Quanzhou Wouxun Electronics WOUXUN09 TWIN BAND MOBILE/BASE TRANSCEIVER User Manual
Quanzhou Wouxun Electronics Co., Ltd. TWIN BAND MOBILE/BASE TRANSCEIVER
User Manual
Thanks for buying the Qwouxun KG-UV920R-A mobile radio. This mobile radio offers latest design, enhanced features, solid performances and easy accessibility. We believe you will be pleased with the high quality and reliable features for all your communication needs. Read this important information on the safe and efficient operation before using mobile radio.This manual is suitable for KG-UV920R-A. One or more of the following statements may be applicable: RF Radiation Information RF Radiation Profile Your @wouxun mobile radio is designed and tested to comply with a number of national and international standards and guidelines (listed below) regarding human exposure to radio frequency electromagnetic energy. This radio complies with the IEEE and lCNIRP exposure limits for occupational/controlled RF exposure environ- ment at operating duty factors of up to 50% transmitting and is authorized by the FCC for occupational use only. In terms of measuring RF energy for compliance with the FCC exposure guidelines, your radio radiates measurable RF energy only while it is transmitting (during talking in PTT mode), not when it is receiving (liste- ning) or in standby mode. The device complies with SAR and/or RF field strength limits of RSS-102 requirement RF Radiation Safety In order to ensure user health, experts from relevant industries including science, engineering, medicine and health work with international organizations to develop standards for safe exposure to RF radiation. These 5 tandards consist of: 0 United States Federal Communications Commission, Code of Federal Regulations; 47CFR part 2 sub-part J; 0 American National Standards Institute (ANSI)/ Institute of Electrical and Electronic Engineers (I EEE) C95. 1-1992; 0 Institute of Electrical and Electronic Engineers (IEEE) C95. 1 ~ 1999; 0 International Commission on Non-Ionizing Radiation Protection (lCNIRP) 1998; FCC Regulations Federal Communication Commission (FCC) requires that all radio communication products should meet the requirements set forth in the above standards before they can be marketed in the US, and the manufacturer shall post a RF label on the product to inform users of Operational instructions, so as to enhance their occupat— ional health against exposure to RF energy. Operational Instructions and Training Guidelines 0 To ensure optimal performance and compliance with the occupational/controlled environment RF energy exposure limits in the above standards and guidelines, users should transmit no more than 50% of the time and always adhere to the following procedures: 0 Gain of antenna must not exceed 5.00dBi for UHF and 2.15dBi for VHE 0 Antenna Installation: Install the mobile antenna at least 100 cm away from your body, in accordance with the requirements of the antenna manufacturer/supplier. 0 The radio is not intended for use by general population in an uncontrolled environment. It is only for occup- ational use and only applied to work-related conditions.The radio must be only used by users, who are fully aware of the hazards of the exposure and who are able to exercise control over their RF exposure to qualify for the higher exposure limits. Part 15 Compliance This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: a Reorient or relocate the receiving antenna. 0 Increase the separation between the equipment and receiver. 0 Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. 0 Consult the dealer or an experienced radio/TV technician for help. Note:"Changes or modifications to this unit not expressly approved by the party responsible for compliance could void the userls authority to oper- ate the equipment. Sefety information The KG-W920R-A is an electrical apparatus, as well as a generator of RFtRadio Frequency) energy, and you should exercise all safety precautions as are appropriate of this type of device. These safety tips apply to any device installed in a well-designed amateur radio station. A Explosive atmospheres(gases, dust, fumes, etc.).Tum OFF your mobile radio while taking on fuel or while parked in gasoline service stations. Do not carry spare fuel containers in the trunk of your vehicle if your mobile radio is mounted in the trunk area. A Injury from radio frequency transmissions. Do not operate your mobile radio when somebody is either standing near to or touching the antenna, to avoid the possibility of radio frequency burns or related physical injury. A Dynamite blasting wps. Operating the mobile radio within 150m(500 feet) of dwamite blasting caps may cause them to explode. Turn OFF your mobile radio when in a area where blasting is in progress. or where 'TURN OFF TWO-WAY RADIO“ signs have been posted. If you are transporting blasting ups in your vehicle. make sure they are carried in a closed metal box with a padded interior. Do not transmit while the caps are being placed into or removed from the container. A Never allow unsupervised children to play in the vicinity of your mobile radio or antenna installation. A Be certain to wrap any wire or cable splices thoroughly with insulafing electrical tape. to prevent short drwits. A Do not route cables or wires through door jambs or other locations where, through wear and tear, they may become frayed and shorted to ground or to each other. A Do not stand in front of a directional antenna while your are transmitting into that antenna. Do not install a directional antenna in any location where humans or pets may be walking in the main directional lobe ofthe anmnna's radiation pattern. Safety Information A In mobile installafions, it is preferable to mount your antenna on top of the root of the vehicle. itfeasible. so as to ufilize the car body as a oounterpoise for the antenna and raise the radiation pattern as far away from passengers as possible. A During vehicular operafion when stopped(in a parking lot. for example). make it a pracfice to switch to Low power it there are people walking nearby. A Never wear dual-earmuff headphones while driving a vehicle. A Do not attempt to drive your vehicle while making a telephone call on an autopatch using the DTMF microphone. Pull over to the side of the road, whether dialing manually or using the auto-dial feature. )) All of the above advice is suited to the use of your @Iuouxm mobile radio and its accessories. If they do not funcflon normally, please get In touch with the Gunman dealer Immediately. )) If you use components or accessories not sold by Wouxun Company. Wouxun will not guarantee the safety and usability of the transceiver. Contents Checking the equipment Main functions v , , Technical specifications ‘- Pre-use installation v Transceiver installation Connecting power source Antenna connection Front panel installation , Accessories installation Getting started Front panel LCD Back panel Side panels Hand microphone Your first 080 Commonly used basic operations Adjust squelch Select singe I dual dispaly mode Select VFO / MR modewr Shortcut operatlon chart Menu operation sheet Function description 17-21 21 21 21 " 21 ,, 22 23-26 27-33 Hotkey function gulde Menu operations . Step frequency settings (STEP) ----- Menu 1 Wide/Narrow bandwidth settings (WIN) ————— Menu 2 Two medium level power settings (MPOWSET) ----- Menu 3 Offset frequency settings (OFF—SET) ——— Menu 4 Transmission prompt settings (ROGER) ---— Menu 5 Beep prompt settings (BEEP) ————— Menu 6 Voice prompt settings (VOICE) —-- Menu 7 Busy channel lock-out (BCL) ----- Menu 8 , Mute settings (SP—MUTE) —— Menu 9 Scan mode settings (SC-REV) ———— Menu 10 Transmission time—out timer (TOT) — -- Menu 11 Transmission overtime alarm (TOA) — - Menu 12 Caller ID transmission settings (ANI—SW) — Menu 13 Ring time (RING) __ Menu 14 , ., . .. . , . Editing Caller ID (ANl-EDIT) ———— Menu 15 DTMF sidetone settings (DTMFST) ————— Menu 16 Caller ID transmission mode (PTT-ID) ----- Menu 17 ' Transmission backlight (TX—LED) ————— Menu 13 Standby backlight (WT-LED) —- - Menu 19 28—33 ' 33-50 - 33 33 34 34 34 35 35 735 36 36 37 37 37 " 37-38 38 39 '39 39 39 Receiving backlight (RX—LED) --— Menu 20 Deleting a channel (DEL—CH) -— Menu 21 Editing a channel name (CH—NAME) ——— Menu 22 Priority channel switch (PRICH-SW) —--— Menu 23 ' Speaker settings (SPK— CONT) ———— Menu 24 v , , , , , Keypad autolock (AutoLock) ——— Menu 25 Receiving CTCSS (RX—OTC) ———— Menu 26 Receiving DCS (RX-DCS ) ----- Menu 27 Transmitting CTCSS (T X—CTC) ----- Menu 28 Transmitting DCS (TX—DOS) ————— Menu 29 Repeater speaker switch (RPT—SPK) —--- Menu 30 Repeater PTT switch (RPT—PTI') — —— Menu 31 Repeater settings (RPT—SET) ————— Menu 32 Scan add (SCAN-ADD) ----- Menu 33 Automatic power-oft (APO-TIME) ----- Menu 34 Single-tone pulse frequency (ALERT)—--- Menu 35 Compand (COMPAND)—-- Menu 36 Overheating detection (AUTO—FAN) —- Menu 37 Voltage testing (LOW -V) ----- Menu 38 Voice scrambler (SCRAM) ————— Menu 39 CTCSS / DCS scanner saving types (SC—OT) ———— Menu 40 TwlnBInflFMT r 40 40 40 41 ~41 42 42 42 42 42-43 43 43 , 44-45 - 45—46 46 46-47 47 47-48 48 48—49 49 Noise reduction settings (ANS) ———— Menu 41 , , , , 49 Scan group settings (SC-GROUP) ————— Menu 42 49-50 FM radio function (FM—Radio) ————— Menu 43 , , ~ , , 50 Reset settings (Reset) ————— Menu 44 > . > . » . 50 How to operate FM radio 51-52 Turning on . , v - v - v - 51 Selecting and scanning radio stations -- -- -- -- -- 51 Storing and calling out the radio stations ..... ....... ..... ....... ..... 51.52 Exiting the FM radio mode , . , 52 Repeater usage - Repeater P‘l'l' selection Repeater SPK selection Two—way cross-band repeater entry and exit , , , , , 53 Hand microphone encoding function - - 54 Remote control function 55.53 Remote control activation 55 Monitoring ,.,, , ~ ~ , 56 Inspection ,, , ,,, , , , ,, ,,, , , , , , , , , 56-57 Remote control power on/off , , , , , , , , , , 57-58 Twin Send PM Wire-clone function , ~ , » 58 Optional accessories ‘ ' ' , ~ ,, 59 Troubleshooting » » , , . , , 60 Announcement , , , , , , .61 Checking the equipmen , Main Functions 1. Frequency Range Suitable for any Region of any Country: 136-174MHz a. 400-470MHZE144-148MH2 & 222425an 9. Both Stations can Form Combined Same 136-174MHz & 400-480MH15144—148MH2 a. 420-450MH2 Band or BMW"! Band RW' W I TX) 136-174MHz a 216-280MH2 iss—aaMHz & 135-174MH2 10. mwsummwmmsomeFMl 136-174MHz a. 420-520MH2566-58MH1 s. 400-480MHZ 11- 0T I DOT Elmira & We. 0T! DOTSeImhll Carefully unpack the n'ansoelver. We recommend that you Identify the Items In the following table before discarding the packing material. If any item is missing or has been damaged during shipment. please notify your Gunman dealer. Standard Accessories 144-146MHz & 430-440MHZ: 12. Multiple Speaker Channel Settings (RX) FM: 65MHZ~108MHZ (100K Frequency Spacing) 13. Individual Hand Microphone with TXI RX Indicator 2. Band can be Set Freely 1‘ lwomiw "woe Display \\ a VHF TX-UHF RX or UHF TX-VHF RX Caller ID display , ' , . 0- o— 3. Dual Reception 15. DTMF Encoding and Decoding Mobile/Base Hand Inclined Switchboard Flat Switchboard Hand Twin Band Simultaneous Reception 16- Group “I“, All ‘3‘“! and Selective Calls Transceiver Microphone Panel (Already Installed Panel Microphone 4. Dual Display 17. BGroups Scramblortomlon-l) on Mobile Transceiver) Hook Large LCD Dual Freqleno/ Display, 13- PM Chanml Sunnlne Two Completely Independent Operating Systems 19- “’0 ""10”“an 5. Over 999 Memory channels 20- English VOIOG Guide / Area Scanning Management 21- Automatic Temperature Testing ' . V 6. Remote-head Mounting Capacity 22- Minimum Operating V0” Settings / / Q Multiple Installan‘on Types. Convenient Usage 23- 5”" '"d Kl" Function ‘ L ' 7. Frequency Steps Selectable 2" Single T0" Pm“ FMWHW Remote Front Mobile Power Users manual Mobile Mounting 2t5(0ptional)l516.25/10112.5l20/25/30I50/100KH2 2100Hz/1750Hz/1450Hz/1000Hz (Used when activating repeater signal) Bracket Panel Blacket Cold 3. Cross-Band Repeat _ UHF I VHF Cross-band Repeal or VHF I UHF 25- 17"“ °°'°" mm” mm Cross-band Repeat Functions 26. Reduced Noise Settings 02 Techn cal specifications General Receiver Wide bandwidth Narrow bandwidth Frequency Range Suitable tor any Region at any Country: Adjacent Channel (RX , TX) Seleomy 37MB seeds Frequency 136<174MH1 a. 400410MHz 136<174MH2 a 400-480MHZ . Range 136-174MH1 a 21 ezcoMHz 13e174MHz a. 420-520an '"‘°""°d“'a"°" ”5‘15 35MB 144—146MH2 a 430440MH2 144—148MH1 & 222-225MHz Spurious Response 37MB a7DdB 144—1me 8. 420-450MHz easemHz 8-136-174MHz tic-saw; & 4004mm: (RX) FM: 85MH1-108MH1 (100K Frequency Spacing) Audio Response traumas-3m) +1-4dBt03—255kHz) Step 2.5(0pttonal)5' Til 1m 7 l ‘ kt , (1 i Connect the cable to the transceiverl s 8 point socket. " “ 1 7i , \ 4 > v 3 . a Left facet connection point 1 Canned through the conducting wire to right facet 1 Left facet connection point 2 Connect "trough the conducting wire to right facet 4 Left facet connection point 3 Canned through the conducting wire to right facet 3 ' Left facet connection point 4 Connect through the conducting wire to right facet 2 ( 2 ) Proceed according the the arrow shown. Left facet connection point 5 Connect through the conducting wire to right facet 5 _ , \\ Left facet connection point 6 Connect through the conducting wire to right facet 6 .r \: afixfiwfium'\ Left facet connection point 7 Canned through the conducting wire to right facet 7 .KM , Left facet connection point 8 Cannect through the conducting wire to right facet 8 ‘ V i} ‘— Therefore the conducting wires connection to the left facet is corresponding and the connection to the right facets 2 and 4 are swapped. 09 10 Front panel rnstalla ron Acoessorles Installation ( 2 ) First string the connection line through opening in the center of the support bracket. then close the bracket cover directly as shown by the arrows. Special Reminder A >> If the connection wires are not ©wouxun Company supplied or dealer approved, @wouxun Company does not guarantee its safety and operational effectivenessl - DIsmantllng the front panel and transceiver ( 1 i Disconnect wver in the direction of the arrow ( 2 ) Remove In the dlrectton shown by the arrow I Outer speakers The external speaker jacks can be connected to a 3.5mm single oultet. There are two speaker outlets located on the back ol the transceiver. - Installatlon of front panel support bracket When the transceivers front panel is installed separately from the main platform, there is a supplied front panel support bred ) Hazardous movin parts keep fingers and other ody parts away. Program connection socket] combined repeater socket we Side panels 15 Hand microphone RX indicator llghl (Green) Handset keypad lock key (device key) Transmission key (PTT) Up key Function keyl Enter key Master lrequency set up key (see not key operation 1) Frequency or channel selection hot key (See hotkey operation 2) Save channel hot key (See not key operation 4) Output power key Frequency shllt dlrecflon hot key (See hot key operation7) TDR single and dual display switch key (See hot key lion 5) Control panel connection socket @222 TX Indlcator light ( Red ) Microphone (MIC) -—Downkey Exit] cancel key Scanning key (See scanner functions) OTCSS I DCS encoding and decoding set up, CTCSS I DOS scanning (See not key operation 3) Encrypted communications set up hot key. (See hol key operation 10) VFO/MR switch key (see hot key operation 8) keyboard lock key (See keyboard lock) Squelch ievei adjustment hot key (see hot key shortcut 9) Receiver speaker 16 17 ur first 080 First 080 Do you want to hurry up and use your transceiver? After reading these chapters and sections you will know how to broadcast your voice out into the sky. Following is a quick instruction manual. If you encounter any problems or need further explanation, please read me detailed explanation later in mis manual. 1.lnstalling the transceiver. (See pre-usage installation) 2.Installlng the antenna. (See pro-usage Installation) 3.Connecting the power source, or vehicle power source. (See pro-usage installation) 4.Press@)to turn on the transceiver. the transceiver will make a long douple beeping tone. its brand and model number will be displayed on the screen, and with a long double beeping tone, the transceiver will enter standby mode. Adjusting the volume Rotate the VOL1 and VOL 2 knobs clockwise In order m Increase the volume. rotate the knobs counter-clockwise (0 decrease volume, the oooresponding volume level will be displayed on the LED. The volume control knobs have upper and lower control devices. The upper control devices is the channel and frequency RX volume control on the left side of the screen. the lower level control device is the channel and frequency RX volume control on the right side of the screen. Turn the volume knob clockwise to increase the volume and the RX volume. The maximum volume is level 16. Turn me knob counter-clockwise to decrease me volume and the RX volume. Confinue turning the knob cou nter—clockwlse to shut off. TURNING Selecting Frequency (1) Frequency mode (VFO) VFO Mode is the basic mode for changing the operating frequency, through rotating the TURNING (Tuning) control knobs you can change the operating frequency. Turn the knobs clockwise to increase the frequency and counEr-olcckwise to decrease. You can also enter the desired frequency using the keypad. Changing the operating frequency using the keypad: While in standby mode, press the (2) key to enter in the operating frequency selection. Alter the LED screeen displays 8 whittl- en‘ees. enter In the 6 figures In order which the frequency will automatically confirm according to the ~trequency automated oo- rrection' verification. And will then display on the LED screen. 18 19 ur first 050 Automatic frequency correction: An operating lrequency has a total of 3 digits, the method for verifying the last two digits atmr inputing 6 digits using the keyboard is as follows: When the 5th digit is entered in as “3" or "8", the 6th digit as "1" the final two digits will be “25". When the 6th digit is entered in as “0" or “5" the last two digits will be “00". If the (5th digit is not entered as shown above, it will be automatically corrected to 6‘25K step match frequenw. Example lrequency 1: 445.95500MHZ standby mode: Press 2 key Dlsplaw Input [4] Display: '“Pu' [‘1 Dismay: Input [5] Display: Invul [9] Display: Input [5] Display: Inpul [5] Dlsplay: Example frequency 2: 445.56875MH2 : standb mode Press 2 key Display: h Input [4] -- Inpul [4] Display: mom [5] Dlsplay: Inpul [5] Display: Invul [5] Display: Inpul [8] Display: (2) Channel mode (CH) Rotate the (TUNING) control knobs in channel mode to change the operan'ng channel in order to get to the selected operan'ng frequency, or use the keypad to select the operating channel. Changing the operating channel using the keypad: In standby mode press the key, at this the time hundredth place of the channel number will appear. Alter entering the desired hundredth digit, the tenth place digit will appear. after entering the 101h place digit, the single place digit will appear. then enter the desired single place digit of the channel. Example: Selecting Channel CH-901 In standby mode, alter pressing a , enter '9”, “0", “1" in sequence. Example: Selecting Channel CH-088 In standby mode, after pressing a , enter ‘0', “8“, “8" in sequence Example: Selecting Channel (SH-008 In standby mode, alter pressing , enter ‘0'. “0', ‘8' in sequence Selecting output power While In standby mode, press thea key on me front panel or meflkey on the encoded handheld microphone, to select the output power. Every time the output power is changed, the sequence will be H. AMEL The transceivers medium output power tith 2 levels. for setup See “Menu 3"(MPOWSET) Special Reminder A >> when selecting the output power only do so in relation to the master frequency, See the hotkey operation chart for how to change the master frequency. 20 21 Commonly used has operations TX (1) In order to transmit signal iirst grab hold of the handheld microphone. and place about 5 CM away from your mouth, press the [PTT] key, and then speak normally into the microphone. When transmitting, The LED backlight will change to your set color (For TX backlight color settings see instructions on P3940), the LED display screen will display a TX-LED indicator light. If you press the P1'l' key while transmitting outside of the coverage area you will hear an error sound. (2) Release the[F"lT]key, to and transmission. Special Reminder A >> lithe transmission time exceeds the "Menu 11 (Transmission time-out timer) set time, you will hear a warning indication tone, the transceiver will also stop transmitting and will Ilmit further transmission. Afler releasing the [PT‘H key, the tone will continue for 10 seconds after which the transmission limitation will be lllted. Note: It you press me [P'l'l] key anytime within the 10 seconds while the tone is sounding, you will hear a warning tone. Commonly used basic operations Squelch settings: Press theakey in standby mode, and the muting level will be displayed on the screen, Press the VIA to choose the desired level of muting. to confirm press them key. Single! dual display: Press urea key in standby mode to select single or dual display. Switching modes: In standby mode, press the Ekey to select VFO frequency mode or MR channel mode. (For detailed operation see hot keyfi) Shortcut operation chart (See P28-32 for explanation) amermanomoromnon -fl MWLLLLLLLCJLLLLL "LLL'LLLLL ELE"““°”°’°.°"““"“""°°"‘°' In standbymodemveee Enlioenterlhechannelor Seeo rations F29 Frewencyordwmel "“me m . [E ubmmwms lnstandbymode ”93% ioervteriheCTCSSorDCS CTCSsovDCSssmusl Sgopemlioosm‘QTCSSlDCSermdlng cross ucs a deoodmmmmmm °' "W InRchde pressL'm" roenterCTOSSorDCSscanner m—LLLLLLLLL-mmm mom-WWW _ Presslhedem'red rtochangeleveloi m mm LLLLLLLLLLLWLL we Wlngmamdew lnmmbynmdemeB-Mtomlhedisplaymode. SeePai'Fiequencylmlietsvm‘ new gimme, standby mode. press pm Frequency mm irection m. . . . . . Ea] quemv shill am See P32 Frequencysllfldneotnn Swlld’l W Ineiwmeistxmymode press 7mfloneverseiiequemy or to turn oil reverse ilequency. mesa-m W}......W.._ m—-LLLLLL»~LLLLLLLLLLL_ mm LLLg/LLLLLLLL mmmwmm Insiand magma-u miookmekeymammommon‘rmmeivu IIHandmlerophone Wm 0 mm m W Note: Frequency mode and channel mode are of identical operation (Besides independent indication mode). Jam" MandFMTmmoalver 22 23 Function Function Code Name 1 swpnsquencysewiigs m ->m.> _ s¥sp - +m 2 vwne/na-m bandwidth ® *E» m 1.124 "' +m selling STwomodiumlevelpowerM-pfi-p settings 4 Oflesel itequency settingsm ->& -> Enter function set Screen disptay 5 Trausmlswn pmntm eeitinge e Beep prompt settings 7 Voice plump! settings a Busy citennel lock-out a Mute mums 10308lulmde 11 Transmksbn timbom tlmef m»m»m- mmmvvw 0:;vava Selectable Parameter Explanation page Baizvn—tI-PrrlwthmMe Wmtlm E01:vaF'rr|:-duud,mmmm mtm, mtme-mmeuwmmm, mnmmtlm cums: m www- Eueusn Ev-qtun pm OFF: W m M. Lmer-aii'il‘ffl" mama» — M»mm» 13 Caller ID tmnsmlselon settings 14 Ring lime m-m»mw 11135 Editing Calle1 m,m-., 16 DTMF sldetone settings M»m->$-> — 17 Caller ID Imnunlssion m, m»m» m» .1251..ng 11-54mm» 19 Standby baekugiii 20 Receiving backlighl 21 Deleting a channel 2 Editing a Ema->3» m»flnfl»— M»fi-m-> cnsnnet name @»M-> man HDW cum-um WWW 41mm”, WED-«mm mun "mun-beam m“ m gum-gm“ win-film W-Fnkaywddmnmthmm mic-«ulna mmwutommum mint-1mg WWI'c-ttquId-tm-mdhyw‘d mmttneeemmwm osrzmat . i. m t... , inflammmw. .mimwmmntm ->m->WP39 nut-mt tit-1 111 mm: mm mum aw: we omit: Guam em mm om mete mns- wnu mm awe a». baa-11w €61an men Wm wflw anE: with mm BLUE an. my: 511an Elm mm Mmssncnmnm,m1-t2m “Y :gmmmu vM’flm mtnmmmwmamnm munhmwuwmu P40 WtMnuMuv/flnh 24 25 23 Friolily mannel swim 24 Speaks! selling: 25 Kaypad @»fl-* auto lock 26 Receiving OTCSS 27 Reoelvlng DOS 28Tremmlflillg CTCSS my swam» :w—m‘“ *W “"3?” 5mm: fi:;:”‘°’m»M»-*W '"° W 33 Sean and @ -> "'> mm m»-»m» swim” m .flfl» ”5.91420; M»E*E* ",2;th M»fl>fl* .5“sz Wflfi" “dim _, M .u P41 mm-Mdlmmm mmmsuuummm -> P42 mm... mm.mmosmn~n mmioswmm -> P4243 mm... ”pm->13 P“ wwummm mmmmmwww mm...” MM 45-46 ommumhmnmmm P hum-numb emu-«mam -- 4| 35 SIngle-lone 38 Voltage mes-ins M»E—>fi* 39anoe scrambler MM" fem" 1:2351 Dcs m *m,@. ”534:1 x'zqrxe roducdon m‘fl’m‘ 5N; val-p 42 Scan group senings m->fl" "‘1 " Mun-m Trim men-N «hum [Illa “WM Hm- Mun-m P47 usunme-nlxclcss/ncs P49 mmnxmrm ->m->fl magnum/Des mmwmm mmmmm -> P49 omn-ndnmmmm m5“ m»®*fl* FM? 26 27 F unc Ion descrrptr I. The vehicle transceiver has multiple functions: (1) Work mode of transceiver (2) Cross-band repeater work mode (3) Repeater receiver and repeater transmitter operating mode. Note: Can be set through Menu 32 (See P44 insmrmions). (1) The vehicle transceiver control panel LED ls divided Into two display settings, A and B, displain the Mo vehicle transceiver operating frequencies. The master frequency will be indicated by ‘V'. This icon is very important. All operating instructions are all concerning the ma- ster frequency indicated by this icon If the frequency does not have the“V" icon. it will be called a secondary frequency. The master and secondary frequency will be separated by a vertical bar on the display device. (2) While the vehicle transceiver is in operating mode, only one channel can be set to the FM receiver (65-108MHz) fundion. (3) The vehicle transceivers two operating channels parameters can be set. Before changing the parameter settings, first set the desired channel to the master frequency. (Master frequency settings see P29 "Master frequency settings') (4) When me vehicle transceiver ls operaflng In cross-band repeater mode, or repeater recepflonl repeamr nansmlsslon mode, some Transceiver functions will be prohibited. Hotkey function guide ll. Hotkey function guide. The setfings menu is divided into quick start and operan'ng menu settings, and aside from their shared operating settings. all of the functional operations of work areas A and B are oriented at the master frequency. Special Reminder A » The vehicle transceiver operating frequency parameters can be separatty set (Example:STEP step frequenw, WIN Wide/narrow bandwidth frequency, VFO/MR display mode, OFF-SET frequency, BCL busy channel lockout, SP—MUTE mode operations). As well as system parameters (Example: RX-LED receiver backlight color function etc.) are AB’s two operational channels. When setting the main frequency it will change the system parameters. l Rapid search function When using the device or setting any functional parameters you can search the data abwe or below it by pressing then or“ keys. (I) Quick operation (0) E Voice scrambler function key(0ptional) When the transceiver is standby, press ”reg key to enter voice scrambling settings, then press the“ In key or a number from 1-8 to choose a voice scrambling group, and press theflkey to confirm, exit settings and return to standby. Voice scrambling has a total of 1 - 8 groups, OFF Shuts down the voice scrambling function, If the vehicle transceiver does not come with this option, pressing this key will be of no effect! )) The voice scrambler function is ineffective in Crow-band repeat or repeater reception mode 1 transmission mode. 28 Hotkey function g e (1) Emma frequency settings hotiuy When the transceiver is standby, press the mkey on the landset or transoeiverto swmh beMeen msterflequerlcy and secondary frequency. Special Reminder A >> When the A or B Areas or the display screen display an “v" Icon, this Indclates that that area Is the master frequency, and the other areas are secondary frequency, this icon is very important, all of the functional operations are oriented at the master frequency. (2) Frequency or channel selectim hotiwy I When the transceiver Is standby (In frequenc/ mode), press lhefikey to enter frequenc/ setihgs, and a whlflletnees will appear, please input another 6 values from the keyboard, which the frequency will automatically confirm. The standards for automatic recognition are: (1 ) When the 6111 digit Is 0 or 5. theflnal irequenq/s, 7th and 31h digits are 0. (2) When the 6th digit is not 0 or 5, then itwill automatically adjust the frequency logelherwi'ltl the 5ltl digit according to 6.25k step frequency, the final frequency/s 7th and 8th digits are 25, 50 and 75. lfarry keys other ltlarl 0-9 are pmsed when hunting tile 6-diQ‘t number, the frequency settings will be exited. I Mienlhelransceiverisstambflcharlnel node),pressfleflkeymflenarscetverorlurxisetbmeeletfivedmnetmilg savingsarmor.poiMBLcosueenMdmaycmoocmmmmmmtmmmmmum Erlbrtheleqied selectivecl'lamelbrmkeaseledlvedbtfbdmnel;Whhmdmrdlasmbeensduoymvlbemmedbmnmfiysetdmfl. (3) - crcssrncs sunning key Thiskeyhastwofundions, whenlhelrarsceiveris in slandbyrnodeitisan CTCSS/DCSencoderand decoderfirmlion. and whenlhe transceiver is in RX mode it is en CTCSS I DOS scanner. (The CTCSS I DCS scanning function is only effective in Transceiver operation 29 nude, in Orcssband repeatorrspeaterreoeption mode/transmission modeitisineflsdive). ACTCSSIDCSencodInganddeooclngsetthgs 111eCTCSS/DCSencodhganddecodngsetthgsslmultaneouslysetthemennelRXCTCSS/DCS(deoodlng)andTXCTCSS/DCS (encoding)settings. Tcsettl‘eencodingand deccdhgfunaionsseperatiyseeMENU 26290993"th insirucli Instandbyrncde,precs-keybselechTCSSorDCSJheLCDwilldspbyc Press“ keytnenterCTCSSsettings/prsmthe-kaylcenlarDT(DCS)settlr9s.Aflerantelingthessttilgs,plessthe u lakeystod'loosetmneededvaluemreesthewka'ymcmflrn. BCTCSSIDCSscmnerfunofion WhentflevehicletralsoeiverisinRXmode,preesme-keyloenterselecttheCTCSSorDCSmarlingfunaicn,lheLCDwil PreesmemkeybdnceefleCTCSSscama/presteflkeybdwooeethemmmnmcell’reswnerissetccnectlthe CTCSSwillremaindsplayedontheLCDsuem,uecsheMkeybsavemdmmlmflecureswidrgCTCSSpemmaersSavem paaretersmdirrgtoMeruMinstruaior—e. mm Smolannelnoruy Whenlhetrensceiverisincl’iarlnelmcdeMRLsavedlpamsdfledenmlbesidesmdfledwanmlmmamdlanmlswnadded. Whenlhetransceivertish Frequenwrnodeerowuremsetdfiamtofi-setnsqrendarbror-semeqwsermgsseemmmm 4), frequenwsll‘ftd'rectionflorfrequerwsfifldireclicn seltinwseehctiaeyoperaticnsnasvvelassavingotherdlannel parameBrs‘I'lI‘sway mmmwmumm—mmmmemmmmwanxmm. Instandbymode,preesmeflkeytoemerseveddwamelatmismtheLCDwilldisplay EnHmHurdledflsplacebrmsmbceaMSirgbflaceUfmdesieddnmdhwqmme Eg.: Stole RX450r025MHL RX CTCSS 67.0Hz, TX460.025MHz to Oinnnel 10. lhedlannelPressthembccnflm. 30 Hotkey function guide 1.|nirequem/mode, enteI‘ASOUWSMthnseimeRXCTCSSbWOsziam 2.1Te1Xfrquemyis1DDOOMHziigierhanRXfiequency. samomsamerwmomowzviamamdsauem frequerwytieaionb+viamhey. 3.Pr$s$key.andseieddanneinm10,fluenpresswbsbremmflmremmhstambymode )) mmmmethWmammm/mm mode. 31 (5) .WWWMWW Mmmkeyflsarotmnpuwerwimhhofley mmmismm,m-Mmmmmmmmmm ksy'sprssssthepoMerwiIlsiifliniheblmlirg diredion: High power (H)—>Medium power (M)—> Low power (L) Medimwmmmsmmmwmmseem3MMmmmm'mum (8) FWIMMMW MvehideuawoeivaopaafigdmmlcmbesaasVFOmenvdeamNRdmml node. wmmnmmm hreedfleremmtypa Ammm EWWWWM 0.0mmrmfiphymThsVFOFmJeru2/modsau MRd1anne|mmmaesdupmpamllmmneedammhmbbewbwbemesnlhelwo. WhMRMmmmmambmmh3mmm. VFOm/RiFrecperw/Gurasuimwmflirgissimbebm VFO —> MR(Cmnnei mrrberdhpiay)—> MR(ChameifrequarwoClmnei mrrberdhpiay)—> MR (O)hannei number name mmmpsmpmammmmmmemomm Nmbfimmaedkjtpmsoode,ifmepasscode‘swmmmmllsmmsuccessfuly, nmmhmmmm wlbeharem/e,adoubiebnewillMammmlefltmuogamlmaiywaymsammmhmmmmwppim mnsasaemedfismnmonmmm. mammuindimmmwy .InFMmode, mhflbybrapflymdireaimmpflyassimnbebms‘ Posiive ' Newtve ' Reverse ReversefrequemyR usro/ ' Camel uenw lrequsrw+ fisquenw- fisquenu/R ’ positivefieqia'cydimhm ’M WM _ mm mm Whenrapidiysimingirequmdes,mmdmmlmfiwmflmmwmmbhmwm .lnoi'ameirnode. mmmmwlmysammqu'mmmMrmreqmo/R'mm. Thlsmmbnmnbepvmbitedmlemevefldemwerlslnaossbmdrepeateronapeateneoeweronepeahmammrmoda (a) E Slngloorduddspiaymhdkay Wheninaandby,mfieflkeyjndywemsmdibetweenshgeamdmldispiay. ThismmmnbeumbitsdmiemevefldeumsoeiverisinamsbamMummummflfirmi (9) flmwwmw mmmmwmmmmm. Whenhmmy,miteflieymdiheminingleveihmeareamllbedisplayedmmesaemmienprmu/aordedymos bdmsefledaiedbvddnmgmwmmm,msaved,nmrenmbaamm. (10) 5mm Inmwmpmmmmmwmamummamxsaimmmenmevasutsmmlrgby‘step Mien/"hm. mmmaanmimhmmdm,mmfleysmbmmmmmm mmwumymmyieybsmpmhgneaseseem1oscREVSaensaurgsbrdeusormmtypes1 32 33 Menu operations Thisfllraimcsn bepluiifiledvmilelneveride mmhinaoss—bandlepealercnepeabneoeWeVurepealerumimer mode. (11) gwmm. mummissmm,mmgmmmmmmmmusmmmmwmbm, bah mekaypadmmmmmwmmmmmmwmflmmummbmmymm (muUPIGY olnlrequsnwrmde, pessflenksybsaanwfieqmvflWW-‘stspheqw’. OInMMVessfleukeyhdesigmmedmmlasflewufingdmnet (13) WW OlanMmmmbwammmmmfimmw’. olndmaelmodemresslmakeybmomdanmlsmemrgmnd. (14)meeniirmdionley unmeammleygswelssa mnmmmmmpmw Menu Operations sup Iroqulncy settings (STEP)- -Menu 1 Whenlhelransceiverisstamby, pvesslhewvtmkeysmdlhesaeenmdsphy 575? "' Hesmmksybamfllenmu,awaMprew‘Qmsu/aksybssledflquliedsbpfieqmmytype. premlhem ksytu commawdmfiksymrammbm msuansueiverhamowpesdsepmzmmszsmm125KI-Iz.20KI-Iz.25KHz30KI-Iz50KI-Iz,1ou > Mmmmmbamm,mmmmmmmmmmmm mempouerselmmfimmnewslybeset OfI-cel frequency telling: (OFF-SEI') - Menu 4 wmmemw,mmm+mkeysmuemmm Prwslnewkeybamsmenlem,arldmesaeenmdspby- mmmdgtmmwm,mmnerem - ' “mm/ambma‘mh meessmmleybmfim,mdmhaleybmnbslmdby. fienansosivefsfiewerwrmgeisfiomOéSQSSSMAHLmdlheNLBlhdgfldiwdhafisquilbeamrmfiwlywnfimedbyslw WW- NOTE A )> memmmmmmmmshmwuwmumm -- Transmssion prompt selling: (ROGER) - Menu 5 Wienmelmnsceiverismbymvessltefivtfl ka/sammesaeenwldsplay. Pressmmlaybamflemjmmmmu/flmbdmflemmedmmmmwleybomfim aldpeaslieakeybreumbmm. MWMAMGWBOdeW), EOT(endofW),BO1H(beg‘mingaMendcfimsmisshL 34 Menu operations andOFFWdeedh/abd). ROGERDJelm-‘eprurnumm,mnbesemrwghlheswpiedplogra'nnigsoihmenoanbesetmrwghmtmswdg'tmrbeneswel asmflwirgnodeorhimavaisfieeprogrannhgsomueb‘heb) Beep prompt settings (BEEP) - Menu 6 v mmmemwmmw+flkeyswmmwmm mam .. Pressihemmyioaooessihenmu, wmmmB/flkeysbmmwimmmmmmmma ksymrehmbshmbyrmde. Thailamoe'werl’asZBeepleunndesmNorOFF Voice prompt settings (VOICE) - Menu 1 Wmflweuarxsoeivaisslemby,preesmm+mieysaflflesaeenvfifl®piaw ,gm'ms "' mummybawsssoemu,mmmmfl/flmbmmmwmm,mmmMmmfim orlheakeybrenmbsa'myi nasuanseewrassvobeprmusemmeINESE.ENGL|sH,am0FE Special Reminder A >> IfyixtneedbumalmnpsdfiwimmoflbdhhesafiudvofioepvmuWenunmdhebeeppmuWenus). Busy channel lock-out (BCL) - Menu 8 Wmenheumva‘issuidby.mmem+flieysmdmesaeenvnflcispiay Pleasmmeieybaweesihenmuardanerprsshgmu/nkeysbdnose quLiedpvonumodemmssii‘ewieyboonfinn. onteflheymeummsum. mmmzmmwmmmwommm) NOTE A » The BCL function is inefiective in Cross-band repeat or repeater reception mode I Iransmission mode. Mule settings (SP-MUTE) - Menu 9 mmmsmmmwamwmmwdw Presfihiwymmhmaflaflerplm‘gheu/aieysbdmeeflmemimdmmefimbm umflieymmmmbmw. wmammmmmmmmmwmassessimgsaeueedmnruselewiewlirggm wilingandalloig ‘I'i‘eTI-aneoeivei’smmemode‘ndm QTMi‘enhmmeivabsahfisnodemlsigubmflemflcssfieqmmmhspeaw, QT+DTMF:wmwmmmmmmmdmmmmmmmmmmsgmm mmmmmmmhmm QT‘DTMF:WWMSWWWWWWMQTWUWWiMMMWW. Scan mode settings (SC-REV) - Menu 10 mmmsmwmmmfi+gmmmmmum Presihefikeymmiienmumdaflermhu/aleysbsebuflerequiredseifng,presslhemmyboonfimmdihe ammmmbmw ‘I'i‘en-aneoeiveri‘asaswnan0,00,mdSE: m:mwimammm.mmmmrmmmmmmsm 00:smrigwlsbpubenammermvesigalI'asbeenmrdammrigmmrfiueimemwavesigdlsmfuam SEzseemirgMIsbpmenacenierwavesigflismid. )> The Scan mode sailings function is ineffeclive in Cross-band repeal or repealer reception mode I transmission mode. 36 37 Menu operations * Transmission (Imp-out timer (TOT) - Menu 11 wranmumsoswmsstam, pestleM+m+mkaysamrmaeanudm Prwsmmwbaceesshmaudammlaksysnsebdmmisdmmhmlfi'bmmamm Elem reun b standJy. meTOTumbesafixwhwmm1bveldfl‘esafigmh1nm. Transmission ovartlrne alarm (TOA) - Menu 12 mummismm,mmm+m+amysau«ammuw mmfimmmmemaummmB/flmbsemmmmmmmflmmmmamm abybraunbsfinday. TmTOAhasamdmmlaghdwmeambvdmresmgbhemeFEDmTOA Special Reminder A >) Wmmmmhmmwam,anenurbmvflpmmptandsloplmwn'flfing, mmimuammarummmmmmmmmmmfimmmmamm Mwnlshma'l) Caller ID transmission fittings (AMI-SW) - Mom: 13 mmmsmfibymmsmfl+meysmmemmm ,pm-sw "“ Pmshfikeybmhmammmfleu/aleysbssbdhmmmpresslhammybmfrmandlhe a keymeummsmty. CderlDumsniss‘on: ON advale, OFF deedivae. Ring time (RING) — Monu 14 Im mumbmmm®+m+mleyswmmnwldw ”5'56 mwmmmfl‘emafimmmflmbwmmm,praslt‘emleyboormnflldlhe ammmuymw flan-arsoeivet’imwlevebofringlheeammxmgb1 mwflflgm Editing caller ID (AMI-EDIT) - Menu 15 “WSWIDSwmposeddmmmmadSO-Qimsflwdgflcmmbe0.3MIDnun‘belszbeassl'maSSMSaMas Iongase. v " Wienflekmsoeiverisslammmem+mfileysmdhsueenwldisflaw ,gw-Ev" mmmemmmm,wmhmmwmummmmn serum Exarple1:edti‘ga&dgflcalerl0mnber(m1235) Wienflenameivahstampasm+m+ keysadhmwld‘apey. :"F-EW“ commaldlhealeytmelumb WMWMWJBWQNMMMWMMWWE ass a 9 whammmmmmmambmmmm. mamamkwmmmmn v u mmmemMmm+m+amwMWde ,rM-ED" Albrpreshgmme wiemlerlenberrmfiaedybeenmlubedspbyedardlfefmdlgmlfashjmderDmmrm beenim101mbe®pbye¢aflflsfirstdgflflflahmfl E mandammsttidduhasbemhmmymwmm hummlmmmmbmmmaommm. Special Reminder A » Eailhamoeilerml‘aveuiyaeederanunbe',Mid1isshaedbyNemAamBi 38 39 Menu operations DTMF sldotono settings (DTMFST) - Monu 16 mmuamisaamwemieM+fi+fikaysmmemmm mmmanuem,wmwessmunB/flmsbsewmmmmpiessihthsyioooninn.armhe amybwnmstancby. hemmeivemssmemmgDTNFrmdeen.mstKeypadsiaeiuewibeawvmedMenuamnfirgzzmmwinmmu beatfivatedu/rmmm:3.DT+ANI1«eypadmdt2llerleiieueaebdhafivatedemmhg. Call-r ID tnnsmlsslon modo(P1'l’-ID)- Mcnu 17 Wmmeuamisaamymmsmm+a+flkeysamhsuaenmdspbx Pnsmmanuem,mmmmnu/flmysbsewmmwsem,pressmemieyiooonnmandme aksytawnmstancbj. mmmammomwmegimdmimwudmmy BOTH(beg"Iiigander-dof W. :x - Transmission hackiigm (TX-LED)- Menu 15 mmumhm,muEM+®mie/sammmmm mmwmbmmm,mmmmlflmbmmmm¢wmmmmmbm mmflmummbmw mmmawmawemnsmmnaommi Standby backllght (WT-LED) - Menu 19 mmmswbmiessMMflflkmmmesuw-wlm fi-LED HessfleMksybawesshemmfirdaibrMheulaleysbsdedheleqLied MWWWSSMMWUJW, wmamymmmbmw mmmamnmmuafimmmneomm Recelvlng hackllghl (RX-LED) - Mcnu 20 mmmbmmmw+a+flmmwiammdm PmsshwleybmhmaflamerWBn/nksfibsebuhmqfledbaddgflmpressihem ksyiooonfirm. mdlhealeybreunbstandzy. MWMSWWBLLEGRENNWHEOFRW. Delotlng a channll (DEL-CH) - Menu 21 v mmmhmmmmfi+mmsmnammum FM" Praesihefiieymamessmm,mmmmfl/flnmmmmmmmm«mwimrgmm codapvesslhsm mbmmmambmmmmw. Special Reminder A » Tm1stmdmdmeprmdmnelsaefoedmidwcmrubedeieted. N E A )) fiieDeH‘tgadHnefisze mmammepfimmode/umsrnmm Editing a channel name (CH-NAME) - Menu 22 Craineina'naicanmwwmhmwMWmWMWthMwnwedm-MWis'naiedivehfreq- uem/mode. WNW-Wmmfi+&.kaysadhemmldmay mmwmmmmm,mmmagnmresh(mimmmisdgt bengedhd) MhflwymmdmwwbmmwmwmmbMer-cmelabrsarumnbevsm'ms mumbdmseliiaddfiram:mammmmdmflumabdeammywaemmm. mnymraveflsmdedmgmmyasflbmflmmdpassfibmmmm. 40 )) totmmlnavmeanbeamwfimnofadamsmwmflmdmmaymbeo. ZWhandamatemny,hdnamelMbedsplayedmmeaaenesm”(”bei1ghamdmrflnmber). Prlorlly channel swluzh (PRIOR-8W) - Manu 23 v Mmhenameiverisstarfly, mmm+a+mkeysmdhesawnwldisphw ”fawn—54'! mummmmmmmmmume/flmbMammm mhmcoootvflnnflnd mmakeyto ream b stand-y mmdmsmcanbesdbONcrOFF. Special Reminder A )) While‘nflewerwnndeordamelnnde.ywaiynwdhummheubviydunetaflheubrflydandwlwminaseomd imfiepfioviydmvdisaiylsedb'reoeivingflfymnwdbmfl,pleusaflepvbfiydamelashpvmfldamel. )) Theptixhydmamdmnbesstvhmepmgmnhgsdtwaeappbdbywrmny. )) mmmwmmnmmammnme/WM. 41 Speaker semngs(SPK-CON1') - Menu 24 v Wrenflekzsoeiverisstampwsshm+-+®eysmdlmweenfldisphy "wk-con: mmmmbmmm,mmmmfl/flkeysnabahdaiedsefimmhemmmmmamm maleymmnmmmy. MWSWMWMZRUMWWEWWWABW1bumm‘Ywmafi/fim WWSMWWWXmmabobdhmmmd mmmmorme. SPK1zodthstra'Isosivaruitspeala'isacfivae. SPKZ odyIm mm! mm isadivana SPK1+SPK2zmellarmeivevmriedspederaIdmehmd niacptuieaebdhaaivab. Keypad autoLock (AUTOLOCK) - Menu 25 Wmflemmbmmmmfi+-+fikeysmlhemmldbpby PrssfinmmmmflBmemavdaflsrplesshgheulakeysbsebuoNaoFF. mlhafikeybmfimand pleas mambmtasvarmy. Recelvlng CTCSS settlngs (RX-OTC) —Menu 26 mmmsm pressmm+a+fileysaumemmudspw nag-c112“ mummymmmm,mmmmulflwnwmmmm, mmmanw usefl‘ea leybrdunbsimdby. 'l'heC‘l'CSShesabtddSngpe ,OFF: Daub/ab Receiving Dcs setting: (RX-DOS) - Menu 27 v m mmmvaissmty, mw+a+mbysmdmweenwldw :HDS mmmmmmmm,wmmmnlflwbwmmmm washefikeybomfim, am mmaleyhmrnbmby. DCS:1059mpsdposifiveoode,1059wpsofnegai/eoode; OFF:Deatfivate‘ Transmmlng OTCSS settlngs (TX-6T6) - Menu 28 Whenmmusosiver'ssfindw, mm®+a+fimmmmmflm mummmmmm,wmmmnlflwemmmmm, ussslhewkaybwnfimw mmaleymmnbmw. c‘rcss hasam #5 groups OFF: Deamvale. Transmmlng DOS settings (TX-D68) - menu 29 Wmmkmmmm+E+-WMMWMIIW wnines” Menu operations MMMmmmm,mmmmu/UMbwmmmmmmMseybmmw mmaksytommbsmrmy. DCS:10§gwpsdposflivsmde,105gmpsnegfiwmde;OFFzDeaamls. _ [moods W 15 mm m, 1mm mm mew mm mm « 01 13 v1 ‘ «m n ‘m 11 ‘ ms 31 ‘ m “ ‘ms «1 rmm a2 own a mm a Hum 11 w" sq mm . a mu :1: mm 45me I: am "firm on mm «a Dual :4 mom 49 mm, a nnmfin mewfiu nus» 20 mm as mm mm." a} num n um 96 mu 2‘ muss ms. mm ummsyosoww Doom 1: mam :1 mm I'm 57 mm .2 um 97 mm zammumumnuumsmunm 24 on.» :9 m4 s4:|ma4 a mm 54 ow to m» 2! man «a mu .1 mm n m": numfi‘m m 2. Dusu «’w saw." u m 53:09»: “711mm 21 mama mu 53m 72 mu‘nmmm nmssuumsmsemmnmmasmmom» 2| DIEM M new 5: M 7‘ WM n D612“ m‘muu 10 mm 67W WVDGSIN YSVDGSN 90.0120! “)6 D750! Repeater speaker swllch (RPTSPK) - Menu 30 Whnameiverisstaruw, mmm +E+Ekeysmdhesa$nwldisphw "WY-mm mmmmmmmmmmmmrgmu/WhammfimmmumMMmmmm mmflmmmnm [mu repeaimwwsebumummmnmmwwamewwam) Repeater PTI' switch (RPT-Prn- Menu 31 mmWhWMMM+$+mmwremwldw 4??me mmmmbmmmmmanerpvmngmB/akeybammmmwsm,mireMboonfimmd mmfimmmnosmm Dumg M,mmmmmmmummmmo~(m)mm) Repeat" sottlngs (RPT-SET) - Menu 32 TraaalBSrmdeslnmerspeaa’ssfimm:RADDnammx-DIRPramsbauclmnlmpeamx-TWRPTMM mmngmemmmmcm—Txmmm IMIanlhelrmsosivsr'smrmsoeivemmds.ywmdflardiedymflaaossbammmmpemnmeormmbmmm fromunssbafirspeatorrepeanndebysaflgmnmu. ummmwwdmummmm mmwfiumdhfimmwmdmwfismammFormfleRXfreqleno/braea/Usat UI-FfrequerwvmilelheBisatVHFfrewerw.Ardvbevers& lummmmmwbammmmawmmwbabmmm mmswmmmm,mmswmmmm. ITmmmmmmbmmmmmmmmmnmmm wflmmmmmmmmmmmmwmammmmmwm verse. newnausshaumpeamaummmraammxmhmsmmmmmambm lepeetRX/TxmaflCTCSS/Dcsmaflmwms: 1NFOmisRX/TkawmdlreceiveheRXfisqu/asfleaossberdrepefi ZNRnndeBRX/TXWMMMRXWdWMasMWflW 3,0ossbaMrepealRXCTCSS/Dcsweomim'sbasedoumereoeiverCTCSS/DCS(deoo(ig)asaossbaMrepeat ICmbafimpeatsrampeahrsdfigscmbesstflmrghMamSNRPT—Sfioaumm(RP'I'P'IT).Ss|sdngrepeahr/Ishylepeabr mmmmmmmmammmmswmmmmwammm.Bowman “WSW,WMUMWWMWWW. mmmhmmmm+ m' +fleysmdlhesamnwillm mummymemsrssmmmun/ambmmmmtype,mmmfllwymMm Menu opera I 5 Special Reminder A )) lnaossbandvepemrnnde,“mmdmmMIIW3.WmWWhinanmmm samwilltfiplayq—J’, Conmdlngllnnhyreoalverandhammllhn ThoughMENU32Msmwfimmmmmflywhmmmmbymwnmmlomamm, mmmmammmwmmmmmw. mmmwlelsanopflafiwy. Special Reminder A ))flewrmwaybsemmmhfiulperdambeeemfimm.8eew1ohm Scan add (SCAN-ADD) - Menu 33 SmaddmmagwmmsaddedmmAsammsfimmulybsusedhmnme,mnulybelsedwflh “www.mblmlnfimwm MmlenameiverishdmwnndepmsMM+I MWWDWMM,MWMM mawbmmstarum SededlBsZpamzoN(add).0FF(wnel) NOTE A )) mmwmsmnmmammpfimmdelmm Automatic power-on (APO-TIME) - Menu 34 WWWEWMWM+-+mmmmmwldw :Fc'v—ms” mummmmmwmm,mmmmB/wammmmmmmm curl-mmdmeakeybmmmamdyy. Nflemmeivaummopaafimsaddoesnmmoefleumravflwsigehwmhasapabddmflemmdffim “Wmmnameiverdl Mmsmdammmmnm:Mmlmmmm,mmm 120mm“ 150mm. OFF: Tumlrgofilhe mmmm. NOTE A ))Wmmdmbimh0mmepeauwmnmelmnme Single-tone pulse lrequency (ALERT) - Menu 85 mdhmmwfimwbmrssdaWuises‘g‘dmaivatejarepedsr'smmhowever, mmummmmmmmmmmnmfltmm1m1m mmmsmmmm .4-Beysmdlhesueenwldisplay. fig." '“ kaysbsebdhmiedpamuesmwksybmm 47 Menu operations whammWMM,wmmmB/flmnwmmmpvassflaemleybocmm,“ mambmmw. NOTE A )) mnmfimnnamwmmmwsmmmwmm'm'mmm. Compand (Compand)- Menu 38 mmmmmimmm, adhrwkaveeepedalyevidemmmmrifilgmwm Vlll‘mlhelmnsos‘werisstardy mmm+- Elwysardlhesaeenwldisphy mama“ nessmemleymamessmemammmmu/flmnsemmmpam pressmemleybmmm and Ileflkaybleunnoslawby. Mareiwolti'xbdoormam:0N(afi¢ab),0FF(deafivats) NOTE A )) MWWSWhWWUWWM/Wm mode. Overheating detection (AUTO-FAN) - Menu 37 WWIWWWBWWEWWMMMSMMMWMWM awe-setarrmrldapemmmWmmhfimd.m:mmflammmmmammmmmm asdanmmadmlmpmkfmmoledmofimcfiflsm Special Reminder A )) Wlmlheuansoeiver inmmanmmbimllammmdmmvamflwlddndseilh‘sfilrmnON. mmmbmmmfi+fl®eysmnuamwldw mhwmbmhmmfimmmmB/DWSbWMWWprestheybomflm andlhealeybmmbsuarmy. Voltage testing (LOW-V) - Menu 38 VVhenlheu-alsoeiverishsbledhacaruamlherumbiepouersouoe(Wasacsrbamry,eh), pleaseaaivatellisfunaionhorderb Whhmfimmmimmwmmfimm, renderinglheeqmtuablebwpfiyelemkiyb'reglhrwk mmmmmwimwwmm wmmmmemmmwflmmsammemmuw mmmmmmmmm,mmM/flmbmmwmmWham/bum, a‘dfl'eflleybreunbsfardmON(adivaue)u0FF(deaaime) Special Reminder A »wrmmevorageistoom,avoioeprwnptwlsandevay1om,ardifVomeTeamisawvemeWwiuwmnfieany mmmmmbmnmmsmnmmm,mmmwm Voice scrambler (SORAM) - Menu 39 ‘l'lizfindimbafimdwetflweemmmmemnmmmmsspmmmmwmdm mammmmmmmm Pressrem+fir-maadmesasmmm Sm" mummmmmmm, mamm/flmbwmmwmmmmMmmm and «gamma-new MaeSvoioesaavflinggmpsflépelecbbiearflOFFdeMvm. Special Reminder A » mwbesuanuensopmaat 4.3 Menu operations NOTE A » mvmmeeMMmSMhmmmummpfimnme/mm mode. CTCSS I Dcs scanner savlng typss (SC-0T) - Menu 40 mmsoeverisincrcssmcsfimmmmmmm‘gmmmmmmammnmm: 1.Savelhemlemna1soeivevsasdeoodermdetmder(All) 2.3memamnmwasasamderfirmder) 3.85veflswmhmvasasmm) Whmmwmissmmweeshm+a+meysauhesaeenvfldw ”SH" Wflmmmmmmwvflmandpmssmammm NOTE A )) WWmewhmhmmmaMWm/mm, Noise ruductlon unlngs (ANS) - Menu 41 mmemmfimmmmwmmmmmmwmmm. Mmambmmmmmmmmymmmmemommuom wmnmumsoswerissvarmy mmmwmksysmmesasenmwsphy ENS Hessuuamdmuesmbwflmandpressmfleymm Scan group settlngs (SC-GROUP) - Menu 42 Mmgmsfiwmhwflmammiwmdwflehmmmmmmmgwps.ltwillsmndd’ameb‘n Iflsguup. Sawgwpsmrgsmmdmasmammmalmmggmps. mmmsmmmww-msauMsammdw Prasuoramsdectptasmboorfimadpvsss lheflkeybreun. NOTE A )) mmgmmemnmmummpfimmde/mm mode, FM radio function (FM-Radio) - Menu 43 Ywmeummmbmmbymmmm Wtenfleuambmmmmm+m+fikeysmdlhemmldbpby PrwsheuorflleysmseleawfmsebaON,leeybemerFMrado,vmense|eot0FF,MbreunbsmM2ym NOTE A )> MWMWSWhWWUWWm/mm nude. Reset settings (Reset)- Menu 44 mmmwmedlmmmmmmmmwmmmm Tmmmmymudesmmmmw mums Whenlhelransoeiver'lstamby mmm+amkeysmdflesaemwldw MMMmWMWMJMMMQMBWWDwmmW plessMammesaeen mum m2”. AMHEWMNFOIALL),itwiI|rBsfiflmdlemmbsu1dbyflnda 50 51 Menu operations How to Operate file FM Radlo 1.T|.lnlngON wrmeeuzsoaverissrampessNM+a+amy,sebdw,wpwsManMRadn Wmmimnfiom Winmmbmmm-WbmwmaMWMWMW — Nomhpnmedw‘vedfrean/(AdmLmdWhhmfieqewbvdminfleswpedfleuamsmmhwibemwm. Wmimfiwwbbayuflhmaauammmflammmmflrsverlbmwsafleqm. Emple1:Se‘mgFMWaveba1d106.9M-Iz wrmuerarsoeiverissrammm-mbmnmmbm,(auispoh1mesasenwiud'splaymedefammwor mmeuwiousrytsedardmesuemvfldspby'FM'mmermem). mm-mmmmm,mmmmmsmmMm E flhudsnaldhesaeen Mdisphy1wwfhauMHD/setwisomm. EmnpleZSsfi'ngFMWavebmdQOAMl-Iz mmmhmmmwb- mmmmm,m-mmmmwammmmu mwmmmmflflmhmmedewmmamwmpmMm InFMradonndeprasa bmhradbsbfiuuflflsbpmirgmmdedambn.flxhgmirguessaw keyexoept Blabmpseam'ng. wmwmmhmm MWmlsuezommiom MmFMWoncm: waninmwaemmmflsmksyaummwfllm- Aflerpvesshgmulflley, Whmmmmwbhbm,mmbmm,amwmmllwmefieflymmb mFMwavebmdfrquem/mplayimfaos. Emmlewmenhmmmmmmfimwbmrfl'fimkhmmmmwwmm seremfldisphy "nmum Hess”!flor¢efiey,armrmoosueenwilldsptam- mmfimmmmwwwmmmmmlymmmbmmmmeqwdwim manammdlosuon: Whmwmmmmfllemmuwemmm 'cnm of mulnwbwmmmbmmemhoorllmJTIevmsceiverwilaLmrmfiwlymmltmado Mywsebdedafldwlaymmesaeen. Ammunmmmde _ wranhmm,mmamaumsasenmdm mm” PrestrsMIaeymeaatMFM-aabm 52 Repeater usage 1.“RPT-SPK”rapImrP1'l’nkdlon Wrmmnmisaam,mw+m+aksysaflmmnfldw rim“ HessmeMkeybaoeessmesemrusm.ardafermfl/flleysbsebdm,plasfllewleyboorfimaflhsfl keyb mmmsuwy. 2.“RPT-SH("WSPK$|ecfion mmmsmmwmmmede fir—swx" mmmmmmmmmm,ammmulnleysbsebammmybwfim,mmakeyb lammtostmmy. amo-waymumanyauw mmmissmmpessmmfl+amsaAMsaeende :av—ssr' Presshwleybmpvesu/abseba X-TWRPT, pleas @mwnfirm. Attflsmmeuammmmmwmwm. Inmmummmmw+ammede :nr—arr“. mmmmmmmu/ammm(m0)Mumewfim Nmmmmmmmmmmmmmbmmm wmmwmmm“mmwmsw,mmmnmmmmmmmm WWMWMWMWWWWMWMMMMWWMWWM swifimMowayaossbaMIepeau'nude. WMWWWRPTWWSFKSON.flmwnmmpealeoeivesmafiaaivemmvssigmms mmumnammmmmmmmagummmmmm 53 Hand mlcrophone encodlng functlon I WMMMW) TrisdeviosfeanlesDTMFsrmxg;mmmmmammmmmmmbmfidflmmmw rue/arming. mmpedoarespordstoDTMFermagmdeasflc-us mmmmmmw: WMmmmmumane'mmmmmmmwnmmwmmwnsqw WSW I WWFW Tommmoormmummmmmuaemmywmammmmmmmm “mommymnu’lybesalfighpmgamsmwae. ' 1.0penl’eKG-UmR-Apmgamhgme. ZWMWDWPC(W 54 Emmot- conlml fundun 7 mem mmmuummmunmmmmmmm “Molt“ AMI-tun @1753 chOMR MCCVEDH .554321- n}!C§ldfi‘ RCOPEN sccamr :afiodno 7 Km Ali—1 Mannamg “733 \ RCSWCUDE‘EU ‘ Stun {fli- ' \nspemun !D'3 7‘ l. u‘ :ANb-HJTUNI |D)Iflllnhh'n:lll0cu'k 1mnamoaammwu IDnst-mazrrmdu ID) (‘1le munmunmhmmwuhawmdmnharm-mum autumn-hung: AMI-Em 12345; RE POWER Mcc-Eulr 'dfifiudu— a "U h Io'r’ We OVEN EGCVEDIT £54321 m 13H Mamkmng ‘UA V‘ Rcsw-conE Elli Swn i'cia' 7" ‘rispeww |n3 omm-Emcm \mmmmmmnmmmmwmbmn W(mtmmmwmu ummm-mwmnamm nummdq man 1.mmnmmmm+flmmhwmmmulmm mm 14-05(an ham-MM \nmmuhmmm‘mwumuwmmfiMMI-Whfi-wk Dm)mwnWinm-mmmuumn'am nm].uhm Dmdlltnm'sh “.mlmmlnin thamlhhnl mhmflh-p—m. fill 1.mmnmwpum+fl mnmnmmwxmmm-mwnm+mmmm hll)+AN \Dmhflmbhmm'n.fl-mflhflmhfl‘ihfimuh-x'dhnhmJl-Mflk Dmmwnmmnmmmmm m‘ 3mm IBM flmmmbhm. "I‘m" MLLiniIL m:mmmm mammal-mm. alum 1.mmhmflumm+fl mmmmnmmwmmunmtnmpmw mummy“ need-(mmmmum‘mmummmmmmm. llammfimlmwnmonuknanmmmnum'um mama-diam Inmm hmihn,mlflhmflmm (minivans-mug Mam-annulus" mummh-p—rm. Hun-t- 1.!h'i'ui'ul'linafl'mn-F'IT'I‘] (mxmm13mwmlm-uuimunmmmma- ”WNW +M IDmflmlblfiWHM ‘maww MIN mmmwmuw.“ Run-nah control funeflon 7 magnum m)mwnmmnammmamummumwnfiumumm vanadium m5nm,mmhlflmm. m:mmmu\mmmfiumnmm‘ I .muflmhfl: WM.“ mammmmmmummmmmmmmmm Speclal Remlnder A nummwmmlnmw Immlmummihm6flhflflfl\ ANH-DH 123-153 MCC FDH nunnfln 505.com jrfsa'in mu 93 ,. _ MunIIDfilIg RC POWER RC Sven Sluu ice Inspembn 'DEIV \ IncoPEri RC swmue _EB _7 mumnm mm Hawaiians; (”MW bid-Uh, ‘ mmnuaamhumcfiwmymm nmmmwmmwmnlwmmurmm Pmu)+1mflauldhdm Dulflmlahmhba. mmmmmmmkmmmuhmmnm‘ ammo»: mwummamhwoFFL-qmumm “mammogram m+mmmmnmm FUMI‘) Hana-unlumm \Dmmhmmum. himmfibflln‘ufldi.fywmhn-Idhhnmhmthwmp-I—ml-dfliIn; Ml ‘ “nah-film mummmnmubmmmpfi. P-Bdeh-l-mhhnmn’m «Imamnmmnmm‘ mmmmmmmuumlflwmmuummmm. Opt nal accessories §‘@ Switching Power USB P ramming Ca Speaker/ Mic Supply (30A) le Clam 3 Install Connecflon Cable ounl Direcfional Antenna 59 /\ Mobile Antenna Omni-anlenna Strong Magnelic Mounl Troubleshootlng -‘”“""“” Twln Band FM Tm MMWWSWMMWWMDWMmimmmwmmmm mmmmmwm Reoevllon prompt remains hul speaker is silenl )) Check ml the volume knob has been set to maximum. » Please reset wb-audlo settings to check wnetneroMerent erronnels lrom otnergroup members nave been set. » oneat wnetner equelon eettlngs are correct. Keypad ls unresponslve » oneolt wnelner keypad has been looked. » Cheek whether other keys have been premd. omer voioee (not trom group members) appear in lhe channel. Reoelve regulervoioe pause (About 3 second Intervals) » Please flange lhe CTCSS/ DOS code. » Please see lltne ‘PRICH—SW' (Prtorlty acannlng swlloh) le lurned on. can not enter scanning mode )) Fleese see "me scan group mannel, Scan Add fundion is [Aimed on. Transoelver automated actlvauon/oeewvatlon swildl wnan pnming lhs lreneoeiver Prr key to ltensmiL mere Is no wtput power and no reoeption Cannot set up tne wmnd repeater » Please make sure all used power soumes ale under11.5V, or lllhe ”APO' swim is on. )) See H II has been mulled 0' killed. » Please make ture NB urea Is on tne woes-band repeaters operatlng frequency. Cannot trenemn ln repeat mode » Please check no eee l1 me receivers squelch and CTCSS l DOS selling: are oonecl. 60 61 Announcement @wouxun endeavors to achieve the accuracy and completeness of this manual, but it is still not perfect for any possible omissions or printing errors. All the above is subject to be updated without prior notice. EditionZKG-UV920R-A-1208-V1
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.6 Linearized : Yes Encryption : Standard V2.3 (128-bit) User Access : Print, Extract, Print high-res XMP Toolkit : 3.1-702 Create Date : 2012:08:10 17:11:38+08:00 Modify Date : 2012:09:10 11:15:58+08:00 Metadata Date : 2012:09:10 11:15:58+08:00 Format : application/pdf Document ID : uuid:fe613f45-5502-4f02-a723-a61452cbd59f Instance ID : uuid:f596a678-2f14-4472-92a1-dfc343e7860a Page Count : 37EXIF Metadata provided by EXIF.tools