 1.0kW DV0P228 MSME 1.5kW DV0PM20047 MDME 0.9kW DV0P228 MHME MSME MDME MHME Single phase, 200V MGME Single phase, 200V Motor series MSME 50W to 750W DV0P220 MGME MGME 0.9kW DV0P221 MSME MSME MDME 3-phase, 200V MDME 1.0kW 1.5kW DV0P222 1.5kW DV0PM20047 1.5kW DV0P222 2.5kW DV0P224 MHME Single phase, 200V MFME 3-phase, 200V 7-120 F D C H Fig.1 F D C H MHME Power supply 3-phase, 200V Inductance Rated current (mH) (A) 6.81 3 4.02 5 2 8 1.39 11 0.848 16 0.557 25 4.02 5 2 8 1.39 11 Rated output Part No. 2.0kW DV0P223 3.0kW DV0P224 4.0kW DV0P225 7. Options 1 Harmonic restraint 3 Connection 4 Setup 5 Adjustment 6 When in Trouble $OOW\SHVRIWKHJHQHUDOSXUSRVHLQYHUWHUVDQGVHUYRGULYHUVXVHGE\VSHFLÀFXVHUVDUH XQGHUWKHFRQWURORIWKH´*XLGHOLQHVIRUKDUPRQLFUHVWUDLQWRQKHDY\FRQVXPHUVZKRUHFHLYHSRZHUWKURXJKKLJKYROWDJHV\VWHPRUH[WUDKLJKYROWDJHV\VWHPµ7KHXVHUVZKR are required to apply the guidelines must calculate the equivalent capacity and harmonic current according to the guidelines and must take appropriate countermeasures LIWKHKDUPRQLFFXUUHQWH[FHHGVDOLPLWYDOXHVSHFLÀHGLQDFRQWUDFWGHPDQG 5HIHUWR JEM-TR 210 and JEM-TR 225.) 7KH´*XLGHOLQHVIRUKDUPRQLFUHVWUDLQWRQKRXVHKROGHOHFWULFDODSSOLDQFHVDQGJHQHUDO SXUSRVH DUWLFOHVµ ZDV DEROLVKHG RQ 6HSWHPEHU +RZHYHU EDVHG RQ FRQYHQtional guidelines, JEMA applies the technical documents JEM-TR 226 and JEM-TR WR DQ\ XVHUV ZKR GR QRW ÀW LQWR WKH ´*XLGHOLQHV IRU KDUPRQLF UHVWUDLQW RQ KHDY\ consumers who receive power through high voltage system or extra high voltage sysWHPµIURPDSHUVSHFWLYHRQHQOLJKWHQPHQWRQJHQHUDOKDUPRQLFUHVWUDLQW7KHSXUSRVH of these guidelines is the execution of harmonic restraint at every device by a user as usual to the utmost extent. 2 Preparation Harmonic restraint measures are not common to all countries. Therefore, prepare the measures that meet the requirements of the destination country. :LWK SURGXFWV IRU -DSDQ RQ 6HSWHPEHU ´*XLGHOLQHV IRU KDUPRQLF UHVWUDLQW RQ heavy consumers who receive power through high voltage system or extra high voltage V\VWHPµ DQG ´*XLGHOLQHV IRU KDUPRQLF UHVWUDLQW RQ KRXVHKROG HOHFWULFDO DSSOLDQFHV DQG JHQHUDOSXUSRVH DUWLFOHVµ HVWDEOLVKHG E\ WKH$JHQF\ IRU 1DWXUDO 5HVRXUFHV DQG (QHUJ\ of the Ministry of Economy, Trade and Industry (the ex-Ministry of International Trade and Industry). According to those guidelines, the Japan Electrical Manufacturers’ Association (JEMA) have prepared technical documents (procedure to execute harmonic restraint: JEM-TR 198, JEM-TR 199 and JEM-TR 201) and have been requesting the users to understand the restraint and to cooperate with us. On January, 2004, it has been decided to H[FOXGHWKHJHQHUDOSXUSRVHLQYHUWHUDQGVHUYRGULYHUIURPWKH´*XLGHOLQHVIRUKDUPRQLF UHVWUDLQW RQ KRXVHKROG HOHFWULFDO DSSOLDQFHV DQG JHQHUDOSXUSRVH DUWLFOHVµ$IWHU WKDW WKH ´*XLGHOLQHV IRU KDUPRQLF UHVWUDLQW RQ KRXVHKROG HOHFWULFDO DSSOLDQFHV DQG JHQHUDO SXUSRVHDUWLFOHVµZDVDEROLVKHGRQ6HSWHPEHU We are pleased to inform you that the procedure to execute the harmonic restraint on JHQHUDOSXUSRVHLQYHUWHUDQGVHUYRGULYHUZDVPRGLÀHGDVIROORZV Before Using the Products Reactor 7 Supplement 7-121 7 7. Options Supplement External Regenerative Resistor Specifications Manufacturer's Resistance part No. Part No. Mass Free air with fan mm kg W W 0.1 10 25 ї DV0P4280 Rated power (reference) *1 cable core outside diameter RF70M 50 DV0P4281 RF70M 100 0.1 10 25 DV0P4282 RF180B 25 0.4 17 50 DV0P4283 RF180B 50 0.2 17 50 DV0P4284 RF240 30 DV0P4285 RH450F 20 DV0PM20048 RF240 120 DV0PM20049 RH450F 80 DV0PM20058 RH450F × 6 3.3 DV0PM20059 RH450F × 6 13.3 ( Ѯ AWG18 stranded wire ) 0.5 40 100 1.2 52 130 0.5 35 80 1.2 65 190 16 — *3 780 16 *3 — *2 — *2 — Activation temperature of built-in thermostat Ý& B-contact Open/Close capacity (resistance load) 1A 125VAC 6000 times 0.5A 250VAC 10000 times 1140 Manufacturer : Iwaki Musen Kenkyusho *1 Power with which the driver can be used without activating the built-in thermostat. A built-in thermal fuse and a thermal protector are provided for safety. The circuit should be so designed that the power supply will be turned off as the thermal protector operates. The built-in thermal fuse blows depending on changes in heat dissipation condition, operating temperature limit, power supply voltage or load. Mount the regenerative resistor on a machine operating under aggressive regenerating condition (high power supply voltage, large load inertia, shorter deceleration time, etc.) and make sure that the surface temperature will not exceed 100°C. $WWDFKWKHUHJHQHUDWLYHUHVLVWRUWRDQRQÁDPPDEOHPDWHULDOVXFKDVPHWDO &RYHUWKHUHJHQHUDWLYHUHVLVWRUZLWKDQRQÁDPPDEOHPDWHULDOVRWKDWLWFDQQRWEHGLUHFWO\WRXFKHG Temperatures of parts that may be directly touched by people should be kept below 70°C. *2 Terminal block with screw tightening torque as shown below. T1, T2, 24V, 0V, E:M4:1.2 to 1.4N·m R1, R2 :M5:2.0 to 2.4N·m 8VHWKHFDEOHZLWKWKHVDPHGLDPHWHUDVWKHPDLQFLUFXLWFDEOH 5HIHUWR3 *3 With built-in fan which should always be operated with the power supply connected across 24 V and 0 V. DV0P4280, DV0P4281 17 8 60 13 30 7 thermostat (light yellow ×2) DV0P4283 D DV0P4284 DV0PM20048 E DV0P4284 × 2 in parallel or DV0P4285 DV0PM20049 DV0P4285 × 2 in parallel DV0PM20049 × 2 in parallel G DV0P4285 × 3 in parallel DV0PM20049 × 3 in parallel H DV0P4285 × 6 in parallel or DV0PM20058 DV0PM20049 × 6 in parallel or DV0PM20059 DV0P4282, DV0P4283 170±1 160 Ѯ thermostat (light yellow ×2) 7 10 Drawing process (2mm MAX) ±1 300±30 24 23 — 21 13 — DV0P4282 SKDVH9 28 C Ѯ DV0P4283 300 13 DV0P4280 DV0P4281 (50W, 100W) DV0P4283 (200W) B F 7-122 Single phase, 9 SKDVH9 10MAX A Single phase, 9 Frame 10MAX Power supply 7. Options 1 DV0P4284, DV0PM20048 DV0P4285, DV0PM20049 300 290 280 300 278 (5) Ѯ thermostat (light yellow ×2) 300 450 100 50 15 20 10 288 18 11 9MAX 10MAX Preparation 300 71 140 130 70 14 15 100 25 4.5 450 10 2 450 Ѯ 53 thermostat (light yellow ×2) Before Using the Products External Regenerative Resistor DV0PM20058, DV0PM20059 R1 R2 3 T1 T2 24V 0V E T.F R T.F R T.F R T.F R T.F R ѡ FAN Connection T.F R The third from the top FG Ѯ 6- 7 5 ї(DV0PM20058) 5 ї(DV0PM20059) 4 240 228 Circuit diagram Setup 20 215 215 20 470 380 193 Cover (Punching metal) 124 (38) Adjustment 270 MAX 5 470 6 Regenerative resistor gets very hot. 7 Supplement Caution Thermal fuse is installed for safety. Compose the circuit so that the power will be turned off when the thermostat is activated. The thermal fuse may blow due to heat dissipating condition, working temperature, supply voltage or load fluctuation. 0DNHLWVXUHWKDWWKHVXUIDFHWHPSHUDWXUHRIWKHUHVLVWRUPD\QRWH[FHHGÝ&DW the worst running conditions with the machine, which brings large regeneration (such case as high supply voltage, load inertia is large or deceleration time is short) Install a fan for a forced cooling if necessary. When in Trouble Remarks Take preventive measures for fire and burns. Avoid the installation near inflammable objects, and easily accessible place by hand. 7-123 7 7. Options Supplement Recommended components Surge absorber for motor brake Motor Part No. 50W to 750W (200V) MSME Manufacturer Z15D271 750W (400V) 1.0kW to 5.0kW Ishizuka Electronics Co. Z15D151 400W (400V) 600W (400V) MDME 1.0kW to 3.0kW NVD07SCD082 KOA CORPORATION 4.0kW to 7.5kW Z15D151 Ishizuka Electronics Co. NVD07SCD082 KOA CORPORATION 0.9kW to 6.0kW Z15D151 Ishizuka Electronics Co. 1.0kW, 1.5kW NVD07SCD082 KOA CORPORATION 2.0kW to 7.5kW Z15D151 Ishizuka Electronics Co. 11kW, 15kW 1.5kW MFME 2.5kW, 4.5kW MGME MHME 7-124 7. Options Supplement /LVWRI3HULSKHUDO(TXLSPHQWV Manufacturer Tel No. / Home Page 1 Peripheral components 81-6-6908-1131 http://panasonic-denko.co.jp/ac Circuit breaker Surge absorber Iwaki Musen Kenkyusho Co., Ltd. 81-44-833-4311 http://www.iwakimusen.co.jp/ Regenerative resistor Ishizuka Electronics Corp. 81-3-3621-2703 http://www.semitec.co.jp/ KOA CORPORATION 81-42-336-5300 http://www.koanet.co.jp/ TDK Corp. 81-3-5201-7229 http://www.tdk.co.jp/ (Nisshin Electric Co., Ltd.) 81-4-2934-4151 http://www.nisshin-electric.com/ 81-3-4544-7040 http://www.okayatec.co.jp/ Japan Aviation Electronics Industry, Ltd. 81-3-3780-2717 http://www.jae.co.jp Sumitomo 3M 81-3-5716-7290 http://www.mmmco.jp Tyco Electronics 81-44-844-8052 http://www.tycoelectronics.com/ japan/ Japan Molex Inc. 81-462-65-2313 http://www.molex.co.jp J.S.T. Mfg. Co., Ltd. 81-45-543-1271 http://www.jst-mfg.com/index_i. html Daiden Co., Ltd. 81-3-5805-5880 http://www.dyden.co.jp/ Mitutoyo Corp. 81-44-813-8236 http://www.mitutoyo.co.jp Magnescale Co., Ltd. 81-463-92-7973 http://www.mgscale.com Schaffner EMC, Inc. 81-3-5712-3650 http://www.schaffner.jp/ 4 Surge absorber 1RLVHÀOWHU 5 Connector 6 When in Trouble Okaya Electric Industries Co. Ltd. 1RLVHÀOWHUIRUVLJQDOOLQHV Adjustment 81-184-53-2307 http://www.kk-corp.co.jp/ 3 Setup KK-CORP.CO.JP Surge absorber for holding brake Cable External scale 7 1RLVHÀOWHU Supplement Note Connection MICROMETALS 2 Preparation Automation Controls Company Panasonic Electric Works, Co.,Ltd Before Using the Products 7 Contact information shown above is as of Februaly 2011. This list is for reference only and subject to change without notice. 7-125 Warranty Warranty period 7KH ZDUUDQW\ SHULRG LV RQH \HDU IURP WKH GDWH RI SXUFKDVH RU PRQWKV IURP WKH month of manufacture in our plant. For a motor with brake, the axis accelerated and decelerated more times than the VSHFLÀHGOLPLWLVQRWFRYHUHGE\ZDUUDQW\ Warranty information 6KRXOG DQ\ GHIHFW GHYHORS GXULQJ ZDUUDQW\ SHULRG XQGHU VWDQGDUG VHUYLFH FRQGLWLRQV as described in the manual, the company agrees to make repairs free of charge. Even during warranty period, the company makes fee-based repair on product containing: [1] Failure or damage due to misuse, improper repair or alteration. [2] Failure or damage due to falling, or damage during transportation, after the original delivery >@ 'HIHFWVUHVXOWLQJIURPQHJOHFWRIWKHVSHFLÀFDWLRQLQXVHRIWKHSURGXFW >@ )DLOXUHRUGDPDJHGXHWRXQUHJXODWHGYROWDJHDQGÀUHDQGDFWRIQDWXUDOGLVDVWHUVVXFKDVHDUWKTXDNHOLJKWQLQJZLQGÁRRGDQGVDOWSROOXWLRQ [5] Defects resulting from invasion of foreign materials such as water, oil and metal pieces. 3DUWVH[FHHGLQJWKHLUVWDQGDUGOLIHWLPHVSHFLÀHGLQWKLVGRFXPHQWDUHH[FOXGHG 7KHFRPSDQ\VKDOOQRWEHOLDEOHIRUDQ\LQGLUHFWLQFLGHQWDORUFRQVHTXHQWLDOGDPDJHRU loss of any nature that may arise in connection with the product. 7-126 Cautions for Proper Use 3UDFWLFDOFRQVLGHUDWLRQVIRUH[SRUWLQJWKHSURGXFWRUDVVHPEO\FRQWDLQLQJWKHSURGXFW When the end user of the product or end use of the product is associated with military affair or weapon, its export may be controlled by the Foreign Exchange and Foreign Trade Control Law. Complete review of the product to be exported and export formalities should be practiced. 7KLVSURGXFWLVLQWHQGHGWREHXVHGZLWKDJHQHUDOLQGXVWULDOSURGXFWEXWQRWGHVLJQHG or manufactured to be used in a machine or system that may cause personal death when it is failed. ,QVWDOODWLRQ ZLULQJ RSHUDWLRQ PDLQWHQDQFH HWF RI WKH HTXLSPHQW VKRXOG EH GRQH E\ TXDOLÀHGDQGH[SHULHQFHGSHUVRQQHO $SSO\DGHTXDWHWLJKWHQLQJWRUTXHWRWKHSURGXFWPRXQWLQJVFUHZE\WDNLQJLQWRFRQVLGeration strength of the screw and the characteristics of material to which the product is LQVWDOOHG 2YHUWLJKWHQLQJ FDQ GDPDJH WKH VFUHZ DQGRU PDWHULDO XQGHUWLJKWHQLQJ FDQ result in loosening. Example) Steel screw into steel section: M4 1.35 to 1.65 N·m. M5 2.7 to 3.3 N·m. M6 4.68 to 5.72 N·m. M8 11.25 to 13.75 N·m. M10 22.05 to 26.95 N·m. M11 37.8 to 46.2 N·m. ,QVWDOODVDIHW\HTXLSPHQWVRUDSSDUDWXVLQ\RXUDSSOLFDWLRQZKHQDVHULRXVDFFLGHQWRU loss of property is expected due to the failure of this product. Consult us if the application of this product is under such special conditions and environments as nuclear energy control, aerospace, transportation, medical equipment, various safety equipments or equipments which require a lesser air contamination. :HKDYHEHHQPDNLQJWKHEHVWHIIRUWWRHQVXUHWKHKLJKHVWTXDOLW\RIWKHSURGXFWVKRZever, application of exceptionally larger external noise disturbance and static electricity, or failure in input power, wiring and components may result in unexpected action. It is highly recommended that you make a fail-safe design and secure the safety in the operative range. ,IWKHPRWRUVKDIWLVQRWHOHFWULFDOO\JURXQGHGLWPD\FDXVHDQHOHFWURO\WLFFRUURVLRQWR the bearing, depending on the condition of the machine and its mounting environment, DQGPD\UHVXOWLQWKHEHDULQJQRLVH&KHFNLQJDQGYHULÀFDWLRQE\FXVWRPHULVUHTXLUHG )DLOXUH RI WKLV SURGXFW GHSHQGLQJ RQ LWV FRQWHQW PD\ JHQHUDWH VPRNH RI DERXW RQH cigarette. Take this into consideration when the application of the machine is clean room related. 3OHDVH EH FDUHIXO ZKHQ XVLQJ LQ DQ HQYLURQPHQW ZLWK KLJK FRQFHQWUDWLRQV RI VXOIXU RU sulfric gases, as sulfuration can lead to disconnection from the chip resistor or a poor contact connection. 7DNHFDUHWRDYRLGLQSXWWLQJDVXSSO\YROWDJHZKLFKVLJQLÀFDQWO\H[FHHGVWKHUDWHGUDQJH to the power supply of this product. Failure to heed this caution may result in damage to WKHLQWHUQDOSDUWVFDXVLQJVPRNLQJDQGRUDÀUHDQGRWKHUWURXEOH The user is responsible for matching between machine and components in terms of FRQÀJXUDWLRQGLPHQVLRQVOLIHH[SHFWDQF\FKDUDFWHULVWLFVZKHQLQVWDOOLQJWKHPDFKLQH RU FKDQJLQJ VSHFLÀFDWLRQ RI WKH PDFKLQH 7KH XVHU LV DOVR UHVSRQVLEOH IRU FRPSO\LQJ with applicable laws and regulations. 7KHSURGXFWZLOOQRWEHJXDUDQWHHGZKHQLWLVXVHGRXWVLGHLWVVSHFLÀFDWLRQOLPLWV Parts are subject to minor change to improve performance. 7-127 After-Sale Service (Repair) Repair Consult to a dealer from whom you have purchased the product for details of repair. When the product is incorporated to the machine or equipment you have purchased, consult to the manufacturer or the dealer of the machine or equipment. Technical information Technical information of this product (Operating Instructions, CAD data) can be downloaded from the following web site. http://industrial.panasonic.com/ww/i_e/25000/motor_fa_e/motor_fa_e.html Panasonic Corporation, Motor Business Unit, Industrial Sales Group Tokyo: Kyobashi MID Bldg, 2-13-10 Kyobashi, Chuo-ku, Tokyo 104-0031 TEL +81-3-3538-2961 )$; Osaka: 1-1, Morofuku 7-chome, Daito, Osaka 574-0044 TEL +81-72-870-3065 )$; For your records: The model number and serial number of this product can be found on either the back or the bottom of the unit. Please note them in the space provided and keep for future reference. Model No. M DH M ME Serial No. Date of purchase Name Dealer Address Phone ( ) - 7-1-1 Morofuku, Daito, Osaka, 574-0044, Japan Phone : +81-72-871-1212 © Panasonic Corporation 2009 IME10 A1009-3121
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.6 Linearized : Yes Encryption : Standard V4.4 (128-bit) User Access : Print, Extract, Print high-res Author : E157989 Create Date : 2012:04:16 16:51:33+09:00 Modify Date : 2012:07:30 13:33:36+09:00 Title : Trapped : False XMP Toolkit : Adobe XMP Core 5.2-c001 63.139439, 2010/09/27-13:37:26 Metadata Date : 2012:07:30 13:33:36+09:00 Creator Tool : Adobe InDesign CS5_J (7.0) Format : application/pdf Creator : E157989 Document ID : uuid:e99e0071-6fe3-4ca1-940c-b250da5fecc3 Instance ID : uuid:8290b02f-4752-43d6-96de-8a8ab26133d9 Producer : Acrobat Distiller 10.0.0 (Windows) Page Count : 478EXIF Metadata provided by EXIF.tools