Adobe After Effects CS3 User Guide Aftereffects En

User Manual: adobe After Effects - CS3 - User Guide Free User Guide for Adobe After Effects Software, Manual

Open the PDF directly: View PDF PDF.
Page Count: 677 [warning: Documents this large are best viewed by clicking the View PDF Link!]

ADOBE® AFTER EFFECTS® CS3
PROFESSIONAL
USER GUIDE
Copyright
© 2007 Adobe Systems Incorporated. All rights reserved.
Adobe® After Effects® CS3 User Guide for Windows® and Mac OS
If this guide is distributed with software that includes an end user agreement, this guide, as well as the software described in it, is furnished under license and may be used or
copied only in accordance with the terms of such license. Except as permitted by any such license, no part of this guide may be reproduced, stored in a retrieval system, or trans-
mitted, in any form or by any means, electronic, mechanical, recording, or otherwise, without the prior written permission of Adobe Systems Incorporated.Pleasenotethatthe
content in this guide is protected under copyright law even if it is not distributed with software that includes an end user license agreement.
Thecontentofthisguideisfurnishedforinformationaluseonly,issubjecttochangewithoutnotice,andshouldnotbeconstruedasacommitmentbyAdobe Systems Incorpo-
rated. Adobe Systems Incorporated assumes no responsibility or liability for any errors or inaccuracies that may appear in the informational content contained in this guide.
Please remember that existing artwork or images that you may want to include in your project may be protected under copyright law. The unauthorized incorporation of such
material into your new work could be a violation of the rights of the copyright owner. Please be sure to obtain any permission required from the copyright owner.
Any references to company names in sample templates are for demonstration purposes only and are not intended to refer to any actual organization.
Adobe, the Adobe logo, Adobe Audition, Adobe Premiere, After Effects, Creative Suite, Encore, Fireworks, Flash, Photoshop, and Soundbooth are either registered trademarks
or trademarks of Adobe Systems Incorporated in the United States and/or other countries.
Apple, Mac, and Mac OS are trademarks of Apple Inc., registered in the United States and other countries. Microsoft, OpenType, and Windows are either registered trademarks
or trademarks of Microsoft Corporation in the United States and/or other countries. Dolby is a trademark of Dolby Laboratories. Intel is a registered trademark of Intel Corpo-
ration in the U.S. and other countries. SGI is a trademark of Silicon Graphics, Inc. UNIX is a registered trademark of The Open Group in the United States and other countries.
All other trademarks are the property of their respective owners.
This product includes software developed by the Apache Software Foundation (http://www.apache.org/).
Portions of the TIFF I/O plug-in were written with MacApp®: ©1985-1988 Apple Inc. APPLE INC. MAKES NO WARRANTIES WHATSOEVER, EITHER EXPRESS OR
IMPLIED, REGARDING THIS PRODUCT, INCLUDING WARRANTIES WITH RESPECT TO ITS MERCHANTABILITY OR ITS FITNESS FOR ANY PARTICULAR
PURPOSE. The MacApp software is proprietary to Apple Inc. and is licensed to Adobe for distribution only for use in combination with Adobe After Effects.
MPEG Layer-3 audio compression technology licensed by Fraunhofer IIS and Thomson Multimedia (http://www.mp3licensing.com).
Speech compression and decompression technology licensed from Nellymoser, Inc. (www.nellymoser.com)
Flash CS3 video is powered by On2 TrueMotion video technology. © 1992-2005 On2 Technologies, Inc. All Rights Reserved. http://www.on2.com
This product includes software developed by the OpenSymphony Group (http://www.opensymphony.com/).
This product contains either BISAFE and/or TIPEM software by RSA Data Security, Inc.
Sorenson SparkTM video compression and decompression technology licensed from Sorenson Media, Inc.
Notice to U.S. Government end users: The Software and Documentation are “Commercial Items,” as that term is defined at 48 C.F.R. §2.101, consisting of “Commercial Computer
Software” and “Commercial Computer Software Documentation,” as such terms are used in 48 C.F.R. §12.212 or 48 C.F.R. §227.7202, as applicable. Consistent with 48 C.F.R.
§12.212 or 48 C.F.R. §§227.7202-1 through 227.7202-4, as applicable, the Commercial Computer Software and Commercial Computer Software Documentation are being
licensed to U.S. Government end users (a) only as Commercial Items and (b) with only those rights as are granted to all other end users pursuant to the terms and conditions
herein. Unpublished-rights reserved under the copyright laws of the United States. Adobe agrees to comply with all applicable equal opportunity laws including, if appropriate,
the provisions of Executive Order 11246, as amended, Section 402 of the Vietnam Era Veterans Readjustment Assistance Act of 1974 (38 USC 4212), and Section 503 of the
Rehabilitation Act of 1973, as amended, and the regulations at 41 CFR Parts 60-1 through 60-60, 60-250, and 60-741. The affirmative action clause and regulations contained in
the preceding sentence shall be incorporated by reference.
Adobe Systems Incorporated, 345 Park Avenue, San Jose, California 95110, USA.
iii
Contents
Chapter 1: Getting started
Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1
Adobe Help . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2
Resources . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5
What’s new . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
Chapter 2: User interface
Customizing the user interface . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13
Using the After Effects interface . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18
Chapter 3: Planning and managing projects
Project basics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23
Project planning and setup . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26
Memory, storage, and performance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37
Plug-ins and scripts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44
Chapter 4: Importing
Importing and interpreting footage items . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47
Working with footage items . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58
Importing from After Effects and Adobe Premiere Pro . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63
Importing video and audio . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67
Importing 3D image files . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77
Importing still images . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80
Introduction to Camera Raw . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86
Navigating, opening, and saving images with Camera Raw . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 92
Adjusting color in Camera Raw . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94
Modifying images with Camera Raw . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101
Camera Raw settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104
Chapter 5: Compositions
Composition basics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107
Nesting, precomposing, and pre-rendering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113
Markers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116
Chapter 6: Views and previews
Previewing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120
Modifying and using views . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 126
Chapter 7: Layers and properties
Creating layers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133
Selecting and arranging layers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 137
Managing layers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 147
Modify layer properties . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 152
iv
Blending modes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 163
Layer styles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 168
Working with 3D layers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 171
Cameras, lights, and points of interest . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 176
Chapter 8: Animation
Animation basics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 183
Setting, selecting, and deleting keyframes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187
Editing, moving, and copying keyframes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 190
Creating and modifying motion paths . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 197
Assorted animation tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 200
Interpolation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 204
Speed . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 210
Time-stretching and time-remapping . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 218
Animating with Puppet tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 226
Chapter 9: Color
Color basics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 234
Color management . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 241
Chapter 10: Masks, transparency, and keying
Transparency overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 252
Creating and importing masks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 254
Working with masks and mattes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 257
Animating masks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 264
Keying . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 268
Chapter 11: Text
Creating and editing text layers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 273
Formatting characters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 278
Formatting paragraphs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 283
Animating text . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 285
Examples of text animation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 295
Chapter 12: Drawing and painting
Using paint tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 302
Shape layers overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 312
Creating shapes and masks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 318
Managing and editing shapes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 325
Chapter 13: Motion tracking
Motion tracking overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 335
Tracking motion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 342
Chapter 14: Effects and animation presets
Effects and animation presets overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 347
Working with effects and animation presets . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 350
v
Chapter 15: Effect reference
Galleries of effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 355
3D Channel effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 367
Audio effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 371
Blur & Sharpen effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 375
Channel effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 381
Color Correction effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 387
Distort effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 404
Generate effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 419
Keying effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 440
Matte effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 450
Noise & Grain effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 452
Paint effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 471
Perspective effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 481
Simulation effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 486
Stylize effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 517
Text effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 524
Time effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 531
Transition effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 536
Utility effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 542
Chapter 16: Expressions
Working with expressions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 547
The expression language . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 556
After Effects expression elements reference . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 559
Expression examples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 582
Chapter 17: Rendering and exporting
Basics of rendering and exporting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 587
Rendering and exporting to Flash formats . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 602
Rendering and exporting still images and still-image sequences . . . . . . . . . . . . . . . . . . . . . . . . . . 606
Exporting project information to other Adobe applications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 608
Encoding and compression options for movies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 612
Automated rendering and network rendering . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 622
Converting movies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 630
Reviewing movies with Clip Notes comments . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 634
Chapter 18: Keyboard shortcuts
Using and modifying keyboard shortcuts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 638
Index . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 657
1
Chapter 1: Getting started
Installation
Requirements
❖To review complete system requirements and recommendations for your Adobe® software, see the Read Me file
on the installation disc.
Install the software
1Close any other Adobe applications open on your computer.
2Insert the installation disc into your DVD drive, and follow the on-screen instructions.
For each licensed copy of Adobe® After Effects® software, you can activate and use one copy of the full version of the
application on one computer. You can also install additional copies on additional computers to use as After Effects
render engines, which assist with network rendering. You install render engines in the same manner as the full
version of the application, but you do not activate them. You run the render engine using the Adobe After Effects
Render Engine shortcut in the Adobe After Effects CS3 folder.
Note: Formoreinformation,seetheReadMefileontheinstallationDVDorvisittheAdobeAfterEffectssupportwebsite
at www.adobe.com/go/learn_ae_support.
See also
“Network rendering with watch folders” on page 625
Activate the software
Ifyouhaveasingle-userretaillicenseforyourAdobesoftware,youwillbeaskedtoactivateyoursoftware;thisisa
simple, anonymous process that you must complete within 30 days of starting the software.
For more information on product activation, see the Read Me file on your installation disc, or visit the Adobe website
at www.adobe.com/go/activation.
1If the Activation dialog box isn’t already open, choose Help > Activate.
2Follow the on-screen instructions.
Note: If you want to install the software on a different computer, you must first deactivate it on your computer. Choose
Help > Deactivate.
Register
Register your product to receive complimentary installation support, notifications of updates, and other services.
❖To register, follow the on-screen instructions in the Registration dialog box, which appears after you install and
activate the software.
If you postpone registration, you can register at any time by choosing Help > Registration.
AFTER EFFECTS CS3
User Guide
2
Read Me
The installation disc contains the Read Me file for your software. (This file is also copied to the application folder
during product installation.) Open the file to read important information about topics such as the following:
•System requirements
•Installation (including uninstalling the software)
•Activation and registration
•Font installation
•Troubleshooting
•Customer support
•Legal notices
Adobe Help
Adobe Help resources
Documentation for your Adobe software is available in a variety of formats.
In-product and LiveDocs Help
In-product Help provides access to all documentation and instructional content available at the time the software
ships. It is available through the Help menu in your Adobe software.
LiveDocs Help includes all the content from in-product Help, plus updates and links to additional instructional
content available on the web. For some products, you can also add comments to the topics in LiveDocs Help. Find
LiveDocs Help for your product in the Adobe Help Resource Center, at www.adobe.com/go/documentation.
AFTER EFFECTS CS3
User Guide
3
Most versions of in-product and LiveDocs Help let you search across the Help systems of multiple products. Topics
may also contain links to relevant content on the web or to topics in the Help of another product.
Think of Help, both in the product and on the web, as a hub for accessing additional content and communities of
users. The most complete and up-to-date version of Help is always on the web.
Adobe PDF documentation
The in-product Help is also available as a PDF that is optimized for printing. Other documents, such as installation
guides and white papers, may also be provided as PDFs.
All PDF documentation is available through the Adobe Help Resource Center, at www.adobe.com/go/documen-
tation. To see the PDF documentation included with your software, look in the Documents folder on the installation
or content DVD.
Printed documentation
Printed editions of the in-product Help are available for purchase in the Adobe Store, at www.adobe.com/go/store.
You can also find books published by Adobe publishing partners in the Adobe Store.
A printed workflow guide is included with all Adobe Creative Suite® 3 products, and stand-alone Adobe products
may include a printed getting started guide.
Using Help in the product
In-productHelpisavailablethroughtheHelpmenu.AfteryoustarttheAdobeHelpViewer,clickBrowsetoseeHelp
for additional Adobe products installed on your computer.
These Help features facilitate cross-product learning:
•Topics may contain links to the Help systems of other Adobe products or to additional content on the web.
•Some topics are shared across two or more products. For instance, if you see a Help topic with an Adobe
Photoshop® CS3 icon and an Adobe After Effects® CS3 icon, you know that the topic either describes functionality
that is similar in the two products or describes cross-product workflows.
•You can search across the Help systems of multiple products.
If you search for a phrase, such as “shape tool,” enclose it in quotation marks to see only those topics that include all
the words in the phrase.
AFTER EFFECTS CS3
User Guide
4
Adobe Help
A. Back/Forward buttons (previously visited links) B. Expandable subtopics C. Icons indicating shared topic D. Previous/Next buttons (topics
in sequential order)
Accessibility features
Adobe Help content is accessible to people with disabilities—such as mobility impairments, blindness, and low
vision. In-product Help supports these standard accessibility features:
•The user can change text size with standard context menu commands.
•Links are underlined for easy recognition.
•If link text doesn’t match the title of the destination, the title is referenced in the Title attribute of the Anchor tag.
For example, the Previous and Next links include the titles of the previous and next topics.
•Content supports high-contrast mode.
•Graphics without captions include alternate text.
•Each frame has a title to indicate its purpose.
•Standard HTML tags define content structure for screen reading or text-to-speech tools.
•Style sheets control formatting, so there are no embedded fonts.
Keyboard shortcuts for Help toolbar controls (Windows)
Back button Alt+Left Arrow
Forward button Alt+Right Arrow
Print Ctrl+P
About button Ctrl+I
Browse menu Alt+Down Arrow or Alt+Up Arrow to view Help for another application
Search box Ctrl+S to place the insertion point in the Search box
C
D
B
A
AFTER EFFECTS CS3
User Guide
5
Keyboard shortcuts for Help navigation (Windows)
•To move between panes, press Ctrl+Tab (forward) and Shift+Ctrl+Tab (backward).
•To move through and outline links in a pane, press Tab (forward) or Shift+Tab (backward).
•To activate an outlined link, press Enter.
•To make text bigger, press Ctrl+equal sign.
•To make text smaller, press Ctrl+hyphen.
Resources
Adobe Video Workshop
The Adobe Creative Suite 3 Video Workshop offers over 200 training videos covering a wide range of subjects for
print, web, and video professionals.
YoucanusetheAdobeVideoWorkshoptolearnaboutanyCreativeSuite3product.Manyvideosshowyouhowto
use Adobe applications together.
AFTER EFFECTS CS3
User Guide
6
When you start the Adobe Video Workshop, you choose the products you want to learn and the subjects you want
to view. You can see details about each video to focus and direct your learning.
Community of presenters
With this release, Adobe Systems invited the community of its users to share their expertise and insights. Adobe and
lynda.com present tutorials, tips, and tricks from leading designers and developers such as Joseph Lowery, Katrin
Eismann, and Chris Georgenes. You can see and hear Adobe experts such as Lynn Grillo, Greg Rewis, and Russell
Brown. In all, over 30 product experts share their knowledge.
Tutorials and source files
The Adobe Video Workshop includes training for novices and experienced users. You’ll also find videos on new
features and key techniques. Each video covers a single subject and typically runs about 3-5 minutes. Most videos
come with an illustrated tutorial and source files, so you can print detailed steps and try the tutorial on your own.
Using Adobe Video Workshop
YoucanaccessAdobeVideoWorkshopusingtheDVDincludedwithyourCreativeSuite3product.It’salsoavailable
online at www.adobe.com/go/learn_videotutorials. Adobe will regularly add new videos to the online Video
Workshop, so check in to see what’s new.
After Effects CS3 videos
Adobe Video Workshop covers a wide range of subjects for Adobe After Effects® CS3, including these:
•Animating shape layers
•Applying effects
•Working with keyframes and the timeline
•Rendering and exporting
AFTER EFFECTS CS3
User Guide
7
Videos also show you how to use After Effects CS3 with other Adobe products:
•Importing Photoshop files
•Using Dynamic Link
•Sending work for review using Clip Notes
To access Adobe Creative Suite 3 video tutorials, visit Adobe Video Workshop at
www.adobe.com/go/learn_videotutorials.
Extras
You have access to a wide variety of resources that will help you make the most of your Adobe software. Some of
these resources are installed on your computer during the setup process; additional helpful samples and documents
are included on the installation or content disc. Unique extras are also offered online by the Adobe Exchange
community, at www.adobe.com/go/exchange.
Installed resources
During software installation, a number of resources are placed in your application folder. To view those files, navigate
to the application folder on your computer.
•Windows®: [startup drive]\Program Files\Adobe\[Adobe application]
•Mac OS®: [startup drive]/Applications/[Adobe application]
The application folder may contain the following resources:
Plug-ins Plug-in modules are small software programs that extend or add features to your software. Once installed,
plug-in modules appear as options in the Import or Export menu; as file formats in the Open, Save As, and Export
Original dialog boxes; or as filters in the Filter submenus. For example, a number of special effects plug-ins are
automatically installed in the Plug-ins folder inside the Photoshop CS3 folder.
Presets Presets include a wide variety of useful tools, preferences, effects, and images. Product presets include
brushes, swatches, color groups, symbols, custom shapes, graphic and layer styles, patterns, textures, actions,
workspaces, and more. Preset content can be found throughout the user interface. Some presets (for example,
Photoshop Brush libraries) become available only when you select the corresponding tool. If you don’t want to create
an effect or image from scratch, go to the preset libraries for inspiration.
Templates Template files can be opened and viewed from Adobe Bridge CS3, opened from the Welcome Screen, or
opened directly from the File menu. Depending on the product, template files range from letterheads, newsletters,
AFTER EFFECTS CS3
User Guide
8
and websites to DVD menus and video buttons. Each template file is professionally constructed and represents a
best-use example of product features. Templates can be a valuable resource when you need to jump-start a project.
Samples Sample files include more complicated designs and are a great way to see new features in action. These files
demonstrate the range of creative possibilities available to you.
Fonts Several OpenType® fonts and font families are included with your Creative Suite product. Fonts are copied to
your computer during installation:
•Windows: [startup drive]\Windows\Fonts
•Mac OS X: [startup drive]/Library/Fonts
For information about installing fonts, see the Read Me file on the installation DVD.
DVD content
The installation or content DVD included with your product contains additional resources for use with your
software. The Goodies folder contains product-specific files such as templates, images, presets, actions, plug-ins, and
effects, along with subfolders for Fonts and Stock Photography. The Documentation folder contains a PDF version
of the Help, technical information, and other documents such as specimen sheets, reference guides, and specialized
feature information.
Adobe Exchange
For more free content, visit www.adobe.com/go/exchange, an online community where users download and share
thousands of free actions, extensions, plug-ins, and other content for use with Adobe products.
Bridge Home
Bridge Home, a new destination in Adobe Bridge CS3, provides up-to-date information on all your Adobe Creative
Suite 3 software in one convenient location. Start Adobe Bridge, then click the Bridge Home icon at the top of the
Favorites panel to access the latest tips, news, and resources for your Creative Suite tools.
ET VERO EOS ET ACCUSAM ET JUSTO
DUO DOLORES ET EA REBUM. STET CLITA KASD.
ET
COSETETUR SADIPSCING
01
PelletirInc.
CORE INVESTMENT SPECTRUM
Vel illum dolore eu feugiat nulla facilisis at vero eros et accumsan
et iusto odio dignissim qui.
RETIREMENT SAVING PLAN
Vel illum dolore eu feugiat nulla facilisis at vero eros et accumsan
et iusto odio dignissim qui.
Your Investment Guide
Are you leaving money on the table?
01
Typi non habent claritatem insitam; est usus legentis in iis qui facit eorum
claritatem. Investigationes demonstraverunt lectores legere me lius quod ii
legunt saepius. Claritas est etiam processus.
Typi non habent claritatem insitam; est usus legentis in iis qui facit eorum
claritatem. Investigationes demonstraverunt lectores legere me lius quod ii
legunt saepius. Claritas est etiam processus.
Travel Earth
Best 100 places to see on the planet
in your lifetime
volute
ipsummy
, commy
re eugia-
rud tem
eraes-
exer
n ullutet
Vel: Ad : Vulputate:
SURVICE MENU
NULCHE
vero dio eum
nulche
agiamet ad lorperit
sum a
$45
agiamet ad atin utet
vero dio eum
nulche suma
agaimet ad eum
nullam
$25
lorperit sum a
agiamet ad lorperit
vero dio
eum nullam
$35
SUCCIVEROS
sucicvero dio
vero dio eum
nulche suma
$15
eum nullam
vero dio eum
nulche suma
agaimet ad eum
nullam
$35
N
eum nullam
$35
SUCCIVEROS
sucicvero dio
vero dio eum
nulche suma
$15
eum nullam
vero dio eum
nulche suma
agaimet ad eum
nullam
$35
CC
a
si
o
p
i
a
S
p
A
AFTER EFFECTS CS3
User Guide
9
Note: Bridge Home may not be available in all languages.
Adobe Design Center
Adobe Design Center offers articles, inspiration, and instruction from industry experts, top designers, and Adobe
publishing partners. New content is added monthly.
You can find hundreds of tutorials for design products and learn tips and techniques through videos, HTML
tutorials, and sample book chapters.
AFTER EFFECTS CS3
User Guide
10
New ideas are the heart of Think Tank, Dialog Box, and Gallery:
•ThinkTankarticlesconsiderhowtoday’sdesignersengagewithtechnologyandwhattheirexperiencesmeanfor
design, design tools, and society.
•In Dialog Box, experts share new ideas in motion graphics and digital design.
•The Gallery showcases how artists communicate design in motion.
Visit Adobe Design Center at www.adobe.com/designcenter.
Adobe Developer Center
Adobe Developer Center provides samples, tutorials, articles, and community resources for developers who build
rich Internet applications, websites, mobile content, and other projects using Adobe products. The Developer Center
also contains resources for developers who develop plug-ins for Adobe products.
In addition to sample code and tutorials, you'll find RSS feeds, online seminars, SDKs, scripting guides, and other
technical resources.
Visit Adobe Developer Center at www.adobe.com/go/developer.
Customer support
VisittheAdobeSupportwebsite,atwww.adobe.com/support, to find troubleshooting information for your product
and to learn about free and paid technical support options. Click the Training link for access to Adobe Press books,
a variety of training resources, Adobe software certification programs, and more.
Downloads
Visit www.adobe.com/go/downloads to find free updates, tryouts, and other useful software. In addition, the Adobe
Store (at www.adobe.com/go/store) provides access to thousands of plug-ins from third-party developers, helping
you to automate tasks, customize workflows, create specialized professional effects, and more.
AFTER EFFECTS CS3
User Guide
11
Adobe Labs
Adobe Labs gives you the opportunity to experience and evaluate new and emerging technologies and products from
Adobe.
At Adobe Labs, you have access to resources such as these:
•Prerelease software and technologies
•Code samples and best practices to accelerate your learning
•Early versions of product and technical documentation
•Forums, wiki-based content, and other collaborative resources to help you interact with like-minded developers
Adobe Labs fosters a collaborative software development process. In this environment, customers quickly become
productive with new products and technologies. Adobe Labs is also a forum for early feedback, which the Adobe
development teams use to create software that meets the needs and expectations of the community.
Visit Adobe Labs at www.adobe.com/go/labs.
User communities
User communities feature forums, blogs, and other avenues for users to share technologies, tools, and information.
Users can ask questions and find out how others are getting the most out of their software. User-to-user forums are
available in English, French, German, and Japanese; blogs are posted in a wide range of languages.
To participate in forums or blogs, visit www.adobe.com/communities.
What’s new
New features
Shape layers
Use new shape drawing tools to create and animate vector graphics. Strokes and fills—including editable gradients—
can be added to shapes, and these properties can be animated. After Effects also includes shape layer operations
based on Adobe® Illustrator® vector effects. See “About shapes and shape layers” on page 314.
To see a video tutorial introducing shape layers, go to the Adobe website at www.adobe.com/go/vid0224. To see a
video tutorial on animating shape layers, go to the Adobe website at www.adobe.com/go/vid0225.
Puppet tools
Use Puppet tools to easily distort any image with natural, life-like motion. See “Animating with Puppet tools” on
page 226.
Photoshop layer styles and video layers
Layer styles and video layers are preserved when you import a Photoshop file. You can also add and animate layer
styles within After Effects and use advanced blending options. See “Layer styles” on page 168 and “Working with
Photoshop and After Effects” on page 32.
To see a video tutorial on importing Photoshop files, go to the Adobe website at www.adobe.com/go/vid0252.
AFTER EFFECTS CS3
User Guide
12
Flash integration
You can export FLV files with cue points that you create as markers within After Effects. Now, when you import a
SWF file, the alpha channel is preserved, and graphics are continuously rasterized, so they stay sharp as you scale
them up. See “Working with Flash and After Effects” on page 33 and “Rendering and exporting to Flash formats” on
page 602.
To see a video tutorial on exporting to FLV files, go to the Adobe website at www.adobe.com/go/vid0262. To see a
video tutorial on exporting markers as cue points, go to the Adobe website at www.adobe.com/go/vid0255.
Per-character 3D properties for text animation
Move or rotate individual characters or words in 3D space. See “Work with per-character 3D text properties” on
page 293.
To see a video tutorial on animating text, go to the Adobe website at www.adobe.com/go/vid0226.
Brainstorm
Use Brainstorm to experiment with properties and see the results side by side. Choose the variants that you like and
use as is or as input to further experimentation. See “Use Brainstorm to experiment and explore settings” on
page 160.
Improved, simpler color management
You can now control the color for each footage item and each output item, all with a robust and simple interface, so
colors look right on any output device. See “Color management” on page 241.
Clip Notes
Add queries to reviewers as markers and then export your composition as a PDF file. Reviewers can use Adobe
Acrobat® or Adobe Reader® to make comments and then return the comments to you by e-mail or FTP. Comments
are imported as markers, which you can see in the Timeline panel. See “Reviewing movies with Clip Notes
comments” on page 634.
Performance improvements
You can use multiple CPUs or multiple processors on one CPU to render multiple frames simultaneously. You can
also use hardware acceleration of previews to move processing to the GPU, freeing up your CPU and providing
greater performance. See “Memory, storage, and performance” on page 37.
Export and preview video for mobile devices
New export presets in the Export Settings dialog box make it easier to export movies suitable for playback on mobile
devices, such as mobile phones and the Apple® iPod®. You can view some output types using Adobe Device Central,
which emulates many mobile devices. See “Preview a movie on a virtual mobile device using After Effects” on
page 618.
13
Chapter 2: User interface
Customizing the user interface
About workspaces
Adobe video and audio applications provide a consistent, customizable workspace. Although each application has its
own set of panels (such as Tools, Properties, Timeline, and so on), you move and group panels in the same way across
products.
The main window of a program is the application window. Panels are organized in this window in an arrangement
called a workspace. The default workspace contains groups of panels as well as panels that stand alone.
You customize a workspace by arranging panels in the layout that best suits your working style. You can create and
save several custom workspaces for different tasks—for example, one for editing and one for previewing.
You can drag panels to new locations, move panels into or out of a group, place panels alongside each other, and
undock a panel so that it floats in a new window above the application window. As you rearrange panels, the other
panels resize automatically to fit the window.
YoucanusefloatingwindowstocreateaworkspacemorelikethoseinpreviousversionsofAdobeapplications,orto
place panels on multiple monitors.
Example workspace
A. Application window B. Grouped panels C. Individual panel
For a video about the Adobe workspace, see www.adobe.com/go/vid0249.
BC
A
AFTER EFFECTS CS3
User Guide
14
Choose a workspace
Each Adobe video and audio application includes several predefined workspaces that optimize the layout of panels
for specific tasks. When you choose one of these workspaces, or any custom workspaces you’ve saved, the current
workspace is redrawn accordingly.
❖Open the project you want to work on, choose Window > Workspace, and select the desired workspace.
Dock, group, or float panels
You can dock panels together, move panels into or out of a group, and undock a panel so that it floats in a new
window above the application window. As you drag a panel, drop zones—areas onto which you can move the panel—
become highlighted. The drop zone you choose determines where the panel is inserted, and whether it docks or
groups with other panels.
Docking zones
Docking zones exist along the edges of a panel, group, or window. Docking a panel places it adjacent to the existing
group, resizing all groups to accommodate the new panel.
Dragging panel (A) onto docking zone (B) to dock it (C)
Grouping zones
Groupingzonesexistinthemiddleofapanelorgroup,andalongthetabareaofpanels.Groupingapanelstacksit
with other panels.
C
B
A
AFTER EFFECTS CS3
User Guide
15
Dragging panel (A) onto grouping zone (B) to group it with existing panels (C)
Dock or group panels
1If the panel you want to dock or group is not visible, choose it from the Window menu.
2Do one of the following:
•
To move an individual panel, drag the gripper area in the upper-left corner of a panel’s tab onto the desired drop zone.
Drag panel gripper to move one panel
•To move an entire group, drag the group gripper at the upper-right corner onto the desired drop zone.
C
B
A
AFTER EFFECTS CS3
User Guide
16
Drag group gripper to move entire group
The application docks or groups the panel, according to the type of drop zone.
Undock a panel in a floating window
When you undock a panel in a floating window, you can add panels to the window or otherwise modify it, as you do
the application window. You can use floating windows to make use of a secondary monitor, or to create a workspace
like those in earlier versions of Adobe applications.
❖Select the panel you want to undock (if it’s not visible, choose it from the Window menu), and then do one of the
following:
•Choose Undock Panel or Undock Frame from the panel menu. Undock Frame undocks the panel group.
•Hold down Ctrl (Windows®) or Command (Mac OS®), and drag the panel or group from its current location.
When you release the mouse button, the panel or group appears in a new floating window.
•Drag the panel or group outside the application window. (If the application window is maximized, drag the panel
to the Windows task bar.)
Resize panel groups
When you position the pointer over dividers between panel groups, resize icons appear. When you drag these icons,
all groups that share the divider are resized. For example, suppose your workspace contains three panel groups
stacked vertically. If you drag the divider between the bottom two groups, they are resized, but the topmost group
doesn’t change.
To quickly maximize a panel beneath the pointer, press the tilde (~) key. (Do not press Shift.) Press the tilde key again
to return the panel to its original size.
1Do either of the following:
•To resize either horizontally or vertically, position the pointer between two panel groups. The pointer becomes a
double-arrow .
•To resize in both directions at once, position the pointer at the intersection between three or more panel groups.
The pointer becomes a four-way arrow .
2Hold down the mouse button, and drag to resize the panel groups.
AFTER EFFECTS CS3
User Guide
17
Dragging divider between panel groups to resize them horizontally
A. Original group with resize icon B. Resized groups
Open and close panels and windows
Even if a panel is open, it may be out of sight, beneath other panels. Choosing a panel from the Window menu opens
it and brings it to the front.
Whenyoucloseapanelgroupintheapplicationwindow,theothergroupsresizetomakeuseofthenewlyavailable
space. When you close a floating window, the panels within it close, too.
•To open or close a panel, choose the panel from the Window menu.
•To close a panel or window, click its Close button .
Working with multiple monitors
To increase the available screen space, use multiple monitors. When you work with multiple monitors, the appli-
cation window appears on the main monitor, and you place floating windows on the second monitor. Monitor
configurations are stored in the workspace.
See also
“Dock, group, or float panels” on page 14
Save a custom workspace
As you customize a workspace, the application tracks your changes, storing the most recent layout. To store a specific
layout more permanently, save a custom workspace. Saved custom workspaces appear in the Workspace menu,
where you can return to and reset them.
❖Arrange the frames and panels as desired, then choose Window > Workspace > New Workspace. Type a name for
the workspace, and click OK.
Note: If a project saved with a custom workspace is opened on another system, the application looks for a workspace with
a matching name. If it can’t find a match (or the monitor configuration doesn’t match), it uses the current local
workspace.
A
B
AFTER EFFECTS CS3
User Guide
18
Reset a workspace
Reset a workspace to return to its original, saved layout of panels.
❖With the workspace you want to reset active, choose Window > Workspace > Reset workspace name.
Delete a workspace
1Choose Window > Workspace > Delete Workspace.
2Choose the workspace you want to delete, and then click OK.
Note: You cannot delete the currently active workspace.
Brighten or darken the interface
Changing the brightness preference affects panels, windows, and dialog boxes.
1Choose Edit > Preferences > User Interface Colors (Windows) or After Effects > Preferences > User Interface
Colors (Mac OS).
2Drag the User Interface Brightness slider to the left or right. Click Default to restore the default brightness level.
Using the After Effects interface
Work with columns
The Project, Timeline, and Render Queue panels contain columns.
•To show or hide columns, right-click (Windows) or Control-click (Mac OS) a column heading (or choose
Columns from the panel menu), and select the columns that you want to show or hide. A check mark indicates
that the column is shown.
•To reorder columns, select a column name and drag it to a new location.
•Toresizecolumns,dragthebartotherightofacolumnname.Draglefttomakethecolumnsmallerandrightto
make it larger. Some columns—such as the Duration column in the Project panel—cannot be resized.
Scroll or zoom with the mouse wheel
You can use the mouse wheel to zoom in the Timeline, Composition, Layer, and Footage panels, and scroll in the
Timeline, Project, Render Queue, Flowchart, Effect Controls, and Effects & Presets panels.
•To zoom into the center of the panel, or into the feature region when tracking, roll the mouse wheel forward.
•To zoom out of the center of the panel, or out of the feature region when tracking, roll the mouse wheel backward.
•To zoom into the area under the pointer, hold down Alt (Windows) or Option (Mac OS) as you roll the mouse
wheel forward.
•To zoom out of the area under the pointer, hold down Alt (Windows) or Option (Mac OS) as you roll the mouse
wheel backward.
•To scroll vertically, roll the mouse wheel forward or backward.
•To scroll horizontally, hold down Shift as you roll the mouse wheel backward or forward. When you are in the
Timeline panel, rolling backward moves you forward in time and vice versa.
AFTER EFFECTS CS3
User Guide
19
You can scroll in a panel even if it is not currently active, as long as you move the pointer over it. For instance, you
can scroll in the Composition panel even if the Effect Controls panel is currently active.
Open panel, viewer, and context menus
Panel menus provide commands relative to the active panel or frame. Viewer menus provide a list of compositions,
layers, or footage items that can be shown in the viewer, as well as commands for closing items and locking the
viewer. Context menus provide commands relative to the active tool or selected item.
A. Triangle for opening viewer menu B. Triangle for opening panel menu
•To open a panel menu, click the triangle in the upper-right corner of the panel.
•To open a viewer menu, click the name of the active composition, layer, or footage item in the viewer tab.
•To open a context menu, right-click (Windows) or Control-click (Mac OS).
Work with viewers
Aviewer is a panel that can contain multiple compositions, layers, or footage items, or multiple views of one such
item. The Composition, Layer, Footage, Flowchart, and Effect Controls panels are viewers.
Locking a viewer prevents the currently displayed item from being replaced when you open or select a new item.
Instead, when a viewer is locked and a new item is opened or selected, After Effects creates a new viewer panel for
that item.
Instead of housing multiple items in a single viewer and using the menu to switch between them, you can choose to
open a separate viewer for each open composition, layer, or footage item. When you have multiple viewers open, you
can arrange them by docking or grouping them together, just as with any other panels.
For example, you can create one Composition viewer each for different 3D views (Top, Bottom, Back, Front) so that
you can maximize each of the views with the ` (accent grave) keyboard command, which maximizes or restores the
panel under the pointer.
To create a custom workspace with multiple viewers, ensure that all viewers are unlocked before you save the workspace.
Locked viewers are associated with a specific project context and are therefore not saved in the preferences file.
•To create a new viewer, choose New from the viewer menu.
•To lock or unlock a viewer, choose Locked from the viewer menu, or click the Toggle Viewer Lock button.
•To lock the current viewer, split the current frame, and create a new viewer of the same type in the new frame,
press Ctrl+Alt+Shift+N (Windows) or Command+Option+Shift+N (Mac OS).
•To cycle forward or backward through the items in the viewer menu list for the active viewer, press Shift+period
or Shift+comma.
See also
“Choose a viewer to always preview” on page 124
“Shortcuts for panels, viewers, workspaces, and windows” on page 639
AB
AFTER EFFECTS CS3
User Guide
20
Activate a tool
The Tools panel can be displayed as a toolbar (as shown here) or as a normal panel.
Tools panel
A. Selection B. Hand C. Zoom D. Rotation E. Orbit Camera, Track XY Camera, Track Z Camera F. Pan Behind G. Mask and shape tools
H. Pen tools I. Type tools J. Brush K. Clone Stamp L. Eraser M. Puppet tools N. Controls related to active tool
Note: Controls related to some tools appear only when the tool is active.
•Click the tool’s button. If the button has a small triangle at its lower-right corner, hold down the mouse button to
view the hidden tools. Then, click the tool you want to select.
•Press the tool’s keyboard shortcut. (Positioning the pointer over a tool button displays a tool tip with the tool’s
name and keyboard shortcut.)
•To cycle through hidden tools, repeatedly press the tool’s keyboard shortcut.
•To momentarily change from one tool to another tool, hold down the shortcut key for the desired tool; release the
shortcut key to return to the previous tool. (This technique does not work with all tools.)
•To view panels most relevant to the active tool, click the panel button if available. For example, clicking this
button when a paint tool is active opens the Paint and Brush Tips panels.
See also
“Shortcuts for activating tools” on page 640
Tips for working with the After Effects user interface
•Use ClearType text anti-aliasing on Windows. ClearType makes the outlines of system text, such as menus and
dialog boxes, easier to read. See Windows Help for information on how to enable ClearType text anti-aliasing.
•To show tool tips, select the Show Tool Tips preference (Edit > Preferences > General (Windows) or After Effects >
Preferences > General (Mac OS)).
•Toassignakeyboardshortcuttothecurrentworkspace,chooseWindow>AssignShortcutTo[Workspace Name]
Workspac e.
•Ifaframecontainsmoregroupedpanelsthancanbeshownatonce,dragthesliderbarthatappearsabovethetabs.
Slider bar for showing other tabs
•Use keyboard shortcuts.
Note: On Mac OS, some keyboard commands for interacting with the operating system conflict with keyboard
commands for interacting with After Effects. Select Use System Shortcut Keys in the General preferences category to
override the After Effects keyboard command in cases in which there's a conflict with the Mac OS keyboard command.
A B C D E F G H I J K L M N
AFTER EFFECTS CS3
User Guide
21
See also
“Using and modifying keyboard shortcuts” on page 638
Work with preferences
•To open the Preferences dialog box, choose Edit > Preferences > [category name] (Windows) or After Effects >
Preferences > [category name] (Mac OS).
•To open the Preferences dialog box to the General category, press Ctrl+Alt+; (semicolon) (Windows) or
Command+Option+; (Mac OS).
•To restore default preference settings, hold Ctrl+Alt+Shift (Windows) or Command+Option+Shift while the
application is starting. To also restore default keyboard shortcuts, Alt-click (Windows) or Option-click (Mac OS)
the OK button.
Preference reference
This section provides links to pages in which the various preferences—those that aren’t self-explanatory—are
explained.
General
•Levels Of Undo: “Undo changes” on page 25
•Show Tool Tips: “Tips for working with the After Effects user interface” on page 20
•Create Layers At Composition Start Time: “About layers” on page 133
•Switches Affect Nested Comps: “About nesting and precomposing” on page 113
•Default Spatial Interpolation To Linear: “Controlling change with interpolation” on page 204
•Preserve Constant Vertex Count When Editing Masks: “Designate the first vertex for a Bezier path” on page 325
•Synchronize Time Of All Related Items: “About nesting and precomposing” on page 113
•Expression Pick Whip Writes Compact English: “Add, edit, and remove expressions” on page 549
•Create Split Layers Above Original Layer: “Split a layer” on page 146
•Allow Scripts To Write Files And Access Network: “Work with scripts” on page 45
•Enable JavaScript Debugger: After Effects CS3 Professional Scripting Guide (PDF)
•Use System Color Picker: “Select a color or edit a gradient” on page 236
•Create New Layers At Best Quality: “Layer image quality” on page 150
•Preserve Clipboard Data For Other Applications: “Copy between After Effects and Adobe Premiere Pro” on
page 65
•Use System Shortcut Keys (Mac OS only): “Tips for working with the After Effects user interface” on page 20
Previews
•Adaptive Resolution Limit: “Preview modes” on page 124
•Enable OpenGL: “Render with OpenGL” on page 593
•Accelerate Effects Using: “Preview modes” on page 124
•Audio Preview Duration: “Preview video and audio” on page 120
Display
•Motion Path: “Work with motion paths” on page 197
AFTER EFFECTS CS3
User Guide
22
•Disable Thumbnails In Project Panel: “Work with composition thumbnail images” on page 111
•Auto-zoom When Resolution Changes: “Resolution” on page 128
•Show Rendering Progress In Info Panel & Flowchart: “Preview video and audio” on page 120
•Hardware Accelerate Composition, Layer, And Footage Panels: “Improve performance” on page 41
Import
•Still Footage: “Create layers from footage items” on page 135
•Sequence Footage: “Import a single still image or a still-image sequence” on page 81
•Interpret Unlabeled Alpha As: “Specify alpha channel interpretation” on page 52
•Default Drag Import As: “Import footage items” on page 50
Output
•Overflow Volumes, Segment Sequences At, Segment Movie Files At, and Audio Block Duration: “Overflow
volumes and segment settings” on page 629
Grids & Guides
•Safe Margins: “Work with safe zones, grids, guides, and rulers” on page 130
Label Colors and Label Defaults
•Label Colors and Label Defaults: “Work with color labels” on page 149
Memory & Cache
•Maximum Memory Usage, Maximum RAM Cache Size, Enable Disk Cache, and Maximum Disk Cache Size:
“Memory & Cache preferences” on page 39
•Conformed Media Cache and Clean Database & Cache: “Work with the media cache” on page 67
•Prevent DLL Address Space Fragmentation (Windows only): “Memory & Cache preferences” on page 39
Video Previews
•Output Device, Output Mode, Output Quality, Output During, and Scale And Letterbox Output To Fit Video
Monitor: “Preview on an external video monitor” on page 126
User Interface Colors
•Cycle Mask Colors: “Control mask path color” on page 260
•User Interface Brightness: “Brighten or darken the interface” on page 18
Auto-Save
•Automatically Save Projects and Maximum Project Versions: “Save and back up projects” on page 24
Multiprocessing
•Render Multiple Frames Simultaneously: “Render multiple frames simultaneously” on page 40
Audio Hardware and Audio Output Mapping
•Audio Hardware and Audio Output Mapping: “Preview video and audio” on page 120
23
Chapter 3: Planning and managing
projects
Project basics
About project files
An After Effects project isasinglefilethatstorescompositionsandreferencestoallofthefootageitemsthatyouuse
in that project. Compositions are collections of layers. Many layers use footage items as a source, though some
layers—such as shape layers and text layers—contain graphics that you create within After Effects. A project file has
the file-name extension .aep. The name of the current project appears at the top of the application window.
Atemplate project is a file with the file-name extension .aet. You can use the many template projects included with
After Effects—including DVD menu templates—as the basis for your own projects, and you can create new
templates based on your projects.
A great way to see how advanced users use After Effects is to open one of the template projects included with After
Effects, select all of its layers, and press Uor UU to reveal only the animated or modified properties. This shows you
what changes the designer of the template project made to create the template. You may need to unlock some layers to
select them.
Create and open projects
Onlyoneprojectcanbeopenatatime.Ifyoucreateoropenanotherprojectfilewhileaprojectisopen,AfterEffects
promptsyoutosavechangesintheopenproject,andthenclosesit.Afteryoucreateaproject,youcanimportfootage
into the project.
•To create a project, choose File > New > New Project.
•To open a project, choose File > Open Project, locate the project, and then click Open.
•To open the most recently opened project, press Ctrl+Alt+Shift+P (Windows) or Command+Option+Shift+P
(Mac OS).
See also
“Import an After Effects project” on page 63
Work with template projects
When you open a template project, After Effects creates a new, untitled project based on the template. This means
that saving changes to the project does not affect the template project.
Often, the creator of a template project will lock layers that should be left unmodified, and leave layers that should
be modified unlocked. This is a convenient way to reuse material and prevent accidental or inappropriate modifica-
tions.
AFTER EFFECTS CS3
User Guide
24
See also
“Lock or unlock a layer” on page 149
Open a template project
•To browse and open template projects using Adobe Bridge, choose File > Browse Template Projects. Double-click
a template project to open it.
•To open a template project, choose File > Open Project. On Windows, choose Adobe After Effects Project
Template from the Files Of Type menu.
Create a template project
•To convert a project to a template project, change the file-name extension from .aep to .aet.
•To save a copy of a project as a template project, choose File > Save A Copy, and then rename the copy with the
file-name extension .aet.
Save and back up projects
•To save a project, choose File > Save.
•To save a copy of the project with a new automatically generated name, choose File > Increment And Save, or press
Ctrl+Alt+Shift+S (Windows) or Command+Option+Shift+S (Mac OS).
A copy of the current project is saved in the same folder as the original project. The name of the copy is the name of
the original followed by a number. If the name of the original ends with a number, that number is increased by 1.
•To save the project with a different name or to a different location, choose File > Save As.
The open project takes the new name and location; the original file remains unchanged.
•To save a copy of the project with a different name or to a different location, choose File > Save A Copy.
The open project retains its original name and location, and a copy is created with the new settings but is not opened.
•To automatically save copies of projects at regular intervals, choose Edit > Preferences > Auto-Save (Windows) or
After Effects > Preferences > Auto-Save (Mac OS), and select Automatically Save Projects.
Auto-saved files are saved in the Adobe After Effects Auto-Save folder, which is located in the same folder as the
original project file. Auto-saved file names are based on the project name: After Effects adds “auto-save n”(wheren
is the number of the file in the auto-save series) to the end of the file name. Maximum Project Versions specifies how
many versions of each project file you want to save. When the number of versions saved reaches the maximum you
specify, the Auto-Save feature overwrites them starting with the oldest file.
•To save a copy of the project and copies of assets used in the project, use the Collect Files command. (See “Collect
files in one location” on page 594.)
Work with the Flowchart panel
In each composition’s flowchart, individual boxes (or tiles) represent each composition, footage item, and layer.
Directional arrows represent the relationships between components.
Note: The Flowchart panel shows you only the existing relationships. You cannot use it to change relationships between
project elements.
Nested compositions and other elements that make up the composition appear when you expand a composition tile.
AFTER EFFECTS CS3
User Guide
25
Mid-gray lines between tiles in the flowchart indicate that the Video or Audio switch for those items is deselected in
the Timeline panel. Black or light gray lines indicate that the switch is selected, depending on the User Interface
Brightness preference setting.
•To open the project’s flowchart, press Ctrl+F11 (Windows) or Command+F11 (Mac OS), or click the Project
Flowchart View button at the top of the vertical scroll bar on the right edge of the Project panel.
•To open a composition’s flowchart, select the composition and choose Composition > Comp Flowchart View, or
click the Comp Flowchart View button at the bottom of the Composition panel.
•To activate (select) an item, click its tile in the Flowchart panel.
When you click a composition in the flowchart, it becomes active in the Project panel and the Timeline panel. When
you click a layer, it becomes active in the Timeline panel. When you click a footage item, it becomes active in the
Project panel.
•To customize the appearance of the flowchart, use the Flowchart panel menu and the buttons along the bottom of
the panel.
For tool tips identifying the buttons in the Flowchart panel, let your pointer hover over a button until the tool tip
appears.
•To delete elements, select them and press Delete. If the selected element is a footage item or composition, it is
deleted from the project and no longer appears in the Timeline and Project panels. If the selected element is a layer,
it is deleted from the composition in which it appears.
•To access the context menu for a selected element, right-click (Windows) or Control-click (Mac OS) the icon to
the left of the name in the element tile. The icons have various appearances, depending on the element type, such
as layers and compositions . For example, you can use the context menu for a layer to work with masks and
effects, or to change switches, apply transformations, and adjust layer image quality.
Note: When you change element properties in the Flowchart panel, be careful to context-click the icon in the tile, not the
name of the element. The context menu associated with the element icon is different from the one that opens from the
element name.
Undo changes
You can undo only those actions that alter the project; for example, you can undo an edit, but you cannot undo the
scrolling of a panel.
You can sequentially undo as many as 99 of the most recent changes made to the project, depending on the Levels
Of Undo setting (Edit > Preferences > General (Windows) or After Effects > Preferences > General (Mac OS)). The
default is 32.
To avoid wasting time undoing accidental modifications, lock a layer when you want to see it but do not want to
modify it.
•To undo the most recent change, choose Edit > Undo [action].
•To undo a change and all changes after it, choose Edit > History, and select the first change that you want to undo.
•To revert to the last saved version of the project, choose File > Revert. All changes made and footage items
imported since you last saved are lost. You cannot undo this action.
See also
“Lock or unlock a layer” on page 149
AFTER EFFECTS CS3
User Guide
26
Project planning and setup
Workflow
Whether you use Adobe After Effects to animate a simple title or create complex special effects, you generally follow
the same basic workflow, though you may repeat some steps—such as the cycle of modifying layer properties,
animating, and previewing until everything looks right. You can choose a predefined workspace to facilitate each
stage of your work, or you can create your own workspaces adapted to your needs.
Import and organize footage
After you create a project, add your footage to the Project panel. After Effects automatically interprets many common
media formats, but you may also specify how you want After Effects to interpret attributes such as frame rate and
pixelaspectratio.YoucanvieweachiteminaFootagepanelandsetitsstartandendtimestofityourcomposition.
For more information, see “Importing and interpreting footage items” on page 47.
Create and arrange layers in a composition
Create one or more compositions. Any footage item can be the source for one or more layers in a composition. You
can arrange the layers spatially in the Composition panel or arrange them in time using the Timeline panel. You can
stack layers in two dimensions or arrange them in three dimensions. You can use masks, blending modes, and keying
tools to composite, or combine, the images of multiple layers. You can even use shape layers, text layers, and paint
tools to create your own visual elements. For more information, see Compositions, Layers and properties, Drawing
and painting, and Text.
Add effects and modify layer properties
You can add any combination of effects and modify any of a layer’s properties, such as size, position, and opacity.
Using effects, you can alter a layer’s appearance or sound, and even generate visual elements from scratch. You can
apply any of the hundreds of effects, animation presets, and layer styles. You can even create and save your own
animation presets. For more information, see Effects and animation presets.
Animate
You can make any combination of a layer’s properties change over time, using keyframes and expressions. Use the
motion tracking to stabilize motion or to animate one layer so that it follows the motion in another layer. For more
information, see Animation, Expressions, and Motion tracking.
Preview
Previewing compositions on your computer monitor or an external video monitor is fast and convenient, even for
complex projects, especially if you use OpenGL technology to accelerate previews. You can change the speed and
quality of previews by specifying their resolution and frame rate, and by limiting the area and duration of the compo-
sition that you preview. You can use color management features to preview how your movie will look on another
output device. For more information, see Views and previews and “Color management” on page 241.
Render and export
Add one or more compositions to the render queue to render them at the quality settings you choose, and to create
movies in the formats that you specify. In some cases, you will export by using the File > Export or Composition
menu, rather than by using the Render Queue panel. For more information, see Rendering and exporting.
AFTER EFFECTS CS3
User Guide
27
Example workflow: Create a simple movie
ThisexampleassumesthatyouhavealreadystartedAfterEffectsandhavenotmadeanychangestotheemptydefault
project. This examples skips the step of importing footage and shows you instead how to create your own visual
elements. After you have rendered a final movie, you can import it into After Effects to view it and use it just as you
would any other footage item.
Some people prefer to use the mouse and menus to interact with After Effects, whereas others prefer to use keyboard
shortcuts for their common tasks. For several steps in this example, two alternative commands are shown that
produce the same result—one demonstrating the disoverability of menu commands and one demonstrating the
speed and convenience of keyboard shortcuts. You will likely find that you use some combination of keyboard
shortcuts and menu commands in your work.
1Create a new composition:
•Choose Composition > New Composition.
•Press Ctrl+N (Windows) or Command+N (Mac OS).
2Change the Duration value in the Composition Settings dialog box to 5;00 (five seconds), choose Web Video from
the Preset menu, and click OK.
3Create a new text layer:
• Choose Layer > New > Text.
•Press Ctrl+Alt+Shift+T (Windows) or Command+Option+Shift+T (Mac OS).
4Type your name. Press Enter on the numeric keypad or press Ctrl+Enter (Windows) or Command+Return (Mac
OS) on the main keyboard to exit text-editing mode.
5Set an initial keyframe for the Position property:
•ClickthetriangletotheleftofthelayernameintheTimelinepanel,clickthetriangletotheleftoftheTransform
group name, and then click the stopwatch button to the left of the Position property name.
•Press Alt+Shift+P (Windows) or Option+Shift+P (Mac OS).
6Activate the Selection tool:
•Click the Selection Tool button in the Tools panel.
•Press V.
7Using the Selection tool, drag your text to the bottom-left corner of the frame in the Composition panel.
8Move the current-time indicator to the last frame of the composition:
• Drag the current-time indicator in the Timeline panel to the far right of the timeline.
•Press End.
9Using the Selection tool, drag your text to the top-right corner of the frame in the Composition panel.
A new keyframe is created at this time for the Position property. Motion is interpolated between keyframe values.
10 Preview your animation using standard preview:
• Click the the Play button in the Time Controls panel. Click Play again to stop the preview.
•Press the spacebar. Press the spacebar again to stop the preview.
11 Apply the Glow effect:
• Choose Effect > Stylize > Glow.
AFTER EFFECTS CS3
User Guide
28
•Type glow in the Contains field at the top of the Effects & Presets panel to find the Glow effect. Double-click the
effect name.
12 Add your composition to the render queue:
• Choose Composition > Add To Render Queue.
•Press Ctrl+Shift+/ (Windows) or Command+Shift+/ (Mac OS).
13 In the Render Queue panel, click the underlined text to the right of Output To. In the Output Movie To dialog
box, choose a name and location for the output movie file, and then click Save. For the location, choose something
easy to find, like your desktop.
14 Click the Render button to process all items in the render queue. The Render Queue panel shows the progress
of the rendering operation. A sound is generated when rendering is complete.
You’ve just created, rendered, and exported a movie.
You can import the movie that you’ve just created and preview it in After Effects, or you can navigate to the movie
and play it using a movie player such as QuickTime Player or Windows Media Player.
See also
“Using and modifying keyboard shortcuts” on page 638
“Import footage items” on page 50
Use Adobe Bridge with After Effects
Adobe Bridge is the control center for Adobe Creative Suite software. Use Adobe Bridge to browse for project
templates and animation presets; run cross-product workflow automation scripts; view and manage files and folders;
organize your files by assigning keywords, labels, and ratings to them; search for files and folders; and view, edit, and
add metadata.
For more information about Adobe Bridge, see Adobe Bridge.
•To open Adobe Bridge from After Effects, choose File > Browse.
•To reveal a file in Adobe Bridge, select a file in the Project panel and choose File > Reveal In Bridge.
•To use Adobe Bridge to open template projects, choose File > Browse Template Projects.
•To use Adobe Bridge to browse for animation presets, choose Animation > Browse Presets.
See also
“Work with template projects” on page 23
“About animation presets” on page 347
Planning your project
Correct project settings, preparation of footage, and initial composition settings can help you to avoid errors and
unexpected results when rendering your final output movie. Before you begin, think about what kind of work you’ll
be doing in After Effects and what kind of output you intend to create. Once you have planned your project and made
some basic decisions about project settings, you’ll be ready to start importing footage and assembling compositions
from layers based on that footage.
AFTER EFFECTS CS3
User Guide
29
The best way to ensure that your movie is suitable for a specific medium is to render a test movie and view it using
thesametypeofequipmentthatyouraudiencewillusetoviewit.It’sbesttodothisbeforeyouhavecompletedthe
difficult and time-consuming parts of your work, to uncover problems early.
AharonRabinowitzhasanarticleontheCreativeCOWwebsiteaboutplanningyourprojectwiththefinaldelivery
specifications in mind: www.adobe.com/go/learn_ae_aharonplanning.
For introductions to digital video, digital audio, high-definition video, DVD, compression, and streaming video, visit
the Adobe website at www.adobe.com/go/learn_dv_primers.
To see a video tutorial on creating and organizing projects, visit the Adobe website at www.adobe.com/go/vid0221.
Acquiring, choosing, and preparing footage
Before importing footage, first decide which media and formats you'll use for your finished movies, and then
determine the best settings for your source material. Often, it’s best to prepare footage before importing it into After
Effects.
For example, if you want an image to fill your composition frame, configure the image in Adobe® Photoshop® so that
the image size and pixel aspect ratio match the composition size and pixel aspect ratio. If the image is too large when
you import it into After Effects, you’ll increase the memory and processor requirements of the compositions that use
it. If the image is too small, you’ll lose image quality when you scale it to the desired size. See “Change pixel aspect
ratio” on page 55.
If possible, use uncompressed footage: less compression means better results for many operations, such as keying and
motion tracking. Certain kinds of compression—such as that used in DV encoding—are especially bad for color
keying, because they discard the subtle differences in color that you depend on for good bluescreen or greenscreen
keying. It’s often best to wait until the final rendering phase to use compression. See “Keying overview and tips” on
page 268.
If possible, use footage with a frame rate at least that of your output, so that After Effects doesn’t have to use frame
blending or similar methods to fill in missing frames. See “Change frame rate” on page 53.
The kind of work that you’ll be doing in After Effects and the kind of output movie that you want to create can even
influence how you shoot and acquire your footage. For example, if you know that you want to animate using motion
tracking, you should consider shooting your scene in a manner that optimizes for motion tracking—for example,
attaching a small, brightly colored ball to the object that you intend to track. See “Motion tracking workflow” on
page 336.
Project settings
Project settings fall into three basic categories: how time is displayed in the project, how color data is treated in the
project, and what sampling rate to use for audio. Of these, the color settings are the ones that you need to think about
before you do much work in your project, because they determine how color data is interpreted as you import
footagefiles,howcolorcalculationsareperformedasyouwork,andhowcolordataisconvertedforfinaloutput.See
“Color management” on page 241 and “Change time display units” on page 131.
Ifyouenablecolormanagementforyourproject,thecolorsthatyouseearethesamecolorsthatyouraudiencewill
see when they view the movie that you create.
Note: Click the color depth indicator at the bottom of the Project panel to open the Project Settings dialog box. Alt-click
(Windows) or Option-click (Mac OS) to cycle through color bit depths: 8 bpc, 16 bpc, and 32 bpc. See “Set the color depth”
on page 234.
AFTER EFFECTS CS3
User Guide
30
Composition settings
After you prepare and import footage items, you use these footage items to create layers in a composition, where you
animate and apply effects. When you create a composition, specify composition settings such as resolution, frame
size, and pixel aspect ratio for your final rendered output. Although you can change composition settings at any time,
it’s best to set them correctly as you create each new composition to avoid unexpected results in your final rendered
output.Forexample,thecompositionframesizeshouldbetheimagesizeintheplaybackmedium.See“Workwith
composition settings” on page 110.
If you’ll be rendering a composition to more than one media format, always match the resolution setting for your
composition to the highest resolution setting used for your output. Later, you can use output modules in the Render
Queue panel to render a separate version of the composition for each format. See “Work with output module settings”
on page 599.
Performance, memory, and storage considerations
If you work with large compositions, make sure that you configure After Effects and your computer to maximize
performance. Complex compositions can require a large amount of memory to render, and the rendered movies can
takealargeamountofdiskspacetostore.Beforeyouattempttorenderathree-hourmovie,makesurethatyouhave
the disk space available to store it. See “Memory, storage, and performance” on page 37.
Planning for playback from film, videotape, and DVD
If you’re creating a movie for film, consider both the frame aspect ratio of your composition and the frame rate of
your source footage. For footage that was transferred from film to video using the 3:2 pulldown telecine method, you
must remove 3:2 pulldown before adding effects. See “Remove 3:2 or 24Pa pulldown from video” on page 72.
For film and video, try to match import and composition settings with settings in the output module used to render
amovie.Insomecases,youmaywanttoconformfootagetoaframeratedifferentthantheframerateofthesource
footage. For example, you may want to conform 25 fps PAL to 24 fps for film. See “Converting movies” on page 630.
If your final output will be videotape, set up your composition to match the requirements of your capture card; or, if
you use an IEEE 1394 (FireWire) port, choose the appropriate DV preset in the Composition Settings dialog box and
in the export settings of the output module Render Queue panel.
AharonRabinowitzhasanarticleontheCreativeCOWwebsiteaboutplanningyourprojectwiththefinaldelivery
specifications in mind: www.adobe.com/go/learn_ae_aharonplanning.
See also
“Work with composition settings” on page 110
“Work with output module settings” on page 599
Planning for playback on computer monitors and mobile devices
Whenyoucreateamovieforplaybackonapersonalcomputer—whetherdownloadedfromtheweborplayedfrom
a CD-ROM—specify composition settings, render settings, and output module settings that keep file size low.
Consider that a movie with a high data rate may not play well from an older CD-ROM drive that cannot read data
from the disc fast enough. Similarly, a large movie may take a long time to download over a dial-up network
connection.
For more information about compression, see the Compression Primer (English only) on the Adobe website at
www.adobe.com/go/learn_dv_compressionprimer.
AFTER EFFECTS CS3
User Guide
31
When rendering your final movie, choose a file type and encoder appropriate for the final media. The corresponding
decodermustbeavailableonthesystemusedbyyourintendedaudience;otherwisetheywillnotbeabletoplaythe
movie. Common codecs (encoders/decoders) include FLV, Sorenson, MPEG-4 video, and codecs installed with
media players such as Flash® Player, RealPlayer, Windows Media Player, and QuickTime Player.
AharonRabinowitzhasanarticleontheCreativeCOWwebsiteaboutplanningyourprojectwiththefinaldelivery
specifications in mind: www.adobe.com/go/learn_ae_aharonplanning.
Mobile devices
Manyoftheconsiderationsforcreatingmoviesforplaybackonmobiledevices,suchasmobilephonesandtheApple
iPod, are similar to those for creating movies for playback on personal computers—but the limitations are even more
extreme. Because the amount of storage (disk space) and processor power are less for mobile phones than for
personal computers, file size and data rate for movies need to be even more tightly controlled.
Use these tips when shooting video for mobile devices:
•Tight shots are better. It’s hard to see a face on a tiny screen unless it’s shot in relative close-up.
•Light your subjects well, and keep them separated from the background; the colors and brightness values between
background and subject should not be too similar.
•Avoid excessive zooming and rolling, which hinder temporal compression schemes.
•Because stable (non-shaky) video is easier to compress, shoot video with a tripod to minimize the shaking of the
camera.
•Avoid using auto-focus and auto-exposure features. When these engage, they change the appearance of all of the
pixels in an image from one frame to the next, making compression using interframe encoding schemes less
efficient.
Use the following tips when working with After Effects:
•Use a lower frame rate (15-22 fps) for mobile devices.
•Use motion-stabilization tools and noise-reduction or blur effects before rendering to final output, to aid the
compressor in reducing file size.
•Match the color palette to the mobile devices that you are targeting. Mobile devices, in general, have a limited color
gamut. Previewing in Adobe Device Central can help determine if the colors used are optimal for an individual
device or range of devices.
•UseFormatOptionspresetsavailablethroughtheoutputmoduleintheRenderQueuepanel.Presetsareavailable
for 3GPP mobile devices, iPod video, and PlayStation Portable.
•Consider using cuts and other fast transitions instead of zooming in and out or using fades and dissolves. Fast cuts
also make compression easier.
Afteryou’verenderedyourmovie,youcanviewitexactlyasitwillappearonanyofalargevarietyofmobiledevices,
using Adobe Device Central.
See also
“Work with composition settings” on page 110
“Work with output module settings” on page 599
“Work with render settings” on page 597
AFTER EFFECTS CS3
User Guide
32
“About compression of movie files” on page 618
“Preview a movie on a virtual mobile device using After Effects” on page 618
Working with Photoshop and After Effects
If you use Photoshop to create still images, you can use After Effects to bring those still images together and make
them move and change. In After Effects, you can animate an entire Photoshop image or any of its layers. You can
even animate individual properties of Photoshop images, such as the properties of a layer style.
If you use After Effects to create movies, you can use Photoshop to refine the individual frames of those movies. You
can remove unwanted visual elements, draw on individual frames, or use the superior selection and masking tools
in Photoshop to divide a frame into elements for animation or compositing.
Comparative advantages for specific tasks
The strengths of After Effects are in its animation and automation features. This means that After Effects excels at
tasks that can be automated from one frame to another. For example, you can use the motion tracking features of
After Effects to track the motion of a microphone boom, and then automatically apply that same motion to the Clone
Stamp tool. In this manner, you can remove the microphone from every frame of a shot, without having to paint the
microphone out by hand on each frame.
In contrast, Photoshop has excellent tools for painting, drawing, and selecting portions of an image. Tracing a
complex shape to create a mask is much easier with the Photoshop Quick Selection tool or Magnetic Lasso tool than
with the masking tools in After Effects. Rather than hand-drawing a mask on each frame in After Effects, consider
doing this work in Photoshop. Similarly, if you are applying several paint strokes by hand to get rid of dust, consider
using the Photoshop paint tools.
Deciding which application to use for painting depends on the task. Paint strokes in Photoshop directly affect the
pixels of the layer. Paint strokes in After Effects are elements of an effect, each of which can be turned on or off or
modified at any time. If the purpose of applying a paint stroke is to permanently modify a still image, use the
Photoshoppainttools.Ifyouwanttohavecompletecontrolofeachpaintstrokeafteryou’veappliedit,orifyouwant
to animate the paint strokes themselves, use the After Effects paint tools.
The animation and video features in Photoshop Extended include simple keyframe-based animation. After Effects
uses a similar interface, though the breadth and flexibility of its animation features are far greater.
After Effects 3D functionality is limited to the manipulation of two-dimensional layers in three dimensions.
Photoshop, however, can manipulate complete 3D models in 3DS and U3D formats, and output two-dimensional
composites and cross-sections of these 3D models from any angle. You can then use these two-dimensional images
in After Effects. After Effects can also automatically create 3D layers to mimic the planes created by the Photoshop
Vanishing Point tool.
Exchanging still images
After Effects can import and export still images in many formats, but you will usually want to use the native
Photoshop PSD format when transferring individual frames or still image sequences between After Effects and
Photoshop.
When importing or exporting a PSD file, After Effects can preserve individual layers, masks, layer styles, and most
other attributes. When you import a PSD file into After Effects, you can choose whether to import it as a flattened
image or with its layers separate and intact.
AFTER EFFECTS CS3
User Guide
33
It is often a good idea to prepare a still image in Photoshop before importing it into After Effects. Examples of such
preparation include correcting color, scaling, and cropping. It is often better for you to do something once to the
source image in Photoshop than to have After Effects perform the same operation many times per second as it
renders each frame for previews or final output.
By creating your new PSD document from the Photoshop New File dialog box with a Film & Video preset, you can
start with a document that is set up correctly for a specific video output type. If you are already working in After
Effects, you can create a new PSD document that matches your composition and project settings by choosing File >
New > Adobe Photoshop File.
Exchanging movies
You can also exchange video files, such as QuickTime movies, between Photoshop and After Effects. When you open
a movie in Photoshop, a video layer is created that refers to the source footage file. Video layers allow you to paint
nondestructively on the movie’s frames, much as After Effects works with layers with movies as their sources. When
yousaveaPSDfilewithavideolayer,youaresavingtheeditsthatyoumadetothevideolayer,noteditstothesource
footage itself.
You can also render a movie directly from Photoshop. For example, you can create a QuickTime movie from
Photoshop that can then be imported into After Effects.
Color
After Effects works internally with colors in an RGB (red, green, blue) color space. Though After Effects can convert
CMYK images to RGB, you should do video work in Photoshop in RGB.
If relevant for your final output, it is better to ensure that the colors in your image are broadcast-safe in Photoshop
before you import the image into After Effects. A good way to do this is to assign the appropriate destination color
space—for example, SDTV (Rec. 601)—to the document in Photoshop. After Effects performs color management
according to color profiles embedded in documents, including imported PSD files.
See also
“Preparing and importing Photoshop files” on page 83
Working with Flash and After Effects
If you use Adobe® Flash® to create video or animation, you can use After Effects® to edit and refine the video. For
example, you can export Flash animations and applications as QuickTime movies or Flash Video (FLV) files. You can
then use After Effects to edit and refine the video.
If you use After Effects to edit and composite video, you can then use Flash to publish that video. You can also export
an After Effects video as Flash content for further editing in Flash.
Exporting QuickTime video from Flash
If you create animations or applications with Flash, you can export them as QuickTime movies using the File >
Export > Export Movie command in Flash. For a Flash animation, you can optimize the video output for animation.
For a Flash application, Flash renders video of the application as it runs, allowing the user to manipulate it. This lets
you capture the branches or states of your application that you want to include in the video file.
AFTER EFFECTS CS3
User Guide
34
Exporting Flash video (FLV) from After Effects
When you render finished video from After Effects, select FLV as the output format in the Render Queue panel to
export directly to the Flash Video (FLV) format. You can specify size, compression, and other output options. Any
After Effects markers are added to the FLV file as cue points.
You can then import the FLV file into Flash and publish it in a SWF file, which can be played by Flash Player.
Importing and publishing video in Flash
When you import a FLV file into Flash, you can use various techniques, such as scripting or Flash components, to
control the visual interface that surrounds your video. For example, you might include playback controls or other
graphics. You can also add graphic layers on top of the FLV file for composite effects.
Composite graphics, animation, and video
Flash and After Effects each include many capabilities that allow you to perform complex compositing of video and
graphics. Which application you choose to use will depend on your personal preferences and the type of final output
you want to create.
Flash is the more web-oriented of the two applications, with its small final file size. Flash also allows for runtime
control of animation. After Effects is oriented towards video and film production, provides a wide range of visual
effects, and is generally used to create video files as final output.
Both applications can be used to create original graphics and animation. Both use a timeline and offer scripting
capabilities for controlling animation programmatically. After Effects includes a larger set of effects, while the Flash
ActionScript™ language is the more robust of the two scripting environments.
Bothapplicationsallowyoutoplacegraphicsonseparatelayersforcompositing.Theselayerscanbeturnedonand
off as needed. Both also allow you to apply effects to the contents of individual layers.
In Flash, composites do not affect the video content directly; they affect only the appearance of the video during
playback in Flash Player. In contrast, when you composite with imported video in After Effects, the video file you
export actually incorporates the composited graphics and effects.
Because all drawing and painting in After Effects is done on layers separate from any imported video, it is always
non-destructive. Flash has both destructive and non-destructive drawing modes.
Exporting After Effects content for use in Flash
You can export After Effects content for use in Flash. You can export a SWF file that can be played immediately in
Flash Player or used as part of another Flash project. When you export content from After Effects in SWF format,
the some of the content may be flattened and rasterized in the SWF file.
Importing Flash SWF files into After Effects
Flash has a unique set of vector art tools that make it useful for a variety of drawing not possible in After Effects or
Adobe Illustrator®. You can import SWF files into After Effects to composite them with other video or render them
as video with additional creative effects. When After Effects imports a SWF file, its internal keyframes are preserved
so that you can continue to use them for timing other effects.
Each SWF file imported into After Effects is flattened into a single continuously rasterized layer, with its alpha
channel preserved. Continuous rasterization means that graphics stay sharp as they are scaled up. This import
method allows you to use the root layer or object of your SWF files as a smoothly rendered element in After Effects,
allowing the best capabilities of each tool to work together.
AFTER EFFECTS CS3
User Guide
35
Working with Adobe Premiere Pro and After Effects
Adobe Premiere® Pro is designed to capture, import, and edit film and video. After Effects is designed to produce
motion graphics and visual effects for film, broadcast television, DVD, and the web. You can easily exchange projects,
compositions, tracks, and layers between After Effects and Adobe Premiere Pro. You can import an Adobe Premiere
Pro project into After Effects, or export an After Effects project as an Adobe Premiere Pro project. You can also
import Adobe Premiere 6.0 and 6.5 projects into After Effects.
You can copy and paste layers and tracks between After Effects and Adobe Premiere Pro. If you have Adobe Creative
Suite® 3 Production Premium, you can use Adobe Dynamic Link to export After Effects compositions into Adobe
Premiere Pro or Adobe Encore without first rendering them, or you can start Adobe Premiere Pro from within After
Effects and capture footage for use in After Effects.
See also
“Copy between After Effects and Adobe Premiere Pro” on page 65
“About Dynamic Link (Production Premium only)” on page 609
“Export an After Effects project to Adobe Premiere Pro” on page 608
Work with Adobe Encore and After Effects
You can use After Effects to quickly create buttons and button layers for importing into Adobe Encore®. Adobe
Encore uses a naming standard to define a button and the role of individual layers as subpicture highlights and video
thumbnails. When you select a group of layers to create as an Adobe Encore button, After Effects precomposes the
layers and names the precomposition according to the naming standards for buttons.
Highlight layer names receive the prefix (=1), (=2), or (=3), and video thumbnail names receive the prefix (%).
After Effects includes template projects that include entire DVD menus for you to use as a basis for your own DVD
menus.TouseAdobeBridgetobrowseandimportthesetemplateprojects,chooseFile>BrowseProjectTemplates.
(See “Work with template projects” on page 23.)
See also
“Create a web link, chapter link, or cue point from a marker” on page 118
Create a button for Adobe Encore
1In the Timeline panel, select the layers to be used in the button.
2Choose Layer > Adobe Encore > Create Button.
3Enter a name for the button.
4Use the menus to assign up to three highlight layers and one video thumbnail layer, and then click OK.
A new composition is created with the button name. In keeping with the Adobe Encore naming standards, the prefix
(+) is added to the name of the composition to indicate that it is a button.
Important: Ifyourenamethebutton,besuretoretainthe(+)prefix.TheprefixensuresthatAdobeEncorerecognizes
the file as a button.
Assign a subpicture highlight and video thumbnail to a layer
1Select the layer.
AFTER EFFECTS CS3
User Guide
36
2Choose Layer > Adobe Encore > Assign To Subpicture [number] or Assign To Video Thumbnail.
Export a button for use in Adobe Encore
1Open the composition that represents the button, and move the current-time indicator to the desired frame.
2Choose Composition > Save Frame As > Photoshop Layers.
Creating an animated GIF movie
An animated GIF file is a sequence of GIF images that plays as a movie. This format is commonly used for small,
short, simple movies that play in web browsers.
To play an animated GIF file, the web browser first loads the entire file into memory and then plays it from memory
(not from disk). To prevent excessive delays before playback begins, and to avoid using too much memory, an
animated GIF should have a short duration and a low frame rate. Frame rates of 5 frames per second (or less) are
recommended, unless the duration is very short (1 second or so).
When you render a movie to the animated GIF format, colors are dithered to an 8-bit palette (256 colors). Before
rendering your final movie, render a test composition so that you can adjust colors if the results are not what you
expect.YoucancreateacolorpaletteinAdobePhotoshopifthedefaultWebSafeorSystemcolorpalettesdon’tgive
the results that you want.
A pixel in an animated GIF file is either completely opaque or completely transparent. When rendering an animated
GIF movie, After Effects must convert the finely-graded alpha channel of the composition to this much simpler type
of transparency. The transition between transparent and opaque areas is abrupt, and may not be desired for more
subtle visual elements.
You render and export a movie as an animated GIF file using the render queue. Animated GIF is one of the formats
available in the Format menu in the Output Module Settings dialog box.
See also
“Basics of rendering and exporting” on page 587
Cross-platform project considerations
After Effects project files are compatible with Mac OS and Windows operating systems, but some factors—mostly
regardingthelocationsandnamingoffootagefilesandsupportfiles—canaffecttheeaseofworkingwiththesame
project across platforms.
File systems
If you want to transfer a project that contains footage stored on a server from Mac OS to Windows, be sure to mount
the server by using AppleShare (AFP). If you mount the volume in Mac OS by using Samba (SMB), After Effects can’t
reestablish links to footage files stored on the server when you open the project on Windows.
Project paths
When you move a project to a different computer and open it, After Effects attempts to locate the project’s footage
files as follows: After Effects first searches the folder in which the project file is located; second, it searches the file’s
original path or folder location; finally, it searches the root of the directory where the project is located.
AFTER EFFECTS CS3
User Guide
37
If you are building cross-platform projects, it’s best if the full paths have the same names on Mac OS and Windows
systems. If the footage and the project are on different volumes, make sure that the appropriate volume is mounted
before opening the project and that network volume names are the same on both systems.
It’s best to store footage in the same folder as the project file or in another folder within that folder. Here’s a sample
hierarchy:
/newproject/project_file.aep
/newproject/source/footage1.psd
/newproject/source/footage2.avi
You can then copy the newproject folder in its entirety across platforms, and After Effects will properly locate all of
the footage.
Note: Use the Collect Files feature to gather copies of all the files in a project into a single folder. You can then move the
folder containing the copied project to the other platform. See “Collect files in one location” on page 594.
File-naming conventions
Name your footage and project files with the appropriate file-name extensions, such as .mov for QuickTime movies
and .aep for After Effects projects. Don’t use high-ASCII or other extended characters in file names to be used cross-
platform.Iffileswillbeusedontheweb,besurethatfilenamesadheretoapplicableconventionsforextensionsand
paths.
Supported file types
Some file types are supported on one platform but not another. See “Supported import formats” on page 48 and
“Supported output formats” on page 588.
Resources
Ensure that all fonts, effects, codecs, and other resources are available on both systems. Such resources are often plug-ins.
If you use a native After Effects effect in a project on one operating system, the effect will still work on the other
operatingsystemtowhichyou’vetransferredyourproject.However,somethird-partyeffectsandotherthird-party
plug-ins may not continue to operate, even if you have versions of these plug-ins on the target system. In such cases,
you may need to reapply some third-party effects.
See also
“About plug-ins” on page 44
“Work with fonts” on page 278
Memory, storage, and performance
Memory usage and storage
Memory requirements for viewing and rendering increase with the resolution of the composition frame, the memory
requirement of the most memory-intensive layer in the composition, and the size of the project file.
AFTER EFFECTS CS3
User Guide
38
After Effects renders each frame of a composition one layer at a time. For this reason, the memory requirement of
each individual layer is more important than the duration of the composition or the number of layers in the compo-
sition. The memory requirement for a composition is equivalent to the memory requirement for the most memory-
intensive single layer in the composition. For example, it generally takes less memory to render 30 layers at NTSC
resolution than 2 layers at motion-picture film resolution.
Note: If the Render Multiple Frames Simultaneously option is selected, each background copy of the After Effects appli-
cation renders one frame at a time.
When a layer includes a composition as a source item, everything in that composition must be rendered before the
next layer is rendered.
The memory requirements of a layer increase under the following circumstances:
•Using a larger source image
•Enabling color management
•Adding a mask
•Adding per-character 3D properties
•Using certain blending modes, layer styles, or effects, especially those involving multiple layers
•Applying certain output options, such as 3:2 pulldown, cropping, and stretching
•Adding shadows or depth-of-field effects
If you have no problems viewing each frame of a full-resolution, best-quality preview of a composition, then you
have enough memory to render the composition. Rendering a composition into a movie takes no more memory than
displaying it on-screen with the same settings.
Occasionally, After Effects may display an alert message indicating that it requires more memory to display or render
a composition. If you receive an out-of-memory alert, free memory or reduce the memory requirements of the most
memory-intensive layers, and then try again.
Free memory immediately with one or more of the commands in the Edit > Purge menu.
After Effects requires a contiguous block of memory to store each frame; it cannot store a frame in pieces in
fragmented memory.
Use the following formula to determine the number of megabytes required to store one uncompressed frame at full
resolution:
(height in pixels) x (width in pixels) x (number of bits per channel) / 2,097,152
Note: The value 2,097,152 is a conversion factor that accounts for the number of bytes per megabyte (220), the number
of bits per byte (8), and the number of channels per pixel (4).
For example, a DV NTSC frame in an 8-bpc project requires 1.3 megabytes, and a D1/DV PAL frame in an 8-bpc
project requires 1.6 megabytes, whereas a 1080i60 DVCPRO HD frame in a 32-bpc project requires 21.1 megabytes.
AFTER EFFECTS CS3
User Guide
39
The operating system imposes certain limits on the amount of memory that an application can use. After Effects on
the Mac OS X operating system can use up to 3.5 GB of RAM, although only about 3GB is actually available to the
foreground application, because Mac OS X uses approximately 500MB to load the user interface libraries. After
Effects on 32-bit Windows operating systems can use up to 3 GB of RAM; however, to use more than 2 GB in After
Effects, you must configure Windows XP or Windows Vista appropriately. (For details, see the Microsoft website or
Jonas Hummelstrand’s website: www.adobe.com/go/learn_ae_jonaswindows3gb.) After Effects on 64-bit Windows
operating systems can use up to 4 GB of RAM with no special configuration.
Note: These numbers are for each After Effects process. The background processes used to render multiple frames simul-
taneously can each use the amount of RAM mentioned above. (See “Render multiple frames simultaneously” on
page 40.)
Because video is typically compressed during encoding when you render to final output, you can’t just multiply the
amount of memory required for a single frame by the frame rate and composition duration to determine the amount
ofdiskspaceneededtostoreyourfinaloutputmovie.However,suchacalculationcangiveyouaroughideaofthe
maximum storage space you might need. For example, one second of uncompressed standard-definition 8-bpc video
requires approximately 40 megabytes (MB). A feature-length movie at that data rate would require more than 200
GB to store. Even with DV compression, which reduces file size to 3.6 MB per second of video, this translates to more
than 20 GB for a typical feature-length movie. It is not unusual for a feature-film project—with its higher color bit
depth and greater frame size—to require terabytes of storage for footage and rendered output movies.
RAM and disk caches
As you work on a composition, After Effects temporarily stores some rendered frames and source images in RAM,
so that previewing and editing can occur more quickly. After Effects does not cache frames that require little time to
render. Frames remain uncompressed in the cache. You can control how After Effects stores images by setting image-
caching preferences.
After Effects also caches at the footage and layer level for faster previews; layers that have been modified are rendered
during the preview, and unmodified layers are displayed from the cache.
Blue bars in the Timeline panel mark frames that are cached to disk. Green bars mark frames that are cached to RAM.
Choose Show Cache Indicators from the Timeline panel menu to turn the cache indicators on and off. Showing the
cache indicactors decreases performance slightly.
Whenthecacheisfull,anynewframeaddedtothecachereplacesaframecachedearlier.WhenAfterEffectsrenders
frames for RAM previews, it stops adding frames to the cache when the cache is full and begins playing only the
frames that could fit in the cache. The disk cache is not used for RAM previews. If disk caching is enabled, After
Effects can store rendered items to your hard disk when the RAM cache is full during standard previews.
The RAM cache and disk cache are automatically purged when you quit After Effects.
To purge the RAM cache and disk cache, choose Edit > Purge > Image Caches.
Memory & Cache preferences
Set memory and caching preferences by choosing Edit > Preferences > Memory & Cache (Windows) or After
Effects > Preferences > Memory & Cache (Mac OS).
For information on the Conformed Media Cache preferences, see “Work with the media cache” on page 67.
Maximum Memory Usage The maximum amount of memory that After Effects can use to render a single frame.
This preference is only relevant during rendering, either for previews or for final output. When After Effects is not
AFTER EFFECTS CS3
User Guide
40
rendering a frame, memory usage drops back down to, at most, the amount set by the Maximum RAM Cache Size
preference.
You can specify values over 100% (where 100% equals the amount of physical RAM you have installed) because
virtual memory uses hard-disk space. Values over 200% are not recommended. The default value is 120%.
Maximum RAM Cache Size The maximum amount of memory that After Effects will use when not rendering a
frame. This memory includes image caches, the application itself, memory reserved for GPU acceleration, and so on.
This setting determines the amount of memory available for (and therefore the duration of) RAM previews.
If you set this value to greater than the default value of 60%, you may encounter problems such as decreased perfor-
mance when switching from one application to another or increased frequency of errors that say that After Effects
is unable to create an image buffer. Like a hard disk, your address space can become fragmented; if you have
Maximum RAM Cache Size set too high, the memory may become too fragmented to store the next rendered frame.
By lowering the cache percentage, you reduce the chance of fragmentation. Set this value above 60% only if necessary.
You should not set this value above 90%.
When you have enabled multiprocessing, the amount of RAM available to background processes is affected by the
amount of RAM reserved for the foreground process. Decreasing Maximum RAM Cache Size can free memory for
background processes. (See “Render multiple frames simultaneously” on page 40.)
Enable Disk Cache Moves rendered frames to your hard disk when the RAM cache is full. After Effects will only use
the disk cache to store a frame if it’s faster to retrieve a frame from the cache than to re-render the frame. Select a
folder to contain your cache, and click OK (Windows) or Choose (Mac OS). For the best performance, select a folder
that’s on a different physical hard disk than your source footage. If possible, the folder should be on a hard disk that
uses a different drive controller than the disk that contains your source footage. The disk cache folder can’t be the
hard disk’s root folder.
Maximum Disk Cache Size Specifies the number of megabytes of hard disk space to use. This should be at least 2
gigabytes (GB).
Prevent DLL Address Space Fragmentation (Windows only) Select this option to give After Effects access to more
contiguous memory on a computer with a large amount of RAM. This option may be incompatible with some
OpenGL drivers, which can cause a crash when the application starts. If such a crash occurs, the option will become
unchecked automatically to prevent further crashes when you start After Effects.
For information on working with large images and avoiding the error message that says that After Effects ”could not
create image buffer”, see Jonas Hummelstrand’s website: www.adobe.com/go/learn_ae_jonasimagebuffererror.
Render multiple frames simultaneously
After Effects can start additional processes of the After Effects application to run in the background to assist the main
application with the rendering of frames for RAM previews or final output. These background processes have the
name AfterFX.exe (Windows) or aeselflink (Mac OS).
Each background process renders its own frame and runs on a separate processor core (CPU). The number of
processes used to render multiple frames simultaneously is never more than the number of processors. The number
of background processes that can run on your computer also depends on the total amount of system RAM and the
amount of RAM that is assigned to the main application (Maximum RAM Cache Size). The amount of RAM
required for each background process varies depending on your system configuration; at least 1GB per process is
recommended.
Note: You can check the current value for Maximum RAM Cache Size by choosing Edit > Preferences > Memory &
Cache (Windows) or After Effects > Preferences > Memory & Cache (Mac OS).
AFTER EFFECTS CS3
User Guide
41
Ifbackgroundprocessesareusedforrendering,thenthemainforegroundapplicationisnotalsousedforrendering.
Thismeansthatcreatingbackgroundprocessesonlyaddstothetotalnumberofprocessesusedforrenderingifthere
are enough resources for at least two background processes to run.
1Choose Edit > Preferences > Multiprocessing (Windows) or After Effects > Preferences > Multiprocessing (Mac OS).
2Select Render Multiple Frames Simultaneously.
The bottom of the Preferences dialog box shows how many additional processors (in addition to the worst-case
scenario of one processor) will be used at the current settings. To increase the number of background processes that
can run, decrease Maximum RAM Cache Size or install more RAM.
Selecting the Render Multiple Frames Simultaneously option does not immediately start the background processes.
The background processes start when the first render operation (for a RAM preview or for final output) is initiated
after the option is selected. The background processes continue running until the option is deselected.
Important: You may experience a small delay when the background processes start for the first time, when the first
render operation occurs. A message in the Info panel indicates when the background processes are initializing.
Deselecting Render Multiple Frame Simultaneously stops the background processes; reselecting the option causes the
same delay when the next render operation begins.
Because antivirus software operates by monitoring every read and write operation, such software can decrease
rendering speed, especially with the Render Multiple Frames Simultaneously preference selected.
If the rendering of a single frame requires more RAM than is available to the individual background processes, then
After Effects will not render multiple frames simultaneously and will instead use only the main foreground process
to render all frames for that composition. If After Effects can’t use background processes to render multiple frames
simultaneously, a message appears in the Info panel.
Note: After Effects can also use multiple processes to accelerate rendering of a single frame. This form of multiprocessing
can take advantage of hyper-threading. The number of CPUs that After Effects reports in the Multiprocessing Preferences
dialog box for accelerating rendering within a single frame counts the virtual (logical) CPUs available due to hyper-
threading.
Improve performance
You can improve performance by optimizing your computer system, After Effects, your project, and your workflow.
GridIron Software provides Nucleo Pro 2, which improves rendering performance in After Effects in several ways:
www.adobe.com/go/learn_ae_gridironnucleopro.
Improve performance before starting After Effects
•Make sure that you’ve installed the current version of After Effects, including any available updates. For more
information about updates, visit the Adobe website at www.adobe.com/go/downloads.
•Make sure that you’ve installed the latest versions of drivers and plug-ins, especially video card drivers. To
download updates for drivers and plug-ins, visit the provider’s website.
•Quit applications that are not necessary for your work. This may include some applications that start automatically
when the operating system starts.
•Make sure that your system includes a display card that supports OpenGL 2.0 or later (Windows) or OpenGL 1.5
or later (Mac OS). Though After Effects can function without it, OpenGL accelerates various types of rendering,
including rendering to the screen for previews. See “Render with OpenGL” on page 593.
AFTER EFFECTS CS3
User Guide
42
•Adjust the size of the virtual memory paging file (Windows only). Virtual memory enables the system to use hard-
disk space to store information normally stored in RAM. Windows manages virtual memory using a paging file.
To improve performance in After Effects, adjust the size of the paging file to a maximum of twice the amount of
installed RAM—the default in Windows XP. (See Windows Help.)
•Defragment all hard disks regularly. See the documentation for your operating system for details.
•Make sure that your system has enough RAM. See the documentation for your operating system and computer
for details on how to check the amount of installed RAM and how to install RAM.
•Stop or pause resource-intensive operations in other applications, such as video previews in Adobe Bridge.
Improve performance by optimizing memory, cache, and multiprocessing settings
•Usemultipleprocessorstorendermultipleframessimultaneously by selecting the Render Multiple Frames Simul-
taneously preference. See “Render multiple frames simultaneously” on page 40.
•Enable caching frames to disk by selecting the Enable Disk Cache preference.
•Set the Maximum RAM Cache Size preference to an optimum value. See “Memory & Cache preferences” on
page 39.
•Purge RAM and disk caches (choose Edit > Purge > Image Caches).
Improve performance by simplifying your project
By simplifying and dividing your project, you can prevent After Effects from using memory and other resources to
process elements that you are not currently working with. Also, by controlling when After Effects performs certain
processing, you can greatly improve overall performance. For example, you can avoid repeating an action that needs
to happen only once, or you can postpone an action until it is more convenient for you.
•Delete unused elements from your project. See “Remove items from a project” on page 60.
•Divide complex projects into simpler projects, and then recombine them before you render the finished movie. To
recombine projects, import all of the projects into a single project by choosing File > Import > File.
•Before rendering, put all of your source footage files on a local disk—not the one that the application runs from.
A good way to do this is with the Collect Files command. See “Collect files in one location” on page 594.
•Prerender nested compositions. Render a completed composition as a movie so that After Effects doesn’t rerender
the composition every time it is displayed. See “Pre-render a nested composition” on page 114.
•Restrict the influence of layer switches by choosing Edit > Preferences > General (Windows) or After Effects >
Preferences > General (Mac OS), and deselecting Switches Affect Nested Comps. (Remember to select this option
again before you render the composition for final output.)
•Collapse transformations for nested compositions. See “Render order and collapsing transformations” on
page 115.
•Substitute a low-resolution or still-image proxy for a source item when not working directly with that item. See
“Work with placeholders and proxies” on page 61.
•Lower the composition’s resolution. See “Resolution” on page 128.
Note: To increase the rendering speed of RAM previews, set the resolution of the Composition panel to match the magni-
fication. For example, if the magnification is 50%, choose Half from the Resolution menu.
•Isolate the layer you’re working on by using the Solo switch. See “Solo a layer” on page 149.
AFTER EFFECTS CS3
User Guide
43
•Deselect the Continuously Rasterize switch for a vector layer until you need to view or render it in detail. This
prevents After Effects from rasterizing the entire layer after each change. See “Continuously rasterize a layer
containing vector graphics” on page 151.
Improve performance by modifying screen output
You can improve performance in many ways that don’t affect how After Effects treats your project data, only how
output is drawn to the screen as you work. Although it is often useful to see certain items and information as you
work, After Effects uses memory and processor resources to update this information, so be selective in what you
choose to display as you work. You will likely need to see different aspects of your project at different points in your
workflow, so you may apply the following suggestions in various combinations at various stages.
•Turn off display color management and output simulation when not needed. See “Simulate how colors will appear
on a different output device” on page 248.
•Enable hardware acceleration of previews, which uses the GPU to assist in drawing previews to the screen. Choose
Edit > Preferences > Display (Windows) or After Effects > Preferences > Display (Mac OS), and select Hardware
Accelerate Composition, Layer, And Footage Panels.
•Close unneeded panels. After Effects must use memory and processor resources to update open panels, which
may slow the work that you are doing in another panel.
•Create a region of interest. If you are working on a small part of your composition, limit which portion of the
composition is rendered to the screen during previews. See “Work with the region of interest” on page 111.
•Deselect Show Cache Indicators in the Timeline panel menu to prevent After Effects from displaying green and
blue bars in the time ruler to indicate cached frames.
•Deselect the Show Rendering Progress In Info Panel & Flowchart preference (in Display preferences) to prevent
the details of each render operation for each frame from being written to the screen.
•Hide Current Render Details in the Render Queue panel by clicking the triangle beside Current Render Details in
the Render Queue panel.
•Press the Caps Lock key to prevent After Effects from updating Footage, Layer, or Composition panels. When you
make a change that would otherwise appear in a panel, After Effects adds a red bar with a text reminder at the
bottom of the panel. After Effects continues to update panel controls such as motion paths, anchor points, and
mask outlines as you move them. To resume panel updates and display all changes, press Caps Lock again.
Note: Pressing the Caps Lock key suspends updates (disables refresh) of previews in viewers during rendering for final
output, too, although no red reminder bar appears.
•Lower a layer’s display quality to Draft or Wireframe. See “Layer image quality” on page 150.
•Select Draft 3D in the Timeline panel menu, which disables all lights and shadows that fall on 3D layers. It also
disables the camera’s depth-of-field blur.
•Deselect Live Update in the Timeline panel menu to prevent After Effects from updating compositions dynami-
cally.
•Display audio waveforms in the Timeline panel only when necessary.
•Disable pixel aspect ratio correction by clicking the Toggle Pixel Aspect Ratio Correction button at the bottom
of a Composition, Layer, or Footage panel.
•Deselect Mirror On Computer Monitor when previewing video on an external video monitor. See “Preview on an
external video monitor” on page 126.
•Hide layer controls, such as masks, 3D reference axes, and layer handles. See “Show or hide layer controls in the
Composition panel” on page 127.
AFTER EFFECTS CS3
User Guide
44
•Lowerthecomposition’smagnification.WhenAfterEffectsdisplaystheComposition,Layer,andFootagepanels
at magnifications of 100% or greater, screen redraw speed decreases.
Improve performance when using effects
Some effects, such as blurs and distortions, require large amounts of memory and processor resources. By being
selective about when and how you apply these effects, you can greatly improve overall performance.
•Apply memory-intensive and processor-intensive effects later. Animate your layers and do other work that
requires real-time previews before you apply memory-intensive or processor-intensive effects (such as glows and
blurs), which may make previews slower than real time.
•Temporarily turn off effects to increase the speed of previews. See “Delete or disable effects and animation presets”
on page 352.
•Limit the number of particles generated by the Particle Playground effect.
•Choose Stiff Elasticity for the Mesh Warp, Reshape, and Smear effects in the Distort effects category.
•Turn off linear blending. See “Linearize working space and enable linear blending” on page 244.
Plug-ins and scripts
About plug-ins
Plug-ins are small software modules—with file-name extensions such as .aex and .8bi—that add functionality to an
application. After Effects effects are implemented as plug-ins, as are some features for working with certain file
formats. The Photoshop Camera Raw plug-in, for example, provides After Effects with its ability to work with
camera raw files.
When After Effects starts, it loads plug-ins from the Plug-ins folder, which is in the Adobe After Effects CS3\Support
Files (Windows) or Adobe After Effects CS3 (Mac OS) folder by default. Several plug-ins come with After Effects
and are automatically installed in this folder. You can obtain other plug-ins for After Effects and other Adobe
products from Adobe or other vendors. For specific instructions for installing a plug-in, refer to its documentation.
Note: (Mac OS) Some third-party plug-in installers incorrectly install their plug-ins into the Mac OS X Package for After
Effects. To reveal these plug-ins, Control-click the After Effects application icon in the Finder and choose Show Package
Contents. You can then move the plug-ins into the After Effects Plug-ins folder.
After Effects comes with several third-party plug-ins, including Foundry Keylight, Synthetic Aperture Color Finesse,
and the Cycore FX plug-ins. Some plug-in installers—including those for Keylight and Color Finesse—install
documentation for the plug-ins in their subfolders in the Plug-ins folder. Documentation for Cycore FX plug-ins is
available on the Cycore website: www.adobe.com/go/learn_ae_cycorefxdocumentation.
When exchanging After Effects projects between computer systems, make sure that the plug-ins that the project
depends on are installed on both systems.
For information on plug-ins available for After Effects, visit the Adobe website at
www.adobe.com/go/learn_ae_plugins. Other resources for purchasing and learning to use plug-ins for After Effects
includetheToolfarmwebsite(www.adobe.com/go/learn_ae_toolfarmhome) and Lutz Albrecht’s Mylenium website
(www.adobe.com/go/learn_ae_lutzplugins).
For information on developing plug-ins for After Effects, visit the Adobe website at
www.adobe.com/go/learn_ae_devcenter.
AFTER EFFECTS CS3
User Guide
45
Plug-ins compiled for the Macintosh PowerPC processor architecture do not run natively on Macintosh computers
that use Intel processors. To use plug-ins compiled for the PowerPC processor architecture, you can run After Effects
CS3 under Rosetta. Rosetta is a software translator for Mac OS X that runs applications for PowerPC processors on
Intel processors. As with any application running in an emulation environment, performance is not as good as it
would be in the native environment.
See also
“Introduction to Camera Raw” on page 86
“About effects” on page 348
Work with scripts
Ascript is a series of commands that tells an application to perform a series of operations. You can use scripts in most
Adobe applications to automate repetitive tasks, perform complex calculations, and even access some functionality
not directly exposed through the graphical user interface. For example, you can direct After Effects to reorder the
layers in a composition, find and replace source text in text layers, or send an e-mail message when rendering is
complete.
After Effects scripts use the Adobe ExtendScript language, which is an extended form of JavaScript, similar to
ActionScript. ExtendScript files have the .jsx file-name extension.
When After Effects starts, it searches the Scripts folder for scripts to load. Loaded scripts are available from the File >
Scripts menu. If you edit a script while After Effects is running, you must save your changes for the changes to be
applied. If you place a script in the Scripts folder while After Effects is running, you must restart After Effects for the
script to appear in the Scripts menu, though you can immediately run the new script using the Run Script File
command.
After Effects provides several prewritten scripts to assist you in performing common tasks, and to provide a basis for
you to modify and create your own scripts.
Run the sample script DemoPalette.jsx to get an idea of what sorts of things you can do with scripts. For example,
the Reverse Layer Order script makes reversing the stacking order of layers in the Timeline panel much easier than
reordering the layers manually.
You can write your own scripts for use in After Effects by using the script editor, which is part of the ExtendScript
Toolkit. The ExtendScript Toolkit provides a convenient interface for creating, debugging, and testing your own
scripts.
Note: Scripts created in After Effects 6.5 or earlier that use an index to access a property may not work as expected in
After Effects 7 or later. To resolve this issue, modify your scripts so that they contain equivalent expressions accessing
properties by name.
Thedefaultisforscriptstonotbeallowedtowritefilesorsendorreceivecommunicationoveranetwork.Toallow
scripts to write files and communicate over a network, choose Edit > Preferences > General (Windows) or After
Effects > Preferences > General (Mac OS), and select the Allow Scripts To Write Files And Access Network option.
•To run a loaded script, choose File > Scripts > [script name]
•To run a script that has not been loaded, choose File > Scripts > Run Script File, locate and select a script, and click
Open.
•To start the script editor, choose File > Scripts > Open Script Editor.
AFTER EFFECTS CS3
User Guide
46
For a complete description of the scripting capabilities available with After Effects, see the After Effects Scripting
Guide on the Adobe website at www.adobe.com/devnet/aftereffects.
To exchange scripts and other useful tools with other After Effects users, visit the After Effects Exchange on the
Adobe website at www.adobe.com/go/learn_ae_exchange.
Jeff Almasol provides a collection of useful scripts on his website: www.adobe.com/go/learn_ae_redefineryhome.
Dan Ebberts provides scripting tutorials and useful scripts on his website:
www.adobe.com/go/learn_ae_danscripting.
The AE Enhancers forum provides example scripts and useful information about scripting (as well as expressions
and animation presets) in After Effects: www.adobe.com/go/learn_ae_aeenhancershome.
This tutorial on the AE Enhancers forum leads the reader step by step through the creation of a script:
www.adobe.com/go/learn_ae_aeenhancersgettingstarted.
47
Chapter 4: Importing
Importing and interpreting footage items
Working with imported files
You import footage items into a project and use them as sources for layers. You work with collections of layers in a
composition to animate, composite, and apply effects. You can import many different kinds of files, collections of
files, or components of files as sources for individual footage items, including moving image files, still-image files,
still-image sequences, and audio files. You can even create footage items yourself within After Effects, such as solids
and precompositions. You can import footage items into a project at any time.
When you import files, After Effects does not copy the image data itself into your project but creates a reference link
to the footage item in the Project panel. This keeps project files relatively small.
If you delete, rename, or move an imported source file, you break the reference link to that file. When a link is broken,
the name of the source file appears in italics in the Project panel, and the File Path column lists it as missing. If the
footage item is available, you can reestablish the link—usually just by double-clicking the item and selecting the file
again.
To reduce rendering time and increase performance, it is often best to prepare footage before you import it into After
Effects. For example, it is often better to scale or crop a still image in Photoshop before you bring it into After Effects,
rather than scaling and cropping the image in After Effects. It is better to perform an operation once in Photoshop
than to force After Effects to perform the same action many times per second—once for each frame in which the
image appears.
You can use the Footage panel to evaluate footage and perform simple editing tasks, such as trimming a footage item’s
duration.
To save time and minimize the size and complexity of a project, import a footage item once and then use it multiple
times in a composition. It is occasionally useful, however, to import a footage item more than once, such as when
you want to use it at two different frame rates.
If you use another application to modify a footage item that is used in a project, the changes appear in After Effects
the next time that you open the project or select the footage item and choose File > Reload Footage.
To replace a layer’s source footage item with another footage item, without affecting edits made to the layer
properties, select the layer and then Alt-drag (Windows) or Option-drag (Mac OS) the new footage item onto the
layer in the Timeline panel.
For introductions to digital video, digital audio, high-definition video, DVD, compression, and streaming video, visit
the Adobe website at www.adobe.com/go/learn_dv_primers.
See also
“Create layers from footage items” on page 135
“Shortcuts for working with footage” on page 644
AFTER EFFECTS CS3
User Guide
48
Supported import formats
Some file-name extensions—such as MOV and AVI—denote container file formats rather than denoting a specific
audio, video, or image data format. Container files can contain data encoded using various compression and
encoding schemes. After Effects can import these container files, but the ability to import the data that they contain
is dependent on which codecs (specifically, decoders) are installed.
By installing additional codecs, you can extend the ability of After Effects to import additional file types. Most codecs
must be installed into the operating system (Windows or Mac OS) and work as a component inside the QuickTime
or Video for Windows formats. Contact the manufacturer of your hardware or software for more information about
codecs that work with the files that your specific devices or applications create.
The Automatic Duck Pro Import AE tool extends your ability to import assets in various formats, including those
used by popular non-linear editing systems. For more information, see the Automatic Duck website:
www.adobe.com/go/learn_ae_automaticduckpiae.
Audio formats
•Advanced Audio Coding (AAC, M4A)
•Audio Interchange File Format (AIF, AIFF)
•MP3 (MP3, MPEG, MPG, MPA, MPE)
•Video for Windows (AVI, WAV; requires QuickTime on Mac OS)
•Waveform (WAV)
Still-image formats
•Adobe Illustrator (AI, AI4, AI5, EPS, PS; continuously rasterized)
•Adobe PDF (PDF; first page only; continuously rasterized)
•Adobe Photoshop (PSD)
•Bitmap (BMP, RLE, DIB)
•Camera raw (TIF, CRW, NEF, RAF, ORF, MRW, DCR, MOS, RAW, PEF, SRF, DNG, X3F, CR2, ERF)
•Cineon (CIN, DPX; converts to project’s color bit depth: 8, 16, or 32 bpc)
•Discreet RLA/RPF (RLA, RPF; 16 bpc, imports camera data)
•EPS
•GIF
•JPEG (JPG, JPE)
•Maya camera data (MA)
•Maya IFF (IFF, TDI; 16 bpc)
•OpenEXR (EXR; 32 bpc)
Note: Plug-ins from fnord software provide access to multiple layers and channels of OpenEXR files:
www.adobe.com/go/learn_ae_fnordproexr.
•PCX
•PICT (PCT)
•Pixar (PXR)
•Portable Network Graphics (PNG; 16 bpc)
AFTER EFFECTS CS3
User Guide
49
•Radiance (HDR, RGBE, XYZE; 32 bpc)
•SGI (SGI, BW, RGB; 16 bpc)
•Softimage (PIC)
•Targa (TGA, VDA, ICB, VST)
•TIFF (TIF)
You can import files of any still-image format as a sequence. See “Importing still images” on page 80.
Video and animation formats
•Animated GIF (GIF)
•DV (in MOV or AVI container, or as containerless DV stream)
•ElectricImage (IMG, EI)
•Filmstrip (FLM)
•Flash (SWF; continuously rasterized)
Note: SWF files are imported with an alpha channel. Interactive content and scripted animation are not retained.
Animation defined by keyframes is retained.
•Media eXchange Format (MXF; Op-Atom variety used by Panasonic DV, DVCPRO, DVCPRO50, and DVCPRO
HD video cameras to record to Panasonic P2 media)
•MPEG-1, MPEG-2, and MPEG-4 formats (MPEG, MPE, MPG, M2V, MPA, MP2, M2A, MPV, M2P, M2T, AC3,
MP4, M4V, M4A)
Note: Some MPEG data formats are stored in container formats with file-name extensions that are not recognized by
After Effects; examples include .vob and .mod. In some cases, you can import these files into After Effects after changing
the file-name extension to one of the recognized file-name extensions. Due to variations in implementation in these
container formats, compatibility is not guaranteed.
•Open Media Framework (OMF; raw media [or essence] only; Windows only)
•QuickTime (MOV; 16 bpc, requires QuickTime)
•Adobe Photoshop with video layer (PSD; requires QuickTime)
•Video for Windows (AVI, WAV; requires QuickTime on Mac OS)
You can import 10-bpc uncompressed YUV AVI files created in Adobe Premiere Pro into 16-bpc RGB After Effects
projects. You can also render with 10-bpc YUV compression. (See “Specify Video for Windows compression options”
on page 620.)
•Windows Media File (WMV, WMA, ASF; Windows only)
Project formats
•Advanced Authoring Format (AAF; Windows only)
•Adobe Premiere 6.0 and 6.5 (PPJ)
•Adobe Premiere Pro 1.0, 1.5, 2.0, CS3 (PRPROJ; 1.0, 1.5, and 2.0 Windows only)
•Adobe After Effects 4.0 and later (AEP, AET)
•XML Forms Data Format (XFDF; for importing of Clip Notes comments)
AFTER EFFECTS CS3
User Guide
50
For information on importing Apple Motion projects into After Effects, see the Apple website:
www.adobe.com/go/learn_ae_importmotionprojects.
See also
“Supported output formats” on page 588
“Import assets in Panasonic P2 format” on page 73
Import footage items
You can import media files into your project either by using the Import dialog box or by dragging. If the Interpret
Footage dialog box appears after you import a footage item, it contains an unlabeled alpha channel, and you must
select an alpha channel interpretation method or click Guess to let After Effects determine how to interpret the alpha
channel.
Imported footage items appear in the Project panel.
See also
“Specify alpha channel interpretation” on page 52
“Import a single still image or a still-image sequence” on page 81
“Shortcuts for working with footage” on page 644
Import footage items using the Import dialog box
1Choose File > Import > File or File > Import > Multiple Files, or double-click an empty area of the Project panel.
IfyouchooseImportMultipleFiles,thenyoucanperformthenextstepmorethanoncewithoutneedingtochoose
an Import command multiple times.
To display only supported footage files (excluding project files), choose All Footage Files from the Files Of Type
(Windows) or Enable (Mac OS) menu.
2Do one of the following:
•Select a file, and then click Open.
•Ctrl-click (Windows) or Command-click (Mac OS) multiple files to select them, and then click Open.
•Click a file and then Shift-click another file to select a range of files, and then click Open.
•Select an entire folder, and then click Import Folder.
Note: If the Sequence option is selected, multiple files from the folder will be imported as a sequence of still images.
Import footage items by dragging
If you always want the layered footage that you drag into After Effects to be imported as a composition, choose Edit
> Preferences > Import (Windows) or After Effects > Preferences > Import (Mac OS), and choose Comp from the
Default Drag Import As menu.
•To import the contents of a folder as a sequence of still images that appear in the Project panel as a single footage
item, drag a file or a folder from Windows Explorer (Windows) or the Finder (Mac OS) into the Project panel.
•To import the contents of the folder as individual footage items that appear in the Project panel in a folder, Alt-
drag a folder from Windows Explorer (Windows) or Option-drag a folder from the Finder (Mac OS) into the
Project panel.
AFTER EFFECTS CS3
User Guide
51
Interpret footage items
After Effects uses a set of internal rules to interpret each footage item that you import according to its best guess for
thesourcefile’spixelaspectratio,framerate,colorprofile,andalphachanneltype.IfAfterEffectsguesseswrong,or
if you want to use the footage differently, you can modify these rules for all footage items of a particular kind by
editing the interpretation rules file (interpretation rules.txt), or you can modify the interpretation of a specific
footage item using the Interpret Footage dialog box.
The interpretation settings tell After Effects the following about each footage item:
•How to interpret the alpha channel’s interaction with other channels. (See “Specify alpha channel interpretation”
on page 52.)
•What frame rate to assume for the footage item. (See “Change frame rate” on page 53.)
•Whether to separate fields and, if so, what field order to assume. (See “Separate video fields” on page 71 and
“Determine the original field order” on page 72.)
•Whether to remove 3:2 or 24Pa pulldown. (See “Remove 3:2 or 24Pa pulldown from video” on page 72.)
•The pixel aspect ratio of the footage item. (See “Change pixel aspect ratio” on page 55.)
•The color profile of the footage item. (See “Interpret a footage item by assigning an input color profile” on
page 245.)
Important: In all of these cases, the information is used to make decisions about how to interpret data in the imported
footageitem.TheinterpretationsettingsintheInterpretFootagedialogboxshouldmatchthesettingsusedtocreatethe
source footage file. These settings are not to be used to specify settings for your final rendered output.
Generally, you don’t need to change interpretation settings. However, if a footage item isn’t of a common kind, After
Effects may need additional information from you to interpret it correctly.
You can use the controls in the Color Management section of the Interpret Footage dialog box to tell After Effects
how to interpret the color information in a footage item. This is usually only necessary when the footage item does
not contain an embedded color profile.
See also
“Shortcuts for working with footage” on page 644
Interpret a single footage item using the Interpret Footage dialog box
❖Select a footage item in the Project panel and choose File > Interpret Footage > Main.
Apply Interpret Footage settings to multiple footage items
You can ensure that different footage items use the same settings by copying interpretation settings from one item
and applying them to others.
1In the Project panel, select the item with the interpretation settings that you want to apply.
2Choose File > Interpret Footage > Remember Interpretation.
3Select one or more footage items in the Project panel.
4Choose File > Interpret Footage > Apply Interpretation.
AFTER EFFECTS CS3
User Guide
52
Edit interpretation rules for all items of a specific kind
The interpretation rules file contains the rules that specify how After Effects interprets footage items. In most cases,
you won’t need to customize the interpretation rules file. When you import a footage item, After Effects looks for a
match in the interpretation rules file, and then determines interpretation settings for the footage item. You can
override these settings after importing, using the Interpret Footage dialog box.
In most cases, the name of the interpretation rules file is interpretation rules.txt; however, some updates to After
Effects install a new interpretation rules file with a name that indicates the updated version number, and the updated
application uses this new file. If you have made changes to the old interpretation rules file, you may need to apply
those changes to the new file, too.
1Quit After Effects.
2As a precaution, make a backup copy of the interpretation rules file. By default, this file is in the same location as
the After Effects application.
3Open the interpretation rules file in a text editor.
4Modify the settings according to the instructions in the file.
Note: Youmustsupplyafour-characterfile-typecodeforeachfootagetypeorcodec.Ifyoudon’tknowthecodeforafile
or codec in a project, press Alt (Windows) or Option (Mac OS) as you select the file in the Project panel. The file-type
code and codec code (if the file is compressed) appear in the lastlineofthefiledescriptionatthetopoftheProjectpanel.
5Save interpretation rules.txt in the same folder as the After Effects application.
Specify alpha channel interpretation
Alpha channels store transparency information in one of two ways: straight or premultiplied. Although the alpha
channels are the same, the color channels differ. Straight (unmatted) channels store transparency information only
in the alpha channel, not in any of the visible color channels. Premultiplied (matted) channels store transparency
information in the alpha channel and also in the visible RGB channels, which are multiplied with a background color.
The colors of semitransparent areas, such as feathered mask edges, are shifted toward the background color in
proportion to their degree of transparency.
Setting the alpha channel interpretation correctly can prevent problems when you import a file, such as undesirable
colors at the edge of an image or a loss of image quality at the edges of the alpha channel. For example, if channels
are interpreted as straight when they are actually premultiplied, semitransparent areas will retain some of the
background color. If a color inaccuracy, such as a halo, appears along the semitransparent edges in a composition,
try changing the interpretation method.
AFTER EFFECTS CS3
User Guide
53
A footage item with premultiplied channels (top) appears with a black halo when interpreted as Straight-Unmatted (bottom left). When the
footage item is interpreted as Premultiplied-Matted With Color and the background color is specified as black, the halo does not appear (bottom
right).
See also
“About straight and premultiplied channels” on page 253
Set the alpha channel interpretation for a footage item
1In the Project panel, select a footage item.
2Choose File > Interpret Footage > Main.
3If you want to switch the opaque and transparent areas of the image, select Invert Alpha.
4In the Alpha section, select an interpretation method:
Guess Attempts to determine the type of channels used in the image. If After Effects cannot guess confidently, it
beeps.
Ignore Disregards transparency information contained in alpha channel.
Straight - Unmatted Interprets the channels as straight.
Premultiplied - Matted With Color Interprets channels as premultiplied. Use the eyedropper or color picker to
specify the color of the background with which the channels were premultiplied.
Set the default alpha channel preferences
1Choose Edit > Preferences > Import (Windows) or After Effects > Preferences > Import (Mac OS).
2Choose options from the Interpret Unlabeled Alpha As menu. The options in this menu are similar to the options
in the Interpret Footage dialog box. Ask User specifies that the Interpret Footage dialog box opens each time a
footage item with an unlabeled alpha channel is imported.
Change frame rate
The composition frame rate determines the number of frames displayed per second, and how time is divided into
frames in the time ruler and time display. Composition frame rate is usually determined by the type of output that
you are targeting. NTSC video has a frame rate of 29.97 frames per second (fps), PAL video has a frame rate of 25
fps, and motion picture film typically has a frame rate of 24 fps. Depending on the broadcast system, DVD video can
have the same frame rate as NTSC video or PAL video, or a frame rate of 23.976. Cartoons and video intended for
CD-ROM or the web are often 10 to 15 fps.
AFTER EFFECTS CS3
User Guide
54
Setting the composition frame rate to twice the rate of the output format causes After Effects to display each field of
interlaced source footage as its own, separate frame in the Composition panel. This process lets you set keyframes on
individual fields and gain precision when animating masks.
When you render a movie for final output, you can choose to use the composition frame rate or another frame rate.
This is useful when you are using the same composition to create output for multiple media.
Each motion-footage item in a composition can also have its own frame rate. The relationship between the footage-
item frame rate and the composition frame rate determines how smoothly the layer plays. For example, if the
footage-item frame rate is 30 fps and the composition frame rate is 30 fps, then whenever the composition advances
one frame, the next frame from the footage item is displayed. If the footage-item frame rate is 15 fps and the compo-
sitionframerateis30fps,theneachframeofthefootageitemappearsintwosuccessiveframesofthecomposition.
(This assumes, of course, the simple case in which no time stretching or frame blending has been applied to the
layer.)
Ideally, use source footage that matches the final output frame rate. This way, After Effects renders each frame, and
thefinaloutputdoesnotomitorduplicateframes.If,however,thesourcefootagehasaframerateslightlydifferent
from what you want to output to (for example, 30-fps footage and 29.97-fps final output), you can make the footage
frame rate match the composition frame rate by conforming it.
Conforming the frame rate of a footage item does not alter the original file, only the reference that After Effects uses.
When conforming, After Effects changes the internal duration of frames but not the frame content. Afterward, the
footage plays back at a different speed. For example, if you conform the frame rate from 15 fps to 30 fps, the footage
plays back twice as fast. In most cases, conform the frame rate only when the difference between the footage frame
rate and the output frame rate is small.
Note: Conforming can change the synchronization of visual footage that has an audio track, because changing the frame
rate changes the duration of the video but leaves the audio unchanged. If you want to stretch both audio and video, use
the Time Stretch command. (See “Time-stretch a layer” on page 218.) Keyframes applied to the source footage remain at
their original locations (which retains their synchronization within the composition but not the visual content of the
layer). You may need to adjust keyframe locations after conforming a footage item.
You can change the frame rate for any movie or sequence of still images. For example, you can import a sequence of
ten still images and specify a frame rate for that footage item of 5 frames per second (fps); this sequence would then
have a duration of two seconds when used in a composition.
Note: If you remove 3:2 pulldown from interlaced video footage, After Effects automatically sets the frame rate of the
resulting footage item to four-fifths of the original frame rate. When removing 3:2 pulldown from NTSC video, the
resulting frame rate is 24 fps.
The composition’s frame rate should match that of the final output format. In most cases, you can simply choose a
composition settings preset. In contrast, set the frame rate for each footage item to that of the original source footage.
See also
“Work with render settings” on page 597
“Converting movies” on page 630
Change frame rate for a footage item
1Select the footage item in the Project panel.
2Choose File > Interpret Footage > Main.
3Select Conform To Frame Rate, enter a new frame rate for Frames Per Second, and then click OK.
AFTER EFFECTS CS3
User Guide
55
Change frame rate for a composition
1Choose Composition > Composition Settings.
2Do one of the following:
•Choose a composition settings preset from the Preset menu.
•Set the Frame Rate value.
Note: Jeff Almasol provides a script to set the frame rate and duration of the current composition and all compositions
nested within it: www.adobe.com/go/learn_ae_jeffcompsetter.
Change pixel aspect ratio
Pixel aspect ratio is the ratio of width to height of one pixel in an image. Frame aspect ratio is the ratio of width to
height of the frame dimensions of an image.
A 4:3 frame aspect ratio (left), and a wider 16:9 frame aspect ratio (right)
Most computer monitors use square pixels, but many video formats—including ITU-R 601 (D1) and DV—use non-
square rectangular pixels.
Some video formats output the same frame aspect ratio but use a different pixel aspect ratio. For example, some
NTSC digitizers produce a 4:3 frame aspect ratio, with square pixels (1.0 pixel aspect ratio), and a resolution of 640
x 480. D1 NTSC produces the same 4:3 frame aspect ratio but uses nonsquare pixels (0.9 pixel aspect ratio) and a
resolution of 720 x 486. D1 pixels, which are always nonsquare, are vertically oriented in systems producing NTSC
video and horizontally oriented in systems producing PAL video.
If you display nonsquare pixels on a square-pixel monitor without alteration, images and motion appear distorted;
for example, circles distort into ellipses. However, when displayed on a broadcast monitor, the images are correct.
When you import D1 NTSC or DV source footage into After Effects, the image looks slightly wider than it does on
a D1 or DV system. (D1 PAL footage looks slightly narrower.) The opposite occurs when you import anamorphic
footage using D1/DV NTSC Widescreen or D1/DV PAL Widescreen. Widescreen video formats have a frame aspect
ratio of 16:9.
Note: To preview non-square pixels on a computer monitor, click the Toggle Pixel Aspect Ratio Correction button at
the bottom of the Composition panel.
3
416
9
AFTER EFFECTS CS3
User Guide
56
Square and nonsquare pixels
A. Square pixels and 4:3 frame aspect ratio B. Nonsquare pixels and 4:3 frame aspect ratio C. Nonsquare pixels displayed on a square-pixel
monitor
If a footage item uses nonsquare pixels, After Effects displays the pixel aspect ratio next to the footage item’s
thumbnail image in the Project panel. You can change the pixel aspect ratio interpretation for individual footage
items in the Interpret Footage dialog box. By ensuring that all footage items are interpreted correctly, you can
combine footage items with different pixel aspect ratios in the same composition.
After Effects reads and writes pixel aspect ratios directly from QuickTime movies. For example, if you import a
movie captured as widescreen (16:9 DV), After Effects automatically tags it correctly. Similarly, AVI and PSD files
contain information that explicitly indicates the pixel aspect ratio of the images.
If a footage item does not contain information that explicitly indicates the image’s pixel aspect ratio, After Effects
uses the dimensions of the footage item’s frame to make a guess. When you import a footage item with either the D1
resolution of 720 x 486 or the DV resolution of 720 x 480, After Effects automatically interprets that footage item as
D1/DV NTSC. When you import a footage item with the D1 or DV resolution of 720 x 576, After Effects automati-
cally interprets that footage item as D1/DV PAL. However, you can make sure that all files are interpreted correctly
by looking in the Project panel or the Interpret Footage dialog box.
Note: Make sure to reset the pixel aspect ratio to Square Pixels when you import a square-pixel file that happens to have
a D1 or DV resolution—for example, a non-DV image that happens to have a resolution of 720 x 480.
The composition’s pixels aspect ratio setting should match that of the final output format. In most cases, you can
simply choose a composition settings preset. In contrast, set the pixel aspect ratio for each footage item to that of the
original source footage.
See also
“Common pixel aspect ratios” on page 57
Change pixel aspect ratio for a footage item
1Select a footage item in the Project panel.
2Choose File > Interpret Footage > Main.
3Choose a ratio from the Pixel Aspect Ratio menu and click OK.
A
BC
AFTER EFFECTS CS3
User Guide
57
Change pixel aspect ratio for a composition
1Choose Composition > Composition Settings.
2Do one of the following:
•Choose a composition settings preset from the Preset menu.
•Choose a value from the Pixel Aspect Ratio menu.
Common pixel aspect ratios
Use square-pixel footage for output to D1/DV NTSC
If you intend to create a movie for the D1 output format, use the D1 NTSC or D1 PAL composition settings preset.
The correct pixel aspect ratio for D1 NTSC or D1 PAL is chosen automatically when you choose the corresponding
composition settings preset.
1Prepare square-pixel footage that fills the entire frame for any of the following final output formats:
DV NTSC Create and save it at a 720 x 534 frame size.
D1 NTSC Create and save it at a 720 x 540 frame size.
D1/DV PAL Create and save it at a 768 x 576 frame size.
2Import the file into After Effects.
3(Optional) If your square-pixel footage was created and saved at 720 x 486 or 720 x 480, select it and choose File >
Interpret Footage > Main. Then choose Square Pixels from the Pixel Aspect Ratio menu and click OK.
Asset Pixel aspect ratio When to use
Square pixels 1.0 Footage has a 640 x 480 or 648 x 486 frame size, is 1920 x 1080 HD (not
HDV or DVCPRO HD), is 1280 x 720 HD or HDV, or was exported from an
application that doesn’t support nonsquare pixels. This setting can also
be appropriate for footage that was transferred from film or for custom-
ized projects.
D1/DV NTSC 0.9 Footage has a 720 x 486 or 720 x 480 frame size, and the desired result
is a 4:3 frame aspect ratio. This setting can also be appropriate for
footage that was exported from an application that works with
nonsquare pixels, such as a 3D animation application.
D1/DV NTSC Widescreen 1.2 Footage has a 720 x 486 or 720 x 480 frame size, and the desired result
is a 16:9 frame aspect ratio.
D1/DV PAL 1.0666 Footage has a 720 x 576 frame size, and the desired result is a 4:3 frame
aspect ratio.
D1/DV PAL Widescreen 1.422 Footage has a 720 x 576 frame size, and the desired result is a 16:9
frame aspect ratio.
Anamorphic 2:1 2.0 Footage was shot using an anamorphic film lens, or it was anamorphi-
cally transferred from a film frame with a 2:1 aspect ratio.
HDV 1080/DVCPRO HD 720
(After Effects), HD Anamorphic
1080 (Adobe Premiere Pro)
1.33 Footage has a 1440 x 1080 or 960 x 720 frame size, and the desired
result is a 16:9 frame aspect ratio.
DVCPRO HD 1080 (After
Effects only)
1.5 Footage has a 1280 x 1080 frame size, and the desired result is a 16:9
frame aspect ratio.
AFTER EFFECTS CS3
User Guide
58
4Choose Composition > New Composition, and then do one of the following:
•If your final output is DV, choose NTSC DV, 720 x 480 for Preset, and D1/DV NTSC (0.9) for Pixel Aspect Ratio.
•If your final output is D1, choose NTSC D1, 720 x 486 for Preset, and D1/DV NTSC (0.9) for Pixel Aspect Ratio.
5Select your other composition settings as desired, and then click OK.
6Add your footage to the new composition.
7Select the layer containing the square-pixel footage and apply the Fit To Comp command: press Ctrl+Alt+F
(Windows) or Command+Option+F (Mac OS).
Note: If your footage was created and saved at a frame size other than those noted in step 1, skip step 7.
See also
“Change pixel aspect ratio” on page 55
Working with footage items
Organize and view items in the Project panel
Compositions and footage items are listed in the Project panel. Unlike items in the Timeline panel and Effect
Controls panel, the order of items in the Project panel has no influence on the appearance of the movies that you
create. This means that you can organize footage items and compositions however you like, including organizing
them using folders. Solids are automatically placed in the Solids folder.
Folders that you create in the Project panel exist only in the Project panel. You can expand a folder to reveal its
contents, and put folders inside other folders. To move a file or folder to the top level of the Project panel, drag it to
the gray information area at the top of the panel.
You can use the File > Collect Files command to gather copies of all files in a project into a single folder.
See also
“Collect files in one location” on page 594
“Work with color labels” on page 149
“Shortcuts for working with projects” on page 639
Show information for items
•To show information about a footage item or composition, select it in the Project panel. Information is displayed
at the top of the Project panel next to the thumbnail image.
•To show the file creator ID for a footage item, Alt-click (Windows) or Option-click (Mac OS) it in the Project
panel.
Create a folder
❖Choose File > New > New Folder, or click the Create Folder icon at the bottom of the Project panel.
AFTER EFFECTS CS3
User Guide
59
Rename and sort items
•To rename a composition, footage item, or folder, select it in the Project panel, press Enter (Windows) or Return
(Mac OS), type the new name, and then press Enter or Return again.
Note: The names of items in the Project panel can be no more than 31 characters long. The same is true for names of
layers, effects, and property groups in the Timeline panel and Effect Controls panel.
•To rename the Comments column, right-click (Windows) or Control-click (Mac OS) the column heading and
choose Rename This.
You can use the Comments column to create a custom sorting option. Rename the column, enter corresponding infor-
mation for each item (for example, camera number), and then sort by that column.
•To sort items by entries in any column, click the column name in the Project panel.
Copy items
•To duplicate or copy an item in the Project panel, select it and choose Edit > Duplicate or Edit > Copy.
•To copy a footage item to Windows Explorer (Windows) or the Finder (Mac OS), drag the footage item from the
Project panel to the desktop.
Find and view items in the Project panel
•To find items in the Project panel, choose File > Find, or click the Find button at the bottom left of the panel.
Select Find Missing Footage to locate all footage items that refer to a file that has been moved, deleted, or renamed.
•To find the next item that matches the most recently used search criteria, Alt-click (Windows) or Option-click
(Mac OS) the Find button.
Working with footage items in the Footage panel
When you double-click a movie in the Project panel, it opens by default in the Footage panel or in a player window:
QuickTime (.mov) files open in a QuickTime Player window; Video for Windows (.avi) files open in a Video for
Windowsplayerwindow.StillimagesalwaysappearintheFootagepanel.CertainAVIfilesarenotsupportedbythe
AVI player window, and will open in the After Effects Footage panel. These include files created with Microsoft’s
DirectX DV codec and all files over 2 GB.
ToopenaQuickTimeorVideoforWindowsmovieintheFootagepanelinsteadofaplayerwindow,Alt-double-click
(Windows) or Option-double-click (Mac OS) the footage item in the Project panel.
The QuickTime and Video for Windows player windows play the source file, not the edited and interpreted footage
item based on the source file.
YoucanusetheSetInPoint ,SetOutPoint ,RippleInsertEdit ,andOverlayEdit controlsintheFootage
panel to trim a footage item and insert it into a composition. This can be more convenient than adding the footage
item to a composition and then trimming in the Timeline panel.
See also
“Trim, extend, or slip-edit a layer” on page 141
“Shortcuts for working with footage” on page 644
AFTER EFFECTS CS3
User Guide
60
Reveal footage items
•To reveal where a footage item is used in a composition, right-click (Windows) or Control-click (Mac OS) the
footage item in the Project panel and choose Reveal In Composition; then select the specific instance you want to
reveal (composition name,layer name).
•To reveal a layer’s source footage item in the Project panel, right-click (Windows) or Control-click (Mac OS) the
layer in the Timeline panel, and then choose Reveal Layer Source In Project.
•To reveal a footage item’s location in Adobe Bridge, Windows Explorer, or the Finder, right-click (Windows) or
Control-click (Mac OS) the footage item in the Project panel and choose Reveal In Bridge, Reveal In Windows
Explorer, or Reveal In Finder.
Refresh footage items
❖To refresh footage items selected in the Project panel to use the current versions of the source footage files, choose
File > Reload Footage.
Edit footage in its original application
You can open and edit a footage item in the application in which it was created, directly from an After Effects project.
The original application must be installed on the computer that you are using, which must have enough available
RAM for it to run. When you edit and save changes to the footage in the original application, the changes are applied
to all instances of the footage when After Effects becomes the active application.
Note: If you’re editing footage that has an alpha channel, make sure that you’re viewing and editing all of the channels,
including the alpha channel, in the other application. Otherwise, changes you make might not be applied to the alpha
channel, and it may become misaligned with the color channels.
When you edit a still-image sequence selected in the Timeline or Composition panel, the individual image that is
currently displayed opens. When you edit a still-image sequence selected in the Project panel, the first image in the
sequence opens.
1IntheProjectpanel,Compositionpanel,orTimelinepanel,selectthefootageitemoralayerthatusesthefootage
item as its source. If you selected a still-image sequence from the Composition or Timeline panel, move the current-
time indicator to the frame displaying the still image you want to edit.
2Choose Edit > Edit Original.
3Edit the footage in its original application, and save the changes.
Remove items from a project
•To remove an item from a project, select the item in the Project panel and press Delete.
•To remove all unused footage items from a project, choose File > Remove Unused Footage.
•To remove all duplicate footage items from a project, Choose File > Consolidate All Footage. Note that After
Effects considers footage items to be duplicates only if they use the same Interpret Footage settings.
When a duplicate item is removed, layers that refer to the duplicate item are updated to refer to the remaining copy.
•To remove unselected compositions and unused footage items from selected compositions in the Project panel,
chooseFile>ReduceProject.ThiscommandisavailableonlywhentheProjectpanelisactive,andremovesboth
unused footage items and all other compositions that are not included within a selected composition as nested
(subordinate) compositions.
AFTER EFFECTS CS3
User Guide
61
If the selected composition includes items that are turned off (that is, the Video or Audio switch is deselected in the
Timeline panel), the Reduce Project command does not remove those items.
If an expression in a selected composition refers to an element in a nonsubordinate composition, Reduce Project
removes the nonsubordinate composition and the applied expression. A message appears after you choose Reduce
Project to remind you of this possibility, so you can undo the command if needed. To avoid removing the expressions
from a nonsubordinate composition, drag the nonsubordinate composition into the composition that refers to it.
Then deselect the Audio and Video switches for the composition that you added.
Work with placeholders and proxies
When you want to temporarily use a substitute for a footage item, use either a placeholder or a proxy.
Placeholder Astillimageofcolorbarsusedtotemporarilytaketheplaceofamissingfootageitem.Useaplaceholder
when you are building a composition and want to try out ideas for a footage item that is not yet available. After Effects
generates placeholders automatically, so you do not have to provide a placeholder footage item.
Proxy Any file used to temporarily replace a footage item, but most often a lower-resolution or still version of an
existing footage item used to replace the original. Often, storyboard images are used as proxies. You can use a proxy
either before you have the final footage or when you have the actual footage item but you want to speed up
previewing or rendering of test movies. You must have a file available to use as a proxy.
Any masks, attributes, expressions, effects, and keyframes that you apply to the layer are retained when you replace
its placeholder or proxy with the final footage item.
IntheProjectpanel,AfterEffectsmarksthefootagenametoindicatewhethertheactualfootageitemoritsproxyis
currently in use:
•A box containing a black square indicates that a proxy item is currently in use throughout the project; the name
of the proxy appears in boldface in the project list.
•An empty box indicates that the actual footage item is in use throughout the project.
•No box indicates that no proxy is assigned to the footage item.
Proxy items in Project panel
A. Proxy assigned and in use B. Proxy assigned, but original in use C. No proxy assigned D. Proxy name
See also
“Work with render settings” on page 597
“Use a post-render action” on page 602
A
D
B
C
AFTER EFFECTS CS3
User Guide
62
Work with placeholders and missing footage items
For best results, set the placeholder to exactly the same size, duration, and frame rate as the actual footage.
If After Effects cannot find source footage when you open a project, the footage item appears in the Project panel
labeled Missing, and the name of the missing footage appears in italics. Any composition using that item replaces it
with a placeholder. You can still work with the missing item in the project, and any effects you applied to the original
footage remain intact. When you replace the placeholder with the source footage, After Effects places the footage in
its correct location in all the compositions that use it.
•To use a placeholder, choose File > Import > Placeholder.
•To replace the selected footage item with a placeholder, choose File > Replace Footage > Placeholder.
•To replace a placeholder with the actual footage item, select the placeholder you want to replace in the Project
panel, choose File > Replace Footage > File, and locate the actual footage.
Work with proxies for footage items
When you use a proxy, After Effects replaces the actual footage with the proxy in all compositions that use the actual
footage item. When you finish working, you can switch back to the actual footage item in the project list. After Effects
then replaces the proxy with the actual footage item in any composition.
When you render your composition as a movie, you may choose to use either all the actual high-resolution footage
items or their proxies. You might want to use the proxies for a rendered movie if, for example, you simply want to
test motion using a rough movie that renders quickly.
For best results, set a proxy so that it has the same aspect ratio as the actual footage item. For example, if the actual
footage item is a 640 x 480-pixel movie, create and use a 160 x 120-pixel proxy. When a proxy item is imported, After
Effects scales the item to the same size and duration as the actual footage. If you create a proxy with an aspect ratio
that is different from that of the actual footage item, scaling will take longer.
❖In the Project panel, do any of the following:
•To locate and use a proxy, select a footage item, choose File > Set Proxy > File, locate and select the file you want
to use as a proxy, and click Open.
•To toggle between using the original footage and its proxy, click the proxy indicator to the left of the footage name.
•To stop using a proxy, select the original footage item, and choose File > Set Proxy > None.
Create a proxy
Use the Create Proxy command to create a proxy from footage or compositions selected in the Project panel or the
Timeline panel. This command adds the selected footage to the Render Queue panel and sets the Post-Render Action
option to Set Proxy.
1Select a footage item or composition in the Project or Timeline panel.
2Choose one of the following commands:
•File > Create Proxy > Still to create a still image proxy.
•File > Create Proxy > Movie to create a moving image proxy.
3Specify a name and output destination for the proxy.
4In the Render Queue panel, specify render settings, and click Render.
Note: To create a still image proxy from a movie or sequence footage item, open the footage item in the Footage panel
and set as the poster frame the frame that you want to use as the proxy.
AFTER EFFECTS CS3
User Guide
63
Create placeholders for output
You can create placeholder files that can be used in different compositions. For example, you can create a placeholder
for an item in the render queue that will create a 24-fps movie and then drag that placeholder into a 30-fps compo-
sition. Then, when you render the 30-fps composition, After Effects first renders the placeholder at 24 fps and uses
this rendered version as it renders the 30-fps composition.
❖Drag the Output Module heading for a queued item from the Render Queue panel to the Project panel. After
Effects creates a placeholder for output in the Project panel and sets the Post-Render Action option for the item to
Import & Replace Usage.
Loop a footage item
If you intend to loop a visual footage item continuously in your project, you only need to create one cycle of the
footage item in After Effects.
1In the Project panel, select the footage item to loop.
2Choose File > Interpret Footage > Main.
3Type an integer value for Loop and click OK.
Importing from After Effects and Adobe Premiere Pro
Import an After Effects project
You can import one After Effects project into another. Everything from the imported project, including footage
items, compositions, and folders, appears inside a new folder in the current Project panel.
You can import an After Effects project from a different operating system, as long as you maintain the file names,
folder names, and either full or relative paths (folder locations) for all files in the project. To maintain relative paths,
thesourcefootagefilesmustresideonthesamevolumeastheprojectfile.UsetheFile>CollectFilescommandto
gather copies of all files in a project or composition into a single location.
Note: When you render a movie and export it to the QuickTime (MOV) or Video for Windows (AVI) container format,
you can embed the After Effects project or a link to the project in the container file. To import the project, import the
MOV or AVI file, and choose Project from the Import As menu in the Import File dialog box. If the file contains a link
to a project that has been moved, you can browse to locate the project.
1Choose File > Import > File.
2Select the After Effects project to import, and click Open.
If a file format is not supported by the operating system that you are using, if the file is missing, or if the reference
link is broken, After Effects substitutes a placeholder item containing color bars. You can reconnect the placeholder
to the appropriate file by double-clicking the entry in the Project panel and navigating to the source file. In most
cases, you need to relink only one footage file. After Effects locates other missing items if they’re in the same location.
See also
“Collect files in one location” on page 594
“Work with placeholders and proxies” on page 61
AFTER EFFECTS CS3
User Guide
64
Import an Adobe Premiere Pro project
The ability to import Adobe Premiere Pro projects into After Effects eliminates the need to render the project in
Premiere Pro before applying visual effects and animations in After Effects. When you import an Adobe Premiere
Pro project, After Effects imports it into the Project panel as both a new composition containing each Adobe
Premiere Pro clip as a layer, and as a folder containing each clip as an individual footage item. If your Adobe Premiere
Pro project contains bins, After Effects converts them to folders within the Adobe Premiere Pro project folder. After
Effects converts nested sequences to nested compositions. You can also import Adobe Premiere 6.0 and 6.5 projects
into After Effects.
Note: After Effects on Mac OS can’t import Adobe Premiere Pro 1.0, 1.5, or 2.0 projects. After Effects on Mac OS can
import Adobe Premiere Pro CS3 and Adobe Premiere 6.0 and 6.5 projects.
After Effects preserves the order of clips in the timeline, the footage duration (including all trimmed In and Out
points), and marker and transition locations. After Effects bases the arrangement of layers in the Timeline panel on
the arrangement of clips in the Adobe Premiere Pro Timeline panel. After Effects adds Adobe Premiere Pro clips to
the Timeline panel as layers in the order they appeared—from the bottom up and from left to right—in the Adobe
PremiereProTimelinepanel.AfterEffectspreserveschangesmadetothespeedofaclip,forexample,withtheClip>
Speed command, and these changes appear as a value in the Stretch column in the After Effects Timeline panel.
After Effects imports effects common to Adobe Premiere Pro and After Effects, and preserves keyframes for these
effects. If you’re working in Adobe Premiere Pro, an After Effects icon in the Effects panel denotes common effects
used by both applications.
Transitions and titles (except for dissolves) included in your Adobe Premiere Pro project appear in the After Effects
composition as solid layers with their original location and duration.
Audio Level keyframes are preserved.
1Choose File > Import > File.
2Select an Adobe Premiere Pro or Adobe Premiere project, and click OK.
3Do any of the following:
•To import only one sequence, choose a sequence from the menu.
•To import audio, select Import Audio.
ToaddasingleitemfromatrackinanAdobePremiereProproject,copytheiteminAdobePremierePro,andchoose
Edit > Paste in After Effects.
See also
“Copy between After Effects and Adobe Premiere Pro” on page 65
“About nesting and precomposing” on page 113
Use Adobe Premiere Pro for capture (Production Premium only)
If you have Adobe Creative Suite 3 Production Premium, you can start Adobe Premiere Pro from inside After Effects
and use it to capture footage for use in your After Effects project.
❖Choose File > Import > Capture In Adobe Premiere Pro.
AFTER EFFECTS CS3
User Guide
65
Copy between After Effects and Adobe Premiere Pro
You can copy and paste layers and assets between Adobe After Effects and Adobe Premiere Pro. For a video on the
workflow between After Effects and Adobe Premiere Pro, see www.adobe.com/go/vid0256.
•From the After Effects Timeline panel, you can copy footage layers or solid layers and paste them into the Adobe
Premiere Pro Timeline panel.
•From the Adobe Premiere Pro Timeline panel, you can copy assets (any items in a track) and paste them into the
After Effects Timeline panel.
•From either After Effects or Adobe Premiere Pro, you can copy and paste footage to the other’s Project panel.
Note: You can’t, however, paste footage from the After Effects Project panel into the Adobe Premiere Timeline panel.
If you want to work with all clips or a single sequence from an Adobe Premiere Pro project, use the Import command
instead to import the project into After Effects.
Use Adobe Dynamic Link to create dynamic links, without rendering, between new or existing compositions in
After Effects and Adobe Premiere Pro.
See also
“About Dynamic Link (Production Premium only)” on page 609
Copy from After Effects to Adobe Premiere Pro
You can copy a footage layer from an After Effects composition and paste it into an Adobe Premiere Pro sequence.
AdobePremiereProconvertsfootagelayerstoclipsinthesequenceandcopiesthesourcefootagetoitsProjectpanel.
If the layer contains an effect that is also used by Adobe Premiere Pro, Adobe Premiere Pro converts the effect and
all of its settings and keyframes.
You can also copy nested compositions, Photoshop layers, solid layers, and audio layers. Adobe Premiere Pro
converts nested compositions to nested sequences, and solid layers to color mattes. You cannot copy text, shape,
camera, light, or adjustment layers to Adobe Premiere Pro.
1Start Adobe Premiere Pro (you must start Adobe Premiere Pro before you copy the layer in After Effects).
2Select a layer (or layers) from the After Effects Timeline panel.
Note: If you select multiple layers and the layers don’t overlap in After Effects, they’re placed on the same track in Adobe
Premiere Pro. On the other hand, if the layers overlap in After Effects, the order in which you select them determines the
order of their track placement in Adobe Premiere Pro. Each layer is placed on a separate track, and the last selected layer
appears on Track 1. For example, if you select layers from top to bottom, the layers appear in the reverse order in Adobe
Premiere Pro, with the bottommost layer on Track 1.
3Choose Edit > Copy.
4In Adobe Premiere Pro, open a sequence in the Timeline panel.
5Move the current-time indicator to the desired location, and choose either Edit > Paste or Edit > Paste Insert.
Results of pasting into Adobe Premiere Pro
When you paste a layer into an Adobe Premiere Pro sequence, keyframes, effects, and other properties in the copied
layer are converted as follows:
AFTER EFFECTS CS3
User Guide
66
Copy from Adobe Premiere Pro to After Effects
YoucancopyavideooraudioassetfromanAdobePremiereProsequenceandpasteitintoanAfterEffectscompo-
sition. After Effects converts assets to footage layers and copies the source footage into its Project panel. If the asset
contains an effect that is also used by After Effects, After Effects converts the effect and all of its settings and
keyframes.
You can copy color mattes, stills, nested sequences, and offline files as well. After Effects converts color mattes into
solid layers and converts nested sequences into nested compositions. When you copy a Photoshop still image into
After Effects, After Effects retains the Photoshop layer information. You cannot paste Adobe Premiere Pro titles or
effects into After Effects.
1Select an asset from the Adobe Premiere Pro Timeline panel.
2Choose Edit > Copy.
3In After Effects, open a composition in the Timeline panel.
4With the Timeline panel active, choose Edit > Paste. The asset appears as the topmost layer in the Timeline panel.
Note: To paste the asset at the current-time indicator, position the current-time indicator and press Ctrl+Alt+V
(Windows) or Command+Option+V (Mac OS).
Results of pasting into After Effects
When you paste an asset into an After Effects composition, keyframes, effects, and other properties in a copied asset
are converted as follows:
After Effects item Converted to in Adobe Premiere Pro Notes
Transform property values and keyframes Motion or Opacity values and keyframes The keyframe type—Bezier, Auto Bezier,
Continuous Bezier, or Hold—is retained.
Effect properties and keyframes Effect properties and keyframes, if the effect
also exists in Adobe Premiere Pro
Adobe Premiere Pro lists unsupported
effects as offline in the Effect Controls panel.
Some After Effects effects have the same
names as those in Adobe Premiere Pro, but
since they’re actually different effects, they
aren’t converted.
Audio volume property Channel Volume filter
Stereo Mixer effect Channel Volume filter
Masks and mattes Not converted
Time Stretch property Speed property Speed and time stretch have an inverse rela-
tionship. For example, 200% stretch in
After Effects converts to 50% speed in
Adobe Premiere Pro.
Layer-time markers Clip markers
Time Remapping properties Not converted
Blending modes Not converted
Expressions Not converted
AFTER EFFECTS CS3
User Guide
67
Importing video and audio
Work with the media cache
When After Effects imports video and audio in some formats, it processes and caches versions of these items that it
can readily access when generating previews. Imported audio files are each conformed to a new .cfa file, and MPEG
files are indexed to a new .mpgindex file. This greatly improves performance for previews, because the video and
audio items do not need to be reprocessed for each preview.
Note: When you first import a file, you may experience a slight delay while the media is being processed and cached.
Adobe Premiere Pro asset Converted to in After Effects Notes
Motion or Opacity values and keyframes Transform property values and keyframes Keyframe type—Bezier, Auto Bezier, Contin-
uous Bezier, or Hold—is retained.
Video effect properties and keyframes Effect properties and keyframes, as long as
the effect also exists in After Effects
After Effects doesn’t display unsupported
effects in the Effect Controls panel.
Crop filter Mask layer
Video and audio transitions Opacity keyframes (Cross dissolve only) or
solids
Volume and Channel Volume audio filters Stereo mixer effect Other audio filters are not converted.
Speed property Time Stretch property Speed and time stretch have an inverse rela-
tionship. For example, 50% speed in Adobe
Premiere Pro is converted to 200% stretch in
After Effects.
Frame Hold Time Remap
Clip marker Layer-time marker
Sequence marker Markers on a new solid layer To copy sequence markers, you must either
copy the sequence itself or import the
entire Adobe Premiere Pro project as a
composition.
Audio track Audio layers Audio tracks that are either 5.1 surround or
greater than 16-bit aren’t supported. Mono
and stereo audio tracks are imported as one
or two layers.
Color mattes Solids
Time Remapping effect Not converted
Titles Not converted
Bars and tone Not converted
Universal counting leaders Not converted
AFTER EFFECTS CS3
User Guide
68
A database retains links to each of the cached media files. This media cache database is shared with Adobe Premiere
Pro, Adobe Encore, and Adobe Soundbooth, so each of these applications can each read from and write to the same
set of cached media files. If you change the location of the database from within any of these applications, the location
is updated for the other applications, too. Each application can use its own cache folder, but the same database keeps
track of them all.
❖Choose Edit > Preferences > Memory & Cache (Windows) or After Effects > Preferences > Memory & Cache (Mac
OS), and do one of the following:
•Click one of the Choose Folder buttons to change the location of the media cache database or the media cache
itself.
•ClickCleanDatabase&Cachetoremoveconformedandindexedfilesfromthecacheandtoremovetheirentries
from the database. This only affects footage items for which the source file is no longer available.
Note: Before clicking the Clean Database & Cache button, make sure that any drives that contain your currently used
source media are connected to your computer. If footage is determined to be missing because the drive on which it is
locatedisnotconnected,theassociatedfilesinthemediacachewillberemoved.Thiswillresultintheneedtoreconform
or reindex the footage when you attempt to use the footage later.
Types of video and film
Someofthesourcefootageyouusemayhavebeencreateddigitally(forexample,inPhotoshoporAdobePremiere
Pro), but other footage may need to be transferred to the computer from analog sources, such as film and videotape.
Understanding some of the media differences can help you decide how to handle footage as you transfer it between
digital and analog devices.
For introductions to digital video, digital audio, high-definition video, DVD, compression, and streaming video, visit
the Adobe website at www.adobe.com/go/learn_dv_primers.
Analog video Comes from an analog camera and carries picture and sound information by creating continuous
variations in an electromagnetic signal. Before you can import analog video into After Effects, you need to capture
it. Capturing transfers video from tape to your hard disk, and involves the conversion of the analog signal to a digital
signal.
Digital video Comes from a digital video camera, and carries picture information by representing each pixel of a
video frame as discrete color and intensity values and transmitting and storing the pixel values in the binary data
format used by computers. Sound is also carried as binary data.
Digital video is not one format but a medium. There are many digital video file formats exist. Even if your source
footage was created digitally, you need to make sure that it is stored in a file format that After Effects can import.
If you plan to distribute the movie digitally, for example on DVD, you must render it in a file format appropriate for
your distribution method.
DV video format is a form of digital video that can be captured directly to your hard disk for editing in applications
such as After Effects and Adobe Premiere Pro. Most DV cameras and decks can connect directly to a computer using
an IEEE 1394 (FireWire/i.Link) interface.
Note: Some formats, such as Adobe Flash Video, have elements of conventional digital video, but represent an interme-
diate category between what has conventionally been thought of as a video format and what has conventionally been
thought of as computer animation format.
Analog film Carries picture information by creating variations in colored pigments on a strip of acetate (the long reel
run through the traditional film projector). Examples include still transparencies and common motion-picture film.
AFTER EFFECTS CS3
User Guide
69
To apply digital effects to motion-picture film using After Effects, you must first transfer the film to a digital format.
You can transfer film in two ways:
•Use a film scanner to transfer each analog film frame directly to a digital movie frame. This method best preserves
the image quality. Using a film scanner is preferable, because you scan the footage directly to the computer as
noninterlaced, full-resolution, 24-fps footage; in other words, it is ready to use in After Effects.
•Transfer the analog film to analog videotape, and then digitize the videotape. This process is called telecine
transfer. It converts 24-fps film footage to 30-fps videotape using 3:2 pulldown. Transferring using the 3:2
pulldown method introduces two issues: You must resolve the different frame rates of videotape and motion-
picture film, and you must separate the fields of the interlaced video. After Effects can automatically resolve both
of these issues while preserving image quality.
Note: To use an After Effects movie in an analog motion-picture film, you must transfer the movie back to the analog
film medium. This transfer process is generally done at a post-production facility.
See also
“Working with Cineon footage items” on page 251
About high-definition (HD) video
High-definition (HD) video refers to any video format with a resolution higher than standard-definition (SD) video
formats. Typically, standard-definition refers to digital formats with resolutions close to those of analog TV
standards, such as NTSC and PAL (around 480 or 576 vertical lines, respectively). The most common HD formats
have resolutions of 1280 x 720 or 1920 x 1080, with a widescreen aspect ratio of 16:9.
HD video formats include interlaced and noninterlaced varieties. Typically, the highest-resolution formats are inter-
laced at the higher frame rates, because noninterlaced video at this resolution would require a prohibitively high data
rate.
HD video formats are designated by their vertical resolution, scan mode, and frame or field rate (depending on the
scan mode). For example, 1080i60 denotes interlaced scanning of 60 interlaced 1920 x 1080 fields per second,
whereas 720p30 denotes progressive scanning of 30 noninterlaced 1280 x 720 frames per second. In both cases, the
frame rate is approximately 30 frames per second. For more information on high-definition video, see
www.adobe.com/go/learn_dv_primer_highdef.
Programs in Adobe Creative Suite 3 Production Premium (Adobe Premiere Pro, Adobe After Effects, Adobe Sound-
booth, and Adobe Encore) includes presets that are designed for working with various HD formats. Some of the most
common HD video formats you may encounter include the following:
DVCPRO HD Panasonic’s high-definition variant of its DVCPRO format, which also includes DVCPRO25 and
DVCPRO50. Whereas DVCPRO25 and DVCPRO50 support data rates of 25Mbits/s (megabits per second) and
50Mbit/s, respectively, DVCPRO HD supports a data rate of 100Mbit/s, from which it gets its other name,
DVCPRO100.
HDCAM Sony’s high-definition version of its Digital Betacam format. A variant called HDCAM SR uses a tape with
a higher particle density to record video with greater color sampling and at higher bit rates. However, HDCAM SR
is supported by decks only, and not camcorders.
HDV Developed jointly by several companies, HDV employs a form of MPEG-2 compression to enable high-
definition video to be encoded onto standard miniDV cassette media.
H.264 Also known as MPEG-4 part 10 and AVC (Advanced Video Coding), H.264 can deliver video over a range of
bitrates more efficiently than previous standards. For example, H.264 can deliver the same quality as MPEG-2 at half
AFTER EFFECTS CS3
User Guide
70
the data rate. H.264 is built into the Apple QuickTime 7 multimedia architecture, and it’s supported by both
HD-DVD and Blu-ray Disc, two newer DVD formats.
Uncompressed HD High-definition video in an uncompressed format. Without compression to reduce the video’s
data rate, uncompressed video requires relatively fast computer processors, hard disks, and a specialized capture
device.
WM9 HDTV Microsoft’s high-definition delivery format is among numerous formats included in the Windows
Media 9 (WM9) framework. By employing an aggressive compression scheme, WM9 HDTV permits high-
definition video encoding and playback at relatively low data rates.
About interlaced and noninterlaced video
Interlacing is a technique developed for transmitting standard-resolution television signals using limited bandwidth.
In an interlaced system, only half the number of horizontal lines for each frame of video are transmitted at a time.
But because of the speed of transmission, the afterglow inherent in cathode ray tubes, and the persistence of vision,
the viewer perceives each frame in full resolution. All of the analog television standards use interlacing. Digital
television standards include both interlaced and noninterlaced varieties. Typically, interlaced signals are generated
from interlaced scanning while noninterlaced signals are generated from progressive scanning.
Each interlaced video frame consists of two fields. Each field contains half the number of horizontal lines in the
frame; the upper field (or Field 1) contains the odd-numbered lines, and the lower field (or Field 2)containstheeven-
numbered lines. An interlaced video monitor displays each frame by first drawing all of the lines in one field and
then drawing all of the lines in the other field. Field order specifies which field is drawn first. In NTSC video, new
fields are drawn to the screen approximately 60 times per second, corresponding to a frame rate of approximately 30
frames per second.
Interlaced scanning of interlaced video fields compared with progressive scanning of noninterlaced video frame.
A. Forinterlacedvideo,entireupperfieldisdrawntoscreenfirst,fromtoptobottom,inonepass. B. Next,entirelowerfieldisdrawntoscreen,
from top to bottom, in one pass. C. For noninterlaced video, entire frame is drawn to screen, from top to bottom, in one pass.
Noninterlaced video frames aren’t separated into fields. A progressive-scan monitor displays a noninterlaced video
frame by drawing all the horizontal lines, from top to bottom, in one pass. Computer monitors are almost all
progressive-scan monitors, and most video displayed on computer monitors is noninterlaced.
A
B
C
AFTER EFFECTS CS3
User Guide
71
The terms progressive and noninterlaced are thus closely related and are often used interchangeably, but progressive
refers to the recording or drawing of the scan lines by a camera or monitor, whereas noninterlaced refers to the fact
that the video data itself isn’t separated into fields. For example, it’s possible with some modern cameras to use
progressive scanning to record two simultaneous fields per frame of interlaced video.
Separate video fields
If you want to use interlaced or field-rendered footage (such as NTSC video) in an After Effects project, you will get
the best results if you separate the video fields when you import the footage. After Effects separates video fields by
creating a full frame from each field, preserving all of the image data from the original footage.
Separating fields is critical if you plan to make significant changes to the footage. When you scale, rotate, or apply
effects to interlaced video, unwanted artifacts, such as crossed fields, are often introduced. By separating fields, After
Effects accurately converts the two interlaced frames in the video to noninterlaced frames, while preserving the
maximum amount of image quality. Using noninterlaced frames allows After Effects to apply edits and effects consis-
tently and at the highest quality.
After Effects creates field-separated footage from a single formerly interlaced field by splitting fields into two
independent frames. Each new frame has only half the information of the original frame, so some frames may appear
to have a lower resolution than others when viewed at Draft quality. When you render the final composition, After
Effects reproduces high-quality interlaced frames for videotape. When you render a movie at Best quality, After
Effects interpolates between the scan lines of a field to produce maximum image quality.
If your output will not be interlaced, it's best to use noninterlaced source footage, to avoid the need to separate fields.
However, if a noninterlaced version of your source footage is not available, interlaced footage will work fine.
When you render a composition containing field-separated footage, set the Field Rendering option to the same field
order as your video equipment. If you don’t field-render the composition, or if you field-render with the incorrect
settings, the final movie may appear too soft, jerky, or distorted.
Toveryquicklygivevideofootageamorefilm-likeappearance,importthefootagetwice,andinterpreteachfootage
item with a different field order. Then add them both to the same composition and blend them together. The misin-
terpreted layer will add some film-like blur.
After Effects automatically separates fields for D1 and DV video footage items. You can manually separate fields for
all other types of video footage in the Interpret Footage dialog box.
1Select the footage item in the Project panel.
2Choose File > Interpret Footage > Main.
3Choose an option from the Separate Fields menu.
4Click Preserve Edges (Best Quality Only) to increase image quality in nonmoving areas when the image is
rendered at Best quality. Then click OK.
Note: If the field settings in the Interpret Footage dialog box are correct for the input footage and the field settings in the
Render Settings dialog box are correct for the output device, you can mix footage items of different field orders in a
composition. If either of these settings is incorrect, however, the frames will be in the correct order, but the field order
may be reversed, resulting in jerky, unacceptable images.
AFTER EFFECTS CS3
User Guide
72
Determine the original field order
The field order for an interlaced video footage item determines the order in which the two video fields (upper and
lower) are displayed. A system that draws the upper lines before the lower lines is called upper-field first; one that
draws the lower lines before the upper lines is called lower-field first. Many standard-definition formats (such as DV
NTSC) are lower-field first, whereas many high-definition formats (such as 1080i DVCPRO HD) are upper-field
first.
Note: Upper-field first corresponds to Even Field First in an ElectricImage file.
The order in which the fields are displayed is important, especially when the fields contain motion. If you separate
video fields using the wrong field order, motion will not appear smooth.
Some programs, including After Effects, label the field order when rendering interlaced video files. When you
import a labeled video file, After Effects honors the field order label automatically. You can override this field order
by applying different footage interpretation settings.
If a file does not contain a field order label, you can match the original field order of your footage. If you are not sure
which field order was used to interlace a footage item, use the procedure below to find out.
1Select the item in the Project panel.
2Choose File > Interpret Footage > Main.
3In the Interpret Footage dialog box, select Upper Field First from the Separate Fields menu, and then click OK.
4In the Project panel, press Alt (Windows) or Option (Mac OS) as you double-click the footage to open it in the
Footage panel.
5If the Time Controls panel is not visible, choose Window > Time Controls.
6In the Footage panel, find a segment that contains one or more moving areas.
7Using the Next Frame button in the Time Controls panel, step forward at least five frames in the Footage panel.
Moving areas should move consistently in one direction. If the moving areas move backward every other frame, the
wrong field-separation option has been applied to the footage.
Remove 3:2 or 24Pa pulldown from video
When you transfer 24-fps film to 29.97-fps video, you use a process called 3:2 pulldown,inwhichthefilmframesare
distributed across video fields in a repeating 3:2 pattern. The first frame of film is copied to fields 1 and 2 of the first
frameofvideo,andalsotofield1ofthesecondvideoframe.Thesecondframeoffilmisthenspreadacrossthenext
two fields of video—field 2 of the second video frame and field 1 of the third frame of video. This 3:2 pattern is
repeated until four frames of film are spread over five frames of video, and then the pattern is repeated.
The 3:2 pulldown process results in whole frames (represented by a W) and split-field frames (represented by an S).
The three whole video frames contain two fields from the same film frame. The remaining two split-field frames
contain a video frame from two different film frames. The two split-field frames are always adjacent to each other.
The phase of 3:2 pulldown refers to the point at which the two split-field frames fall within the first five frames of the
footage.
Phase occurs as a result of two conversions that happen during 3:2 pulldown: 24-fps film is redistributed through
30-fps video, so each of four frames of 24-fps film is spread out over five frames of 30(29.97)-fps video. First, the film
is slowed down 0.1% to match the speed difference between 29.97 fps and 30 fps. Next, each film frame is repeated
in a special pattern and mated to fields of video.
AFTER EFFECTS CS3
User Guide
73
When you apply 3:2 pulldown to footage, one frame of the film (A) is separated into two or three interlaced video fields (B) which are grouped
into video frames containing two fields each.
When importing interlaced video that was originally transferred from film, you can remove the 3:2 pulldown that
was applied during the transfer from film to video as you separate fields so that effects you apply in After Effects don’t
appear distorted.
It’s important to remove 3:2 pulldown from video footage that was originally film so that effects you add in After
Effects synchronize perfectly with the original frame rate of film. Removing 3:2 pulldown reduces the frame rate by
1/5—from 30 to 24 fps or from 29.97 to 23.976 fps, which also reduces the number of frames you have to change. To
remove 3:2 pulldown, you must also indicate the phase of the 3:2 pulldown.
After Effects also supports Panasonic DVX100 24p DV camera pulldown, called 24P Advance (24Pa).Thisformatis
used by some cameras to capture 23.976 progressive-scan imagery using standard DV tapes.
Before you remove 3:2 pulldown, separate the fields as either upper-field first or lower-field first. Once the fields are
separated, After Effects can analyze the footage and determine the correct 3:2 pulldown phase and field order. If you
already know the phase and field order, choose them from the Separate Fields and the Remove Pulldown menus in
the Interpret Footage dialog box.
1In the Project panel, select the footage item from which to remove 3:2 pulldown.
2Choose File > Interpret Footage > Main.
3In the Fields and Pulldown section, select Upper Field First or Lower Field First from the Separate Fields menu.
4Do one of the following and click OK:
•If you know the phase of the 3:2 or 24Pa pulldown, choose it from the Remove Pulldown menu.
•To have After Effects determine the correct settings, click Guess 3:2 Pulldown or Guess 24Pa Pulldown.
Note: Ifyourfootagefilecontainsframesfromdifferentsources,thephasemaynotbeconsistent.Ifthisisthecase,import
the footage multiple times, once for each phase, and interpret each footage item with a different setting. Then, add each
footage item to your composition and trim each layer to use only the appropriate frames.
Import assets in Panasonic P2 format
A P2 card is a solid-state memory device that plugs into the PCMCIA slot of a Panasonic P2 video camera, such as
the AG-HVX200. The digital video and audio data from the video camera is recorded onto the card in a structured,
codec-independent format known as MXF (Media eXchange Format). Specifically, Adobe Premiere Pro and After
Effects support the Panasonic Op-Atom variant of MXF, with video in DV, DVCPRO, DVCPRO50, and DVCPRO
HD formats. A clip is said to be in the P2 format if its audio and video are contained in Panasonic Op-Atom MXF
files, and these files are located in a specific folder structure.
2323
A
B
WS S WW
AFTER EFFECTS CS3
User Guide
74
The root of the P2 folder structure is a CONTENTS folder. Each essence item(anitemofvideooraudio)iscontained
in a separate MXF wrapper file; the video MXF files are in the VIDEO subfolder, and the audio MXF files are in the
AUDIO subfolder. The relationships between essence files and the metadata associated with them are tracked by
XML files in the CLIP subfolder.
Note: Adobe Premiere Pro and After Effects do not support proxies recorded by Panasonic P2 camcorders in P2 card
PROXY folders.
The video and audio on a P2 card are already in a digital form, as if the P2 card were a hard disk, so there is no capture
step involved in importing media from a P2 card. The process of reading the data from the card and converting it to
a format that can be used in a project is sometimes referred to as ingest.
For your computer to read P2 cards, you must install the appropriate driver, which you can download from the
Panasonic website. Panasonic also provides the P2 Viewer application, with which you can browse and play media
stored on a P2 card. See the Panasonic website for details: www.adobe.com/go/learn_pp_panasonicp2.
Because Panasonic P2 cards use the FAT32 file system, each file is limited to a size of 4 GB. When a shot is recorded
that requires more than the 4 GB, a P2 camera creates another file and continues recording the shot to the new file
without interruption. This is referred to as clip spanning,becausetheshotspansmorethanonefileorclip.Similarly,
a camera may span a shot across files on different P2 cards: if the camera has more than one P2 card loaded, it will
recordtheshotuntilitrunsoutofroomonthefirstP2card,createanewfileonthenextP2cardwithavailablespace,
and continue recording the shot to it. Although a single shot can be recorded to a group of multiple spanned clips,
the multiple-file shot is designed to be treated as a single clip or footage item in a video editing application. For After
Effects to automatically import a group of spanned clips simultaneously and assemble them into a single footage
item, they must all have been recorded to the same P2 card and none of the files can be missing, including the
associated XML metadata file.
1(Optional) Copy the entire contents of the P2 card to a hard disk.
Though it is possible to import assets into Adobe Premiere Pro or After Effects directly from a P2 card, it is usually
more efficient to copy the contents of the P2 card to a hard disk before importing.
2Choose File > Import.
3Navigate to the CONTENTS folder.
4Select one or more MXF files:
•To import a video essence item and its associated audio essence items, select the MXF files from the VIDEO folder.
•To import only the audio essence items, select the MXF files from the AUDIO folder.
•To import a group of spanned clips for a shot that were recorded onto the same P2 card, select only one of the MXF
files in the group from the VIDEO folder. The group will be imported as a single footage item with a duration
equal to the total duration of all the spanned clips it includes. If you select more than one of these spanned clips,
you will import duplicates of the whole group of spanned clips, as duplicate footage items in the Project panel.
Youcannotimportspannedclipsfromashotthatspanstwodifferentcardsasasinglefootageitem.Rather,youmust
select a single MXF file belonging to the shot from each card to create a separate footage item for the part of the shot
recorded on each card. For example, if a group of spanned clips for a single shot itself spans two cards, you must select
a spanned clip from the group on card 1 and another from the group on card 2. This will import the contents of the
shot into two footage items in the Project panel.
The Date column in the Project panel shows when each source clip was acquired. After you import spanned clips,
you can use the Date value to determine their correct chronological order within the shot.
AFTER EFFECTS CS3
User Guide
75
For additional information on the Panasonic P2 format and workflows with Adobe digital video software, see the
Adobe website:
•P2 workflow guide for Adobe digital video products: www.adobe.com/go/learn_dva_p2workflowguide
•Dave Helmly’s video introduction to the P2 workflow in After Effects:
www.adobe.com/go/learn_dva_p2davehelmly
Importing AAF and OMF files (Windows only)
AAF (Advanced Authoring Format) is a multimedia file interchange format that contains all of the editing decisions
of a project from a non-linear editor (NLE). Using AAF, you can exchange NLE projects between platforms, systems,
and applications. AAF files do not contain media, such as video and audio; rather, they contain editing decisions and
links to media.
OMF (Open Media Framework) is an extensible, object-oriented format that provides a means of tracking
production and post-production information. Unlike AAF files, OMF files can contain media as well as project
information. An AAF file may link to an associated OMF file as a media source. When you import an AAF file that
references an OMF file, the OMF footage is also imported. After Effects imports only raw (essence) OMF files, which
are OMF files that have embedded media and no project information. After Effects doesn't import OMF project files.
You can use an application such as Automatic Duck to import OMF project files on Windows or Mac OS.
Note: You can also output to OMF. See “Render a composition to OMF (Windows only)” on page 622.
The following OMF codecs are supported for importing and outputting to OMF: Uncompressed, Avid AVR, Avid
JPEG, JFIF, and DV.
The OMF file format supports video only. Avid editing systems store audio files as separate .wav files, which you can
import into After Effects if desired. Depending on the resolution and codec, each frame may be composed of a full
noninterlaced frame, two interlaced fields, or a single line-doubled field (for single-field media). The codec used to
encode the media is displayed in the footage information area in the Project panel.
To ensure that the project that you want to import conforms to general AAF specifications and is compatible with
After Effects, consider the following:
Character limits for names The folder name (based on the AAF file name) created in the Project panel is truncated
to 31 characters, the maximum limit in After Effects. Names for items in the Project panel and for layers in the
Timeline panel are also truncated to 31 characters.
Platform-specific footage references Footage references are saved with platform-specific paths and file names in the
AAF file.
Separate video and audio tracks An AAF file can have separate clips for audio and video. When the AAF file is
imported into After Effects, each clip is converted into a layer. For an audio clip, only the audio switch is enabled for
the layer. For a video clip, only the video switch is enabled for the layer.
Clips on the same track Clips that appear on the same track in Avid appear as separate layers in After Effects.
Depth order of video and audio tracks During AAF import, video tracks are processed before audio tracks, so
converted audio layers will appear above video layers in the After Effects Timeline panel.
Different image dimensions and pixel aspect ratios When an Avid editing system imports footage, it is scaled to the
dimensions of the project regardless of the original dimensions of the footage. When the AAF file is imported into
After Effects, footage appears with its original dimensions and pixel aspect ratio, which may be different from the
dimensions of the project. You can use the Interpret Footage command in After Effects to make pixel aspect ratio
adjustments.
AFTER EFFECTS CS3
User Guide
76
Missing media Referencedmediathatisnotaccessibleduringtheimportoperationappearsasplaceholderfootage
in After Effects.
Empty sequences If a sequence contains no tracks, the composition created when it is imported is set at DV
resolution (720 x 480; 0.9 pixel aspect ratio) with a length of 10 seconds.
Cuts-only video and audio clips Supported.
Audio Audio gain (level) changes are supported, but audio pan is not. Mono and stereo audio are supported; 5.1
audio is not supported. Separate audio channel tracks (even if out of synchronization) are imported into After Effects
as a single audio layer.
Clip Speed Clips with a Motion Effect are converted to the corresponding layer Stretch value (for slow or fast
motion) or layer Time Remap keyframes (for reverse motion).
Empty tracks Ignored.
Muted tracks Avid does not save muted track information in an exported AAF file, so muted tracks cannot be
preserved in After Effects.
Locators Ignored.
Composition size and pixel aspect ratio Created based on the StoredWidth and StoredHeight values for the first
media file in the first sequence found.
Importing DDR-based footage
To find out if After Effects plug-ins are available for your digital disk recorder (DDR), contact your DDR manufac-
turer. For information on using your specific DDR with After Effects, refer to your DDR manufacturer’s plug-in
documentation.
Edit audio in Adobe Soundbooth or Adobe Audition
While working in After Effects, you may want to use the more comprehensive audio-editing capabilities of Adobe
Soundbooth or Adobe Audition to fine-tune your audio layers. You can use the Edit In Adobe Soundbooth or Edit
In Adobe Audition command to start Adobe Soundbooth or Adobe Audition from within After Effects.
If you edit an audio-only file (for example, a WAV file) in Adobe Soundbooth or Adobe Audition, you make changes
to the original file. If you edit a layer that contains both audio and video (for example, an AVI file), you edit a copy
of the layer’s audio file.
Important: Adobe Soundbooth is only available for Windows and for Mac OS running on Intel processors. Adobe
Audition is only available for Windows. Neither Adobe Soundbooth nor Adobe Audition are available for Mac OS
running on PowerPC processors.
1Selectthelayerthatcontainstheaudiothatyouwanttoedit.TheitemmustbeofatypethatiseditableinAdobe
Soundbooth or Adobe Audition.
2Choose Edit > Edit In Adobe Soundbooth or Edit > Edit In Adobe Audition to open the clip in Edit view in Adobe
Soundbooth or Adobe Audition.
3Edit the file, and then do one of the following:
•If you’re editing an audio-only layer, choose File > Save to apply your edits to the original audio file, or choose
File > Save As to apply your edits to a copy of the audio file. If you choose File > Save As, you need to reimport the
copy of the file into After Effects.
AFTER EFFECTS CS3
User Guide
77
•Ifyou’reeditingalayerthatcontainsbothaudioandvideo,chooseFile>SaveAs.Afteryousavethefile,import
it into After Effects, add it to the composition, and mute the original audio in the audio-video clip by deselecting
the Audio switch in the Timeline panel.
Note: Any effects applied to audio in After Effects aren’t included in the copy that is sent to Adobe Soundbooth or Adobe
Audition.
Importing 3D image files
3D files from other applications
After Effects can import 3D-image files saved in Softimage PIC, RLA, RPF, and Electric Image EI format. These 3D-
image files contain red, green, blue, and alpha (RGBA) channels, as well as auxiliary channels with optional infor-
mation, such as z depth, object IDs, texture coordinates, and more.
Note: Some 3D applications, such as Cinema 4D, can export an After Effects composition directly.
With RLA and RPF files, all of the auxiliary channels are included in a single file. Softimage PIC files have a corre-
sponding ZPIC file that contains the z-depth channel information. Although you can’t import a ZPIC file, you can
access the additional channel information as long as the ZPIC file is stored in the same folder as the imported PIC file.
Similarly, Electric Image (EI) files can have associated EIZ files with z-depth channel data. Just as with ZPIC files,
you cannot import EIZ files into After Effects; instead, you simply store them in the same folder as the EI files. For
information about creating EIZ files, see your Electric Image documentation.
After Effects can also import baked camera data, including focal length, film size, and transformation data, from
Maya project files as a single composition or two compositions.
Though you can import composited files with 3D information into After Effects, you cannot manipulate or create
3D models directly with After Effects.
A common technique when working in a 3D modeling application is to insert null objects, such as null lights or null
locator nodes in the locations where you want to composite in an image in After Effects. Then, after you have
importedthe3DfileintoAfterEffects,youcanusethesenullobjectsasareferencefortheplacementsofothervisual
elements.
After Effects treats each composited 3D file from another application as a single 2D layer. That layer, as a whole, can
be given 3D attributes and treated like any After Effects 3D layer, but the objects contained within that 3D file cannot
be manipulated individually in 3D space. To access the 3D depth information and other auxiliary channel infor-
mation in 3D image files, use the 3D Channel effects.
See also
“Working with 3D layers” on page 171
“Cameras, lights, and points of interest” on page 176
“3D Channel effects” on page 367
AFTER EFFECTS CS3
User Guide
78
Importing 3D images from Photoshop Extended and Illustrator
3D models in Photoshop
Adobe Photoshop Extended can import and manipulate 3D models in several popular formats, including 3D Studio
(.3ds) and Universal 3D (.u3d). You can manipulate these 3D models in Photoshop Extended and then save one or
more frames as PSD files that you then import into After Effects.
Vanishing Point exchange
When you use the Vanishing Point feature in Photoshop Extended, you can then use the File > Export For After
Effects CS3 (.vpe) command to save the results as a collection of PNG files—one for each plane—and a .vpe file that
describes the geometry of the scene. You can then import the .vpe file into After Effects. After Effects uses the infor-
mation in the .vpe file to recreate the scene as a composition containing a camera layer and one perspective-
corrected 3D layer for each PNG file.
The camera is on the negative z axis, at (x,y)=(0,0). The point of interest for the camera is in the center of the compo-
sition. The camera zoom is set according to the field of view in the Vanishing Point scene.
The 3D layers for the planes in the scene have a parent layer with its anchor point at the center of the composition,
so the whole scene can be transformed together.
Vanishing Point exchange only works well for images that have square pixels in Photoshop.
Illustrator 3D effects
The effects in the 3D category in Illustrator—Extrude & Bevel, Revolve, and Rotate—give a three-dimensional
appearance to any vector graphic object, including text and drawings. If you want to add depth to your vector art and
text, consider creating it in Illustrator, using the 3D effects, and then importing the results into After Effects.
See also
“Working with 3D layers” on page 171
“Cameras, lights, and points of interest” on page 176
Import RLA or RPF data into a camera layer
After Effects imports camera data saved with RLA or RPF sequence files. That data is incorporated into camera
layers—one for each camera in the sequence—that After Effects creates in the Timeline panel. You can access the
camera data of an imported RLA or RPF sequence and create a camera layer containing that data.
1Add the sequence to a composition, and select its layer in the Timeline panel.
2Choose Animation > Keyframe Assistant > RPF Camera Import.
Note: To create an RLA or RPF file with the camera data in 3D Studio Max, save your rendering in RPF format with
Coverage, Z Depth, and Alpha Channels enabled.
See also
“Working with 3D layers” on page 171
“Cameras, lights, and points of interest” on page 176
AFTER EFFECTS CS3
User Guide
79
Baking and importing Maya data
After Effects imports camera data from Maya project files. Before importing Maya camera information, you need to
bake it.Thismakesanimatingwithkeyframeseasierlaterinyourproject.Bakingplacesakeyframeateachframeof
the animation. You can have 0, 1, or a fixed number of keyframes for each camera or transform property. For
example, if a property is not animated in Maya, either no keyframes are set for this property or one keyframe is set
at the start of the animation. If a property has more than one keyframe, it must have the same number as all of the
other animation properties with more than one keyframe.
Reduce import time by creating or saving the simplest Maya file possible. In Maya, reduce keyframes by deleting
static channels before baking, and save a version of the Maya project that contains the camera animation only.
Note: The following transformation flags are not supported: query, relative, euler, objectSpace, worldSpace, worldSpace-
Distance, preserve, shear, scaleTranslation, rotatePivot, rotateOrder, rotateTranslation, matrix, boundingBox, bound-
ingBoxInvisible, pivots, CenterPivots, and zeroTransformPivots. After Effects skips these unsupported flags, and no
warnings or error messages appear.
By default, After Effects treats linear units specified in the Maya file as pixels.
You can import camera data from Maya project files (.ma) and work with the data as a single composition or two
compositions.
For each Maya file you import, After Effects creates either one or two compositions:
•If the Maya project has a square pixel aspect ratio, After Effects creates a single, square-pixel composition
containing the camera data and transformations.
•If the Maya project has a nonsquare pixel aspect ratio, After Effects creates two compositions. The first compo-
sition, which has a file name prefixed by Square, is a square-pixel composition containing the camera data. The
second, or parent, composition is a nonsquare-pixel composition that retains the dimensions of the original file
and contains the square-pixel composition. When working with imported camera data, use 3D layers and square-
pixel footage in the square-pixel composition, and use all nonsquare-pixel footage in the parent composition.
When you import a Maya file with a 1-node camera, After Effects creates a camera in the square-pixel composition
that carries the camera's focal length, film size, and transformation data.
When you import a Maya file with a 2-node or targeted camera, After Effects creates a camera and an additional
parent node in the square-pixel composition. The parent node contains only the camera’s transformation data. After
Effects imports 2-node cameras automatically with the locator node as the point of interest, with the camera's Auto-
Orientation option set to Orient Towards Point Of Interest.
After Effects doesn’t read 3-node cameras.
Note: After Effects reads only the rendering cameras in Maya files and ignores the orthographic and perspective cameras.
Therefore, always generate a rendering camera from Maya, even if it’s the same as the perspective camera. If you apply
the FilmFit camera setting, make sure to use either horizontal or vertical FilmFit, not fill.
After Effects can read Maya locator nodes, which enable you to track objects from the Maya scene as it is translated
into After Effects. After Effects creates a null layer and applies the relevant transformations to it if a Maya locator
node’s name contains the word Null,NULL, or null. Avoid parenting locator nodes to each other in Maya; instead,
parent the locator nodes to geometry.
Note: After Effects doesn’t read World or Underworld coordinates in the LocatorShape. Use a transform node to place them.
AFTER EFFECTS CS3
User Guide
80
See also
“Working with 3D layers” on page 171
“Cameras, lights, and points of interest” on page 176
Importing still images
Preparing still-image files for importing
You can import individual still images into After Effects or import a series of still images as a sequence. You can
import still images from Adobe applications such as Photoshop and Illustrator, or import images using the Adobe
Stock Photos service using Adobe Bridge. For information about the still-image formats that After Effects imports,
see “Supported import formats” on page 48.
After Effects works internally in an RGB color space, but it can import and convert CMYK images. However, when
possible, you should work in an RGB color space in applications such as Illustrator and Photoshop when creating
images for video, film, and other non-print media. Working in RGB provides a larger gamut and more accurately
reflects your final output.
BeforeyouimportastillimageintoAfterEffects,prepareitascompletelyaspossibletoreducerenderingtime.Itis
usually easier and faster to prepare a still image in its original application than to modify it in After Effects. Consider
doing the following to an image before importing it into After Effects:
•Make sure that the file format is supported by the operating system you plan to use.
•Crop the parts of the image that you do not want to be visible in After Effects.
Note: Illustrator files can have fractional dimensions (e.g., 216.5 x 275.5 pixels). When importing these files, After Effects
compensates for the fractional dimensions by rounding-up to the next whole number of pixels (e.g., 217 x 278 pixels).
This rounding results in a black line at the right (width) or bottom (height) edge of the imported image. When cropping
in Illustrator, make sure that the dimensions of the cropped area are whole numbers of pixels.
•If you want to designate areas as transparent, create an alpha channel or use the transparency tools in applications
such as Photoshop or Illustrator.
•If final output will be broadcast video, avoid using thin horizontal lines (such as 1-pixel lines) for images or text
because they may flicker as a result of interlacing. If you must use thin lines, add a slight blur so that the image or
text appears in both video fields instead of flickering between them. (See “About interlaced and noninterlaced
video” on page 70.)
•If final output will be broadcast video, make sure that important parts of the image fall within the action-safe and
title-safe zones. When you create a document in Illustrator or Photoshop using a preset for film and video, the safe
zones are shown as guide lines. (See “Work with safe zones, grids, guides, and rulers” on page 130.)
•If the final output will be broadcast video, keep colors within the broadcast-safe ranges. (See “Broadcast-safe
colors” on page 250.)
•Save the file using the correct naming convention. For example, if you plan to import the file into After Effects on
Windows, use a three-character file-name extension.
AFTER EFFECTS CS3
User Guide
81
•Set the pixel dimensions to the resolution and frame aspect ratio that you will use in After Effects. If you plan to
scaletheimageovertime,setimagedimensionsthatprovideenoughdetailatthelargestsizetheimagehasinthe
project. After Effects supports a maximum image size of 30,000 x 30,000 pixels for importing and rendering files,
except for PICT (4,000 x 4,000 pixels) and BMP (16,000 x 30,000 pixels). The size of image that you can import or
export is influenced by the amount of physical RAM available to After Effects. The maximum composition dimen-
sions are also 30,000 x 30,000 pixels.
Note: The image size or pixel dimensions setting in Photoshop (or other image-editing application) is relevant for the
preparation of image data for import into After Effects—not dpi (dots per inch) or ppi (pixels per inch) settings. The
image size determines how many pixels wide and tall an image is, whether those pixels are the tiny ones on a mobile
deviceorthebigonesonamotionbillboard.Thedpiorppisettingsarerelevanttoprintinganimageandtothescaleof
copied and pasted paths.
See also
“Memory usage and storage” on page 37
“Copy a path from Illustrator, Photoshop, or Fireworks” on page 324
Import a single still image or a still-image sequence
You can import still image files as individual footage items, or you can import a series of still image files as a still-
image sequence, which is a single footage item in which each still image is used as a single frame.
To import multiple image files as a single still-image sequence, the files must be in the same folder and use the same
numeric or alphabetic filename pattern (such as Seq1, Seq2, Seq3).
When you import a file that appears to After Effects to be one file in a still-image sequence, After Effects will by
default import all other files in the same folder that appear to be in the same sequence. Similarly, when you select
multiple files that appear to be in a sequence, After Effects will by default import them as a sequence. You can see
what After Effects is about to import by looking at the bottom of the Import dialog box. (You can also import images
and sequences by dragging files and folders into the Project panel.
To prevent After Effects from importing unwanted files when you want to import only a single file, or to prevent After
Effects from interpreting multiple files as a sequence, deselect the Sequence option in the Import dialog box. After
Effects remembers this setting and will henceforth use it as the default.
You can import multiple sequences from the same folder simultaneously by selecting files from different sequences
and selecting Multiple Sequences at the bottom of the Import dialog box.
When importing a sequence of still images, you can use the Force Alphabetical Order option in the Import dialog
box to import a sequence with gaps in its numbering (e.g., Seq1, Seq2, Seq3, Seq5). If you import a sequence with
gaps in its numbering without selecting this option, After Effects warns you of missing frames and replaces them
with placeholders.
After Effects uses settings of the first image in the sequence to determine how to interpret the images in the sequence.
If the image files in a sequence are of a layered file type—such as Adobe Photoshop or Adobe Illustrator
documents—then you can choose to import the sequence as a standard footage item, or as a composition in which
each layer in each file is imported as a separate sequence and appears as a separate layer in the Timeline panel.
Note: When you render a composition that contains a numbered sequence, the output module uses the start frame
number as the first frame number. For example, if you start to render on frame 25, the name of the file is 00025.
AFTER EFFECTS CS3
User Guide
82
A sequence of still-image files (left) becomes one image sequence when imported into After Effects (right).
See also
“Work with output module settings” on page 599
“Import footage items” on page 50
Import a still-image sequence as a single footage item
1Choose File > Import > File.
2Selectanyfileinthesequence.Toimportasubsetoffilesinasequence,selectthefirstfile,holddownShift,and
then select the last file to import.
3Choose Footage from the Import Kind menu.
4Click Open (Windows) or Import (Mac OS).
5In the [filename] dialog box, choose one of the following from the Choose Layer menu:
Merged Layers Imports the sequence as a sequence footage item in which the layers in the file, if any, are merged
into one layer.
Choose Layer Imports the sequence as a sequence footage item in which the same layer from each source file—for
example, layer 3—is imported and used in the sequence. If you choose this option for a PSD sequence, then you can
alsochoosewhethertoignorelayerstylesormergethemintothelayer.YoumustalsochooseaFootageDimensions
option: Layer Size matches the dimensions of the layer to the layer’s content; Document Size matches the dimensions
of the layer to the original document’s size.
6Click OK.
If at any time you decide that you want access to the individual components of the footage item, you can convert it
to a composition. See “Convert a merged footage item into a composition” on page 83.
AFTER EFFECTS CS3
User Guide
83
Import a still-image sequence as a composition
When you import a Photoshop or Illustrator file as a composition, you have access to the individual layers, blending
modes, adjustment layers, layer styles, masks, guides, and other features created in Photoshop or Illustrator. The
imported composition and a folder containing each of its layers as footage items appears in the Project panel.
1Choose File > Import > File.
2Selectanyfileinthesequence.Toimportasubsetoffilesinasequence,selectthefirstfile,holddownShift,and
then select the last file to import.
3Choose one of the following from the Import Kind menu:
Composition - Cropped Layers Import the layers with their original dimensions. This option makes it easier to
manipulate layers and speeds their rendering time.
Composition Import layers and have them match the dimensions of the composition. This option is helpful when
you need to align layers manually.
4Click Open (Windows) or Import (Mac OS).
Change the frame rate of a sequence
Whenyouimportasequenceofstillimages,itassumestheframeratespecifiedbytheSequenceFootagepreference
in the Import category. The default rate is 30 frames per second (fps). You can change the frame rate after importing
by reinterpreting the footage item:
❖Select the sequence in the Project panel, choose File > Interpret Footage > Main, and then enter a new value for
Assume This Frame Rate.
For more information, see “Change frame rate” on page 53.
Convert a merged footage item into a composition
When you import a layered file, such as a Photoshop or Illustrator file, as footage, all of its layers are merged together.
If at any time you decide that you want access to the individual components of the footage item, you can convert it
to a composition.
•To convert all instances of a footage item, select it in the Project panel and choose File > Replace Footage > With
Layered Comp.
•To convert only one instance of the footage item, select the layer in the Timeline panel, and choose Layer >
Convert To Layered Comp.
Note: It may take a few moments to convert a merged footage item to a layered composition.
Preparing and importing Photoshop files
Because After Effects includes the Photoshop rendering engine, After Effects imports all attributes of Photoshop
files, including position, blending modes, opacity, visibility, transparency (alpha channel), layer masks, layer groups
(imported as nested compositions), adjustment layers, common layer styles, layer clipping paths, vector masks,
image guides, and clipping groups.
To see a video tutorial on importing Photoshop files, visit the Adobe website at www.adobe.com/go/vid0252.
AFTER EFFECTS CS3
User Guide
84
A very convenient command within After Effects is Layer > New > Adobe Photoshop File, which adds a layer to a
composition and then opens the source of that layer in Photoshop for you to begin creating a visual element, such as
a background layer for your movie. The layer in Photoshop is created with the correct settings for your After Effects
composition. As with many of the Creative Suite applications, you can use the Edit Original command in After
Effects to open a PSD file in Photoshop, make and save changes, and have those changes appear immediately in the
movie that refers to the PSD source file. Even if you don’t use Edit Original, you can use the Reload Footage
command to have After Effects refresh its layers to use the current version of the PSD file. (See “Create a layer and
new Photoshop footage item” on page 137 and “Edit footage in its original application” on page 60.)
Adobe Photoshop supports a transparent area and one optional layer mask (alpha channel) for each layer in a file.
You can use these layer masks to specify how different areas within a layer are hidden or revealed. If you import one
layer, After Effects combines the layer mask (if present) with the transparent area and imports the layer mask as a
straight alpha channel.
If you import a layered Photoshop file as a merged file, After Effects merges the transparent areas and layer masks of
all the layers into one alpha channel that is premultiplied with white.
If the layered Photoshop file contains clipping groups, After Effects imports each clipping group as a precomposition
nested within the main composition. After Effects automatically applies the Preserve Underlying Transparency
option to each layer in the clipping-group composition, maintaining transparency settings. These nested precompo-
sitions have the same dimensions as the main composition. (Paul Tuersley provides a script that crops the precom-
positions to the size of their contents, while retaining their correct position in the main composition:
www.adobe.com/go/learn_ae_paulphotoshopcrop.)
WhenyouimportaPhotoshopfileasacomposition,vectormasksareconvertedtoAfterEffectsmasks.Youcanthen
modify and animate these masks within After Effects.
After Effects also supports blending modes and layer styles applied to the file. When you import a Photoshop file
with layer styles, you can choose the Editable Layer Styles option or the Merge Layer Styles Into Footage option:
Editable Layer Styles Matches appearance in Photoshop and preserves supported layer style properties as editable.
Note that a layer with a layer style interferes with intersection of 3D layers and the casting of shadows.
Merge Layer Styles Into Footage Layerstylesaremergedintothelayerforfasterrendering,buttheappearancemay
notmatchtheappearanceoftheimageinPhotoshop.Thisoptiondoesn’tinterferewithintersectionof3Dlayersor
casting of shadows.
Photoshop files can even contain video and animation layers. After Effects can import these files just as any other
Photoshop files, either as a footage item with all layers merged together or as a composition with each Photoshop
layer separate and editable in After Effects. (Working with Photoshop video layers requires QuickTime 7.1 or later.)
Photoshop layer groups are imported as individual compositions.
It is often valuable to group layers into Smart Objects in Photoshop so that you can import meaningful collections
of Photoshop layers as individual layers in After Effects. For example, if you used 20 layers to create your foreground
object and 30 layers to create your background object in Photoshop, you probably don’t need to import all of those
individual layers into After Effects if all that you want to do is animate your foreground object flying in front of your
background object; consider grouping them into a single foreground Smart Object and a single background Smart
Object before importing the PSD file into After Effects.
AFTER EFFECTS CS3
User Guide
85
Before you import a layered Photoshop file into After Effects, prepare it thoroughly to reduce preview and rendering
time. Avoid problems importing and updating Photoshop layers by doing the following:
•Organize and name layers. If you change a layer name in a Photoshop file after you have imported it into After
Effects, After Effects retains the link to the original layer. However, if you delete a layer, After Effects is unable to
find the original layer and lists it as Missing in the Project panel.
•Make sure that each layer has a unique name. This is not a requirement of the software, but it will help to keep you
from becoming confused.
See also
“Layer styles” on page 168
“Working with Photoshop and After Effects” on page 32
Preparing and importing Illustrator files
Before you save an Illustrator file for importing into After Effects, consider doing the following:
•Crop the image so that you are only saving the portion that you want to import into After Effects.
•To ensure that Illustrator files appear correctly in After Effects, select Create PDF Compatible File in the Illustrator
Options dialog box.
•To copy paths between Illustrator and After Effects, make sure that the AICB and Preserve Paths options are
selected in the Files & Clipboard section of the Illustrator Preferences dialog box. If you don’t select AICB in
Illustrator, After Effects prompts you when you attempt to paste the path.
•To ensure that files rasterize most faithfully in After Effects, save your file in AI format instead of Illustrator 8.x or
9.x EPS format.
When you import an Illustrator file, After Effects makes all empty areas transparent by converting them into an alpha
channel.
Note: When you’ve imported an Illustrator file, you can specify whether anti-aliasing is to be performed at higher quality
or at higher speed. Select the footage item in the Project panel and choose File > Interpret Footage > Main, and click the
More Options button at the bottom of the dialog box.
After Effects does not read embedded color profiles from Illustrator files. To ensure color fidelity, assign an input
color profile to the Illustrator footage item that matches the color profile with which the Illustrator file was created.
See also
“Interpret a footage item by assigning an input color profile” on page 245
“Copy a path from Illustrator, Photoshop, or Fireworks” on page 324
Importing Cineon sequences
You can import Cineon 4.5 or Digital Picture Exchange (DPX) files directly into an After Effects project as individual
frames or as a sequence of numbered stills. Once you have imported a Cineon file, you can use it in a composition
and then render the composition as a Cineon sequence.
AFTER EFFECTS CS3
User Guide
86
Cineon files are commonly used to transfer motion-picture film to a digital format. To preserve the full dynamic
range of motion-picture film, Cineon files are stored using logarithmic 10-bpc color. However, After Effects inter-
nally uses 8-bpc, 16-bpc, or 32-bpc color, depending on the color bit depth of the project. Work with Cineon files in
a 16- or 32-bpc project—by default, After Effects stretches the logarithmic values to the full range of values available.
In most cases, you should use color management features to automatically interpret the colors of Cineon footage.
(See “Working with Cineon footage items” on page 251.) You can, though, use the Cineon Settings dialog box to
control the conversion manually.
Manual settings in the Cineon Settings dialog box:
Converted Black Point Specifies the black point used for the layer in After Effects.
Converted White Point Specifies the white point used for the layer in After Effects.
10 Bit Black Point Specifies the black level (minimum density) for converting a 10-bit Cineon layer.
10 Bit White Point Specifies the white level (maximum density) for converting a 10-bit Cineon layer.
Current Gamma Specifies the target gamma value.
Highlight Rolloff Specifies the rolloff value used to correct bright highlights. To get over range values when working
in 32 bpc, set the value to 0.
Logarithmic Conversion Converts the Cineon sequence from log color space to the target gamma specified by the
Current Gamma setting. When you’re ready to produce output from the Cineon file, it is important that you reverse
the conversion. (To convert from logarithmic to linear, set Current Gamma to 1.)
Units Specifies the units After Effects uses to display dialog values.
See also
“Set the color depth” on page 234
“Color management” on page 241
Introduction to Camera Raw
Note: This document describes features of Photoshop Camera Raw 4.1.
About camera raw files
Acamera raw file contains unprocessed, uncompressed grayscale picture data from a digital camera’s image sensor,
along with information about how the image was captured (metadata). Photoshop Camera Raw software interprets
the camera raw file, using information about the camera and the image’s metadata to construct and process a color
image.
Think of a camera raw file as your photo negative. You can reprocess the file at any time, achieving the results that
you want by making adjustments for white balance, tonal range, contrast, color saturation, and sharpening. When
you adjust a camera raw image, the original camera raw data is preserved. Adjustments are stored as metadata in an
accompanying sidecar file, in a database, or in the file itself (in the case of DNG format).
AFTER EFFECTS CS3
User Guide
87
When you shoot JPEG files with your camera, the camera automatically processes the JPEG to enhance and
compress the image. You generally have little control over how this processing occurs. Shooting camera raw images
with your camera gives you greater control than shooting JPEG images, because camera raw does not lock you into
processing done by your camera. You can still edit JPEG and TIFF images in Camera Raw, but you will be editing
pixels that were already processed by the camera. Camera raw files always contain the original, unprocessed pixels
from the camera.
To shoot camera raw images, you need to set your camera to save files in its own camera raw file format.
Note: The Photoshop Raw format (.raw) is a file format for transferring images between applications and computer
platforms. Don’t confuse Photoshop raw with camera raw file formats.
Digital cameras capture and store camera raw data with a linear tone response curve (gamma 1.0). Both film and the
human eye have a nonlinear, logarithmic response to light (gamma greater than 2). An unprocessed camera raw
image viewed as a grayscale image would seem very dark, because what appears twice as bright to the photosensor
and computer seems less than twice as bright to the human eye.
About Camera Raw
Camera Raw software is included as a plug-in with Adobe After Effects and Adobe Photoshop, and also adds
functionality to Adobe Bridge. Camera Raw gives each of these applications the ability to import and work with
camera raw files. You can also use Camera Raw to work with JPEG and TIFF files.
You must have Photoshop or After Effects installed to open files in the Camera Raw dialog box from Adobe Bridge.
However, if Photoshop or After Effects is not installed, you can still preview the images and see their metadata in
Adobe Bridge. If another application is associated with the image file type, it’s possible to open the file in that appli-
cation from Adobe Bridge.
Using Adobe Bridge, you can apply, copy, and clear image settings, and you can see previews and metadata for
camera raw files without opening them in the Camera Raw dialog box. The preview in Adobe Bridge is a JPEG image
generated using the current image settings; the preview is not the raw camera data itself, which would appear as a
very dark grayscale image.
Note: A caution icon appears in the thumbnails and preview image in the Camera Raw dialog box while the preview
is generated from the camera raw image.
You can modify the default settings that Camera Raw uses for a particular model of camera. For each camera model,
you can also modify the defaults for a particular ISO setting or a particular camera (by serial number). You can
modify and save image settings as presets for use with other images.
When you use Camera Raw to make adjustments (including straightening and cropping) to a camera raw image, the
image’s original camera raw data is preserved. The adjustments are stored for each image in either the Camera Raw
database, as metadata embedded in the image file, or in a sidecar XMP file (a metadata file that accompanies a camera
raw file). For more information, see “Specify where Camera Raw settings are stored” on page 104.
After you process and edit a camera raw file using the Camera Raw plug-in, an icon appears in the image
thumbnail in Adobe Bridge.
If you open a camera raw file in Photoshop, you can save the image in other image formats, such as PSD, JPEG, Large
Document Format (PSB), TIFF, Cineon, Photoshop Raw, PNG, or PBM. From the Camera Raw dialog box in
Photoshop, you can save the processed files in Digital Negative (DNG), JPEG, TIFF, or Photoshop (PSD) formats.
Although Photoshop Camera Raw software can open and edit a camera raw image file, it cannot save an image in a
camera raw format.
AFTER EFFECTS CS3
User Guide
88
Note: In Photoshop, the Camera Raw dialog box is automatically suppressed when you use a batch of files for a web photo
gallery, picture package, or contact sheet.
As new versions of Camera Raw become available, you can update this software by installing a new version of the
plug-in. You can check for updates to Adobe software by choosing Help > Updates.
For up-to-date documentation for Camera Raw, go to the Adobe website at
www.adobe.com/go/learn_ps_camerarawhelp.
Different camera models save camera raw images in many different formats, and the data must be interpreted differ-
ently for these formats. Camera Raw includes profiles for many camera models, and it can interpret many camera
raw formats.
Note: For a list of supported cameras and for more information about Camera Raw, see
www.adobe.com/go/learn_ps_cameraraw.
About the Digital Negative (DNG) format
The Digital Negative (DNG) format is a non-proprietary, publicly documented, and widely supported format for
storing raw camera data. Hardware and software developers use DNG because it results in a flexible workflow for
processing and archiving camera raw data. You may also use DNG as an intermediate format for storing images that
were originally captured using a proprietary camera raw format.
Because DNG metadata is publicly documented, software readers such as Camera Raw do not need camera-specific
knowledge to decode and process files created by a camera that supports DNG. If support for a proprietary format
is discontinued, users may not be able to access images stored in that format, and the images may be lost forever.
Because DNG is publicly documented, it is far more likely that raw images stored as DNG files will be readable by
software in the distant future, making DNG a safer choice for archival storage.
DNG is an extension of the TIFF 6.0 format and is compatible with the TIFF-EP standard. It is possible (but not
required) for a DNG file to simultaneously comply with both the Digital Negative specification and the TIFF-EP
standard.
Metadata for adjustments made to images stored as DNG files can be embedded in the DNG file itself instead of in
a sidecar XMP file or in the Camera Raw database.
YoucanconvertcamerarawfilestotheDNGformatbyusingtheAdobeDNGConverterortheCameraRawdialog
box. For more information on the DNG format and DNG Converter, see www.adobe.com/go/learn_ps_dng.
Processing images with Camera Raw
1. Copy camera raw files to your hard disk, organize them, and (optionally) convert them to DNG.
Before you do any work on the images that your camera raw files represent, transfer them from the camera’s memory
card, organize them, give them useful names, and otherwise prepare them for use. Use the Get Photos From Camera
command in Adobe Bridge to accomplish these tasks automatically.
2. Open the image files in Camera Raw.
You can open camera raw files in Camera Raw from Adobe Bridge, After Effects, or Photoshop. You can also open
JPEG and TIFF files in Camera Raw from Adobe Bridge. (See “Open images in Camera Raw” on page 92.)
To see a video tutorial on importing images with Camera Raw, go to the Adobe website at
www.adobe.com/go/vid0005.
AFTER EFFECTS CS3
User Guide
89
3. Adjust color.
Color adjustments include white balance, tone, and saturation. You can make most adjustments on the Basic tab, and
then use controls on the other tabs to fine-tune the results. If you want Camera Raw to analyze your image and apply
approximate tonal adjustments, click Auto on the Basic tab.
To apply the settings used for the previous image, or to apply the default settings for the camera model, camera, or
ISO settings, choose the appropriate command from the Camera Raw Settings menu . (See “Apply saved Camera
Raw settings” on page 105.)
To see a video tutorial on adjusting images with Camera Raw, go to the Adobe website at
www.adobe.com/go/vid0006.
To see a video tutorial on adjusting multiple images with Camera Raw, go to the Adobe website at
www.adobe.com/go/vid0007.
4. Make other adjustments and image corrections.
Use other tools and controls in the Camera Raw dialog box to perform such tasks as sharpening the image, reducing
noise, correcting for lens defects, and retouching.
5. (Optional) Save image settings as a preset or as default image settings.
To apply the same adjustments to other images later, save the settings as a preset. To save the adjustments as the
defaults to be applied to all images from a specific camera model, a specific camera, or a specific ISO setting, save
the image settings as the new Camera Raw defaults. (See “Save, reset, and load Camera Raw settings” on page 104.)
6. Set workflow options for Photoshop.
Set options to specify how images are saved from Camera Raw and how Photoshop should open them. You can
accesstheWorkflowOptionssettingsbyclickingthelinkbeneaththeimagepreviewintheCameraRawdialogbox.
7. Save the image, or open it in Photoshop or After Effects.
When you finish adjusting the image in Camera Raw, you can apply the adjustments to the camera raw file, open the
adjusted image in Photoshop or After Effects, save the adjusted image to another format, or cancel and discard
adjustments. If you open the Camera Raw dialog box from After Effects or Photoshop, the Save and Done buttons
are unavailable.
Save Applies the Camera Raw settings to the images and saves copies of them in JPEG, PSD, TIFF, or DNG format.
Press Alt (Windows) or Option (Mac OS) to suppress the Camera Raw Save Options dialog box and save the files
using the last set of save options. (See “Save a camera raw image in another format” on page 93.)
Open or OKOpens copies of the camera raw image files (with the Camera Raw settings applied) in Photoshop or
After Effects. The original camera raw image file remains unaltered. Press Shift while clicking Open to open the raw
file in Photoshop as a Smart Object. At any time, you can double-click the Smart Object layer that contains the raw
file to adjust the Camera Raw settings.
Done Closes the Camera Raw dialog box and stores file settings either in the camera raw database file, in the sidecar
XMP file, or in the DNG file.
Cancel Cancels the adjustments specified in the Camera Raw dialog box.
Import and interpret camera raw files
You can import sequences of camera raw files much as you import sequences of other kinds of still image files.
AFTER EFFECTS CS3
User Guide
90
After Effects applies the settings for the first camera raw image in the sequence to all of the images in the sequence
that do not have their own XMP sidecar files. After Effects does not check the Camera Raw database for image
settings.
Note: Camera raw files are uncompressed. Their large size may increase rendering time.
1Choose File > Import > File.
2Select the camera raw file, and click Open.
3Make any necessary adjustments in the Camera Raw dialog box, and click OK.
You can adjust a camera raw image after importing it. To open the image in the Camera Raw dialog box, select the
footage item in the Project panel, choose File > Interpret Footage > Main, and click More Options.
Note: You can’t assign an input color profile to a camera raw image for use in a color-managed project. For information
on how colors are automatically interpreted, see “Interpret a footage item by assigning an input color profile” on
page 245.
See also
“Import a single still image or a still-image sequence” on page 81
“Color management” on page 241
Camera Raw dialog box overview
Camera Raw dialog box
A. Filmstrip B. Toggle Film strip C. Camera, file name, and Exif information D. Toggle full screen mode E. Image adjustment tabs
F. Histogram G. Camera Raw Settings menu H. Zoom levels I. Clicktodisplayworkflowoptions J. Navigation arrows K. Adjustment sliders
A F GDCB E
H JI K
AFTER EFFECTS CS3
User Guide
91
Note: Somecontrols,suchastheWorkflowOptionslink,thatareavailablewhenyouopentheCameraRawdialogbox
from Adobe Bridge or Photoshop are not available when you open the Camera Raw dialog box from After Effects.
Camera Raw Settings menu
To open the Camera Raw Settings menu, click the button in the upper-right corner of any of the image
adjustment tabs. Several of the commands in this menu are also available from the Edit > Develop Settings menu in
Adobe Bridge.
Camera Raw view controls
Zoom tool Sets the preview zoom to the next higher preset value when you click the preview image. Alt-click
(Windows) or Option-click (Mac OS) to use the next lower zoom value. Drag the Zoom tool in the preview image
to zoom in on a selected area. To return to 100%, double-click the Zoom tool.
Hand tool Moves the image in the preview window if the preview image is set at a zoom level higher than 100%.
Hold down the spacebar to temporarily activate the Hand tool while using another tool. Double-click the Hand tool
to fit the preview image to the window.
Select Zoom Level Choose a magnification setting from the menu or click the Select Zoom Level buttons.
Preview Displays a preview of the image adjustments made in the current tab, combined with the settings in the
other tabs. Deselect to show the image with the original settings of the current tab combined with the settings in the
other tabs.
RGB Shows the red, green, and blue values of the pixel under the pointer in the preview image.
Shadows and Highlights Displays shadow and highlight clipping. Clipped shadows appear in blue, and clipped
highlights appear in red. Highlight clipping is shown if any one of the three RGB channels is clipped (fully saturated
with no detail). Shadow clipping is shown if all three RGB channels are clipped (black with no detail).
Image adjustment tabs
Basic Adjust white balance, color saturation, and tonality.
Tone Curve Fine-tune tonality using a Parametric curve and a Point curve.
Detail Sharpen images or reduce noise.
HSL / Grayscale Fine-tune colors using Hue, Saturation, and Luminance adjustments.
Split Toning Color monochrome images or create special effects with color images.
Lens Corrections Compensate for chromatic aberration and vignetting caused by the camera lens.
Camera Calibration Correct a color cast in the shadows and adjust non-neutral colors to compensate for the
difference between the behavior of your camera and the Camera Raw profile for your camera model.
Presets Save and apply sets of image adjustment settings as presets.
Work with the Camera Raw cache in Adobe Bridge
When you view camera raw files in Adobe Bridge, the thumbnails and previews use either the default settings or your
adjustedsettings.ThecacheinAdobeBridgeandtheCameraRawcachestoredataforthefilethumbnails,metadata,
and file information. Caching this data shortens the loading time when you return to a previously viewed folder.
Because caches can become very large, you may want to purge the cache or limit its size. You can also purge and
regenerate the cache if you suspect that it is corrupted or old. Purging the cache deletes thumbnail information and
metadata added since the camera raw file was opened in Adobe Bridge.
AFTER EFFECTS CS3
User Guide
92
Note: The Camera Raw cache holds data for about 200 images for each gigabyte of disk storage allocated to it. By default,
the Camera Raw cache is set to a maximum size of 1 GB. You can increase its limit in the Camera Raw preferences.
1In Adobe Bridge, choose Edit > Camera Raw Preferences (Windows) or Bridge > Camera Raw Preferences
(Mac OS), or, with the Camera Raw dialog box open, click the Open Preferences Dialog button .
2Do any of the following:
•To change the cache size, enter a Maximum Size value.
•To purge the camera raw cache, click the Purge Cache button.
•To change the location of the camera raw cache, click Select Location.
Navigating, opening, and saving images with Camera
Raw
Process, compare, and rate multiple images in Camera Raw
The most convenient way to work with multiple camera raw images is to use the Filmstrip view in Camera Raw,
which opens by default when you open multiple images in Camera Raw from Adobe Bridge.
Images can have three states in Filmstrip view: deselected, selected (but not active), and active (also selected). In
general, adjustments are applied to all selected images.
You can also synchronize settings to apply settings from the active image to all selected images. You can quickly apply
a set of adjustments to an entire set of images—such as all shots taken under the same conditions—and then do fine-
tuning on the individual shots later, after you’ve determined which you’ll use for your final output.
•To select an image, click its thumbnail. To select a range of images, Shift-click two thumbnails. To add an image
to a selection, Ctrl-click (Windows) or Command-click (Mac OS) its thumbnail.
•To change which image is active without changing which images are selected, click a navigation arrow at
the bottom of the preview pane.
•To apply settings from the active image to all selected images, click the Synchronize button at the top of the
Filmstrip pane and choose which settings to synchronize.
•To apply a star rating, click a rating under the image thumbnail.
•To mark selected images for deletion, click Mark For Deletion .
A red cross appears in the thumbnail of an image marked for deletion. The file is sent to the Recycle Bin (Windows) or
Trash (Mac OS) when you close the Camera Raw dialog box. (If you decide to keep an image that you marked for deletion,
select it in the Thumbnail pane and click Mark For Deletion again, before you close the Camera Raw dialog box.)
Open images in Camera Raw
•To process raw images in Camera Raw, select one or more camera raw files in Adobe Bridge, and then choose
File > Open In Camera Raw or press Ctrl+R (Windows) or Command+R (Mac OS). When you finish making
adjustments in the Camera Raw dialog box, click Done to accept changes and close the dialog box. You can also
click Open to open a copy of the adjusted image in Photoshop.
AFTER EFFECTS CS3
User Guide
93
•To process JPEG or TIFF images in Camera Raw, select one or more JPEG or TIFF files in Adobe Bridge, and then
choose File > Open In Camera Raw or press Ctrl+R (Windows) or Command+R (Mac OS). When you finish
making adjustments in the Camera Raw dialog box, click Done to accept changes and close the dialog box. You
can specify whether JPEG or TIFF images with Camera Raw settings are always opened in Camera Raw in the
JPEG and TIFF Handling section of the Camera Raw preferences. You can also specify that JPEG and TIFF images
are opened in Camera Raw in the Thumbnail section of the Bridge preferences and the File Handling section of
the Photoshop preferences.
•To import camera raw images in Photoshop, select one or more camera raw files in Adobe Bridge, and then choose
File > Open With > Photoshop CS3. (You can also choose File > Open In Photoshop, and browse to select camera
raw files.) When you finish making adjustments in the Camera Raw dialog box, click Open to accept changes.
Press Shift while clicking Open to open the image as a Smart Object in Photoshop. At any time, you can double-
click the Smart Object layer that contains the raw file to adjust the Camera Raw settings.
Shift-double-click a thumbnail in Adobe Bridge to open a camera raw image in Photoshop without opening the
Camera Raw dialog box. Hold down Shift while choosing File > Open to open multiple selected images.
•To import camera raw images in After Effects using Adobe Bridge, select one or more camera raw files in Adobe
Bridge, and then choose File > Place In After Effects. (You can also choose a File > Import command in After
Effects and browse to select camera raw files.) When you finish making adjustments in the Camera Raw dialog
box, click OK to accept changes.
•To import TIFF and JPEG files into After Effects using Camera Raw, select File > Import in After Effects, select
All Files from the Enable menu (Mac OS) or Files of Type menu (Windows) in the After Effects Import dialog box.
Select the file to import, select Camera Raw from the Format menu, and click Open.
•Placing or dragging image stacks from Adobe Bridge into After Effects imports them as an image sequence. Add
an extra bullet specific to importing camera raw files as a sequence into After Effects. Camera Raw settings applied
to the first camera raw file upon import are applied to the remaining files in the sequence unless an XMP sidecar
fileispresentforanysubsequentfileinthesequence.Inthatcase,thesettingsintheXMPfileorintheDNGfile
are applied to that specific frame in the sequence, all other frames use the settings that the first file in the sequence
specifies.
Save a camera raw image in another format
You can save camera raw files from the Camera Raw dialog box in PSD, TIFF, JPEG, or DNG formats.
When you use the Save command in the Camera Raw dialog box, files are placed in a queue to be processed and
saved. This is useful if you are processing several files in the Camera Raw dialog box and saving them in the same
format.
1In the Camera Raw dialog box, click the Save button in the lower-left corner of the dialog box.
Alt-click (Windows) or Option-click (Mac OS) Save to suppress the Camera Raw Save Options dialog box when
saving a file.
2In the Save Options dialog box, specify the following options:
Destination Specifies where to save the file. If necessary, click the Select Folder button and navigate to the location.
File Naming Specifies the file name using a naming convention that includes elements such as date and camera serial
number. Using informative file names based on a naming convention helps you keep image files organized.
3Choose a file format from the Format menu.
4Click Save.
AFTER EFFECTS CS3
User Guide
94
Format options
Digital Negative Saves a copy of the camera raw file in the DNG file format.
•Compressed (lossless) Uses lossless compression, meaning that no information is lost while reducing the file size.
•Convert To Linear Image Stores the image data in an interpolated (demosaiced) format. The resulting interpolated
image can be interpreted by other software even if that software does not have a profile for the digital camera that
captured the image.
•Embed Original Raw File Stores all of the original camera raw image data in the DNG file.
•JPEG Preview Embeds a JPEG preview in the DNG file. If you decide to embed a JPEG preview, you can choose
the preview size. If you embed JPEG previews, other applications can view the contents of the DNG file without
parsing the camera raw data.
JPEG Saves copies of the camera raw files in JPEG (Joint Photographic Experts Group) format. To specify the
amount of compression, enter a value from 0 to 12 or choose from the menu. Entering a higher value, or choosing
High or Maximum, applies less compression and increases file size and image quality. JPEG format is commonly
used to display photographs and other continuous-tone images in web photo galleries, slideshows, presentations, and
other online services.
TIFF Saves copies of the camera raw files as TIFF (Tagged-Image File Format) files. Specify whether to apply no
compression, or LZW or ZIP file compression. TIFF is a flexible bitmap image format supported by virtually all
paint, image-editing, and page-layout applications. TIFF provides greater compression and compatibility with other
applications than does PSD format.
Photoshop Saves copies of the camera raw files in the PSD file format. You can specify whether to preserve cropped
pixel data in the PSD file.
Adjusting color in Camera Raw
Using histogram and RGB levels in Camera Raw
Ahistogram is a representation of the number of pixels at each luminance value in an image. A histogram that has
nonzero values for each luminance value indicates an image that takes advantage of the full tonal scale. A histogram
that doesn’t use the full tonal range corresponds to a dull image that lacks contrast. A histogram with a spike at the
left side indicates shadow clipping; a histogram with a spike on the right side indicates highlight clipping.
Select Shadows or Highlights to see, in the preview image, which pixels are being clipped. For more information, see
“Preview highlight and shadow clipping in Camera Raw” on page 95.
One common task for adjusting an image is to spread out the pixel values more evenly from left to right on the
histogram, instead of having them bunched up at one end or the other.
A histogram is made up of three layers of color that represent the red, green, and blue color channels. White appears
when all three channels overlap; yellow, magenta, and cyan appear when two of the RGB channels overlap (yellow
equals the red + green channels, magenta equals the red + blue channels, and cyan equals the green + blue channels).
The histogram changes automatically as you adjust the settings in the Camera Raw dialog box.
The RGB values of the pixel under the pointer (in the preview image) appear below the histogram.
AFTER EFFECTS CS3
User Guide
95
Note: You can also use the Color Sampler tool to place up to nine color samplers in the preview image. The RGB values
appear above the preview image. To remove a color sampler, Alt-click (Windows) or Option-click (Mac OS) it. To clear
the color samplers, click Clear Samplers.
The Camera Raw dialog box displays the RGB values of the pixel under the pointer.
Preview highlight and shadow clipping in Camera Raw
Clipping occurs when a pixel’s color values are higher than the highest value or lower than the lowest value that can
be represented in the image; overbright values are clipped to output white, and overdark values are clipped to output
black. The result is a loss of image detail.
•To see which pixels are being clipped with the rest of the preview image, select Shadows or Highlights options
beneath the histogram.
•To see only the pixels that are being clipped, press Alt (Windows) or Option (Mac OS) while dragging the
Exposure, Recovery, or Black sliders.
For highlights, pixels that are clipped in all color channels appear white. For shadows, pixels that are clipped in all
color channels appear black. Clipping in one or two channels is shown by the primary color (red, green, blue) or a
combined color (cyan, magenta, yellow).
Note: In some cases, clipping occurs because the color space that you are working has a gamut that is too small. If your
colors are being clipped, consider working in a color space with a large gamut, such as ProPhoto RGB.
White balance controls in Camera Raw
In very simple terms, adjusting the white balance is a matter of identifying what objects in the image should be
neutral-colored (white or gray) and then adjusting the colors in the image to make those objects neutral-colored. A
whiteorgrayobjectinascenetakesonthecolorcastbytheambientlightorflashusedtoshootthepicture.When
you use the White Balance tool to specify an object that should be white or gray, Camera Raw can determine the
color of the light in which the scene was shot and then adjust for scene lighting automatically.
Color temperature (in Kelvins) is used as a measure of scene lighting because natural and incandescent light sources
give off light in a predictable distribution according to their temperature.
A digital camera records the white balance at the time of exposure as a metadata entry. The Camera Raw plug-in
reads this value and makes it the initial setting when you open the file in the Camera Raw dialog box. This setting
usually yields the correct color temperature, or nearly so. You can adjust the white balance if it is not quite right.
Note: Not all color casts are a result of incorrect white balance. Use the controls in the Calibrate tab to correct a color
cast that remains after the white balance is adjusted.
AFTER EFFECTS CS3
User Guide
96
The Basic tab in the Camera Raw dialog box has three controls for correcting a color cast in an image:
White Balance Camera Raw applies the white balance setting and changes the Temperature and Tint properties in
the Basic tab accordingly. Use these controls to fine-tune the color balance.
•As Shot Uses the camera’s white balance settings, if they are available.
•Auto Calculates the white balance based on the image data.
Note: If Camera Raw doesn’t recognize the white balance setting of a camera, choosing As Shot is the same as choosing Auto.
Temperature Sets the white balance to a custom color temperature. Decrease Temperature to correct a photo taken
with a lower color temperature of light; the Camera Raw plug-in makes the image colors bluer to compensate for the
lower color temperature (yellowish) of the ambient light. Conversely, increase Temperature to correct a photo taken
with a higher color temperature of light; the image colors become warmer (yellowish) to compensate for the higher
color temperature (bluish) of the ambient light.
Note: The range and units for the Temperature and Tint controls are different when you are adjusting a non-camera raw
image, such as a TIFF or JPEG image. For instance, Camera Raw provides a true-temperature adjustment slider for raw
files from 2,000 Kelvin to 50,000 Kelvin. For JPEG or TIFF files, Camera Raw attempts to approximate a different color
temperature or white balance, but because the original value was already used to alter the pixel data in the file, Camera
Raw does not provide the true Kelvin temperature scale. In these instances an approximate scale of -100 to 100 is used
in place of the temperature scale.
Correcting the white balance
A. Moving the Temperature slider to the right corrects a photo taken with a higher color temperature of light B. Moving the Temperature slider
to the left corrects a photo taken with a lower color temperature of light C. Photo after color temperature adjustment
Tint Sets the white balance to compensate for a green or magenta tint. Decrease Tint to add green to the image;
increase Tint to add magenta.
To adjust the white balance quickly, select the White Balance tool , and then click an area in the preview image
that should be a neutral gray or white. The Temperature and Tint properties adjust to make the selected color exactly
neutral (if possible). If you’re clicking whites, choose a highlight area that contains significant white detail rather than a
specular highlight. You can double-click the White Balance button to reset White Balance to As Shot.
A
C
B
AFTER EFFECTS CS3
User Guide
97
Adjust tone in Camera Raw
You adjust the image tonal scale using the tone controls in the Basic tab.
When you click Auto at the top of the tone controls section of the Basic tab, Camera Raw analyzes the camera raw
image and makes automatic adjustments to the tone controls (Exposure, Recovery, Fill Light, Blacks, Brightness, and
Contrast).
You can also apply automatic settings separately for individual tone controls. To apply an automatic adjustment to
an individual tone control, such as Exposure or Recovery, press Shift and double-click the slider. To return an
individual tone control to its original value, double-click its slider.
When you adjust tone automatically, Camera Raw ignores any adjustments previously made in other tabs (such as
fine-tuning of tone in the Curves tab). For this reason, you should usually apply automatic tone adjustments first—
if at all—to get an initial approximation of the best settings for your image. If you are very careful during shooting
and have deliberately shot with different exposures, you probably don’t want to undo that work by applying
automatictoneadjustments.Ontheotherhand,youcanalwaystryclickingAutoandthenundotheadjustmentsif
you don’t like them.
Previews in Adobe Bridge use the default image settings. If you want the default image settings to include automatic
tone adjustments, select Apply Auto Tone Adjustments in the Default Image Settings section of the Camera Raw
preferences.
Note: If you are comparing images based on their previews in Adobe Bridge, you may want to leave the Apply Auto Tone
Adjustments preference deselected, which is the default. Otherwise, you’ll be comparing images that have already been
adjusted.
As you make adjustments, keep an eye on the end points of the histogram, or use the shadow and highlight clipping
previews.
While moving the Exposure, Recovery, or Blacks slider, hold down Alt (Windows) or Option (Mac OS) to preview
where highlights or shadows are clipped. Move the slider until clipping begins, and then reverse the adjustment
slightly. (For more information, see “Preview highlight and shadow clipping in Camera Raw” on page 95.)
•To manually adjust a tone control, drag the slider, type a number in the text box, or select the value in the text box
and press the Up or Down Arrow key.
•To reset a value to its default, double-click the slider control.
Exposure Adjusts the overall image brightness, with a greater effect in the high values. Decrease Exposure to darken
the image; increase Exposure to brighten the image. The values are in increments equivalent to f-stops. An
adjustment of +1.50 is similar to widening the aperture 1-1/2 stops. Similarly, an adjustment of -1.50 is similar to
reducing the aperture 1-1/2 stops. (Use Recovery to bring highlight values down.)
Recovery Attempts to recover details from highlights. Camera Raw can reconstruct some details from areas in which
one or two color channels are clipped to white.
Fill Light Attempts to recover details from shadows, without brightening blacks. Camera Raw can reconstruct some
details from areas in which one or two color channels are clipped to black. Using Fill Light is similar to using the
shadows portion of the Photoshop Shadow/Highlight filter or the After Effects Shadow/Highlight effect.
Blacks Specifies which input levels are mapped to black in the final image. Increasing Blacks expands the areas that
are mapped to black. This sometimes creates the impression of increased contrast in the image. The greatest change
is in the shadows, with much less change in the midtones and highlights. Using the Blacks slider is similar to using
the black point slider for input levels when using the Photoshop Levels command or the After Effects Levels effect.
AFTER EFFECTS CS3
User Guide
98
Brightness Adjusts the brightness or darkness of the image, much as the Exposure property does. However, instead
of clipping the image in the highlights or shadows, Brightness compresses the highlights and expands the shadows
when you move the slider to the right. Often, the best way to use this control is to set the overall tonal scale by first
setting Exposure, Recovery, and Blacks; then set Brightness. Large Brightness adjustments can affect shadow or
highlight clipping, so you may want to readjust the Exposure, Recovery, or Blacks property after adjusting
Brightness.
Contrast Increases or decreases image contrast, mainly affecting midtones. When you increase contrast, the middle-
to-dark image areas become darker, and the middle-to-light image areas become lighter. Generally, you use the
Contrast property to adjust the contrast of the midtones after setting the Exposure, Blacks, and Brightness values.
Fine-tune tone curves in Camera Raw
Use tone curves to fine-tune images after you’ve made tone adjustments in the Basic tab.The tone curves represent
changes made to the tonal scale of an image. The horizontal axis represents the original tone values of the image
(input values), with black on the left and progressively lighter values toward the right. The vertical axis represents
the changed tone values (output values), with black on the bottom and progressing to white at the top.
Ifapointonthecurvemovesup,theoutputisalightertone;ifitmovesdown,theoutputisadarkertone.Astraight,
45-degree line indicates no changes to the tone response curve: the original input values exactly match the output
values.
Use the tone curve in the Parametric tab to adjust the values in specific tonal ranges in the image. The areas of the
curve affected by the region properties (Highlights, Lights, Darks, or Shadows) depend on where you set the split
controlsatthebottomofthegraph.Themiddleregionproperties(DarksandLights)mostlyaffectthemiddleregion
of the curve. The Highlight and Shadows properties mostly affect the ends of the tonal range.
❖To adjust tone curves, do any of the following:
•Drag the Highlights, Lights, Darks, or Shadows slider in the Parametric tab. You can expand or contract the curve
regions that the sliders affect by dragging the region divider controls along the horizontal axis of the graph.
•Drag a point on the curve in the Point tab. As you drag the point, the Input and Output tonal values are displayed
beneath the tone curve.
•Choose an option from the Curve menu in the Point tab. The setting you choose is reflected in the Point tab, but
not in the settings in the Parametric tab. Medium Contrast is the default setting.
Clarity, Saturation, and Vibrance controls in Camera Raw
You can change the color saturation (vividness or color purity) of all colors by adjusting the Clarity, Vibrance, and
Saturation controls on the Basic tab. (To adjust saturation for a specific range of colors, use the controls on the HSL
/ Grayscale tab.)
Clarity Adds depth to an image by increasing local contrast. This setting is similar to a large-radius unsharp mask.
When using this setting, it is best to zoom in to 100% or greater. To maximize the effect, increase the setting until
you see halos near the edge details of the image and then reduce the setting slightly.
Vibrance Adjusts the saturation so that clipping is minimized as colors approach full saturation, changing the
saturation of all lower-saturated colors with less effect on the higher-saturated colors. Vibrance also prevents skin
tones from becoming oversaturated.
Saturation Adjusts the saturation of all image colors equally from -100 (monochrome) to +100 (double the
saturation).
AFTER EFFECTS CS3
User Guide
99
HSL / Grayscale controls in Camera Raw
You can use the controls in the HSL / Grayscale tab to adjust individual color ranges. For example, if a red object
looks too vivid and distracting, you can decrease the Reds values in the nested Saturation tab.
The following nested tabs contain controls for adjusting a color component for a specific color range:
Hue Changes the color. For example, you can change a blue sky (and all other blue objects) from cyan to purple.
Saturation Changes the color vividness or purity of the color. For instance, you can change a blue sky from gray to
highly saturated blue.
Luminance Changes the brightness of the color range.
If you select Convert To Grayscale, you see only one nested tab:
Grayscale Mix Use controls in this tab to specify the contribution of each color range to the grayscale version of the
image.
Tone a grayscale image in Camera Raw
Use the controls in the Split Toning tab to color a grayscale image. You can add one color throughout the tonal range,
such as a sepia appearance, or create a split tone result, in which a different color is applied to the shadows and the
highlights. The extreme shadows and highlights remain black and white.
You can also apply special treatments, such as a cross-processed look, to a color image.
1Select a grayscale image. (This can be an image that you converted to grayscale by selecting Convert To Grayscale
in the HSL / Grayscale tab.)
2In the Split Toning tab, adjust the Hue and Saturation properties for the highlights and shadows. Hue sets the color
of the tone; Saturation sets the magnitude of the result.
3Adjust the Balance control to balance the influence between the Highlight and Shadow controls. Positive values
increase the influence of the Shadow controls; negative values increase the influence of the Highlight controls.
Adjust color rendering for your camera in Camera Raw
For each camera model it supports, Camera Raw uses profiles to process raw images. The profiles are produced by
photographing a color target under different white-balanced lighting conditions. When you set white balance,
Camera Raw uses the profiles for your camera to extrapolate color information.
Sometimes colors rendered by the Camera Raw plug-in do not look as expected. The cause may be a difference
between a camera’s profile and the profile in Camera Raw for that camera model. Alternatively, the photo may have
been taken under nonstandard lighting conditions beyond the compensating range of the Camera Raw plug-in.
To render non-neutral colors differently, use the Hue and Saturation controls in the Calibrate tab to adjust the
settings for the profile built into Camera Raw. You can also specify whether to use the profiles built into Camera Raw
or a profile built into the file itself.
1In the Calibrate tab, choose a profile from the Camera Profile menu.
Important: The options in the Camera Profile menu vary, depending on whether the file has a profile embedded and
whether a newer version of the profile has become available in Camera Raw.
ACR 2.4, 3.0, or higher Higher version numbers represent newer and improved camera profiles for some cameras. If
you only see a lower version number, such as 2.4, your camera’s profiles didn’t require updating. If multiple options
are available, you may want to choose a lower version number for consistent behavior with legacy images.
AFTER EFFECTS CS3
User Guide
100
Embedded Use the profile embedded in the current file. TIFF, JPEG, and DNG files can have embedded profiles.
2Adjust the Shadow Tint property to remove a color cast in the shadows. Usually, decreasing Shadow Tint adds
green to the shadow areas, and increasing Shadow Tint adds magenta.
3UsetheHueandSaturationcontrolstoadjustthered,green,andblueintheimage.Lookatthepreviewimageas
you make adjustments until the image looks correct to you. In general, adjust the hue first, and then adjust its
saturation.
4Adjustments made in the Calibrate tab affect the selected image in the Camera Raw dialog box. If you want to save
the adjustments and make them the default image settings for the files from a specific camera, choose Save New
Camera Raw Defaults from the Camera Raw Settings menu .
Note: To save settings as defaults for a specific camera (by serial number) or for a specific lighting condition (by ISO
number), you can also modify the Default Image Settings preferences in the Camera Raw preferences. (See “Save, reset,
and load Camera Raw settings” on page 104.)
Compensate for chromatic aberration in Camera Raw
Chromatic aberration is a common defect caused by the failure of the lens to focus different frequencies (colors) to
the same spot. In one type of chromatic aberration, the image from each color of light is in focus, but each image is
a slightly different size. This type of aberration is seen as a complementary color fringing in areas away from the
center of the image. For example, you may see a red fringe on the side of an object toward the center of the image,
and cyan fringe on the side of the object away from the center of the image.
Original image (top), and after fixing chromatic aberration (bottom)
Another type of chromatic artifact affects the edges of specular highlights, such as those found when light is reflected
off of the surface of rippled water or edges of polished metal. This situation usually results in a purple fringe around
each specular highlight. Similar-colored fringing can occur along edges between dark objects and very bright
objects.
1Zoom into an area near the corner of the preview image. For the best results, the area should contain very dark or
black detail against a very light or white background. Look for the color fringing.
2In the Lens Corrections tab, adjust any of these controls:
Fix Red/Cyan Fringe Adjusts the size of the red channel relative to the green channel. This compensates for red/cyan
color fringing.
Fix Blue/Yellow Fringe Adjusts the size of the blue channel relative to the green channel. This compensates for
blue/yellow color fringing.
Defringe Desaturates colored fringing around specular highlights. Choose All Edges to correct color fringing for all
edges, including any sharp change in color values. If choosing All Edges results in thin grey lines near edges or other
AFTER EFFECTS CS3
User Guide
101
unwanted effects, choose Highlight Edges to correct color fringing only in edges of highlighting, where fringing is
most likely to occur. Choose Off to turn off defringing.
Look at the preview image as you move each slider left or right. If you’re adjusting red/cyan color fringing, hold down
Alt (Windows) or Option (Mac OS) to hide the blue/yellow color fringing. Similarly, hold down Alt (Windows) or
Option (Mac OS) while adjusting the blue/yellow color fringing to hide the red/cyan color fringing. The goal is to
reduce the color fringing as much as possible.
Compensate for lens vignetting in Camera Raw
Vignetting is a lens defect that causes the edges, especially the corners, of an image to be darker than the center. Use
controls in the Lens Vignetting section of the Lens Correction tab to compensate for vignetting.
1Increase Amount to lighten the corners, or decrease Amount to darken them.
2Decrease Midpoint to apply the adjustment to a larger area away from the corners, or increase Midpoint to restrict
the adjustment to an area closer to the corners.
Modifying images with Camera Raw
Rotate images with Camera Raw
•Click the Rotate Image 90˚ Counterclockwise button (or press L).
•Click the Rotate Image 90˚ Clockwise button (or press R).
Note: Using commands in the Edit menu, you can also rotate images in Adobe Bridge without opening the Camera Raw
dialog box.
Straighten images in Camera Raw
1In the Camera Raw dialog box, select the Straighten tool .
2Drag the Straighten tool in the preview image to establish what’s horizontal or vertical.
Note: The Crop tool is active immediately after you use the Straighten tool.
Crop selected images in Camera Raw
1In the Camera Raw dialog box, select the Crop tool .
To constrain your initial crop area to a specific aspect ratio, hold the mouse button down as you select the Crop tool,
and choose an option from the menu. To apply a constraint to a previously applied crop, Ctrl-click (Mac OS) or right-
click (Windows) on the crop.
2Drag in the preview image to draw the crop area box.
3To move, scale, or rotate the crop area, drag the crop area or its handles.
When you are finished, the cropped area of the image remains visible, but is dimmed in the image preview.
Note: To cancel the crop operation, press Esc with the Crop tool active, or click and hold the Crop tool button and choose
ClearCropfromthemenu.TocancelthecropandclosetheCameraRawdialogboxwithoutprocessingthecameraraw
image file, click the Cancel button or deselect the Crop tool and press Esc.
AFTER EFFECTS CS3
User Guide
102
Remove red-eye in Camera Raw
1 Zoom the image in to at least 100%.
2In the Toolbar, select the Red Eye Removal tool .
3Drag a selection in the photo around the red eye.
Camera Raw sizes the selection to match the pupil. You can adjust the size of the selection by dragging its edges.
4Drag the Pupil Size slider on the toolbar to the right to increase the size of the area corrected.
5Drag the Darken slider to the right to darken the pupil area within the selection and the iris area outside the
selection.
Deselect Show Overlay to turn off the selection and check your correction.
Note: Move between multiple selected red eye areas by clicking the selection.
Retouch images in Camera Raw
The Retouch tool lets you repair a selected area of an image with a sample from another area.
1Select the Retouch tool from the toolbar.
2Select one of the following from the Type menu:
Heal Matches the texture, lighting, and shading of the sampled area to the selected area.
Clone Applies the sampled area of the image to the selected area.
3(Optional) In the toolbar, drag the Radius slider to specify the size of the area that the Retouch tool affects.
4Move the Retouch tool into the photo and click the part of the photo to retouch. A red and white dashed circle
appears over the selected area. The green and white dashed circle designates the sampled area of the photo used to
clone or heal.
5Do any of the following:
•To specify the sampled area, drag inside the green and white circle to move it to another area of the image.
•To specify the selected area being cloned or healed, drag inside the red and white circle.
•To adjust the size of the circles, move the pointer over the edge of either circle until it changes to a double-pointing
arrow, and then drag to make both circles larger or smaller.
•To cancel the operation, press Backspace (Windows) or Delete (Mac OS).
Repeat this procedure for each area of the image that needs retouching. To remove all sample areas and start over,
click the Clear All button in the Toolbar.
Adjust sharpening in Camera Raw
The sharpening controls on the Detail tab adjust edge definition in the image. Camera Raw provides four adjust-
ments to help you fine-tune image sharpness.
Use the Apply Sharpening To preference in the Camera Raw preferences to specify whether sharpening is applied to
all images or just to previews.
1Zoom the preview image to at least 100%.
AFTER EFFECTS CS3
User Guide
103
2In the Detail tab, adjust any of these controls:
Amount Adjusts edge definition. Increase the Amount value to increase sharpening. A value of zero (0) turns off
sharpening. In general, set Amount to a lower value for cleaner images. The adjustment is a variation of Unsharp
Mask, which locates pixels that differ from surrounding pixels based on the threshold you specify and increases the
pixels’ contrast by the amount you specify. When opening a camera raw image file, the Camera Raw plug-in calcu-
lates the threshold to use based on camera model, ISO, and exposure compensation.
Radius Adjusts the size of the details that sharpening is applied to. Photos with very fine details may need a lower
setting. Photos with larger details may be able to use a larger radius. Using too large a radius generally results in
unnatural-looking results.
Detail Adjusts how much high-frequency information is sharpened in the image and how much the sharpening
process emphasizes edges. Lower settings primarily sharpen edges to remove blurring. Higher values are useful for
making the textures in the image more pronounced.
Masking Controls an edge mask. With a setting of zero (0), everything in the image receives the same amount of
sharpening. With a setting of 100, sharpening is mostly restricted to those areas near the strongest edges. Press Alt
(Windows) or Option (Mac OS) while dragging this slider to see the areas to be sharpened (white) versus the areas
masked out (black).
Reducing noise in Camera Raw
The Noise Reduction section of the Detail tab has controls for reducing image noise, the extraneous visible artifacts
that degrade image quality. Image noise includes luminance (grayscale) noise, which makes an image look grainy,
and chroma (color) noise, which is usually visible as colored artifacts in the image. Photos taken with high ISO
speeds or less-sophisticated digital cameras can have noticeable noise.
The Luminance control reduces grayscale noise, and the Color control reduces chroma noise. Moving a slider to zero
turns off noise reduction.
When making Luminance Smoothing or Color Noise Reduction adjustments, first zoom in on the preview image to
at least 100% to see the noise reduction previewed.
Moving Luminance Smoothing slider right reduces grayscale noise (above right), and moving Color Noise Reduction slider right reduces
chroma noise (below right).
AFTER EFFECTS CS3
User Guide
104
Camera Raw settings
Save, reset, and load Camera Raw settings
You can reuse the adjustments that you’ve made to an image. You can save all of the current Camera Raw image
settings, or any subset of them, as a preset or as a new set of defaults. The default settings apply to a specific camera
model, a specific camera serial number, or a specific ISO setting, depending on the settings in the Default Image
Settings section of the Camera Raw preferences.
Presets appear by name in the Presets tab, in the Edit > Develop Settings menu in Adobe Bridge, in the context menu
for camera raw images in Adobe Bridge, and in the Apply Presets submenu of the Camera Raw Settings menu in the
Camera Raw dialog box. Presets are not listed in these locations if you don’t save them to the Camera Raw settings
folder. However, you can use the Load Settings command to browse for and apply settings saved elsewhere.
You can save and delete presets using the buttons at the bottom of the Presets tab.
❖Click the Camera Raw Settings menu button , and choose a command from the menu:
Save Settings Saves the current settings as a preset. Choose which settings to save in the preset, and then name and
save the preset.
Save New Camera Raw Defaults Saves the current settings as the new default settings for other images taken with the
same camera, with the same camera model, or with the same ISO setting. Select the appropriate options in the
Default Image Settings section of the Camera Raw preferences to specify whether to associate the defaults with a
specific camera’s serial number or with an ISO setting.
Reset Camera Raw Defaults Restores the original default settings for the current camera, camera model, or ISO
setting.
Load Settings OpenstheLoadRawConversionSettingsdialogbox,inwhichyoubrowsetothesettingsfile,select
it, and then click Load.
Specify where Camera Raw settings are stored
Choose a preference to specify where the settings are stored. The XMP files are useful if you plan to move or store
the image files and want to retain the camera raw settings. You can use the Export Settings command to copy the
settings in the Camera Raw database to sidecar XMP files or embed the settings in Digital Negative (DNG) files.
When a camera raw image file is processed with Camera Raw, the image settings are stored in one of two places: the
Camera Raw database file or a sidecar XMP file. Settings for DNG files are typically stored in the DNG files
themselves, as with TIFF and JPEG files.
Note: When you import a sequence of camera raw files in After Effects, the settings for the first file are applied to all files
in the sequence that do not have their own XMP sidecar files. After Effects does not check the Camera Raw database.
You can set a preference to determine where settings are stored. When you reopen a camera raw image, all settings
defaulttothevaluesusedwhenthefilewaslastopened.Imageattributes(targetcolorspaceprofile,bitdepth,pixel
size, and resolution) are not stored with the settings.
1In Adobe Bridge, choose Edit > Camera Raw Preferences (Windows) or Bridge > Camera Raw Preferences
(Mac OS).
AFTER EFFECTS CS3
User Guide
105
2In the Camera Raw Preferences dialog box, choose one of the following from the Save Image Settings In menu:
Camera Raw Database StoresthesettingsinaCameraRawdatabasefileinthefolderDocumentandSettings/[user
name]/Application Data/Adobe/CameraRaw (Windows) or Users/[user name]/Library/Preferences (Mac OS). This
database is indexed by file content, so the image retains camera raw settings even if the camera raw image file is
moved or renamed.
Sidecar “.xmp” Files Stores the settings in a separate file, in the same folder as the camera raw file, with the same base
name and an .xmp extension. This option is useful for long-term archiving of raw files with their associated settings,
and for the exchange of camera raw files with associated settings in multiuser workflows. These same sidecar XMP
files can store IPTC (International Press Telecommunications Council) data or other metadata associated with a
camera raw image file. If you open files from a read-only volume such as a CD or DVD, be sure to copy the files to
your hard disk before opening them. The Camera Raw plug-in cannot write an XMP file to a read-only volume and
writes the settings to the Camera Raw database file instead. You can view XMP files in Adobe Bridge by choosing
View > Show Hidden Files.
Important: If you are using a revision control system to manage your files and are storing settings in sidecar XMP files,
keep in mind that you must check your sidecar files in and out to make changes to camera raw images; similarly, you
must manage (e.g., rename, move, delete) XMP sidecar files together with their camera raw files. Adobe Bridge,
Photoshop, After Effects, and Camera Raw take care of this file synchronization when you work with files locally.
If you store the camera raw settings in the Camera Raw database and plan to move the files to a different location
(CD, DVD, another computer, and so forth), you can use the Export Settings To XMP command to export the
settings to sidecar XMP files.
3If you want to store all adjustments to DNG files in the DNG files themselves, select Ignore Sidecar “.xmp” Files
in the DNG File Handling section of the Camera Raw Preferences dialog box.
Copy and paste Camera Raw settings
In Adobe Bridge, you can copy and paste the Camera Raw settings from one image file to another.
1In Adobe Bridge, select a file and choose Edit > Develop Settings > Copy Camera Raw Settings.
2Select one or more files and choose Edit > Develop Settings > Paste Settings.
You can also right-click (Windows) or Control-click (Mac OS) image files to copy and paste using the context menu.
3In the Paste Camera Raw Settings dialog box, choose which settings to apply.
Apply saved Camera Raw settings
1In Adobe Bridge or in the Camera Raw dialog box, select one or more files.
2In Bridge, choose Edit > Develop Settings or right-click a selected file. Or, in the Camera Raw dialog box, choose
Camera Raw Settings .
3Choose one of the following:
Image Settings Uses the settings from the selected camera raw image. This option is available only from the Settings
menu in the Camera Raw dialog box.
Camera Raw Defaults Uses the saved default settings for a specific camera, camera model, or ISO setting.
Previous Conversion Uses the settings from the previous image of the same camera, camera model, or ISO setting.
A preset name Uses the settings (which can be a subset of all image settings) saved as a preset.
AFTER EFFECTS CS3
User Guide
106
Applying a preset
Note: You can also apply presets from the Presets tab.
Export Camera Raw settings and DNG previews
If you store file settings in the Camera Raw database, you can use the Export Settings To XMP command to copy the
settings to sidecar XMP files or embed them in DNG files. This is useful for preserving the image settings with your
camera raw files when you move them.
You can also update the JPEG previews embedded in DNG files.
1Open the files in the Camera Raw dialog box.
2If you are exporting settings or previews for multiple files, select their thumbnails in the Filmstrip view.
3In the Camera Raw Settings menu , choose Export Settings To XMP or Update DNG Previews.
The sidecar XMP files are created in the same folder as the camera raw image files. If you saved the camera raw image
files in DNG format, the settings are embedded in the DNG files themselves.
107
Chapter 5: Compositions
Composition basics
Introduction to compositions
Acomposition is the framework for a movie. A typical composition includes multiple layers that represent compo-
nents such as video and audio footage items, animated text and vector graphics, still images, and lights. You add a
footage item to a composition by creating a layer for which the footage item is the source. You then arrange layers
within a composition in space and time, and composite using transparency features to determine which parts of
underlyinglayersshowthroughthelayersstackedontopofthem.Yourender a composition to create a final output
movie.
Simple projects may include only one composition; complex projects may include hundreds of compositions to
organize large amounts of footage or many effects.
In some places in the After Effects user interface, composition is abbreviated as comp.
Use the Composition panel to preview a composition and modify its contents manually. The Composition panel
contains the composition frame and a pasteboard area outside of the frame that you can use to move layers into and
out of the composition frame. Only the area inside the composition frame is previewed and rendered. The offstage
extents of layers—the portions not in the composition frame—are shown as rectangular outlines.
EachcompositionhasanentryintheProjectpanel.Double-clickacomposition’sentryintheProjectpaneltoopen
the composition in its own Timeline panel. To select a composition in the Project panel, right-click (Windows) or
Control-click (Mac OS) in the composition's Composition panel or Timeline panel and choose Reveal Composition
In Project from the context menu.
Use the Flowchart panel to see the structure of a complex composition.
Timeline button Click this button at the bottom of the Composition panel to activate the Timeline panel for the
current composition.
Press the backslash (\) key to switch activation between the Composition panel and Timeline panel for the current
composition.
Comp button Click this button at the upper-right of the Timeline panel to activate the Composition panel for the
current composition.
Flowchart button Click this button at the bottom of the Composition panel to activate the Flowchart panel for
the current composition.
When working with a complex project, you may find it easiest to organize the project by nesting compositions—
putting one or more compositions into another composition. You can create a composition from any number of
layers by precomposing them. If you are finished making changes to some layers of your composition, you can
precompose those layers and then pre-render the precomposition, replacing it with a rendered movie.
AFTER EFFECTS CS3
User Guide
108
See also
“Creating layers” on page 133
“Preview video and audio” on page 120
“Work with the Flowchart panel” on page 24
Create a composition
You can change a composition’s settings at any time. However, it’s best to specify settings such as frame aspect ratio
and frame size when you create the composition, with your final output in mind. Because After Effects bases certain
calculations on these composition settings, changing them late in your workflow can affect your final output.
Note: You can override some composition settings when rendering to final output. For example, you can use different
frame sizes for the same movie. For more information see “Work with render settings” on page 597 and “Work with
output module settings” on page 599.
When you create a composition without changing settings in the Composition Settings dialog box, the new compo-
sition uses the settings from the previous time that composition settings were set.
Note: The previous Preserve Frame Rate When Nested Or In Render Queue and Preserve Resolution When Nested
settings are not inherited by new compositions.
See also
“Work with composition settings” on page 110
“About nesting and precomposing” on page 113
Create a composition and manually set composition settings
❖Choose Composition > New Composition, or press Ctrl+N (Windows) or Command+N (Mac OS).
Create a composition from a single footage item
❖DragthefootageitemtotheCreateANewCompositionbutton atthebottomoftheProjectpanelorchoose
File > New Comp From Selection.
Composition settings, including frame size (width and height) and pixel aspect ratio, are automatically set to match
the characteristics of the footage item.
Create a single composition from multiple footage items
1Select footage items in the Project panel.
2DragtheselectedfootageitemstotheCreateANewCompositionbutton atthebottomoftheProjectpanel,
or choose File > New Comp From Selection.
3Select Single Composition and other settings in the New Composition From Selection dialog box:
Use Dimensions From Choose the footage item from which the new composition gets composition settings,
including frame size (width and height) and pixel aspect ratio.
Still Duration The duration for the still images being added.
Add To Render Queue Add the new composition to the render queue.
Sequence Layers, Overlap, Duration, and Transition Arrange the layers in a sequence, optionally overlap them in
time, set the duration of the transitions, and choose a transition type.
AFTER EFFECTS CS3
User Guide
109
Create multiple composition from multiple footage items
1Select footage items in the Project panel.
2DragtheselectedfootageitemstotheCreateANewCompositionbutton atthebottomoftheProjectpanel,
or choose File > New Comp From Selection.
3Select Multiple Compositions and other settings in the New Composition From Selection dialog box:
Still Duration The duration of the compositions created from still images.
Add To Render Queue Add the new compositions to the render queue.
Duplicate a composition
1Select the composition in the Project panel.
2Choose Edit > Duplicate or press Control+D (Windows) or Command+D (Mac OS).
Timeline panel overview
Each composition has its own Timeline panel. You use the Timeline panel to perform many tasks, such as animating
layer properties, arranging layers in time, and setting blending modes. The layers at the bottom of the layer stacking
order in the Timeline panel are rendered first and—in the case of 2D image layers— appear farthest back in the
Composition panel.
To cycle forward through Timeline panels, press Alt+Shift+period (.) (Windows) or Option+Shift+period (.)
(Mac OS). To cycle backward through Timeline panels, press Alt+Shift+comma (,) (Windows) or
Option+Shift+comma (,) (Mac OS).
A composition’s current time is indicated by the current-time indicator, the vertical red line in the time graph. A
composition’s current time also appears in the current time display in the upper-left corner of the Timeline panel.
For more information on moving the current-time indicator, see “Move the current-time indicator” on page 123.
A. Current-time display B. Current-time indicator C. Time ruler D. Layer switches E. Time graph
The left side of the Timeline panel consists of columns of controls for layers. The right side of the Timeline panel—
the time graph—contains a time ruler, markers, keyframes, expressions, duration bars for layers (in layer bar mode),
and the Graph Editor (in Graph Editor mode).
Press the backslash (\) key to switch activation between the Composition panel and Timeline panel for the current
composition.
See also
“Show and hide layers in the Timeline panel” on page 150
“Layer switches and columns in the Timeline panel” on page 147
“Work with the Graph Editor” on page 184
E
A B
C
D
AFTER EFFECTS CS3
User Guide
110
“Work with columns” on page 18
“Using and modifying keyboard shortcuts” on page 638
Work with composition settings
You can enter composition settings manually, or you can use composition settings presets to automatically set frame
size (width and height), pixel aspect ratio, and frame rate for many common output formats. You can also create and
save your own custom composition settings presets for later use. Resolution, Start Timecode, Duration, and
Advanced composition settings are not saved with composition settings presets.
Note: The limit for composition duration is three hours. You can use footage items longer than three hours, but time after
three hours does not display correctly. The maximum composition size is 30,000 x 30,000 pixels. Note that a 30,000 x
30,000 8bpc image requires approximately 3.5 GB; your maximum composition size may be less, depending on your
operating system and available RAM.
•To open the Composition Settings dialog box to change composition settings, select a composition in the Project
panel or activate the Timeline or Composition panel for a composition, and then choose Composition > Compo-
sition Settings, or press Ctrl+K (Windows) or Command+K (Mac OS).
•To save a custom composition settings preset, set Width, Height, Pixel Aspect Ratio, and Frame Rate values in the
Composition Settings dialog box, and then click the Save button .
•To delete a composition settings preset, choose it from the Preset menu in the Composition Settings dialog box,
and click the Delete button .
•To restore default composition settings presets, Alt-click (Windows) or Option-click (Mac OS) the Delete
button or the Save button in the Composition Settings dialog box.
•To scale an entire composition, choose File > Scripts > DemoPalette.jsx to run the DemoPalette script, and then
click the Scale Comp button.
Jeff Almasol provides a script to set the frame rate and duration of the current composition and all compositions
nested within it: www.adobe.com/go/learn_ae_jeffcompsetter.
See also
“Change pixel aspect ratio” on page 55
“Change frame rate” on page 53
“Resolution” on page 128
“Specify resolution to use for rendering shadows” on page 181
“About nesting and precomposing” on page 113
“Use motion blur” on page 200
Composition settings
Basic composition settings
For information on specific Basic composition settings not listed here, see the related sections.
Resolution This setting affects rendering, both for previews and for final output. You can also use the Resolution
menu at the bottom of the Composition panel to modify this setting.
AFTER EFFECTS CS3
User Guide
111
Start Timecode or Start Frame Timecode or frame number assigned to the first frame of the composition. This value
does not affect rendering; it merely specifies where to start counting from.
Advanced composition settings
For information on specific Advanced composition settings not listed here, see the related sections.
Anchor Click an arrow button to anchor layers to a corner or edge of the composition as it is resized.
Work with the region of interest
The region of interest istheareaofthecomposition,layer,orfootageitemthatispreviewed.Createasmallerregion
of interest to use less processing power and memory when previewing, thereby improving interaction speed and
increasing RAM preview duration. Changing the region of interest does not affect file output, though you can change
the size of your composition and select what portion is rendered by cropping to the region of interest.
Note: When the region of interest is selected, the Info panel displays the horizontal and vertical distances of the top (T),
left (L), bottom (B), and right (R) edges of the region from the top-left corner of the composition.
•To draw a region of interest, click the Region Of Interest button at the bottom of the Composition, Layer, or
Footage panel, and then drag to select a viewable area of the panel.
To start over with the marquee tool, hold down Alt (Windows) or Option (Mac OS) and click the Region Of Interest
button.
•To switch between using the region of interest and using the full composition, layer, or footage frame, click the
Region Of Interest button.
•To move or resize the region of interest, drag its edges or handles. Shift-drag a corner handle to resize while
preserving aspect ratio.
•To crop to the region of interest, choose Composition > Crop Comp To Region Of Interest.
Set composition background color
The default background color for the Composition panel is black, but you can change the color at any time.
❖Choose Composition > Background Color, and then click the color swatch or use the eyedropper to pick a color.
Note: When you add one composition to another (nesting), the containing composition’s background color is preserved,
and the nested composition’s background becomes transparent. To preserve the nested composition’s background color,
create a solid-color layer to use as a background layer in the nested composition.
See also
“Select a color or edit a gradient” on page 236
“Create or modify a solid-color layer” on page 136
Work with composition thumbnail images
You can choose which frame of a composition to show as a thumbnail image in the Project panel. By default, a
composition’s thumbnail image is the first frame of the composition, with transparent portions shown as black.
•To set the thumbnail image for a composition, move the current-time indicator to the desired frame in the compo-
sition’s Timeline panel, and choose Composition > Set Poster Time.
•To add a transparency grid to the thumbnail view, choose Thumbnail Transparency Grid from the Project panel menu.
AFTER EFFECTS CS3
User Guide
112
•To hide the thumbnail images in the Project panel, choose Edit > Preferences > Display (Windows) or After
Effects > Preferences > Display (Mac OS) and select Disable Thumbnails In Project Panel.
Zoom in or out in time
•In the Timeline panel, click the Zoom In button or the Zoom Out button , or drag the zoom slider between
the buttons.
•On the main keyboard, press the = (equal sign) key to zoom in or press the – (hyphen) key to zoom out in time.
•In the navigator view, drag the Time Navigator Start or Time Navigator End brackets to magnify or shrink a
section of the time ruler.
Dragging Time Navigator End bracket to show more of time ruler.
When zoomed in time, press D to center the time graph on the current time.
Set the work area
The work area is the part of the duration of a composition that is previewed or rendered. In the Timeline panel, the
work area appears in a lighter shade of gray.
•To set the work area start time or end time to the current time, press B (begin) or N (end), respectively.
•To set the work area, move the start and end work area markers in the time ruler.
Work-area markers indicate the composition duration rendered for previews or output.
•To move the work area, drag the center of the work area bar left or right.
Dragging center of work area bar to move work area
•To expand the work area to the size of the composition, double-click the center of the work area bar.
AFTER EFFECTS CS3
User Guide
113
See also
“Preview video and audio” on page 120
Nesting, precomposing, and pre-rendering
About nesting and precomposing
Nesting is the inclusion of one composition within another. The nested composition appears as a layer in the
containing composition.
If you want to group some layers that are already in a composition, you can precompose those layers. Precomposed
layers are placed in a new composition (sometimes called a precomposition), and the new composition becomes the
source for a single layer in the original composition. The new composition appears in the Project panel and is
available for rendering or use in any other composition.
Youcanalsonestcompositionsbyaddinganexistingcompositiontoanothercomposition,justasyouwouldadda
footage item to a composition.
Note: To open a precomposition, Alt-double-click (Windows) or Option-double-click (Mac OS) it in the Timeline panel.
To open the composition that contains the current precomposition, click the Open Parent Composition button at the
top of the Timeline panel.
Precomposing and nesting are very useful for managing and organizing complex compositions.
By precomposing and nesting, you can do the following:
Apply complex changes to an entire composition You can create a composition that contains multiple layers, nest
the composition within the overall composition, and animate and apply effects to the nested composition so that all
of the layers change in the same ways over the same time period.
Reuse anything you build Youcanbuildananimationinitsowncompositionandthendragthatcompositioninto
other compositions as many times as you want.
Update in one step When you make changes to a nested composition, those changes affect every composition in
which it is used, just like changes made to a source footage item affect every composition in which it is used.
Alter the default rendering order of a layer You can specify that After Effects render a transformation (such as
rotation) before rendering effects, so that the effect applies to the rotated footage.
Add another set of transform properties to a layer The layer that represents the composition has its own properties,
in addition to the properties of the layers that it contains. This allows you to apply an additional set of transforma-
tions to a layer or set of layers.
For example, you can use nesting to make a planet both rotate and revolve (moving like the Earth, which spins on its
own axis and also travels around the Sun). To do this, you animate the Rotation property of the planet layer,
precompose that layer, modify the Anchor Point property of the precomposition layer, and then animate the
Rotation property of the precomposition layer.
Becauseaprecompositionisitselfalayer,youcancontrolitsbehaviorusinglayerswitchesandcompositionswitches
in the Timeline panel. You can choose whether changes made to the switches in the containing composition are
propagated to the nested composition. To prevent layer switches from affecting nested compositions, choose Edit >
Preferences > General (Windows) or After Effects > Preferences > General (Mac OS), and then deselect Switches
Affect Nested Comps.
AFTER EFFECTS CS3
User Guide
114
In the Advanced composition settings (Composition > Composition Settings), choose Preserve Resolution When
NestedorPreserveFrameRateWhenNestedOrInRenderQueueforacompositiontoretainitsownresolutionor
frame rate, and not inherit those settings from the containing composition. For example, if you deliberately used a
low frame rate in a composition to create a jerky, hand-animated result, you should preserve the frame rate for that
composition when it is nested. Similarly, the results of rotoscoping may look wrong when converted to a different
frame rate or resolution. Use this setting instead of the Posterize Time effect, which is less efficient.
Changing the current time in one panel updates the current time in other panels associated with that composition.
By default, the current time is also updated for all compositions related to the current composition by nesting. To
prevent compositions related by nesting from updating their current times when you change the current time in one
composition, deselect the Synchronize Time Of All Related Items preference (Edit > Preferences > General
(Windows) or After Effects > Preferences > General (Mac OS)).
See also
“Create layers from footage items” on page 135
“How render order and collapsed transformations affect 3D layers” on page 175
“Layer switches and columns in the Timeline panel” on page 147
“Work with parent and child layers” on page 158
Precompose layers
Precomposing layers places them in a new composition (sometimes called a precomposition), which replaces the
layers in the original composition. Precomposing a single layer is useful for adding transform properties to a layer
and influencing the order in which elements of a composition are rendered.
1Select the layers in the Timeline panel, and choose Layer > Pre-compose or press Ctrl+Shift+C (Windows) or
Command+Shift+C (Mac OS).
2Select one of the following:
Leave All Attributes In Leaves the properties and keyframes of the precomposed layer in the original composition,
applied to the new layer that represents the precomposition. The frame size of the new composition is the same as
thesizeoftheselectedlayer.Thisoptionisnotavailablewhenyouselectmorethanonelayer,atextlayer,orashape
layer.
Move All Attributes Into The New Composition Moves the properties and keyframes of the precomposed layers one
level further from the root composition in the composition hierarchy. When you use this option, changes you applied
to the properties of the layers remain with the individual layers within the precomposition. The frame size of the new
composition is the same as that of the original composition.
Pre-render a nested composition
Acomplexnestedcompositioncantakealongtimetopreviewandrender.Ifyouhaveanestedcompositionthatyou
do not expect to work on further, you can save time during each previewing and rendering operation by pre-
rendering the nested composition into a movie and replacing the composition with the rendered movie. You can still
make changes to the original nested composition, because it remains in the project list. If you make a significant
change to the original nested composition, just render it again.
Pre-rendering a nested composition is particularly beneficial when you will use it multiple times in a project. Using
a pre-rendered movie in place of a nested composition also saves time and memory when you render the final
version of the main composition.
AFTER EFFECTS CS3
User Guide
115
Note: Apply your final output settings when you pre-render the nested composition.
1Select the composition in the Project or Composition panel.
2Choose Composition > Pre-render.
The Pre-render command adds the composition to the render queue and sets the Import & Replace Usage post-
render action to replace the composition with the rendered movie.
3In the Render Queue panel, adjust settings as necessary, and click the Render button to render the composition.
Note: An alternative to replacing the composition with the movie is to use the rendered movie as a proxy for the nested
composition.
See also
“Use a post-render action” on page 602
“Work with placeholders and proxies” on page 61
“Basics of rendering and exporting” on page 587
Render order and collapsing transformations
A composition consists of layers stacked on top of one another in the Timeline panel. When the composition is
rendered—either for previewing or for final output—the bottom layer is rendered first. Within each raster (non-
vector) layer, elements are applied in the following order: masks, effects, transformations, and layer styles. For
continuously rasterized vector layers, transformations occur before masks and effects.
Transformations are changes to those properties grouped under the Transform category in the Timeline panel,
including Anchor Point, Position, Scale, Rotation, and Opacity. What you see in the Layer panel is the result of the
rendering before transformations are performed.
Note: For additional control over when transformations are performed, you can apply the Transform effect and reorder
it with respect to other effects.
In a group of effects or masks, items are processed from top to bottom. For example, if you apply the Circle effect
and then apply the Magnify effect, the circle is magnified. However, if you drag the Magnify effect above (before) the
Circle effect in the Effect Controls or Timeline panel, the circle is drawn after the magnification and isn’t magnified.
After a layer has been rendered, rendering begins for the next layer. The rendered layer below may be used as input
to the rendering of the layer above—for example, for determining the result of a blending mode.
If a composition contains other compositions nested within it, the nested composition is rendered before other
layers.
If the Collapse Transformations switch is selected for a nested composition, then the transformations for the
nested composition are not performed until after the masks and effects for the containing composition are rendered.
This allows the transformations for the nested composition and the containing composition to be combined—or
collapsed—and performed together. The same is true for vector layers that are not continuously rasterized.
Note: Instead of a Collapse Transformations switch, vector layers have a Continuously Rasterize switch in the same
location. Vector layers include shape layers, text layers, and layers with vector graphic files as the source footage. Text
layers and shape layers are always continuously rasterized.
AFTER EFFECTS CS3
User Guide
116
Collapsing transformations can, for example, preserve resolution when a layer is scaled down by half in a nested
composition,andthenestedcompositionisscaledupbyafactoroftwointhecontainingcomposition.Inthiscase,
rather than performing both transformations and losing image data in the process, one transformation can be
performed—doing nothing, because the individual transformations cancel each other.
If transformations are not collapsed, a nested composition that contains 3D layers is rendered as a 2D image of the
3D arrangement, using the default composition camera. This prevents the nested composition from intersecting
with3Dlayers,castingshadowson3Dlayers,andreceivingshadowsfrom3Dlayersinthecontainingcomposition.
The nested composition is also not controlled by the containing composition’s cameras and lights.
If transformations are collapsed, the 3D properties of the layers in the nested composition are exposed to the
containing composition. Thus, the nested composition can intersect with 3D layers, cast shadows on 3D layers, and
receive shadows from 3D layers in the containing composition. The containing composition's camera and lights can
also control the nested composition.
When a closed mask (with mask mode other than None), a layer style, or an effect is applied to a nested composition
with collapsed transformations, the layers in the nested composition are first rendered on their own, then masks and
effects are applied, and then the result is composited into the main composition. This rendering order means that
the blending modes of the nested layers are not applied to any underlying layers in the main composition, and that
3D layers above and below the collapsed layer cannot intersect or cast shadows on each other.
See also
“How render order and collapsed transformations affect 3D layers” on page 175
“Change the stacking order for selected layers” on page 138
“Transform effect” on page 417
Markers
About markers
Use composition-time markers and layer-time markers to mark important times in a composition or in a specific
layer. Both kinds of markers can hold the same information, but composition-time markers appear in the time ruler
for the entire composition, whereas layer-time markers appear on a specific layer duration bar.
When you render a composition that contains markers, the markers can be converted to web links, chapter links,
Flash Video cue points, or Clip Notes comments, depending on the values that you set in the marker dialog box. The
default comment for a composition-time marker is a number, whereas the default comment for a layer-time marker
is nothing.
To view a video tutorial on working with markers and cue points, visit the Adobe website at
www.adobe.com/go/vid0255.
Markers make it easier to align layers or the current-time indicator with specific points in time: When you drag a
keyframe, the current-time indicator, or a layer duration bar in the Timeline panel, hold down Shift to snap these
items to markers.
A marker that contains data other than a comment has a small dot in its icon.
AFTER EFFECTS CS3
User Guide
117
A. Composition-time marker B. Composition-time marker with cue-point data C. Layer-time marker D. Layer-time marker with cue-point
data
If you add one composition to another, the original composition becomes a layer in the composition. All of the
nested composition’s composition-time markers become layer-time markers in the timeline of the parent compo-
sition. These markers are not linked to the original composition-time markers. Changes you make to the compo-
sition-time markers in the original composition do not affect layer-time markers in the nested composition. For
example, if you remove one of the original composition-time markers, the corresponding layer-time marker for the
nested composition remains in place.
See also
“Reviewing movies with Clip Notes comments” on page 634
Work with composition-time markers
Composition-time markers appear on the time ruler in the Timeline panel. If you remove a marker, the other
markers remain numbered as they were. If you change the comment from the default number, that number may be
reused by a composition-time marker created later.
Note: Numbering of composition-time markers begins at 0. In After Effects 7.0 and earlier, numbering started at 1.
When you render a composition for comments using Adobe Clip Notes, the comments in composition-time markers
are included as comments in the Clip Notes PDF. When you import the comments from a Clip Notes review back
into After Effects, the reviewers’ PDF comments are converted back to composition-time markers.
•To add a composition-time marker from the bin, drag the marker from the Comp Marker Bin button.
Dragging a composition-time marker from the Comp marker bin.
•To add a composition-time marker at the current time, press Shift + a number key (0 to 9) on the main keyboard.
Note: If the number you press is already used by another composition-time marker, After Effects does not create a new
marker. Instead, it moves the existing marker with that number to the new position.
•
To move a composition-time marker, drag it to a different time or double-click it and enter a time in the dialog box.
•To edit a marker’s data, double-click the marker.
•To remove a composition-time marker, drag the marker to the Comp Marker Bin button or Ctrl-click (Windows)
or Command-click (Mac OS) the marker.
See also
“Reviewing movies with Clip Notes comments” on page 634
D
C
B
A
AFTER EFFECTS CS3
User Guide
118
Work with layer-time markers
Layer-time markers are retained when you render to AVI or QuickTime format.
Layer-time markers appear as small triangles on a layer-duration bar. You can have any number of layer-time
markers in a layer. You can also drag existing markers to new time locations or remove them, as needed. You can
double-click the layer-time marker at any time to view or modify its attributes.
•To add a layer-time marker to selected layers at the current time, choose Layer > Add Marker or press * (multiply)
on the numeric keypad.
•To move a layer-time marker, drag it to a different time or double-click it and enter a time in the dialog box.
•To edit a marker’s data, double-click the marker.
•To remove a layer-time marker, Ctrl-click (Windows) or Command-click (Mac OS) the marker.
•To remove all layer-time markers from selected layers, right-click (Windows) or Control-click (Mac OS) a marker,
and choose Delete All Markers.
•To lock layer-time markers, right-click (Windows) or Control-click (Mac OS) a marker, and choose Lock Markers.
Paul Tuersley provides a script for splitting layers at layer-time markers:
www.adobe.com/go/learn_ae_paulsplitatmarkers.
Create a web link, chapter link, or cue point from a marker
You can associate a Uniform Resource Locator (URL) with a marker to create an automatic link to that site. After
Effects embeds this information within certain kinds of movies, including Flash (SWF), Windows Media, and
QuickTime movies. When these movies are played in a web browser, the embedded URL is recognized, initiating a
jump to the specified URL. You can target a specific frame in the site.
You can also associate a chapter reference point with a marker. Chapter links are similar to chapters used in
CD-ROM and DVD discs. Like the chapters of a book, a chapter link divides a movie into segments. Chapter links
are supported in QuickTime and Windows Media movies.
Adobe Encore can read chapter references in After Effects layer-time markers when you export to the AVI or MPEG-
2 file format. To be compatible with DVD format, make sure that markers are at least 15 frames apart.
Flash Video cue points can each have any number of parameters, each with a name and a value. You can only add
three parameters using the marker dialog box. To work with more than three parameters, use the scripting interface.
To convert selected properties to Flash Video cue point parameters in layer-time markers, choose File > Scripts >
Convert Selected Properties To Markers.jsx. This script adds a layer-time marker on the layer at the same time as
each keyframe for each selected property. The markers’ cue point parameters indicate the name of the property and its
valueatthattime.Iftheselectedpropertyhasanexpression,amarkeriscreatedforeachframe,withthevaluessampled
at each frame.
1Double-click a marker to open the marker dialog box.
2Enter information in the appropriate boxes in the marker dialog box:
•To create a web link, enter a Uniform Resource Locator in the URL box in the Chapter And Web Links area of the
marker dialog box. To activate a specific frame in a site, enter the file name of the frame for Frame Target.
•Enter the chapter name and number (if available) in the Chapter text box in the Chapter And Web Links area of
the marker dialog box.
•Enter the Flash Video cue point’s name, and names and values for any parameters. Select Event or Navigation to
determine what kind of cue point to create.
AFTER EFFECTS CS3
User Guide
119
See also
“Work with scripts” on page 45
Synchronize markers to audio
After Effects provides a quick way to add and label markers for significant points in a layer’s audio track, such as a
rhythmic beat in music or spoken words in dialogue. After markers are created, you can use them to synchronize
video or other effects.
1In the Time Controls panel, click the Audio button , and then click the RAM preview button .
2At the points in time where you want to add a marker, press the multiply key (*) on the numeric keypad to create
a layer-time marker.
3When previewing is complete, double-click a marker you just created, and add comments or otherwise modify
the markers as you would any other layer-time markers.
See also
“Preview video and audio” on page 120
120
Chapter 6: Views and previews
Previewing
Preview video and audio
Yo u c a n preview all or part of your composition as you work, without rendering to final output. Many of the controls
for previewing are in the Time Controls panel.
With all previewing methods—as with rendering to final output—a layer is only visible if its Video layer switch
is selected.
Some factors that influence the speed with which previews are rendered include layer switches, Fast Previews
settings, and composition settings. One of the simplest and most influential of the preview settings is the
Resolution/Down Sample Factor setting at the bottom of the Composition panel; set this to a value other than Full
to see all previews at a lower resolution.
To turn pixel-aspect ratio correction on or off for previews, click the Toggle Pixel Aspect Ratio Correction button
at the bottom of the panel. Because the scaling is not of high quality, use pixel aspect ratio correction to evaluate
shapes, not fine pixel detail. (See “Change pixel aspect ratio” on page 55.)
When possible, preview on the same sort of device that your audience will be using to view your final output. For
example, you can preview on an external video monitor. To see your composition as it will appear on a mobile
device—such as a mobile phone—first render your composition to final output, and then use Adobe Device Central
to view the movie.
If color management is enabled, you can preview a composition, layer, or footage item as it will appear in the output
color space. (See “Simulate how colors will appear on a different output device” on page 248.)
Note: Select Show Rendering Progress In Info Panel & Flowchart (Edit > Preferences > Display (Windows) or After
Effects > Preferences > Display (Mac OS)) to see additional information in the Info panel or Flowchart panel during
rendering, either for previews or for final output.
See also
“Preview a movie on a virtual mobile device using After Effects” on page 618
“Set the work area” on page 112
“Shortcuts for working with previews” on page 642
“Shortcuts for using and modifying views” on page 644
“Layer switches and columns in the Timeline panel” on page 147
Use standard preview
Standard preview (commonly called spacebar play) plays video in the active Composition, Layer, or Footage panel
from the current time. Standard previews play at a speed as close to that of real time as possible; however, for complex
compositions, the speed of the preview may be much less than that of real time.
❖Click the Play button in the Time Controls panel, or press the spacebar.
AFTER EFFECTS CS3
User Guide
121
Use RAM preview
RAM preview allocates RAM to play video and audio in the Timeline, Layer, or Footage panel in real time. The
number of frames that can be stored for real-time playback depends on the amount of RAM available to the appli-
cation and the settings in the Time Controls panel.
In the Time Controls panel, you can specify two sets of RAM preview options: RAM Preview Options and
Shift+RAM Preview Options. For example, you may decide to set RAM Preview Options for full frame rate and full
resolution, and set Shift+RAM Preview Options to skip one out of every two frames and preview at half resolution.
In the Layer and Footage panels, RAM previews play untrimmed footage.
1To modify RAM preview options, click the RAM Preview Options menu in the center of the Time Controls panel
and choose RAM Preview Options or Shift+RAM Preview Options. You can change any of the following:
Mute Audio Include or exclude audio from RAM preview.
Frame Rate Choose Auto to use the composition frame rate.
Skip The number of frames to skip between each rendered frame. Choose 0 to render all frames.
Resolution Choose Auto to use the composition resolution.
From Current Time Select From Current Time to play from the current time; otherwise, RAM Preview will play the
work area or from the beginning of the composition, layer, or footage item.
Full Screen Play RAM preview at the full size of the composition, layer, or footage item on a screen that is the
background color. You can change the panel’s background color using the User Interface Brightness control in User
Interface Colors preferences.
2Do one of the following:
•To preview using RAM Preview Options, click the RAM Preview button in the Time Controls panel or press
0 (zero) on the numeric keypad.
•To preview using Shift+RAM Preview Options, Shift-click the RAM Preview button in the Time Controls
panel or press Shift+0 (zero) on the numeric keypad.
Press the asterisk key (*) on the numeric keypad during a RAM preview to place a layer marker on the selected layers
atthecurrentlypreviewedframe.Thisisaconvenientwaytoplacemarkerscorrespondingtoimportantpointsinan
audio track.
Note: The performance of RAM previews performed with the Render Multiple Frames Simultaneously preference
selected may be decreased if antivirus software is running. (See “Render multiple frames simultaneously” on page 40.)
Save a RAM preview as a movie
After Effects can save RAM previews as uncompressed AVI files (Windows) or MOV files (Mac OS). When saving
a RAM preview, keep the following in mind:
•After Effects uses the composition frame size and resolution setting to determine the final dimension in pixels of
a saved RAM preview. It doesn’t consider the zoom level.
•RAM preview doesn’t generate interlaced fields, so a saved RAM preview never contains fields.
Note: The 3D View of the active composition panel must be set to Active Camera for Save RAM Preview to work, even
if the composition doesn’t contain 3D layers.
1After you generate a RAM preview, choose Composition > Save RAM Preview.
2Type a name, specify a location, and click Save.
AFTER EFFECTS CS3
User Guide
122
Loop options for previews
Click the Loop Options button in the Time Controls panel until it shows the desired state:
Loop Repeatedly plays preview from beginning to end.
Play Once Plays preview once.
Ping Pong Repeatedly plays preview, alternating between backward and forward play.
Preview audio
When you preview audio, it’s played back in real time, unless you’ve applied Audio effects other than Stereo Mixer,
in which case you may have to wait for audio to render before it plays back.
Note: If audio must be rendered for a preview, then only the amount of audio specified by the Duration setting in the
Previews preferences will be rendered and played for the preview.
Set the sample rate for audio for the entire project in the Project Settings dialog box (File > Project Settings). CD-
quality sound is 44.1 KHz, 16-bit stereo.
The Audio Hardware and Audio Output Mapping preferences determine the behavior of audio previews. These
preferences do not affect final output. The quality of audio in final output is determined by the output module
setting.
•Topreviewonlyaudiofromthecurrenttime,chooseComposition>Preview>AudioPreview(HereForward)or
press the period key (.) on the numeric keypad.
•To preview only audio in the work area, choose Composition > Preview > Audio Preview (Work Area) or press
Alt+period (.) (Windows) or Option+period (.) (Mac OS) on the numeric keypad.
Manually preview (scrub) video and audio
•To manually prev iew (scrub) video in the Timeline panel or go to a specific frame, drag the current-time indicator.
•To scrub audio in the Timeline panel, Ctrl+Alt-drag (Windows) or Command+Option-drag (Mac OS) the
current-time indicator.
•To scrub audio and video in the Timeline panel, Ctrl-drag (Windows) or Command-drag (Mac OS) the current-
time indicator.
If you stop moving the current-time indicator while keeping the mouse button depressed, a short section of audio
loops.
Audio panel options
During previews, the Audio panel’s volume unit (VU) meter actively displays audio volume levels. At the top of the
VU meter, signals indicate when the audio is clipping—a distortion that occurs when the audio signal exceeds the
maximum level that the audio device allows.
To view the VU meter and levels controls in more detail, increase the height of the Audio panel.
AFTER EFFECTS CS3
User Guide
123
Audio panel
A. VU meter B. Level controls C. Level units D. Audio panel menu E. Level values
Choose Options on the Audio panel menu to specify the following options:
Units Choose whether to display audio levels in decibels or in percentages. 100% equals 0 decibels (0 dB).
Slider Minimum The minimum audio level to display in the Audio panel.
Move the current-time indicator
The most basic way of previewing frames is to manually preview by moving or dragging the current-time indicator.
The time ruler visually represents the time dimension of a composition, a layer, or a footage item. In a Layer or
Footage panel, the time ruler appears near the bottom of the panel. For a Composition panel, the time ruler appears
in the corresponding Timeline panel. The time rulers in different panels represent different durations. The time ruler
in a Layer or Footage panel represents the duration of the contents of that panel; the time ruler in the Timeline panel
represents the duration of the entire composition.
On a time ruler, the current-time indicator indicates the frame you are viewing or editing.
Current-time indicator in the time ruler in the Timeline panel (left) and in the Layer panel (right)
•To go forward or backward one frame, click the Next Frame or Previous Frame button in the Time Controls
panel, or press Page Down or Page Up.
•To go forward or backward ten frames, Shift-click the Next Frame or Previous Frame button, or press Shift+Page
Down or Shift+Page Up.
•To go forward a specific period of time or number of frames, click the current-time display, and then enter the
plus sign (+) followed by the timecode or number of frames to advance. For example, enter +20 to go forward 20
frames or 1:00 to go forward one second. Precede the value by the minus sign (-) to go backward. For example,
enter +-20 to go backward 20 frames or +-1:00 to go backward one second.
•To go to the first or last frame, click the First Frame or Last Frame button in the Time Controls panel, or
press Home or End.
•To go to the first or last frame of the work area, press Shift+Home or Shift+End.
A
C
B
E
D
AFTER EFFECTS CS3
User Guide
124
•To go to a specific frame, click in the time ruler; click the current-time display in the Footage, Layer, Composition,
or Timeline panel; or press Alt+Shift+J (Windows) or Option+Shift+J (Mac OS).
•Shift-drag the current-time indicator to snap to keyframes, markers, In and Out points, the beginning or end of
the composition, or the beginning or end of the work area.
See also
“Shortcuts for time navigation” on page 643
Choose a viewer to always preview
Designating a viewer as the default panel to preview is particularly useful when you have a Composition viewer that
represents your final output, and you always want to preview that viewer even when you’re changing settings in other
panels.
The panel that’s set to always preview appears frontmost for the duration of the preview.
❖Click the Always Preview This View button in the bottom left corner of the panel.
Note: When multiple views are open, previews use the frontmost composition view for 2D compositions and the Active
Camera view for 3D compositions. To turn off the Active Camera, deselect Previews Favor Active Camera in the Time
Controls menu.
See also
“Work with viewers” on page 19
Preview modes
Each preview mode provides a different balance between quality and speed for playback and for updating of images
during editing and other interactions.
Draft 3D and Live Update modes apply to all views of a composition.
Draft 3D Disables lights, shadows, and cameras’ depth-of-field blur. To turn Draft 3D mode on or off, click the Draft
3D button at the top of the Timeline panel.
Live Update Updates images in the Composition or Layer panel during editing and other interactions. When Live
Update is deselected, After Effects displays wireframe representations during edits, such as dragging a layer in the
Composition panel or modifying a property value in the Timeline panel. To turn Live Update mode on or off, click
the Live Update button , at the top of the Timeline panel.
To temporarily toggle Live Update mode, hold Alt (Windows) or Option (Mac OS) while dragging to move a layer,
modify a property value, or move the current-time indicator.
Fast Previews You can use a different Fast Previews mode for each view in the Composition panel. For example, in
a 4 Views layout, you could use OpenGL for the Active Camera view and Wireframe for Left, Right, and Top views.
Click the Fast Previews button , at the bottom of the Composition panel to set Fast Previews preferences or choose
from the following Fast Previews modes:
•Wireframe Represents each layer as a wireframe outline, which increases playback speed and allows you to quickly
reposition a layer with a high resolution or several effects applied.
AFTER EFFECTS CS3
User Guide
125
•Adaptive Resolution Decreases the preview resolution of layers when necessary to maintain speed of updating of
images during editing and other interactions. The Adaptive Resolution Limit value in the Fast Previews area in the
Previews preferences category specifies the maximum reduction in resolution to use.
•OpenGL-Interactive or OpenGL-Always OnOpenGL mode provides high-quality previews that require less
rendering time than other playback modes. OpenGL can also be used to speed up rendering to final output. OpenGL
features in After Effects rely on OpenGL features of your video hardware. When OpenGL does not support a feature,
it simply creates a preview without using that feature. For example, if your layers contain shadows and your OpenGL
hardware does not support shadows, the preview will not contain shadows. Select OpenGL-Interactive to use
OpenGL only for interactions, such as manually previewing (scrubbing) in the Timeline panel or dragging a layer in
the Composition panel. You can tell that OpenGL is engaging by looking at the Fast Previews icon, which will light
up. Select OpenGL-Always On to use OpenGL for all previews. In this mode, “OpenGL” will appear in the upper-
left corner of each view in the Composition panel.
Note: The Enable OpenGL option in the Fast Previews area of the Preview preferences category must be selected for you
to use OpenGL.
To prevent After Effects from updating images in the Footage, Layer, or Composition panels, press the Caps Lock key.
When you make a change that would otherwise appear in a panel, After Effects adds a red bar at the bottom of the
panel with a text reminder that image refresh is disabled. After Effects continues to update panel controls such as motion
paths, anchor points, and mask outlines as you move them. To resume panel updates and display all changes, press Caps
Lock again. Pressing Caps Lock is a good way to prevent views from being refreshed for each frame during rendering for
final output.
See also
“Render with OpenGL” on page 593
Work with snapshots
When you want to compare one view to another in the Composition, Layer, or Footage panel, take a snapshot. For
example, you might want to compare two frames at different times in a movie.
Snapshots taken in one kind of panel can be displayed in another kind. For example, you can take a snapshot of a
Layer panel and display the snapshot in the Composition or Footage panel. Displaying a snapshot does not replace
the content of the panel. If the snapshot has a different size or aspect ratio than the panel in which you display it, the
snapshot is resized to fit the current view.
Snapshots are for reference only and do not become part of the layer, composition, or rendered movie.
A sound is generated when you take a snapshot.
•To take a snapshot, click the Take Snapshot button at the bottom of the panel or press Shift+F5, Shift+F6,
Shift+F7, or Shift+F8.
•To view the most recent snapshot, click and hold the Show Last Snapshot button at the bottom of the panel.
•To view a specific snapshot, press and hold F5, F6, F7, or F8.
•To purge a snapshot, hold down Ctrl+Shift (Windows) or Command+Shift (Mac OS) and press F5, F6, F7, or F8.
•To free all memory used to store snapshots, choose Edit > Purge > Snapshot.
AFTER EFFECTS CS3
User Guide
126
Preview on an external video monitor
You can preview the contents of your Layer, Footage, or Composition panel on an external video monitor. This
requires additional hardware, such as a video capture card or a FireWire port. If you’re using a video digitizing card
to connect an external video monitor, follow the directions that came with your video digitizing card to connect the
monitor for viewing previews. If you’re using a FireWire port, first connect a digital camcorder or video tape recorder
(VTR) to the port, then connect the video monitor to the camcorder or VTR. For more information on setting up
FireWire previews, see the documentation that came with your digital camcorder or VCR.
Whetherornotcolormanagementisenabledfortheproject,AfterEffectsdoesnotmanagethecolorofpreviewson
an external video monitor. The colors sent to the external video monitor are in the project’s working color space. For
more information, see “Choose a working color space and enable color management” on page 243.
1Choose Edit > Preferences > Video Preview (Windows) or After Effects > Preferences > Video Preview (Mac OS).
2Choose an external device from the Output Device menu. (If a device is available, it’s automatically listed in this
menu.)
3Choose a mode from the Output Mode menu. The choices listed depend on the device you are using. The Frame
Size value that appears under the Output Mode menu is dependent on the value that you select from the Output
Mode menu, and is not dependent on any other After Effects settings.
4Set any of the following options:
Previews Displays RAM previews or standard previews on the external monitor only.
Mirror On Computer Monitor DisplaysRAMpreviewsorstandardpreviewssimultaneouslyontheexternalmonitor
and on the computer screen. This may slow down the previews.
Interactions Displays interactive previews, such as scrubbing in the Timeline panel or dragging in the Composition
panel, on the computer screen and simultaneously on the external monitor.
Renders Displays each frame on the computer screen and simultaneously on the external monitor as the frames
render in the render queue.
5Select Scale And Letterbox Output To Fit Video Monitor if you are working with image sizes that don’t match your
preview device frame size and you want to see the entire image scaled to fit.
After choosing an output device in the Video Preview preferences, you can preview the current frame on the output
device by pressing the forward slash (/) key on the numeric keypad. Press Ctrl+/ (Windows) or Command+/
(Mac OS) to toggle the preference to Desktop Only or to the output device you specified.
Modifying and using views
Select a view layout and share view settings
The Composition panel can show one, two, or four views at a time. By default, viewer options (such as grids and
rulers) affect only the currently selected view.
•To select a view layout, choose an option from the Select View Layout menu at the bottom of the Composition
panel.
•To scroll through view layouts, position the pointer over the Select View Layout menu and spin the mouse wheel.
•Toapplyviewsettingstoallviewsinthecurrentlayout,chooseShareViewOptionsfromtheSelectViewLayout
menu. Hold Ctrl (Windows) or Command (Mac OS) to momentarily reverse this behavior.
AFTER EFFECTS CS3
User Guide
127
See also
“Select a 3D view” on page 127
“Work with viewers” on page 19
Select a 3D view
You can view your 3D layers from several angles, using orthographic views or custom views that employ perspective.
You can switch views at any time. The orthographic views (Front, Back, Left, Top, Right, and Bottom) show layers’
positions in the composition but do not show perspective.
You can adjust the point of view and direction of view for the custom views with the camera tools.
You can also choose to look at selected layers or all layers. When you do this, After Effects changes the point of view
and direction of view to include the layers that you have selected.
•Choose a view from the 3D View menu at the bottom of the Composition panel.
•Choose View > Switch 3D View, and choose a view from the menu.
•Choose View > Switch To Last 3D View.
•To switch to the previous 3D view, press Esc.
•To see selected layers, choose View > Look At Selected Layers.
•To see layers that aren’t visible in the active view, choose View > Look At All Layers.
•To select one of the 3D views with keyboard shortcuts, press F10, F11, or F12.
Tochangewhich3Dviewisassignedtoakeyboardshortcut,switchtoaviewandthenpressShiftandtheshortcut
key. For example, to make F12 the shortcut for Top view, switch to Top view and then press Shift+F12. You can also
use the View > Assign Shortcut To menu command for this purpose.
See also
“Working with 3D layers” on page 171
“Cameras, lights, and points of interest” on page 176
“Select a view layout and share view settings” on page 126
Show or hide layer controls in the Composition panel
You can assign different options to each view in the Composition panel, so that you can see any combination of
camera and light wireframes, layer handles, mask and shape paths, effect control points, and motion path controls.
•To choose which layer controls to show in a view, choose View > View Options, or press Ctrl+Alt+U (Windows)
or Command+Option+U (Mac OS).
•To show or hide layer controls in a view, choose View > Show Layer Controls, or press Ctrl+Shift+H (Windows)
or Command+Shift+H (Mac OS). This also shows or hides the 3D reference axes.
•To show or hide mask path and shape paths in a view, click the Toggle Mask And Shape Path Visibility button
at the bottom of the Composition panel.
AFTER EFFECTS CS3
User Guide
128
Zoom
The Magnification Ratio control in the lower-left corner of a Composition, Layer, or Footage panel shows and
controls the current magnification. By default, the magnification is set to fit the current size of the panel. When you
change magnification, you change the appearance of the pixels in the panel that you are previewing, not the actual
resolution of the composition.
Note: After Effects renders vector objects before zooming (scaling for preview), so some vector objects may appear jagged
when you zoom in on them. This does not affect scaling of layers or rendering to final output.
•To zoom in to or out from the center of the active view, press the period (.) key or the comma (,) key. Each keypress
additionally increases or decreases the magnification.
•Tozoomintooroutfromthecenteroftheviewusingthemousescrollwheel,positionthepointeroverthepanel
and move the scroll wheel.
•To zoom in on or out from a specific point using the mouse scroll wheel, position the pointer over the panel and
Alt-move (Windows) or Option-move (Mac OS) the scroll wheel.
•To zoom in on a specific point using the Zoom tool , click the area in the panel you want to magnify. Each click
additionally magnifies the image, centering the display on the point you click. You can also drag the tool to
magnify a specific area.
•To zoom out from a specific point using the Zoom tool, Alt-click (Windows) or Option-click (Mac OS) the point
that you want to be the center of the zoomed-out view. Each click additionally decreases the magnification of the
image, centering the display on the point you click.
•To zoom the active view to 100%, double-click the Zoom tool button in the Tools panel.
•To zoom to fit or to zoom to a preset magnification, choose a zoom level from the Magnification Ratio menu. To
change the magnification of all views in a Composition panel, hold down Ctrl (Windows) or Command (Mac OS)
while choosing a zoom level from the menu. Choose Fit to make the image fit the Composition panel; choose Fit
Up To 100% to limit the zoom level to 100%.
To pan around in the Composition, Layer, or Footage panel while zoomed in, drag with the Hand tool, which you
can activate by holding down the spacebar or the H key.
See also
“Shortcuts for using and modifying views” on page 644
Resolution
Resolution determines the dimensions of the image in pixels, which affects the image quality of the previewed or
rendered composition. Rendering time and memory for each frame are roughly proportional to the number of pixels
being rendered.
You can use a low resolution setting when animating or previewing a movie, and then increase the resolution before
rendering your final movie.
For previewing purposes, you can automatically zoom in and out depending on the Resolution setting by selecting
the Auto-zoom When Resolution Changes preference (Edit > Preferences > Display (Windows) or After Effects >
Preferences > Display (Mac OS)). Deselect this preference to maintain the composition’s size in the Composition
panel.
AFTER EFFECTS CS3
User Guide
129
You can choose from the following Resolution settings in the Composition Settings (Composition > Composition
Settings) dialog box or at the bottom of the Composition panel:
Full Renders each pixel in a composition. This setting gives the best image quality, but takes the longest to render.
Half Renders one-quarter of the pixels contained in the full-resolution image—half the columns and half the rows.
Third Renders one-ninth of the pixels contained in the full-resolution image.
Quarter Renders one-sixteenth of the pixels contained in the full-resolution image.
Custom Renders the image at the resolution you specify.
Viewing a color channel or alpha channel
You can view red, green, blue, and alpha channels—together or separately—in a Footage, Layer, or Composition
panel by clicking the Show Channel button at the bottom of the panel and choosing from the menu. When you
view a single color channel, the image appears as a grayscale image, with the color value of each pixel mapped to a
scale from black (0 value for the color) to white (maximum value for the color).
To see color values displayed in the channel’s own color instead of white, choose Colorize from the Show Channel
menu.
When you preview the alpha channel, the image appears as a grayscale image, with the transparency value of each
pixel mapped to a scale from black (completely transparent) to white (completely opaque).
Note: When you choose RGB Straight, which shows straight RGB values before they are matted (premultiplied) with the
alpha channel, pixels with complete transparency are undefined and therefore may contain unexpected colors.
You can view other channel values, such as saturation and hue, by applying the Channel Combiner effect and
choosing Lightness from the To menu.
To switch between showing the alpha channel and showing all RGB channels, Alt-click (Windows) or Option-click
(Mac OS) the Show Channel button.
See also
“About alpha channels and mattes” on page 252
“About straight and premultiplied channels” on page 253
“Shortcuts for using and modifying views” on page 644
“Channel Combiner effect” on page 383
Adjust exposure for previews
You can adjust the exposure (in f-stop units) for previews with the Adjust Exposure control, which is located to the
right of the Reset Exposure button at the bottom of a Composition, Layer, or Footage panel. Each viewer can have
its own Adjust Exposure setting.
When the Adjust Exposure control is set to a value other than zero, the center of the Reset Exposure button is orange .
The Adjust Exposure control doesn’t affect final output, only how video appears during previews. To make tonal
adjustments to a layer that appear in final output, use the Exposure effect.
AFTER EFFECTS CS3
User Guide
130
The Adjust Exposure control is useful for finding the black point or white point in an image. For example, drag the
valuecontroltotheright(positivevalues)untiltheentireimageiswhiteexceptforonearea;thatareaisthedarkest
area in the image.
•To adjust exposure for a viewer, drag the Adjust Exposure control to the left or right, or click the control and enter
a value in the text box.
•To reset exposure, click the Reset Exposure button. To return to the most recent non-zero setting, click the button
again.
See also
“Exposure effect” on page 397
Work with safe zones, grids, guides, and rulers
In the Footage, Layer, and Composition panels, you can display safe zones, grids, rulers, and guide lines to align and
arrange visual elements. After Effects preserves guides when importing Photoshop files saved with guides.
Television sets enlarge a video image and allow some portion of its outer edges to be cut off by the edge of the screen.
This is known as overscan. The amount of overscan is not consistent between television sets, so you should keep
important parts of a video image within margins known as safe zones. The conventional action-safe zone is 90% of
the width and height of the frame; keep important visual elements within this zone. The conventional title-safe zone
is 80% of the width and height of the frame; keep text that you intend for the audience to read within this zone. Safe-
zone margins represent the percentage of image dimensions not included in the safe zone. You should always design
from one edge of the frame to the other, because computer monitors and some television sets may show the entire
frame.
Grids, guides, and rulers can help you to arrange and align layers. The size of proportional grids increases or
decreases when the composition size changes; the size of standard grid squares remains the same regardless of
composition size.
You can change the origin, or zero point,inbothrulers.Thepositionofthepointermeasuredfromthenewzeropoint
is shown in the Info panel as X’ and Y’ coordinates.
Grids and guides are not rendered, either for RAM previews or for final output.
AFTER EFFECTS CS3
User Guide
131
Composition panel’s zones and grids
A. Grid B. Title-safe zone C. Action-safe zone D. Overscan
•To change the portion of the composition marked as title-safe or action-safe, as well as other options for grids and
guides, choose Edit > Preferences > Grids & Guides (Windows) or After Effects > Preferences > Grids & Guides
(Mac OS).
•To show or hide safe zones, grids, guides, or rulers, click the Grid And Guides Options button and choose the
appropriate menu item, or use a menu command or keyboard shortcut in the View menu.
•To toggle between showing and hiding the safe zones, Alt-click (Windows) or Option-click (Mac OS) the Grid
And Guide Options button.
•To make layer edges and mask edges snap to grids or guides, choose View > Snap To Grid or View > Snap To
Guides.
•To create a guide line, drag from either ruler.
•To delete a guide line, drag it to a ruler using the Selection tool.
•To delete all guide lines, choose View > Clear Guides.
•To move a guide line, drag it using the Selection tool.
•To lock or unlock guides, choose View > Lock Guides. Locking a guide prevents it from being accidentally moved.
•To set the zero point for the rulers, drag the crosshair from the intersection of the two rulers (in the upper-left
corner) into the image area. Reset the zero point by double-clicking the intersection of the rulers.
Dragging the zero point crosshair
See also
“Shortcuts for using and modifying views” on page 644
Change time display units
Many quantities in After Effects are either points in time or spans of time, including current time, layer In and Out
points, and durations of layers, footage items, and compositions.
A
B
C
D
AFTER EFFECTS CS3
User Guide
132
By default, After Effects displays time in Society of Motion Picture and Television Engineers (SMPTE) timecode:
hours, minutes, seconds, and frames. You can change to another system of time display, such as frames, or feet and
frames of 16mm or 35mm film.
Video-editing workstations often use SMPTE timecode that is recorded onto videotape for reference. If you are
creating video that will be synchronized with video that uses SMPTE timecode, use the default timecode display
style.
You may want to see time values in a feet plus frames format, for example, if you are preparing a movie for eventual
output to film, or in simple frame numbers if you plan to use your movie in an animation program such as Flash.
The format you choose applies to the current project only.
Important: Changing the time display format does not alter the frame rate of your assets or output—it changes only how
frames are numbered for display in After Effects.
The current-time display appears in the upper-left corner of the Timeline panel and at the bottom of the Layer,
Composition, and Footage panels.
•To cycle through Timecode Base, Frames, and Feet + Frames, Ctrl-click (Windows) or Command-click (Mac OS)
the current-time display at the bottom of the Composition, Layer, or Footage panel, or at the top of the Timeline
panel.
•To change time display units, choose File > Project Settings, and choose from the options in the Display Style
section.
Timecode Base Displays time as timecode, using the frame rate that you specify as the timecode base. Auto uses the
rounded frame rate of the footage item or composition. If an item doesn’t have timecode (such as an audio file), After
Effects uses a default value (30 fps for English and Japanese versions of After Effects, or 25 fps for French, German,
Spanish, and Italian versions) or the last non-auto value you specified in the Project Settings dialog box. You can also
specify that After Effects use a specific frame rate.
Note: You can specify specific frame rates for display in the Timecode Base menu; however, in most cases, you should
leave the timecode base set to Auto.
Drop Frame versus Non-Drop Frame Two of the more commonly used combinations of time display settings are 30
fps drop-frame timecode and 30 fps non-drop-frame timecode. When the frame rate is a non-integer number—as
is the case with the NTSC frame rate of 29.97 frames per second—a compromise of one sort or another must be made
in displaying time. Either the time display can accurately show clock time (after one hour, the time display shows
1:00:00:00) or the time display can be continuously numbered (frame n is always followed by frame n + 1, modulo
the number of frames per second). Drop-frame timecode does the former; non-drop-frame timecode does the latter.
In the case of NTSC 30 fps drop-frame timecode, two frame numbers are skipped for each minute, except for every
tenth minute. Drop-frame timecode is conventionally indicated by separating the time units with semicolons. The
most common case for which drop-frame versus non-drop-frame timecode is relevant is 29.97 fps NTSC, but it also
applies to 23.976 fps (which is treated by After Effects as non-drop-frame timecode) and 59.94 fps.
Timecode for 59.94 fps compositions and footage items matches that in Adobe Premiere Pro: When the timecode
base is 30 fps, each timecode value repeats twice. When the timecode base is 60 fps drop-frame, frame numbers
0,1,2,3 are dropped in exactly the same places as where 0,1 are dropped for drop-frame timecode with a timecode
base of 30 fps.
Feet + Frames Displays number of feet of film, plus frames for fractional feet, for 16mm or 35mm film. Numbering
starts at the frame number that you specify with the Start Numbering Frames At value.
Frames Displays frame number instead of time. Use this setting for convenience when doing work that you are
integrating with a frame-based format, like Flash.
133
Chapter 7: Layers and properties
Creating layers
About layers
Layers are the elements that make up a composition. Without layers, a composition is only an empty frame. Use as
many layers as necessary to create your composition. Some compositions contain thousands of layers, whereas some
compositions contain only one layer.
Layers in After Effects are similar to tracks in Adobe Premiere Pro. The primary difference is that each After Effects
layer can have no more than one footage item as its source, whereas a Premiere Pro track typically contains multiple
clips. Layers in After Effects are also very similar to layers in Photoshop, though the interface for working with layers
differs.
Four layers as viewed in the Composition panel (top) and in the Timeline panel (bottom)
You can create several kinds of layers:
•Video and audio layers that are based on footage items that you import, such as still images, movies, and audio
tracks
•Layers that you create within After Effects to perform special functions, such as cameras, lights, adjustment layers,
and null objects
•Solid-color layers that are based on solid-color footage items that you create within After Effects
•Synthetic layers that hold visual elements that you create within After Effects, such as shape layers and text layers
•Precomposition layers, which use compositions as their source footage items
To see a video tutorial on creating and managing layers, visit the Adobe website at www.adobe.com/go/vid0222.
When you make a change to a layer, you do not affect its source footage item. This means that you can use the same
footage item as the source for more than one layer, and use the footage differently in each instance. (See “Importing
and interpreting footage items” on page 47.)
AFTER EFFECTS CS3
User Guide
134
Changes made to one layer do not affect other layers, unless you specifically link the layers. For example, you can
move, rotate, and draw masks for one layer without disturbing any other layers in the composition.
After Effects automatically numbers all layers in a composition. By default, these numbers are visible in the Timeline
panelnexttothelayername.Thenumbercorrespondstothepositionofthatlayerinthestackingorder.Whenthe
stacking order changes, After Effects changes all numbers accordingly. The layer stacking order affects rendering
order, and therefore affects how the composition appears for previews and final rendered output. (See “Render order
and collapsing transformations” on page 115.)
After you add a layer, you can reposition it in the Composition panel. In the Timeline panel, you can change a layer’s
duration, starting time, and place in the layer stacking order.
Note: By default, new layers begin at the beginning of the composition duration. You can instead choose to have new
layers begin at the current time by deselecting the Create Layers At Composition Start Time preference (Edit >
Preferences > General (Windows) or After Effects > Preferences > General (Mac OS)).
See also
“Creating and editing text layers” on page 273
“Working with 3D layers” on page 171
“Shortcuts for working with layers” on page 645
“Cameras, lights, and points of interest” on page 176
“About shapes and shape layers” on page 314
“Create a null object” on page 159
Work with the Layer panel
You can perform many tasks—such as drawing masks—in either the Composition panel or the Layer panel.
However, other tasks—such as tracking motion and using the paint tools—must be performed in the Layer panel.
The Layer panel shows you a layer before any transforms are applied to the layer. For example, the Layer panel does
not show the result of modifying a layer’s Rotation properties. To see a layer in context with other layers and with the
results of transforms, use the Composition panel.
Layers that are not based on a source footage item are synthetic layers. Synthetic layers include text layers and shape
layers. You cannot open a synthetic layer in the Layer panel. You can, however, precompose a synthetic layer and
open the precomposition in the Layer panel.
•To open a layer in the Layer panel, double-click the layer in the Timeline panel.
•To view changes to a layer (such as masks or effects), select Render in the Layer panel. Deselect Render to view
the original, unaltered layer.
See also
“Work with viewers” on page 19
“Modifying and using views” on page 126
“Shortcuts for working with layers” on page 645
“Precompose layers” on page 114
AFTER EFFECTS CS3
User Guide
135
Create layers from footage items
You can create a layer from any footage item in the Project panel, including another composition. After you add a
footage item to a composition, you can modify and animate the resulting layer.
When you add a composition to another composition, you create a layer that uses the composition that you added
as its source. (See “Nesting, precomposing, and pre-rendering” on page 113.)
The Still Footage preference setting (Preferences > Import) controls the default duration of layers that use still
footage items as their sources. By default, when you create a layer with a still image as its source, the layer’s duration
is the duration of the composition. You can change the duration of the layer after it’s created by trimming the layer.
Note: By default, new layers begin at the beginning of the composition duration. You can instead choose to have new
layers begin at the current time by deselecting the Create Layers At Composition Start Time preference (Edit > Prefer-
ences > General (Windows) or After Effects > Preferences > General (Mac OS)).
Often, the next step after adding a layer to a composition is scaling and positioning the layer to fit in the frame. (See
“Scale a layer” on page 155.)
See also
“Working with footage items” on page 58
“Trim, extend, or slip-edit a layer” on page 141
“Shortcuts for working with layers” on page 645
Create layers from one or more footage items
When you create layers from multiple footage items, the layers appear in the layer stacking order in the Timeline
panel in the order in which they were selected in the Project panel.
1Select one or more footage items and folders in the Project panel.
2Do one of the following:
•Drag the selected footage items to the Composition panel, or press Ctrl+/ (Windows) or Command+/ (Mac OS).
•Drag the selected footage items to the Timeline panel. When you drag the item into the layer outline, a highlight
bar indicates where the layer will appear when you release the mouse button. If you drag the item over the time
graph area, a time marker indicates where the layer’s In point will be when you release the mouse button.
•Drag the selected footage items to the composition name or icon in the Project panel.
Create a layer from a trimmed footage item
You can trim a moving-image footage item in the Footage panel before inserting a layer based on that footage item
into a composition.
1To open a footage item in the Footage panel, double-click it in the Project panel.
Double-clicking opens some footage items—including MOV and some AVI movies—in a media player window. To
open some kinds of footage items in the Footage panel, you must Alt-double-click (Windows) or Option-double-
click (Mac OS) them. (See “Working with footage items in the Footage panel” on page 59.)
2Move the current-time indicator in the Footage panel to the frame that you want to use as the layer’s In point, and
click the Set In Point button at the bottom of the Footage panel.
3Move the current-time indicator in the Footage panel to the frame that you want to use as the layer’s Out point,
and click the Set Out Point button at the bottom of the Footage panel.
AFTER EFFECTS CS3
User Guide
136
4To create a layer based on this trimmed footage item, click an Edit button at the bottom of the Footage panel:
Overlay Edit Createsthenewlayeratthetopofthelayerstackingorder,withtheInpointsetatthecurrenttime
in the Timeline panel.
Ripple Insert Edit Also creates the new layer at the top of the layer stacking order, with the In point set at the
current time in the Timeline panel, but splits all other layers. Newly created split layers are moved later in time so
that their In points are at the same time as the inserted layer’s Out point.
Replace layer sources with references to another footage item
1Select one or more layers in the Timeline panel
2Alt-drag (Windows) or Option-drag (Mac OS) a footage item from the Project panel onto a selected layer in the
Timeline panel.
Create or modify a solid-color layer
You can create layers of any solid color and any size (up to 30,000 x 30,000 pixels). Solid-color layers have solid-color
footage items as their sources. Solids work just like any other footage item: You can add masks, modify transform
properties, and apply effects to a layer that has a solid as its source footage item. Use solid layers to color a
background, as the basis of a control layer for a compound effect, or to create simple graphic images.
Solid-color footage items are automatically stored in the Solids folder in the Project panel.
See also
“Working with footage items” on page 58
“Trim, extend, or slip-edit a layer” on page 141
“Shortcuts for working with layers” on page 645
Create a solid-color layer or solid-color footage item
•To create a solid footage item but not create a layer for it in a composition, choose File > Import > Solid.
•To create a solid footage item and create a layer for it in the current composition, choose Layer > New > Solid or
press Ctrl+Y (Windows) or Command+Y (Mac OS).
To create a layer that fits the composition when you create a solid-color layer, choose Make Comp Size.
Modify settings for solid-color layers and solid-color footage items
•To modify settings for the selected solid-color layer or footage item, choose Layer > Solid Settings.
To apply the changes to all solid-color layers that use the footage item, select Affect All Layers That Use This Solid.
If you don’t select this option, you create a new footage item, which becomes the source for the selected layer.
Create an adjustment layer
When you apply an effect to an ordinary layer, the effect applies only to that layer and no others. However, an effect
can exist independently if you create an adjustment layer for it. Any effects applied to an adjustment layer affect all
layersbelowitinthelayerstackingorder.Anadjustmentlayeratthebottomofthelayerstackingorderhasnovisible
result.
AFTER EFFECTS CS3
User Guide
137
Because effects on adjustment layers apply to all layers beneath them, they are useful for applying effects to many
layers at once. In all other respects, an adjustment layer behaves exactly like other layers; for example, you can use
keyframes or expressions with any adjustment layer property.
Note: If you want to apply an effect or transformation to a collection of layers, you can precompose the layers and then
apply the effect or transformation to the precomposition layer. (See “Precompose layers” on page 114.)
Use masks on an adjustment layer to apply an effect to only parts of the underlying layers. You can animate masks to
follow moving subjects in the underlying layers.
•To create a new adjustment layer, choose Layer > New > Adjustment Layer.
•To convert selected layers to adjustment layers, select the Adjustment Layer switch for the layers in the
Timeline panel or choose Layer > Switches > Adjustment Layer.
Note: You can deselect the Adjustment Layer switch for a layer to convert it to a normal layer.
See also
“Apply an effect or animation preset” on page 351
“Creating and importing masks” on page 254
Create a layer and new Photoshop footage item
WhenyoucreateanewAdobePhotoshopfilefromAfterEffects,PhotoshopstartsandcreatesanewPSDfile.This
PSD file consists of a blank Photoshop layer that has the same dimensions as your composition, with the appropriate
title-safe and action-safe guides. The color bit depth of the PSD file is the same as that of your After Effects project.
The newly created PSD file is automatically imported into After Effects as a footage item. Any changes that you save
in Photoshop appear in the footage item in After Effects.
•To create a new Photoshop footage item and use it as the source for a new layer in the current composition, choose
Layer > New > Adobe Photoshop File. The Photoshop layer is added as the top layer in your composition.
•To create a new Photoshop footage item with the settings of the most recently open composition, without adding
it to a composition, choose File > New > Adobe Photoshop File.
See also
“Working with footage items” on page 58
“Preparing and importing Photoshop files” on page 83
“Working with Photoshop and After Effects” on page 32
Selecting and arranging layers
Select layers
Selected layers that also have properties selected are indicated with a hollow highlight in the Timeline panel. A
selected layer that has no properties selected is indicated with a solid highlight.
AFTER EFFECTS CS3
User Guide
138
Top layer selected, but no properties selected; bottom layer selected with properties selected.
To scroll the topmost selected layer to the top of the Timeline panel, press X.
•To select a layer, click the layer in the Composition panel, click the layer’s name or duration bar in the Timeline
panel, or click the layer’s name in the Flowchart panel.
•To select a layer that is obscured in the Composition panel, right-click (Windows) or Control-click (Mac OS) over
the layer in the Composition panel, and choose Select > [layer name].
•To select a layer if the layer is open in its own Layer panel, choose the layer name from the Window menu or the
Layer panel viewer menu.
•To select a layer by position number, type the layer number on the numeric keypad. If the layer number has more
than one digit, type the digits quickly so that After Effects can recognize them as one number.
•To select the next layer in the stacking order, press Ctrl+Down Arrow (Windows) or Command+Down Arrow
(Mac OS). To select the previous layer, press Ctrl+Up Arrow (Windows) or Command+Up Arrow (Mac OS).
•To extend the selection to the next layer in the stacking order, press Ctrl+Shift+Down Arrow (Windows) or
Command+Shift+Down Arrow (Mac OS). To extend the selection to the previous layer in the stacking order,
press Ctrl+Shift+Up Arrow (Windows) or Command+Shift+Up Arrow (Mac OS).
•To select all layers, choose Edit > Select All while the Timeline or Composition panel is active. To deselect all
layers, choose Edit > Deselect All.
•To deselect any currently selected layers and select all other layers; with at least one layer selected, choose Invert
Selection from the context menu in the Composition or Timeline panel.
•Toselectalllayersthatusethesamecolorlabel,clickthelayer’scolorlabelintheTimelinepanel,andchooseSelect
Label Group, or select the layer and choose Edit > Label > Select Label Group.
•To select all child layers assigned to a parent layer, select the parent layer and choose Select Children from the
context menu in the Composition or Timeline panel. The child layers are added to the existing selection.
See also
“Work with parent and child layers” on page 158
“Work with color labels” on page 149
“Shortcuts for working with layers” on page 645
Change the stacking order for selected layers
The vertical arrangement of layers in the Timeline panel is the layer stacking order, which is directly related to the
render order.Youcanchangetheorderinwhichlayersarecomposedwithoneanotherbychangingthelayerstacking
order.
AFTER EFFECTS CS3
User Guide
139
Note: Becauseoftheirdepthproperties,thestackingorderof3DlayersintheTimelinepaneldoesnotnecessarilyindicate
their spatial position in the composition.
•In the Timeline panel, drag the layer names to a new position in the layer stacking order.
•To move the selected layers up one level in the layer stacking order, press Ctrl+Alt+Up Arrow (Windows) or
Command+Option+Up Arrow (Mac OS); to move the selected layers down one level, press Ctrl+Alt+Down
Arrow (Windows) or Command+Option+Down Arrow (Mac OS).
•To move the selected layers to the top of the layer stacking order, press Ctrl+Alt+Shift+Up Arrow (Windows) or
Command+Option+Shift+Up Arrow (Mac OS); to move the selected layers to the bottom, press
Ctrl+Alt+Shift+Down Arrow (Windows) or Command+Option+Shift+Down Arrow (Mac OS).
•ChooseLayer,andthenchooseBringLayerForward,SendLayerBackward,BringLayerToFront,orSendLayer
To B ack.
When you copy (or cut) and paste layers, the layers are pasted so that they appear from top to bottom in the Timeline
panel in the same order in which they were selected prior to the copy (or cut) operation. This means that you can
Ctrl-click (Windows) or Command-click (Mac OS) layers to select them in any arbitrary order, cut them, and then
immediately paste them to reorder the layers in the order in which they were selected.
See also
“Render order and collapsing transformations” on page 115
“How render order and collapsed transformations affect 3D layers” on page 175
About coordinate systems
As you move the pointer over the layer frame in the Layer panel, the Info panel displays the coordinates of the pixel
under the pointer in layer space. The X coordinate represents position on the horizontal axis, and the Y coordinate
represents position on the vertical axis. Values for these coordinates are in pixels. The X and Y coordinates are
relative to the origin (0,0), which is fixed at the upper left corner of the layer.
You can modify the rulers’ zero point, but you can’t modify the origin of layer space. If the zero point differs from
the origin, X' and Y' coordinates appear in the Info panel below the X and Y coordinates, indicating coordinates
based on the rulers’ zero point.
When you move the pointer over the composition frame in the Composition panel, the Info panel displays coordi-
nates in composition space. As you drag a layer, the lower portion of the Info panel displays the coordinates of the
layer’s anchor point.
See also
“Work with safe zones, grids, guides, and rulers” on page 130
“Work with layer anchor points” on page 154
Move layers in space
When you move a layer in space, you modify its Position property.
You can manipulate the x, y, and z components of a layer's position independently by applying the Separate XYZ
Position animation preset to the layer and then modifying the Separate XYZ Position effect's properties.
AFTER EFFECTS CS3
User Guide
140
See also
“Work with safe zones, grids, guides, and rulers” on page 130
“Work with layer anchor points” on page 154
“Select layers” on page 137
“Modify layer properties” on page 152
“Working with effects and animation presets” on page 350
“Shortcuts for working with layers” on page 645
“Shortcuts for modifying properties” on page 648
Move layers by dragging in the Composition panel
To snap a layer’s edges to grids or guides as you drag, choose View > Snap To Grid or View > Snap To Guides.
•Select one or more layers, and then drag a selected layer using the Selection tool .
When you move a layer by dragging it in the Composition panel, the Info panel shows the change in the Position
property as you drag.
Move layers by directly modifying the Position property
1Select one or more layers.
2Press P to show the Position property in the Timeline panel.
3Modify the Position property in the Timeline panel.
Move layers with arrow keys
1Select one or more layers.
2To move selected layers one pixel left, right, up, or down, press an arrow key. To move 10 pixels, hold Shift as you
press the arrow key.
Align or distribute layers in 2D space
Use the Align panel to line up or evenly space selected layers. You can align or distribute layers vertically or horizon-
tally.
Note: To align, you must select two or more layers; to distribute, you must select three or more layers.
1Select the layers to align or distribute.
2In the Align panel, click the button representing the desired type of alignment or distribution.
When you align and distribute selected layers, keep the following in mind:
•An alignment option aligns selected layers to the layer that most closely represents the new alignment. For
example, for right-edge alignment, all selected layers align to the selected layer that is farthest to the right.
•A distribution option evenly spaces selected layers between the two most extreme layers. For example, for a
vertical distribution option, the selected layers are distributed between the topmost and bottommost selected
layers.
AFTER EFFECTS CS3
User Guide
141
•When you distribute layers of different sizes, the spaces between layers may not be uniform. For example, distrib-
uting layers by their centers creates equal space between the centers—but different-sized layers extend by different
amounts into the space between layers.
•Alignment or distribution options cannot move locked layers.
•The Align panel does not affect text alignment.
See also
“Select layers” on page 137
“Work with safe zones, grids, guides, and rulers” on page 130
“Align and justify text” on page 283
Trim, extend, or slip-edit a layer
The beginning of a layer’s duration is its In point, and the end is its Out point. The duration is the span between the
In point and the Out point, and the bar that extends from the In point to the Out point is the layer duration bar.
To trim a layer is to modify its In or Out point so that the layer has a different duration. When you trim a layer that
is based on moving source footage, you affect which frames of the source footage item are shown in the layer; the
first frame to appear is at the In point, and the last frame to appear is at the Out point.
Trimming a layer in the Timeline panel
A. Original In point B. Negative layer time indicator for still image layer C. Original In point D. Slip-edit bar, representing excluded frames
for motion footage layer E. New In points
When you use a footage item as a source for different layers, you can trim each layer differently to show different
portions of the source. Trimming a layer does not alter the footage item or the original source file.
You can trim a layer by changing the In and Out points in the Layer panel or the Timeline panel. (You can also trim
a footage item before using it to create a layer. See “Create layers from footage items” on page 135.)
TheInpoint ,Outpoint ,andduration valuesforalayerareshownatthebottomoftheLayerpanel.Toshow
this information for all layers in the Timeline panel, click the In/Out/Duration/Stretch button in the lower-left
corner of the Timeline panel. The duration, In point, and Out point for the selected layer are also shown in the Info
panel.
In the Layer panel, In and Out points are expressed in layer time. In the Timeline panel, In and Out points are
expressed in composition time. The duration is the same in both cases (unless time-remapping or time-stretching is
enabled for the layer).
A B
C
D
E
AFTER EFFECTS CS3
User Guide
142
You can extend many kinds of layers for any duration, extending their In points and Out points out past their original
times. This applies to time-remapped layers, shape layers, layers based on still-image footage items, camera layers,
light layers, and text layers. If you extend a layer back in time so that the layer extends into negative layer time (past
layer time zero), a series of hash marks on the bottom of the layer bar indicates the portions of the layer that are in
negative layer time. This indication is useful if you’ve applied an effect to the layer—such as Particle Playground—
that uses layer time to calculate its results.
See also
“Timeline panel overview” on page 109
“Work with the Layer panel” on page 134
“Shortcuts for working with layers” on page 645
“Using and modifying keyboard shortcuts” on page 638
Trim or extend layers in the Timeline panel
Dragging the Out point of a layer duration bar.
1Select one or more layers in the Timeline panel.
2Do one of the following:
•Drag either end of a layer duration bar.
•Move the current-time indicator to the time at which you want to set the In point or Out point. To set the In point
to the current time, press Alt+[ (Windows) or Option+[ (Mac OS). To set the Out point to the current time, press
Alt+] (Windows) or Option+] (Mac OS).
Trim or extend a layer in the Layer panel
•Open the layer in the Layer panel and drag either end of the layer duration bar.
•Move the current-time indicator in the Layer panel to the time at which you want the footage to begin or end, and
then click the In or Out button to set the In or Out point to the current time.
Slip-edit a layer
Afteryou’vetrimmedalayerbasedonmovingfootage,apaleslip-edit bar represents the frames of the footage item
that you are excluding from the composition. This pale rectangle does not appear for a trimmed layer based on a still
footage item. You can choose which frames are played within a trimmed duration by dragging the slip-edit bar. The
layer’s In and Out points are not affected.
Moving only a layer’s In or Out point doesn’t move keyframes. Dragging the layer duration bar moves all keyframes.
Dragging the slip edit bar moves selected keyframes, but does not move unselected keyframes.
AFTER EFFECTS CS3
User Guide
143
When performing a slip edit, you probably want to move some keyframes with the source footage—such as mask
keyframes. Other keyframes should stay where they are in time. Press Shift+F2 to deselect keyframes and leave the
layer selected.
•Drag the slip-edit bar to the left or right.
Remove part of a layer’s duration
1In the Timeline panel, set the work area to include only the portion of the layers’ duration to remove: Move the
current-time indicator to the time that the work area is to begin, and press B. Move the current-time indicator to the
time at which the work area is to end, and press N.
2Do one of the following:
•Select the layers from which to remove a section.
•Select the Lock switch for layers that you do not want affected by the extraction. Press F2 to deselect all layers.
Note: If no layers are selected, the following step removes the section from all unlocked layers.
3Do one of the following:
•To remove the section and leave a gap of the same duration as the removed section, choose Edit > Lift Work Area.
•To remove the section, choose Edit > Extract Work Area. The gap is closed by ripple deletion.
See also
“Set the work area” on page 112
“Select layers” on page 137
Place a layer in time
The layer duration bar represents the layer duration visually. The In, Out, and Duration columns in the Timeline
panel represent the layer duration numerically.
Note: To choose which columns are visible in the Timeline panel, choose Columns from the panel menu, or right-click
(Windows) or Control-click (Mac OS) a column heading.
These procedures move the entire layer in time.
•To set the In point or Out point numerically, click the number in the In or Out column for the layer in the Timeline
panel.
•To move the In point or Out point to the current time, Alt-click (Windows) or Option-click (Mac OS) the number
in the In or Out column for the layer in the Timeline panel.
•To move the In points of selected layers to the beginning of the composition, press Alt+Home (Windows) or
Option+Home (Mac OS).
•To move the Out points of selected layers to the end of the composition, press Alt+End (Windows) or Option+End
(Mac OS).
•To move selected layers one frame later, press Alt+Page Down (Windows) or Option+Page Down (Mac OS). To
move selected layers 10 frames later, press Alt+Shift+Page Down (Windows) or Option+Shift+Page Down
(Mac OS).
•To move selected layers one frame earlier, press Alt+Page Up (Windows) or Option+Page Up (Mac OS). To move
selected layers 10 frames earlier, press Alt+Shift+Page Up (Windows) or Option+Shift+Page Up (Mac OS).
AFTER EFFECTS CS3
User Guide
144
•To move the entire layer in time by dragging, drag the layer duration bar to the left or right. To snap the layer
duration bar to significant points in time (such as markers, or the start or end of the composition), Shift-drag the
layer duration bar.
Note: WhenyoudragalayerintheTimelinepanel,theInfopaneldisplaysthename,duration,changeintime,andIn
and Out points for the layer.
Before and after dragging the duration bar
See also
“Layer switches and columns in the Timeline panel” on page 147
“Select layers” on page 137
“Shortcuts for working with layers” on page 645
“Trim, extend, or slip-edit a layer” on page 141
“Timeline panel overview” on page 109
Arrange layers in time sequentially
Use the Sequence Layers keyframe assistant to automatically arrange layers in a sequence. When you apply the
keyframe assistant, the first layer you select remains at its initial time, and the other selected layers move to new times
in the Timeline panel based on the order in which you selected them.
Layers selected in Timeline panel (top), and layers arranged in sequence by applying the Sequence Layers Keyframe Assistant (bottom)
AFTER EFFECTS CS3
User Guide
145
Overlapping layers can have Opacity keyframes set automatically to create a cross-dissolve.
For a layer to be put into a sequence, its duration must be less than the length of the composition so that it leaves
time for other layers. (See “Trim, extend, or slip-edit a layer” on page 141.)
1In the Timeline panel, hold down Ctrl (Windows) or Command (Mac OS) and select layers in sequential order,
beginning with the layer to appear first.
2Choose Animation > Keyframe Assistant > Sequence Layers.
3In the Sequence Layers dialog box, do one of the following:
•To arrange the layers end to end, leave the Overlap option unselected.
•To overlap layers, select Overlap, enter a Duration value for the duration of the overlap, and select a transition.
Select Cross Dissolve Front And Back Layers to use the transparency of the selected layers; otherwise, choose
Dissolve Front Layer.
•To leave gaps between the layers, select Overlap and enter a negative Duration value.
See also
“Select layers” on page 137
Copy or duplicate a layer
When you copy a layer, you copy all of its properties, including effects, keyframes, expressions, and masks.
Duplicating a layer is a shortcut with which you copy and paste the layer with one command. Duplicating a layer
with a track matte preserves the relative ordering of the layer and its track matte.
When you paste layers, they are placed in the order in which you selected them before copying. The first layer
selectedisthelastonetobeplaced,soitendsuponthetopinthelayerstackingorder.Ifyouselectlayersfromthe
top first, they will end up in the same stacking order when pasted.
If you have a component of a layer—such as a mask or keyframe—selected when you copy, you copy only that
component. Before copying, press Shift+F2 to deselect all of a layer’s components and leave the layer selected.
•To copy selected layers and place the In points of the copies at the current time, choose Edit > Copy, and then press
Ctrl+Alt+V (Windows) or Command+Option+V (Mac OS).
•Tocopyselectedlayersandplacethecopiesatthesametimesastheoriginals,chooseEdit>Copy,andthenchoose
Edit > Paste.
ToplacecopiesatthetopofthelayerstackintheTimelinepanel instead of immediately above the originals, press F2
to deselect the originals before you paste.
•To duplicate selected layers, choose Edit > Duplicate or press Ctrl+D (Windows) or Command+D (Mac OS).
AFTER EFFECTS CS3
User Guide
146
See also
“Copy and paste keyframes” on page 191
“Work with layer properties in the Timeline panel” on page 152
“Shortcuts for working with layers” on page 645
Split a layer
In the Timeline panel, you can split a layer at any time, creating two independent layers. This is a time-saving alter-
native to duplicating and trimming the layer—something you might do when you want to change the stacking-order
position of the layer in the middle of the composition.
Note: To make new split layers appear above the original layer in the Timeline panel, select Create Split Layers Above
Original Layer (Edit > Preferences > General (Windows) or After Effects > Preferences > General (Mac OS)). Deselect
this option to make the layers appear below the original layer.
1Select one or more layers.
2Move the current-time indicator to the time at which to split the layers.
3Choose Edit > Split Layer.
When you split a layer, both resulting layers contain all of the keyframes that were in the original layer in their
original positions. Any applied track mattes retain their order, on top of the layer.
Afteryousplitalayer,thedurationoftheoriginallayerendsatthepointofthesplit,andthenewlayerstartsatthat
point in time.
If no layer is selected when you choose Edit > Split Layer, all layers are split at the current time.
Paul Tuersley provides a script for splitting layers at layer-time markers:
www.adobe.com/go/learn_ae_paulsplitatmarkers.
See also
“Change the stacking order for selected layers” on page 138
“Select layers” on page 137
“Shortcuts for working with layers” on page 645
Auto-Orientation options
Each layer’s auto-orientation options (Layer > Transform > Auto-Orient) specify how its orientation depends on
motion paths, points of interest, and cameras.
Off The layer rotates freely, independent of the motion path, point of interest, or other layers.
Orient Along Path The layer faces in the direction of the motion path. For example, use this option for a camera to
depict a driver’s perspective while looking at the road ahead while driving.
Orient Towards Camera The layer is always oriented so that it faces the active camera. This option is available for 3D
layers; this option is not available for 2D layers, cameras, or lights.
Orient Towards Point Of Interest The camera or light always points at its point of interest. This option is not available
for layers other than cameras and lights.
AFTER EFFECTS CS3
User Guide
147
Note: If you specify an auto-orientation option, and then change the layer's Orientation or X, Y, or Z Rotation properties,
the layer orientation is offset by the new values. For example, you can set a camera with Orient Along Path, and then
rotate the camera 90 degrees to the right to depict the perspective of a passenger looking out the side window of a car as
it moves.
The automatic orientation to point to the point of interest occurs before the Rotation and Orientation properties'
transformations are applied. This means that a camera or light with the Orient Towards Point Of Interest option can
still be made to look temporarily away from the point of interest by means of animation of the Rotation and Orien-
tation transform properties.
See also
“Working with 3D layers” on page 171
“Cameras, lights, and points of interest” on page 176
“Work with motion paths” on page 197
Managing layers
View and change layer information
•To rename a layer or property group, select it in the Timeline panel and press Enter on the main keyboard
(Windows) or Return (Mac OS).
Layernamescanbenomorethan31characterslong.ThesameistruefornamesoffootageitemsintheProjectpanel.
•To alternate between viewing the name of a selected layer’s source footage item and the name of the layer in the
Timeline panel, click the Layer Name/Source Name column heading in the Timeline panel.
•To show the name of a selected layer’s source footage file in the Info panel, press Ctrl+Alt+E (Windows) or
Command+Option+E (Mac OS).
•To see what footage item is the source for a layer, right-click (Windows) or Control-click (Mac OS) the layer in the
Timeline panel and choose Reveal Layer Source In Project.
The source footage item is selected in the Project panel.
See also
“Select layers” on page 137
“Working with footage items” on page 58
“Timeline panel overview” on page 109
“Shortcuts for working with layers” on page 645
Layer switches and columns in the Timeline panel
Many of a layer’s characteristics are determined by its layer switches, which are arranged in the Timeline panel in
columns. By default, the A/V Features column appears to the left of the layer name, and the Switches and Modes
(Transfer Controls) columns appear to the right, but you can arrange columns in a different order. (See “Work with
columns” on page 18.)
AFTER EFFECTS CS3
User Guide
148
To show or hide columns in the Timeline panel, click the Layer Switches , Transfer Controls , or
In/Out/Duration/Stretch button in the bottom left of the Timeline panel. Press Shift+F4 to show or hide the
Parent column. Press F4 to toggle the Switches and Modes columns.
The results of some layer switch settings depend on the settings of composition switches, which are in the upper right
of the layer outline in the Timeline panel.
Quickly change the state of a switch for multiple layers by clicking the switch for one layer and dragging up or down
that column for the adjacent layers.
Switches in the A/V Features column
Video Toggles layer visuals on or off. (See “Exclude a layer from previews and final output” on page 148.)
Audio Toggles layer sounds on or off.
Solo Includes the current layer in previews and renders, ignoring layers without this switch set. (See “Solo a layer”
on page 149.)
Lock Locks layer contents, preventing all changes. (See “Lock or unlock a layer” on page 149.)
Switches in the Switches column
Shy Hides the current layer when the Hide Shy Layers composition switch is selected. (See “Show and hide
layers in the Timeline panel” on page 150.)
Collapse Transformations/Continuously Rasterize Collapses transformations if the layer is a precomposition;
continuously rasterizes if the layer is a shape layer, text layer, or layer with a vector graphics file (such as an Adobe
Illustrator file) as the source footage. Selecting this switch for a vector layer causes After Effects to rerasterize the
layer for each frame, which improves image quality, but also increases the time required for previewing and
rendering. (See “Render order and collapsing transformations” on page 115 and “Continuously rasterize a layer
containing vector graphics” on page 151.)
Quality Toggles between Best and Draft options for layer quality for rendering, including rendering to the screen
for previews. (See “Layer image quality” on page 150.)
Effect Select to render the layer with effects. The switch does not affect the setting for individual effects on the
layer. (See “Delete or disable effects and animation presets” on page 352.)
Frame Blend Sets frame blending to one of three states: Frame Mix , Pixel Motion , or off. If the Enable
Frame Blending composition switch is not selected, the layer’s frame blending setting is irrelevant. (See “Apply
frame blending to a layer” on page 225.)
Motion Blur Toggles motion blur on or off for the layer. If the Enable Motion Blur composition switch is not
selected, the layer’s motion blur setting is irrelevant. (See “Use motion blur” on page 200.)
Adjustment Layer Identifies the layer as an adjustment layer. (See “Create an adjustment layer” on page 136.)
3D Layer Identifies the layer as a 3D layer. If the layer is a 3D layer with 3D sublayers—as is the case for a text
layer with per-character 3D properties—the switch looks like this: . (See “About 3D layers” on page 171.)
See also
“Shortcuts for working with layers” on page 645
Exclude a layer from previews and final output
•
To prevent a layer from being rendered—both for previews and for final output—deselect the layer’s Video switch .
AFTER EFFECTS CS3
User Guide
149
•To select the Video switch for all layers, choose Layer > Switches > Show All Video.
•To deselect the Video switch for all layers except the selected layers, choose Layer > Switches > Hide Other Video.
See also
“Layer switches and columns in the Timeline panel” on page 147
Solo a layer
You can isolate one or more layers for animating, previewing, or final output by soloing. Soloing excludes all other
layers of the same type from being rendered—both for previews in the Composition panel and for final output. For
example, if you solo a video layer, any lights and audio layers are unaffected, so they appear when you preview or
render the composition. However, the other video layers do not appear.
•To solo one or more layers, select the layers in the Timeline panel, and click the Solo icon to the left of the layer
names.
•To solo one layer and unsolo all other layers, Alt-click (Windows) or Option-click (Mac OS) the Solo icon to
the left of the layer name.
The Video switch is dimmed for other layers when a layer is soloed, indicating that the other layers are not visible.
See also
“Layer switches and columns in the Timeline panel” on page 147
Lock or unlock a layer
TheLockswitchpreventslayersfrombeingeditedaccidentally.Whenalayerislocked,youcannotselectitineither
the Composition or Timeline panels. If you try to select or modify a locked layer, the layer flashes in the Timeline
panel.
When a layer is locked, the Lock icon appears in the A/V Features column, which appears by default to the left
of the layer name in the Timeline panel.
•To lock or unlock a layer, click the Lock switch for the layer in the Timeline panel.
•To unlock all layers in the active composition, choose Layer > Switches > Unlock All Layers.
See also
“Layer switches and columns in the Timeline panel” on page 147
Work with color labels
You can use labels (colored boxes in the Label column) in the Project panel and Timeline panel to organize and
manage footage items and layers. By default, different label colors indicate different kinds of footage items, but you
can assign label colors to indicate whatever categories you choose. Layer handles and motion paths in the Compo-
sition and Layer panels display the label color of the layer.
•To select all layers with the same label color, select a layer with that label color and choose Edit > Label > Select
Label Group.
•To change the color of a label for one layer, click the label in the Timeline panel and choose a color.
AFTER EFFECTS CS3
User Guide
150
•To change the color of a label for all layers with that label color, select one of the layers belonging to the label group,
choose Edit > Label > Select Label Group, and choose Edit > Label > [color name].
•To change the default colors for labels, choose Edit > Preferences > Label Colors (Windows) or After Effects >
Preferences > Label Colors (Mac OS).
•To change the default associations of label colors with source types, choose Edit > Preferences > Label Defaults
(Windows) or After Effects > Preferences > Label Defaults (Mac OS).
See also
“Select a color or edit a gradient” on page 236
Show and hide layers in the Timeline panel
You can mark a layer as shy andthenusetheHideShyLayers compositionswitchatthetopoftheTimelinepanel
to hide all shy layers in the Timeline panel layer outline. Making layers shy is useful for making room in the Timeline
panel to show the layers and layer properties that you want to adjust.
The icon in the Switches column indicates whether a layer is shy or not shy .
Shy layers are still rendered, both for previews and for final output. To exclude layers from previews or final output,
use the Video switch or make the layer a guide layer.
•To toggle a layer between shy and not shy, click the Shy switch for the layer, or select the layer in the Timeline panel
and choose Layer > Switches > Shy.
•To toggle between hiding and showing all shy layers, click to select or deselect the Hide Shy Layers composition
switch at the top of the Timeline panel, or choose Hide Shy Layers from the Timeline panel menu.
See also
“Layer switches and columns in the Timeline panel” on page 147
Layer image quality
A layer’s quality setting determines how precisely it is rendered, as well as influencing the precision of other calcula-
tions involving the layer, such as motion tracking and the use of the layer as a control layer for a compound effect.
The default quality of new layers is determined by the Create New Layers At Best Quality preference in the General
preferences category.
Duplicated or split layers retain the Quality setting of the original layer.
To toggle between Best and Draft quality of selected layers, click the Quality switch in the Timeline panel. To choose
from all three options, choose Layer > Quality:
Best Displays and renders a layer using subpixel positioning, anti-aliasing, 3D shading, and complete calculation of
any applied effects. Best requires the most time for rendering—both for previews and for final output.
Draft Displays a layer so that you can see it, but only at rough quality. Draft quality displays and renders a layer
without anti-aliasing and subpixel positioning, and some effects are not precisely calculated. Draft quality is often
themostusefulsettingforgeneralworkandforvideolayers(toavoidblurringwhenmatchingcompositionstoraw
video footage).
Wireframe Displays a layer as a box, without layer contents. Layer wireframes are displayed and rendered faster than
layers rendered with Best or Draft settings.
AFTER EFFECTS CS3
User Guide
151
See also
“Layer switches and columns in the Timeline panel” on page 147
“Preview modes” on page 124
Continuously rasterize a layer containing vector graphics
When you import vector graphics, After Effects automatically rasterizes them. However, if you want to scale a layer
that contains vector graphics above 100%, then you need to continuously rasterize the layer to maintain image
quality. You can continuously rasterize vector graphics in layers based on Illustrator, Flash SWF, EPS, and PDF files.
Continuously rasterizing causes After Effects to rasterize the file as needed based on the transformation for each
frame. A continuously rasterized layer generally produces higher-quality results, but it may render more slowly.
Shape layers and text layers are always continuously rasterized.
When you apply an effect to a continuously rasterized layer, the results may be different than when you apply the
effect to a layer without continuous rasterization. This is because the default rendering order for the layer changes.
The default rendering order for a layer without continuous rasterization is masks, followed by effects, and then trans-
formations; whereas the default rendering order for a continuously rasterized layer is masks, followed by transfor-
mations, and then effects.
Whether or not you continuously rasterize, if you view and render a composition using Best Quality, After Effects
anti-aliases (smooths) the vector graphics.
You cannot open or interact with a continuously rasterized layer in a Layer panel. This means that you can’t paint
directly on a continuously rasterized layer. However, you can apply the Paint effect, and you can copy and paste paint
strokes from other layers.
Image from imported Illustrator file
A. Original B. Enlarged with Continuously Rasterize switch turned off C. Enlarged with Continuously Rasterize switch turned on
❖In the Timeline panel, click the layer’s Continuously Rasterize switch , which is the same as the Collapse Trans-
formations switch for nested composition layers.
See also
“Layer switches and columns in the Timeline panel” on page 147
“Render order and collapsing transformations” on page 115
A
BC
AFTER EFFECTS CS3
User Guide
152
Modify layer properties
Work with layer properties in the Timeline panel
Each layer has properties, many of which you can modify and animate. The basic group of properties that every layer
has is the Transform group, which includes Position and Opacity properties. When you add certain features to a
layer—for example, by adding masks or effects, or by converting the layer to a 3D layer—the layer gains additional
properties, collected in property groups.
All layer properties are temporal—they can change the layer over time. Some layer properties, such as Position, are
also spatial—they can move the layer across composition space.
You can expand the layer outline to display layer properties and change property values.
Collapsed property group (left) compared to expanded property group (right) in layer outline
Properties in the Effects property group (effect properties) are also layer properties. Many effect properties can also
be modified in the Effect Controls panel.
See also
“Work with effects in the Effect Controls panel” on page 350
“Shortcuts for showing properties in the Timeline panel” on page 647
“Shortcuts for working with layers” on page 645
“Shortcuts for showing properties in the Timeline panel” on page 647
“Shortcuts for modifying properties” on page 648
Show or hide properties in the Timeline panel
•To expand or collapse a property group, click the triangle to the left of the layer name or property group name.
•To expand or collapse a property group and all of its children, Ctrl-click (Windows) or Command-click (Mac OS)
the triangle.
•To expand or collapse all groups for selected layers, press Ctrl+~ (tilde) (Windows) or Command+~ (tilde)
(Mac OS).
•To reveal an effect property in the Timeline panel, double-click the property name in the Effect Controls panel.
•To hide a property or property group, Alt+Shift-click (Windows) or Option+Shift-click (Mac OS) the name in the
Timeline panel.
•To show only the selected properties or property groups in the Timeline panel, press SS.
Note: This is especially useful for working with paint strokes. Select the paint stroke in the Layer panel, and press SS to
open the property group for that stroke in the Timeline panel.
AFTER EFFECTS CS3
User Guide
153
•To show only a specific property or property group, press its shortcut key or keys.
•To add a property or property group to the properties shown in the Timeline panel, hold Shift while pressing the
shortcut key for the property or property group.
•To show only properties that have been modified from their default values, press UU, or choose Animation >
Reveal Modified Properties.
•To show only properties that have keyframes or expressions, press U, or choose Animation > Reveal Animating
Properties.
Note: The U and UU commands are especially useful for learning how animation presets, template projects, or other
animated items work, because they isolate the properties that were modified by the designer of those items.
Select a property or property group in the Timeline panel
•To select a property or property group—including all values, keyframes, and expressions—click the name in the
layer outline in the Timeline panel.
Copy or duplicate a property or property group in the Timeline panel
•To copy properties from one layer or property group to another, select the layer, property, or property group, press
Ctrl+C (Windows) or Command+C (Mac OS), select the target layer, property, or property group, and press
Ctrl+V (Windows) or Command+V (Mac OS).
•To duplicate a property group, select the property group and press Ctrl+D (Windows) or Command+D (Mac OS).
You can only duplicate some property groups, including shapes, masks, and effects. However, you can’t duplicate top-
level property groups such as Contents, Masks, Effects, and Transforms. If you attempt to duplicate a top-level
property group, the entire layer is duplicated, instead.
Set a property value
If multiple layers are selected and you change a property for one layer, then the property is changed for all selected
layers. Sliders, angle controls, and some other property controls are only available in the Effect Controls panel.
To change the units for a property, right-click (Windows) or Control-click (Mac OS) the underlined value, choose
Edit Value, and choose from the Units menu. The available units are different for different property types. You can’t
change the units for some properties.
•Place the pointer over the underlined value, and drag to the left or right.
•Click the underlined value, enter a new value, and then press Enter (Windows) or Return (Mac OS).
Note: You can enter simple arithmetic expressions for property values and other number entries. For example, you can
enter 2*3 instead of 6,4/2 instead of 2, and 2e2 instead of 200.
•Right-click (Windows) or Control-click (Mac OS) the underlined value and choose Edit Value.
•Drag the slider left or right.
•Click a point inside the angle control or drag the angle control line.
Note: After you click inside the angle control, you can drag outside it for more precision.
•To increase or decrease the property value by 1 unit, click the underlined value and press the Up Arrow or Down
Arrow key. To increase or decrease by 10 units, hold Shift while pressing the Up Arrow or Down Arrow key. To
increase or decrease by 0.1 units, hold Ctrl (Windows) or Command (Mac OS) while pressing the Up Arrow or
Down Arrow key.
AFTER EFFECTS CS3
User Guide
154
•To reset properties in a property group to their default values, click Reset next to the property group name. To
reset an individual property, right-click (Windows) or Control-click (Mac OS) the property name (not the value)
and choose Reset from the context menu.
If the property contains keyframes, a keyframe is added at the current time with the default value.
Alan Shisko provides a video tutorial that shows how to use label colors and multiple selections to rapidly change
properties for multiple layers simultaneoulsy: www.adobe.com/go/learn_ae_alanmultilayer.
See also
“Work with effects in the Effect Controls panel” on page 350
“Shortcuts for showing properties in the Timeline panel” on page 647
“Shortcuts for modifying properties” on page 648
Work with layer anchor points
Transformations, such as rotation and scale, occur around a layer’s anchor point (sometimes called transformation
point or transformation center). By default, the anchor point for most layer types is at the center of a layer.
The easiest way to pan and scan over a large image is to animate Anchor Point and Scale properties.
Anchor point in center of text layer (left) compared to anchor point moved to the end of the text layer (right)
When you use the Pan Behind tool to move the anchor point in the Composition panel (left), After Effects automatically compensates for the
move so that the layer maintains its position relative to the composition frame (right).
Note: If you don’t see the anchor point in the Layer panel, select Anchor Point Path from the View menu at the bottom
right of the Layer panel.
See also
“Work with the Layer panel” on page 134
“Selecting and arranging layers” on page 137
“Shortcuts for modifying properties” on page 648
AFTER EFFECTS CS3
User Guide
155
Move a layer anchor point
•Drag the anchor point using the Selection tool in the Layer panel.
Note: Layers of some types, such as text layers and shape layers, can’t be opened in the Layer panel.
•To move a layer anchor point 1 pixel, choose Anchor Point Path from the View menu at the bottom right of the
Layer panel, and press an arrow key. To move 10 pixels, hold Shift as you press an arrow key. Pixel measurements
are at the current magnification in the Layer panel.
•TomovealayeranchorpointintheCompositionpanelwithoutmovingthelayer,selectthelayerandusethePan
Behind tool to drag the anchor point.
Note: Moving an anchor point with the Pan Behind tool changes Position and Anchor Point values so that the layer
remains where it was in the composition before you moved the anchor point. To change only the Anchor Point value, Alt-
drag (Windows) or Option-drag (Mac OS) with the Pan Behind tool.
Reset a layer anchor point
•To reset the anchor point to its default location in the layer, double-click the Pan Behind tool button in the
Tools panel.
•To reset the anchor point to its default location in the layer, Alt-double-click (Windows) or Option-double-click
(Mac OS) the Pan Behind tool button. The layer moves to the center of the composition
Scale a layer
As with other transformations, scaling occurs around the layer’s anchor point. You can scale a layer beyond the
composition frame.
For information on scaling exponentially, as with a zoom lens, see “Use Exponential Scale” on page 218.
•To scale a layer proportionally in the Composition panel, Shift-drag any layer handle.
•To scale a layer freely in the Composition panel, drag a corner layer handle.
•To scale one dimension only in the Composition panel, drag a side layer handle.
•To increase or decrease Scale for a selected layer by 1%, hold down Alt (Windows) or Option (Mac OS) as you
press + or – on the numeric keypad.
•To increase or decrease Scale for selected layers by 10%, hold down Alt+Shift (Windows) or Option+Shift
(Mac OS) as you press + or – on the numeric keypad.
•To scale to a specific set of pixel dimensions, right-click (Windows) or Control-click (Mac OS) the Scale value in
the Timeline panel, choose Edit Value, and change the units to pixels in the Scale dialog box.
•To scale an entire composition, choose File > Scripts > DemoPalette.jsx to run the DemoPalette script, and then
click the Scale Comp button.
•To scale and center selected layers to fit in the composition frame, choose Layer > Transform > Fit To Comp.
•Toscaleandcenterselectedlayerstofitthewidthorheightofthecompositionframe,whilepreservingthelayer’s
aspect ratio, choose Layer > Transform > Fit To Comp Width, or Layer > Transform > Fit To Comp Height.
•To scale a layer proportionally in the Timeline panel, select the layer, press S to display the Scale property, click the
Constrain Proportions icon to the left of the Scale values, and enter a new value for the x, y, or z scale.
To activate the Constrain Proportions icon and match the height to the width, Alt-click (Windows) or Option-click
(Mac OS) it.
AFTER EFFECTS CS3
User Guide
156
Scaling a raster (non-vector) layer down sometimes causes a slight softening or blurring of the image. Scaling a raster
layer up by a large factor can cause the image to appear blocky or pixelated. Plug-ins that provide high-quality
upscaling include Digital Anarchy ReSizer (www.adobe.com/go/learn_ae_digitalanarchyresizer) and Red Giant
Instant HD (www.adobe.com/go/learn_ae_redgiantinstanthd).
For a script that scales multiple compositions simultaneously, see the AE Enhancers forum:
www.adobe.com/go/learn_ae_scriptscalemultiplecompositions.
See also
“Show or hide layer controls in the Composition panel” on page 127
“Selecting and arranging layers” on page 137
“Work with layer anchor points” on page 154
“Shortcuts for modifying properties” on page 648
Flip a layer
A layer flips around its anchor point. If you move the anchor point away from the center of the layer, the layer may
move when you flip it.
1Select one or more layers.
2Press S to reveal the Scale property.
3Right-click (Windows) or Control-click (Mac OS) the underlined Scale value and choose Edit Value from the
pop-up menu that appears.
4In the Scale dialog box, choose None from the Preserve pop-up menu.
5Do one of the following:
•To flip horizontally, enter a negative Width value.
•To flip vertically, enter a negative Height value.
Layer flipped with varying Height and Width values
A. Width 100, Height 100 B. Width -100, Height 100 C. Width 100, Height -100 D. Width -100, Height -100
To flip a layer by dragging in the Composition panel, drag a layer handle across the layer’s anchor point. (See “Show
or hide layer controls in the Composition panel” on page 127.)
A B
C D
AFTER EFFECTS CS3
User Guide
157
See also
“Work with layer anchor points” on page 154
“Selecting and arranging layers” on page 137
“Shortcuts for modifying properties” on page 648
Rotate a 2D layer
As with other transformations, rotation occurs around the layer’s anchor point.
To reveal the Rotation property value for selected layers in the Timeline panel, press R. The first part of the property
value is the number of whole rotations; the second part is the fractional rotation in degrees.
For information on rotating 3D layers, see “Rotate or orient a 3D layer” on page 173.
•To rotate a layer by dragging in the Composition panel, drag the layer using the Rotation tool . To constrain
rotation to 45˚ increments, hold down Shift as you drag.
•To rotate selected layers by 1 degree, press plus (+) or minus (-) on the numeric keypad.
•To rotate selected layers by 10 degrees, press Shift+plus (+) or Shift+minus (-) on the numeric keypad.
See also
“Work with layer anchor points” on page 154
“Selecting and arranging layers” on page 137
“Shortcuts for modifying properties” on page 648
Adjust audio volume levels
When you use footage containing audio, the default audio level for playback is 0 dB, meaning that the level is
unadjusted in After Effects. Setting a positive decibel level increases volume, and setting a negative decibel level
decreases volume.
Note: Double-clicking an Audio Levels keyframe activates the Audio panel.
The VU meter in the Audio panel displays the volume range for the audio as it plays. The red blocks at the top of the
meter represent your system’s volume limit.
For more precision in setting audio levels by dragging sliders, increase the height of the Audio panel.
❖In the Audio panel, to adjust volume, do one of the following:
•To set the level of the left and right channels together, drag the center slider up or down.
•To set the level of the left channel, drag the left slider up or down, or type a new value in the levels box at the
bottom of the left slider.
•To set the level of the right channel, drag the right slider up or down, or type a new value in the levels box at the
bottom of the right slider.
See also
“Preview video and audio” on page 120
AFTER EFFECTS CS3
User Guide
158
Work with parent and child layers
To synchronize changes to layers by assigning one layer’s transformations to another layer, use parenting.Afteralayer
is made a parent to another layer, the other layer is called the child layer.Whenyouassignaparent,thechildlayer’s
transform properties become relative to the parent layer instead of to the composition. For example, if a parent layer
moves 5 pixels to the right of its starting position, then the child layer also moves 5 pixels to the right of its position.
Parenting is similar to grouping; transformations made to the group are relative to the parent’s anchor point.
Parenting affects all transform properties except Opacity: Position, Scale, Rotation, and (for 3D layers) Orientation.
A layer can have only one parent, but a layer can be a parent to any number of layers in the same composition.
You can animate child layers independent of their parent layers. You can also parent using null objects, which are
hidden layers.
Youcannotanimatetheactofassigningandremovingtheparentdesignation—thatis,youcannotdesignatealayer
as a parent at one point in time and designate it as a normal layer at a different point in time.
When you create a parenting relationship, you can choose whether to have the child take on the parent’s transform
property values or retain its own. If you choose to have the child take on the parent’s transform property values, the
child layer jumps to the parent’s position. If you choose to have the child retain its own transform property values,
then the child stays where it is. In both cases, subsequent changes to the parent’s transform property values are
applied to the child. Similarly, you can choose whether the child jumps when the parenting relationship is removed.
Dragging the pick whip in the Timeline panel to designate the planet layer as the parent to the saucer layer
Note: To show or hide the Parent column in the Timeline panel, choose Columns > Parent from the Timeline panel menu.
Angie Taylor provides a character animation tutorial that shows how to use parenting and expressions:
www.adobe.com/go/learn_ae_angietutorials.
Guy Chen provides a simple project that demonstrates the animation of several 3D layers arranged as a cube,
controlled by a parent null layer: www.adobe.com/go/learn_ae_guy3dcube.
•To parent a layer, in the Parent column, drag the pick whip from the layer that is to be the child layer to the layer
that is to be the parent layer.
•To parent a layer, in the Parent column, click the menu of the layer that you want to be the child, and choose a
parent layer name from the menu.
•Toremoveaparentfromalayer,intheParentcolumn,clickthemenuofthelayertoremovetheparentfrom,and
choose None.
•To extend the selection to include all child layers of a selected parent layer, right-click (Windows) or Control-click
(Mac OS) the layer in the Composition or Timeline panel, and choose Select Children.
•To make a child layer jump when a parent is assigned or removed, hold down Alt (Windows) or Option (Mac OS)
as you assign or remove the parent.
•To remove a parent from a layer (i.e., set Parent to None), Ctrl-click (Windows) or Command-click (Mac OS) the
child layer's parenting pickwhip in the Timeline panel. Alt+Ctrl-click (Windows) or Option+Command-click
(Mac OS) the child layer's parenting pickwhip to remove the parent and cause the child layer to jump.
AFTER EFFECTS CS3
User Guide
159
Paul Tuersley provides a script for duplicating a parent layer and all of its children, preserving the parenting
hierarchy: www.adobe.com/go/learn_ae_paulduplicateparenting.
See also
“Work with columns” on page 18
Create a null object
To assign a parent layer, but keep that layer from being a visible element in your project, use a null object.Anullobject
is an invisible layer that has all the properties of a visible layer so that it can be a parent to any layer in the compo-
sition. Adjust and animate a null object as you would any other layer. You use the same commands to modify settings
for a null object that you use for a solid-color layer (Layer > Solid Settings).
You can apply Expression Controls effects to null objects and then use the null object as a control layer for effects and
animations in other layers. For example, when working with a camera or light layer, create a null object and use an
expression to link the camera or light's Point Of Interest property to the null layer's Position property. Then, you can
animate the Point Of Interest property by moving the null object. It is often easier to select and see a null object than it
is to select and see the point of interest.
A composition can contain any number of null objects. A null object is visible only in the Composition and Layer
panels and appears in the Composition panel as a rectangular outline with layer handles. Effects are not visible on
null objects.
❖Select the Timeline or Composition panel and choose Layer > New > Null Object.
Note: The anchor point of a new null object layer appears in the upper-left corner of the layer, and the layer is anchored
in the center of the composition at its anchor point. Change the anchor point as you would for any other layer.
If a null object is visually distracting in your composition frame, consider dragging it out of the frame, onto the paste-
board.
Guy Chen provides a simple project that demonstrates the animation of several 3D layers arranged as a cube,
controlled by a parent null layer: www.adobe.com/go/learn_ae_guy3dcube.
See also
“Using Expression Controls effects” on page 555
“Work with layer anchor points” on page 154
Work with guide layers
You can create guide layers from existing layers to use for reference in the Composition panel, to help you position
and edit elements. For example, you can use guide layers for visual reference, for audio timing, for timecode
reference, or for storing comments to yourself.
A guide layer icon appears next to a guide layer’s source or layer name in the Timeline panel.
By default, guide layers aren’t rendered when you create output but can be rendered when desired by changing the
composition’s render settings.
Note: Guide layers in nested compositions can’t be viewed in the parent composition.
•To convert selected layers to guide layers, choose Layer > Guide Layer.
AFTER EFFECTS CS3
User Guide
160
•To render a composition with its visible guide layers, click Render Settings in the Render Queue panel, and choose
Current Settings from the Guide Layers menu in the Render Settings dialog box.
•To render a composition without rendering guide layers, click Render Settings in the Render Queue panel, and
choose All Off from the Guide Layers menu in the Render Settings dialog box.
See also
“Work with render settings” on page 597
Use Brainstorm to experiment and explore settings
Brainstorm creates multiple temporary variants of your composition and displays them in a grid. You can save any
number of these variants, apply one to the current composition, or redo the Brainstorm operation using only the
variants that you choose as input.
Brainstorm uses genetic algorithms to mutate and select property values used as input into each Brainstorm
operation. You decide which variants to include as input to each generation and how much mutation (randomness)
to use.
AFTER EFFECTS CS3
User Guide
161
Brainstorm dialog box in Randomness mode
A. Original composition (original in center tile when using Brainstorm on single numerical value) B. Maximize Tile C. Save As New Compo-
sition D. Apply To Composition E. Use In Next Brainstorm F. Randomness control (Spread control when using Brainstorm on single
numerical value) G. Back and Forward to previous and next generations H. Playback controls
With Brainstorm, you can rapidly accomplish the following:
•Compare the results of multiple values for a single property so that you can find the value that works best.
•Explore the results of randomly modifying any number of properties to achieve a creative result.
Open a template project or apply an animation preset to a layer, select some properties (or entire property groups),
and then use Brainstorm to quickly modify these properties. Starting from such complete material, you can use
Brainstorm to very quickly create your own projects and animations.
You can use Brainstorm on any number of properties and property groups, from one or more layers in the same
composition. For example, you can use Brainstorm to refine the single Stroke Width property for a star on a shape
layer; or you can select the entire Contents property group and use Brainstorm to explore the entire space of
properties for all shapes on the layer.
A B C DE
GHF
AFTER EFFECTS CS3
User Guide
162
You can use Brainstorm on any property that has numeric values or options in a pop-up menu in the Timeline panel.
Examples of properties on which you can’t use Brainstorm are Source Text, Mask Path, and the Histogram property
for the Levels effect; however, you can use Brainstorm on the properties of the Levels (Individual Controls) effect.
Brainstorm operates on all selected keyframes. For a property with no keyframes, Brainstorm operates on the global,
constant value.
If you use Brainstorm on a single one-dimensional property (such as Opacity, but not Position), the Randomness
value that controls the amount of variation (mutation) is replaced by a Spread value. The variants that are presented
in the Brainstorm dialog box are then not random, but represent a range of values around the central value. The
original composition appears in the center tile of the dialog box, and you can only select one variant on which to base
the next Brainstorm operation.
Though you can’t directly use Brainstorm on expressions, you can use Brainstorm on the properties of Expression
Control effects, to which expressions can refer.
1Set a work area and region of interest for the duration and spatial area of the composition that you want to preview
during the Brainstorm session. (See “Set the work area” on page 112 and “Work with the region of interest” on
page 111.)
2Select one more properties or property groups in the Timeline panel, and click the Brainstorm button at the
top of the Timeline panel.
The variant compositions all play in the Brainstorm dialog box simultaneously. Controls for each variant are only
visible when the pointer is over it. Use the playback controls at the bottom of the Brainstorm dialog box to play,
pause, or rewind the previews.
3In the Brainstorm dialog box, do any of the following:
•To get a better look at a variant, click its Maximize Tile button. Click the Restore Tile Size button to return
to the grid view of all variants.
•To show or hide the transparency grid, click the Toggle Transparency Grid button at the bottom of the Brain-
storm dialog box.
•To mark a variant for inclusion in the next Brainstorm operation, click that variant’s Include In Next Brainstorm
button.
•To save a variant as a new composition in the current project, click that variant’s Save As New Composition
button.
•To increase the randomness or spread for the next generation, adjust the Randomness or Spread value at the
bottom of the Brainstorm dialog box. Make this number small for precision work; make it larger for experimen-
tation and exploration.
4(Optional) To create another generation of variants from those marked for inclusion in the next Brainstorm
operation, click Brainstorm at the bottom of the Brainstorm dialog box and return to step 2. If you click Brainstorm
without marking any variants for inclusion, the Brainstorm operation is repeated using the same input as the current
generation.
If the Brainstorm operation uses Randomness, the variants marked for input into the next generation are included
unchanged into the next generation, and remain in their positions in the dialog box. If the Brainstorm operation uses
Spread, only one variant is carried into the next generation, and it appears in the center tile.
Repeat this cycle until you have found the variant that you want to save as the current composition.
AFTER EFFECTS CS3
User Guide
163
You can move back or forward a generation by clicking the arrow buttons on either side of the Brainstorm button at
the bottom of the Brainstorm dialog box. If you move back a generation and then perform another Brainstorm
operation, the later generations are lost.
Note: Press Esc to close the Brainstorm dialog box.
See also
“Work with layer properties in the Timeline panel” on page 152
Blending modes
Change a layer’s blending mode
Blending modes for layers control how each layer blends with or interacts with layers beneath it. Blending modes for
layers in After Effects (formerly referred to as layer modes and sometimes called transfer modes) are identical to
blending modes in Adobe Photoshop.
Most blending modes modify only color values of the source layer, not the alpha channel. The Alpha Add blending
mode affects the alpha channel of the source layer, and the silhouette and stencil blending modes affect the alpha
channels of layers beneath them.
You can’t directly animate blending modes by using keyframes. To change a blending mode at a certain time, split
the layer at that time and apply the new blending mode to the part of the layer that continues. You can also use the
Compound Arithmetic effect, the results of which are similar to those for blending modes but can change over time.
Each layer has a blending mode, even if that blending mode is the default Normal blending mode.
Note: To blend colors with a gamma value of 1, choose File > Project Settings and select Blend Colors Using 1.0 Gamma.
Deselect this option to blend colors in the project’s color space. (See “Linearize working space and enable linear blending”
on page 244.)
Blending modes for multiple masks on a single layer are called mask modes.
Some effects include their own blending mode options. For details, see the descriptions of the individual effects.
•To cycle through blending modes for selected layers, hold down the Shift key and press - (hyphen) or = (equals
sign) on the main keyboard.
Note: This is a great way to experiment with the appearance of various blending modes.
•To apply a blending mode to selected layers, choose a blending mode from the menu in the Mode column in the
Timeline panel or from the Layer > Blending Mode menu.
•To show the Modes column in the Timeline panel, choose Columns > Modes from the panel menu, or click the
Expand Or Collapse The Transfer Controls button at the bottom left of the Timeline panel.
See also
“Mask modes” on page 260
“Split a layer” on page 146
AFTER EFFECTS CS3
User Guide
164
Blending mode reference
All blending modes described in this section are available for blending between layers. Some of these options are
available for paint strokes, layer styles, and effects.
For in-depth information about the concepts and algorithms behind these blending modes, see the PDF reference
material on the Adobe website at www.adobe.com/go/learn_general_blendingmodes.
Blending mode gallery
underlying layer
source layer
Normal Dissolve Dancing Dissolve
Darken Multiply Color Burn
Classic Color Burn Linear Burn Darker Color
Add Lighten Screen
Color Dodge Classic Color Dodge Linear Dodge
AFTER EFFECTS CS3
User Guide
165
Blending mode descriptions
In the following descriptions, these terms are used:
•The source color is the color of the layer or paint stroke to which the blending mode is applied.
Lighter Color Overlay Soft Light
Hard Light Linear Light Vivid Light
Pin Light Hard Mix Difference
Classic Difference Exclusion Hue
Saturation Color Luminosity
Stencil Alpha Stencil Luma Silhouette Alpha
Silhouette Luma Alpha Add Luminescent Premul
AFTER EFFECTS CS3
User Guide
166
•The underlying color is the color of the composited layers below the source layer or paint stroke in the layer
stacking order in the Timeline panel.
•The result color is the output of the blending operation; the color of the composite.
The stencil and silhouette blending modes use either a layer’s alpha channel or its luma values to affect the alpha
channel of all layers beneath the layer. This differs from a track matte, which affects only one layer. Stencil modes cut
through all layers, so that you can, for example, show multiple layers through the stencil layer’s alpha channel.
Silhouette modes block out all layers below, so you can cut a hole through several layers at once. To keep the
silhouette and stencil blending modes from cutting through or blocking all layers underneath, precompose the layers
that you want to affect and nest them in your composition.
Stencil (left) shows all layers below through the frame of the stencil layer’s alpha channel; silhouette (right) cuts a hole through all layers below.
Normal The result color is the source color. This mode ignores the underlying color. This is the default mode.
Dissolve The result color for each pixel is either the source color or the underlying color. The probability that the
result color is the source color depends on the opacity of the source. If opacity of the source is 100%, then the result
color is the source color. If opacity of the source is 0%, then the result color is the underlying color. Dissolve and
Dancing Dissolve do not work on 3D layers.
Dancing Dissolve Same as Dissolve, except that the probability function is recalculated for each frame, so the result
varies over time.
Darken Each result color channel value is the lower (darker) of the source color channel value and the corresponding
underlying color channel value.
Multiply For each color channel, multiplies source color channel value with underlying color channel value and
divides by maximum value for 8-bpc, 16-bpc, or 32-bpc pixels, depending on the color depth of the project. The
result color is never brighter than the original. If either input color is black, the result color is black. If either input
color is white, the result color is the other input color. This blending mode simulates drawing with multiple marking
pens on paper or placing multiple gels in front of a light. When blending with a color other than black or white, each
layer or paint stroke with this blending mode results in a darker color.
Color Burn Theresultcolorisadarkeningofthesourcecolortoreflecttheunderlyinglayercolorbyincreasingthe
contrast. Pure white in the original layer does not change the underlying color.
Classic Color Burn The Color Burn mode from After Effects 5.0 and earlier, renamed Classic Color Burn. Use it to
preserve compatibility with older projects; otherwise, use Color Burn.
Linear Burn Theresultcolorisadarkeningofthesourcecolortoreflecttheunderlyingcolor.Purewhiteproduces
no change.
Darker Color Each result pixel is the color of darker of the source color value and the corresponding underlying color
value. This is similar to Darken, but Darker Color does not operate on individual color channels.
Add Each result color channel value is the sum of the corresponding color channel values of the source color and
underlying color. The result color is never darker than either input color.
AFTER EFFECTS CS3
User Guide
167
Lighten Each result color channel value is the higher (lighter) of the source color channel value and the corre-
sponding underlying color channel value.
Screen Multiplies the complements of the channel values, and then takes the complement of the result. The result
color is never darker than either input color. Using the Screen mode is similar to superimposing two different film
negatives and printing the result.
Color Dodge The result color is a lightening of the source color to reflect the underlying layer color by decreasing
the contrast. If the source color is pure black, the result color is the underlying color.
Classic Color Dodge The Color Dodge mode from After Effects 5.0 and earlier, renamed Classic Color Dodge. Use
it to preserve compatibility with older projects; otherwise, use Color Dodge.
Linear Dodge The result color is a lightening of the source color to reflect the underlying color by increasing the
brightness. If the source color is pure black, the result color is the underlying color.
Lighter Color Each result pixel is the color of lighter of the source color value and the corresponding underlying
color value. This is similar to Lighten, but Lighter Color does not operate on individual color channels.
Overlay Multiplies or screens the input color channel values, depending on the underlying color. The result
preserves highlights and shadows in the underlying layer.
Soft Light Darkens or lightens the color channel values of the underlying layer, depending on the source color. The
result is similar to shining a diffused spotlight on the underlying layer. For each color channel value, if the source
color is lighter than 50% gray, the result color is lighter than the underlying color, as if dodged. If the source color is
darker than 50% gray, the result color is darker than the underlying color, as if burned. A layer with pure black or
white becomes markedly darker or lighter, but does not become pure black or white.
Hard Light Multiplies or screens the input color channel value, depending on the original source color. The result is
similar to shining a harsh spotlight on the layer. For each color channel value, if the underlying color is lighter than
50% gray, the layer lightens as if it were screened. If the underlying color is darker than 50% gray, the layer darkens
as if it were multiplied. This mode is useful for creating the appearance of shadows on a layer.
Linear Light Burns or dodges the colors by decreasing or increasing the brightness, depending on the underlying
color. If the underlying color is lighter than 50% gray, the layer is lightened because the brightness is increased. If the
underlying color is darker than 50% gray, the layer is darkened because the brightness is decreased.
Vivid Light Burns or dodges the colors by increasing or decreasing the contrast, depending on the underlying color.
If the underlying color is lighter than 50% gray, the layer is lightened because the contrast is decreased. If the under-
lying color is darker than 50% gray, the layer is darkened because the contrast is increased.
Pin Light Replaces the colors, depending on the underlying color. If the underlying color is lighter than 50% gray,
pixels darker than the underlying color are replaced, and pixels lighter than the underlying color do not change. If
the underlying color is darker than 50% gray, pixels lighter than the underlying color are replaced, and pixels darker
than the underlying color do not change.
Hard Mix Enhances the contrast of the underlying layer that is visible beneath a mask on the source layer. The mask
size determines the contrasted area; the inverted source layer determines the center of the contrasted area.
Difference For each color channel, subtracts the darker of the input values from the lighter. Painting with white
inverts the backdrop color; painting with black produces no change.
Classic Difference The Difference mode from After Effects 5.0 and earlier, renamed Classic Difference. Use it to
preserve compatibility with older projects; otherwise, use Difference.
AFTER EFFECTS CS3
User Guide
168
Exclusion CreatesaresultsimilartobutlowerincontrastthantheDifferencemode.Ifthesourcecoloriswhite,the
result color is the complement of the underlying color. If the source color is black, the result color is the underlying
color.
Hue Result color has luminance and saturation of the underlying color, and the hue of the source color.
Saturation Result color has luminance and hue of the underlying color, and the saturation of the source color.
Color Resultcolorhasluminanceoftheunderlyingcolor,andhueandsaturationofthesourcecolor.Thispreserves
the gray levels in the underlying color. This is useful for coloring grayscale image and for tinting color images.
Luminosity Result color has hue and saturation of the underlying color, and luminance of the source color. This
mode is the opposite of the Color mode.
Stencil Alpha Creates a stencil using the layer’s alpha channel.
Stencil Luma Createsastencilusingthelayer’slumavalues.Thelighterpixelsofthelayeraremoreopaquethanthe
darker pixels.
Silhouette Alpha Creates a silhouette using the layer’s alpha channel.
Silhouette Luma Creates a silhouette using the layer’s luma values. Creates transparency in painted areas of the layer,
allowing you to see underlying layers or background. The luminance value of the blend color determines opacity in
theresultcolor.Thelighterpixelsofthesourcecausemoretransparencythanthedarkerpixels.Paintingwithpure
white creates 0% opacity. Painting with pure black produces no change.
Alpha Add Composites layers normally, but adds complementary alpha channels to create a seamless area of trans-
parency. Useful for removing visible edges from two alpha channels that are inverted relative to each other or from
the alpha channel edges of two touching layers that are being animated.
Luminescent Premul Prevents clipping of color values that exceed the alpha channel value after compositing by
adding them to the composition. Useful for compositing rendered lens or light effects (such as lens flare) from
footage with premultiplied alpha channels. May also improve results when compositing footage from other manufac-
turers’ matting software. When applying this mode, you may get the best results by changing interpretation of the
premultiplied-alpha source footage to straight alpha.
Layer styles
About layer styles
Photoshop provides a variety of layer styles—such as shadows, glows, and bevels—that change the appearance of a
layer.AfterEffectscanpreservetheselayerstyleswhenimportingPhotoshoplayers.Youcanalsoapplylayerstyles
in After Effects and animate their properties.
In addition to the layer styles that add visual elements—like a drop shadow or a color overlay—each layer’s Layer
Styles property group contains a Blending Options property group. You can use the Blending Options settings for
powerful and flexible control over blending operations.
Though layer styles are referred to as effects in Photoshop, they behave more like blending modes in After Effects.
Layer styles follow transformations in the standard render order, whereas effects precede transformations. Another
difference is that each layer style blends directly with the underlying layers in the composition, whereas an effect is
rendered on the layer to which it’s applied, the result of which then interacts with the underlying layers as a whole.
AFTER EFFECTS CS3
User Guide
169
WhenyouimportaPhotoshopfilethatincludeslayersasacomposition,youcanretaineditablelayerstylesormerge
layer styles into footage. When you import only one layer that includes layer styles, you can choose to ignore the layer
styles or merge layer styles into footage. At any time, you can convert merged layer styles into editable layer styles for
each After Effects layer based on a Photoshop footage item.
After Effects can preserve all layer styles in imported Photoshop files, but you can only add and modify some layer
styles and controls within After Effects.
Layer styles that you can apply and edit in After Effects
Drop Shadow Adds a shadow that falls behind the layer.
Inner Shadow Adds a shadow that falls inside the layer’s contents, giving the layer a recessed appearance.
Outer Glow Adds a glow that emanates outward from the layer’s contents.
Inner Glow Adds a glow that emanates inward from the layer’s contents.
Bevel And Emboss Adds various combinations of highlights and shadows.
Satin Applies interior shading that creates a satiny finish.
Color Overlay Fills the layer’s contents with a color.
Gradient Overlay Fills the layer’s contents with a gradient.
Stroke Outlines the layer’s contents.
See also
“Preparing and importing Photoshop files” on page 83
“Render order and collapsing transformations” on page 115
“How render order and collapsed transformations affect 3D layers” on page 175
Work with layer styles
•To convert merged layer styles into editable layer styles, select one or more layers and choose Layer > Layer Styles
> Convert To Editable Styles.
•To add a layer style to selected layers, choose Layer > Layer Styles, and choose a layer style from the menu.
•To remove a layer style, select it in the Timeline panel and press Delete.
•To remove all layer styles from selected layers, choose Layer > Layer Styles > Remove All.
When a layer style is applied to a vector layer—such as a text layer, a shape layer, or a layer based on an Illustrator
footage item—visual elements that apply to the edges of the layer’s contents apply to the outlines of the vector objects,
suchastextcharactersorshapes.Whenalayerstyleisappliedtoalayerbasedonanon-vectorfootageitem,thelayer
style applies to the edges of the layer’s bounds or masks.
Youcanapplyalayerstyletoa3Dlayer,butalayerwithalayerstylecan’tintersectwithother3Dlayersorinteract
with other 3D layers for casting and receiving shadows. 3D layers on either side of a layer with a layer style can’t
intersect one another or cast shadows on one another.
When you use the Layer > Convert To Editable Text command on a text layer from a Photoshop file, any layer styles
on that layer are also converted to editable layer styles.
AFTER EFFECTS CS3
User Guide
170
See also
“Preparing and importing Photoshop files” on page 83
“Render order and collapsing transformations” on page 115
“How render order and collapsed transformations affect 3D layers” on page 175
Layer style settings
Each layer style has its own collection of properties in the Timeline panel.
Align With Layer Uses the bounding box of the layer to calculate the gradient fill.
Altitude For the Bevel And Emboss layer style, the elevation of the light source above the layer, in degrees.
Choke Shrinks the boundaries of the matte of an Inner Shadow or Inner Glow prior to blurring.
Distance The offset distance for a Shadow or Satin layer style
Highlight Mode, Shadow Mode Specifies the blending mode of a bevel or emboss highlight or shadow.
Jitter Varies the application of a gradient’s color and opacity.
Layer Knocks Out Drop Shadow Controls the drop shadow’s visibility in a semitransparent layer.
Reverse Flips the orientation of a gradient.
Scale Resizes the gradient.
Spread Expands the boundaries of the matte prior to blurring.
Use Global Light Set this to On to use the Global Light Angle and Global Light Altitude in the Blending Options
property group instead of the individual layer style’s Angle and Altitude settings. This is useful if you have multiple
layer styles applied to the same layer and want to animate the position of the light for all of them.
Working with blending options for layer styles
Each layer style has its own blending mode, which determines how it interacts with underlying layers. The under-
lying layer in this context may or may not include the layer to which the layer style is applied. For example, a drop
shadow does not blend with the layer to which it’s applied, because the shadow falls behind the layer; whereas an
inner shadow does blend with the layer to which it’s applied.
Layer styles can be categorized as interior layer styles or exterior layer styles. Interior layer styles affect the opaque
pixels of the layer to which they’re applied. These include Inner Glow, Inner Shadow, Color Overlay, Gradient
Overlay, Satin, and Bevel And Emboss. Exterior layer styles do not blend with the pixels of the layer to which they’re
applied, but only interact with the underlying layers. These include Outer Glow and Drop Shadow.
If Blend Interior Styles As Group is set to On, interior layer styles use the blending mode of the layer.
If you modify a layer’s Opacity property, the opacity of the layer’s contents and the opacity of the layer styles are all
affected. If, however, you modify the Fill Opacity property in the Blending Options property group, the opacity of
the layer styles is unaffected. For example, if a text layer has the Drop Shadow layer style applied, decreasing the Fill
Opacity to 0 makes the text disappear, but the drop shadow remains visible.
Use the Blend Ranges From Source option to use the advanced blending options set for the Photoshop file that
determine what blending operations to perform based on the color characteristics of the input layer.
AFTER EFFECTS CS3
User Guide
171
Exclude channels from blending
You can exclude one or more of a layer’s color channels from blending operations.
The Blending Options property group is only included for a layer if the layer has had a layer style added to it. To add
a Blending Options property group without a layer style, add an arbitrary layer style and then immediately delete it;
the Blending Options property group and its containing Layer Styles property group will remain.
1Expand the layer’s Blending Options property group in the Layer Styles property group in the Timeline panel.
2To exclude a channel from blending, set Red, Green, or Blue to Off in the Advanced Blending property group.
Youcananimatetheseproperties,soyoucanexcludeachannelfromblendingatsometimesbutincludethechannel
at other times.
Working with 3D layers
About 3D layers
The basic objects that you manipulate in After Effects are flat, two-dimensional (2D) layers. When you make a layer
a 3D layer, the layer itself remains flat, but it gains additional properties: Position (z), Anchor Point (z), Scale (z),
Orientation, X Rotation, Y Rotation, Z Rotation, and Material Options properties. Material Options properties
specify how the layer interacts with light and shadows. Only 3D layers interact with shadows, lights, and cameras.
2D layers (left) and layers with 3D properties (right)
Any layer can be a 3D layer, except an audio-only layer. Individual characters within text layers can optionally be 3D
sublayers, each with their own 3D properties. A text layer with Enable Per-character 3D selected behaves just like a
precomposition that consists of a 3D layer for each character. All camera and light layers have 3D properties.
By default, layers are at a depth (z-axis position) of 0. In After Effects, the origin of the coordinate system is at the
upper-left corner; x (width) increases from left to right, y (height) increases from top to bottom, and z (depth)
increases from near to far. Some video and 3D applications use a coordinate system that is rotated 180 degrees
around the x axis; in these systems, y increases from bottom to top, and z increases from far to near.
You can transform 3D layers relative to the composition’s coordinate space, the layer’s coordinate space, or a custom
space by selecting an axis mode.
You can add effects and masks to 3D layers, composite 3D layers with 2D layers, and create and animate camera and
light layers to view or illuminate 3D layers from any angle.
All effects are 2D, including effects that simulate 3D distortions. This means that, for example, viewing a layer with
the Bulge effect from the side will not show a protrusion.
As with all masks, mask coordinates on a 3D layer are in the 2D coordinate space of the layer.
AFTER EFFECTS CS3
User Guide
172
Note: After Effects 7.0 and earlier included a Standard 3D rendering plug-in; this plug-in is not included with After
Effects CS3. In After Effects 6.0 and later, the default plug-in for rendering 3D layers has been the Advanced 3D
rendering plug-in. When you open a project that was created with the Standard 3D rendering plug-in, the project is
converted to use the Advanced 3D rendering plug-in. As third-party plug-ins become available, you can choose them
from the Advanced section of the Composition Settings dialog box.
Paul Tuersley provides a pair of scripts for converting a composition based on a layered Photoshop file into a set of
3D layers, www.adobe.com/go/learn_ae_paulphotoshop3dlayers.
You can download an example project from the AE Enhancers forum that shows how to arrange several 3D layers in
the shape of a sphere, control the layers with a null layer, and light them:
www.adobe.com/go/learn_ae_oscarussphere3d.
Several plug-ins add the ability to manipulate, warp, and extrude 3D shapes in After Effects. Rich Young of AE Portal
provides information about Zaxwerks 3D Warps and Zaxwerks Invigorator PRO, two such products:
www.adobe.com/go/learn_ae_richzaxwerks3d.
See also
“Work with per-character 3D text properties” on page 293
“3D files from other applications” on page 77
“Shortcuts for 3D layers” on page 649
“Cameras, lights, and points of interest” on page 176
“Layer 3D attributes and methods” on page 572
Convert 3D layers
When you convert a layer to 3D, a depth (z) value is added to its Position, Anchor Point, and Scale properties, and
the layer gains Orientation, Y Rotation, X Rotation, and Material Options properties. The single Rotation property
is renamed Z Rotation.
When you convert a 3D layer back to 2D, the Y Rotation, X Rotation, Orientation, and Material Options properties
are removed, including all values, keyframes, and expressions. (These values cannot be restored by converting the
layer back to a 3D layer.) The Anchor Point, Position, and Scale properties remain, along with their keyframes and
expressions, but their z values are hidden and ignored.
See also
“Work with per-character 3D text properties” on page 293
“Layer switches and columns in the Timeline panel” on page 147
“Shortcuts for 3D layers” on page 649
Convert a layer to a 3D layer
❖Select the layer’s 3D Layer switch in the Timeline panel, or select the layer and choose Layer > 3D Layer.
Convert a text layer to a 3D layer with per-character 3D properties enabled
❖Choose Animation > Animate Text > Enable Per-Character 3D, or choose Enable Per-Character 3D from the
layer’s Animate menu in the Timeline panel.
AFTER EFFECTS CS3
User Guide
173
Convert a 3D layer to a 2D layer
❖Deselect the layer’s 3D Layer switch in the Timeline panel, or select the layer and choose Layer > 3D Layer.
Show or hide 3D axes and layer controls
3D axes are color-coded arrows: red for x, green for y, and blue for z.
•To show or hide 3D axes, camera and light wireframe icons, layer handles, and the point of interest, choose View >
Show Layer Controls.
If the axis that you want to manipulate is difficult to see, try a different setting in the Select View Layout menu at
the bottom of the Composition panel.
•To show or hide a set of persistent 3D reference axes, click the Grid And Guides Options button at the bottom
of the Composition panel, and choose 3D Reference Axes.
See also
“Show or hide layer controls in the Composition panel” on page 127
Move a 3D layer
1Select the 3D layer that you want to move.
2Do one of the following:
•In the Composition panel, use the Selection tool to drag the arrowhead of the 3D axis layer control corre-
sponding to the axis along which you want to move the layer. Shift-drag to move the layer more quickly.
•In the Timeline panel, modify the Position property values.
Press P to show Position.
See also
“Selecting and arranging layers” on page 137
“Modify layer properties” on page 152
“Shortcuts for 3D layers” on page 649
Rotate or orient a 3D layer
You can turn a 3D layer by changing the layer’s Orientation values or by changing its Rotation values. In both cases,
thelayerturnsarounditsanchorpoint.TheOrientationandRotationpropertiesdifferinhowthelayermoveswhen
you animate them.
When you animate a 3D layer’s Orientation property, the layer turns as directly as possible to reach the specified
orientation. When you animate any of a 3D layer’s X, Y, or Z Rotation properties, the layer rotates along each
individual axis according to the individual property values. In other words, Orientation values specify an angular
destination, whereas Rotation values specify an angular route. Animate Rotation properties to make a layer turn
multiple times.
Animating the Orientation property is often better for natural, smooth motion, whereas animating the Rotation
properties provides more precise control.
AFTER EFFECTS CS3
User Guide
174
Donat Van Bellinghen provides a some expressions for placing and orienting a 3D layer in the plane defined by three
points: www.adobe.com/go/learn_ae_donat3dlayer3points.
See also
“Selecting and arranging layers” on page 137
“Modify layer properties” on page 152
“Shortcuts for 3D layers” on page 649
Rotate or orient a 3D layer in the Composition panel
1Select the 3D layer that you want to turn.
2Select the Rotation tool , and choose Orientation or Rotation from the Set menu to determine whether the tool
affects Orientation or Rotation properties.
3In the Composition panel, do one of the following:
•Drag the arrowhead of the 3D axis layer control corresponding to the axis around which you want to turn the layer.
•Drag a layer handle. Dragging a corner handle turns the layer around the z axis; dragging a left or right center
handle turns the layer around the y axis; dragging a top or bottom handle turns the layer around the x axis.
•Drag the layer.
Shift-drag to constrain your manipulations to 45-degree increments.
Rotate or orient a 3D layer in the Timeline panel
1Select the 3D layer that you want to turn.
2In the Timeline panel, modify the Rotation or Orientation property values.
Press R to show Rotation and Orientation properties.
Axis modes
Axis modes specify on which set of axes a 3D layer is transformed. Choose a mode in the Tools panel.
Local Axis mode Aligns the axes to the surface of a 3D layer.
World Axis mode Aligns the axes to the absolute coordinates of the composition. Regardless of the rotations you
perform on a layer, the axes always represent 3D space relative to the 3D world.
View Axis mode Alignstheaxestotheviewyouhaveselected.Forexample,supposethatalayerhasbeenrotated
and the view changed to a custom view; any subsequent transformation made to that layer while in View Axis mode
happens along the axes corresponding to the direction from which you are looking at the layer.
Note: The camera tools always adjust along the view’s local axes, so the action of the camera tools is not affected by the
axis modes.
See also
“About coordinate systems” on page 139
AFTER EFFECTS CS3
User Guide
175
How render order and collapsed transformations affect 3D layers
The positions of certain kinds of layers in the layer stacking order in the Timeline panel prevent groups of 3D layers
from being processed together to determine intersections and shadows.
A shadow cast by a 3D layer does not affect a 2D layer or any layer that is on the other side of the 2D layer in the layer
stacking order. Similarly, a 3D layer will not intersect with a 2D layer or any layer that is on the other side of the 2D
layer in the layer stacking order. No such restriction exists for lights.
3D layers intersecting (left), and 3D layers prevented from intersecting by intervening 2D layer (right)
Just like 2D layers, other types of layers also prevent 3D layers on either side from intersecting or casting shadows on
one another:
•An adjustment layer
•A 3D layer with a layer style applied
•A3Dprecompositiontowhichaneffect,closedmask(withmaskmodeotherthanNone),ortrackmattehasbeen
applied
•A 3D precomposition layer without collapsed transformations
A precomposition with collapsed transformations (Collapse Transformations switch selected) does not interfere
with the interaction of 3D layers on either side—as long as all of the layers in the precomposition are themselves 3D
layers. Collapsing transformations exposes the 3D properties of the layers that compose the precomposition. Essen-
tially, collapsing transformations in this case allows each 3D layer to be composited into the main composition
individually, rather than creating a single 2D composite for the precomposition layer and compositing that into the
main composition. The tradeoff is that this setting removes your ability to specify certain layer settings for the
precomposition as a whole—such as blending mode, quality, and motion blur.
Shadows cast by continuously rasterized 3D layers (including text layers) are not affected by effects applied to that
layer. If you want the shadow to show the results of the effect, then precompose the layer with the effect.
To ensure that the shadow remains where expected on a 3D layer with a track matte, precompose the 3D layer and
the track matte layer together (but don’t collapse transformations), and then apply the shadow to the precomposition.
Effectsoncontinuouslyrasterizedvectorlayerswith3Dpropertiesarerenderedin2Dandthenprojectedontothe
3D layer. OpenGL rendering does not support this sort of projection, so results may differ when rendering using
OpenGL. This projection does not occur for compositions with collapsed transformations.
AFTER EFFECTS CS3
User Guide
176
See also
“Render order and collapsing transformations” on page 115
“Precompose layers” on page 114
“Continuously rasterize a layer containing vector graphics” on page 151
Cameras, lights, and points of interest
Create a camera layer and change camera settings
You can view 3D layers from any angle and distance using camera layers.Justasit’seasierintherealworldtomove
cameras through and around a scene than it is to move and rotate the scene itself, it’s often easiest to get different
views of a composition by setting up a camera layer and moving it around in a composition.
You can modify and animate camera settings to configure the camera to match the real camera and settings that were
used to record footage with which you’re compositing. You can also use camera settings to add camera-like
behaviors—from depth-of-field blur to pans and dolly shots—to synthetic effects and animations.
Cameras affect only 3D layers and 2D layers to which you’ve applied an effect with a Comp Camera attribute. With
effects that have a Comp Camera attribute, you can use the active composition camera or lights to view or light an
effect from various angles to simulate more sophisticated 3D effects.
You can choose to view a composition through the active camera or through a named custom camera. The active
camera is the topmost camera in the Timeline panel at the current time for which the Video switch is selected.
Theactivecameraviewisthepointofviewusedforcreatingfinaloutputandnestingcompositions.Ifyouhavenot
created a custom camera, then the active camera is the same as the default composition view.
All cameras are listed in the 3D View menu at the bottom of the Composition panel, where you can access them at
any time.
Example of a camera
A. Point of interest B. Frame C. Camera
Note: If you import or open an After Effects 5.x project containing a 3D composition that used a default camera, After
Effects adds an AE 5.x Default Camera to the composition.
Dale Bradshaw provides a script and sample project for automating the rigging of a camera on the Creative Workflow
Hacks website: www.adobe.com/go/learn_ae_dale3dcamerarigging.
B
A
C
AFTER EFFECTS CS3
User Guide
177
See also
“Working with 3D layers” on page 171
“Auto-Orientation options” on page 146
“Shortcuts for 3D layers” on page 649
“Effects with a Comp Camera attribute” on page 349
“Select a view layout and share view settings” on page 126
Create a camera layer
❖Choose Layer > New > Camera, or press Ctrl+Alt+Shift+C (Windows) or Command+Option+Shift+C (Mac OS).
Note: By default, new layers begin at the beginning of the composition duration. You can instead choose to have new
layers begin at the current time by deselecting the Create Layers At Composition Start Time preference (Edit >
Preferences > General (Windows) or After Effects > Preferences > General (Mac OS)).
Change camera settings
You can change camera settings at any time.
❖Double-click the camera layer in the Timeline panel, or select the layer and then choose Layer > Camera Settings.
Camera settings
You can change camera settings at any time by double-clicking the layer in the Timeline panel or selecting the layer
and choosing Layer > Camera Settings.
Name The name of the camera. By default, Camera 1 is the name of first camera that you create in a composition,
and all subsequent cameras are numbered in ascending order. You should choose distinctive names for multiple
cameras to make it easier to distinguish them.
Preset The type of camera settings you want to use. The presets are named according to focal lengths. Each preset
is meant to represent the behavior of a 35mm camera with a lens of a certain focal length. Therefore, the preset also
sets the Angle Of View, Zoom, Focus Distance, Focal Length, and Aperture values. The default preset is 50mm. You
can also create a custom camera by specifying new values for any of the settings.
Zoom Thedistancefromthelenstotheimageplane.Inotherwords,alayerthatistheZoomdistanceawayappears
at its full size, a layer that is twice the Zoom distance away appears half as tall and wide, and so on.
Angle Of View The width of the scene captured in the image. The Focal Length, Film Size, and Zoom values
determine the angle of view. A wider angle of view creates the same result as a wide-angle lens.
Enable Depth Of Field Applies custom variables to the Focus Distance, Aperture, F-Stop, and Blur Level settings.
Using these variables, you can manipulate the depth of field to create more realistic camera-focusing effects. (The
depthoffieldisthedistancerangewithinwhichtheimageisinfocus.Imagesoutsidethedistancerangeareblurred.)
Focus Distance The distance from the camera to the plane that is in perfect focus.
Lock To Zoom Makes the Focus Distance value match the Zoom value.
Note: If you change the settings of the Zoom or Focus Distance options in the Timeline panel, the Focus Distance value
becomesunlockedfromtheZoomvalue.Ifyouneedtochangethevaluesandwantthevaluestoremainlocked,thenuse
the Camera Settings dialog box instead of the Timeline panel. Alternatively, you can add an expression to the Focus
Distance property in the Timeline panel: Select the Focus Distance property, and choose Animation > Add Expression;
then drag the expression pick whip to the Zoom property. (See “Working with expressions” on page 547.)
AFTER EFFECTS CS3
User Guide
178
Aperture The size of the lens opening. The Aperture setting also affects the depth of field—increasing the aperture
increases the depth of field blur. When you modify Aperture, the values for F-Stop change to match it.
Note: In a real camera, increasing the aperture also allows in more light, which affects exposure. Like most 3D compos-
iting and animation applications, After Effects ignores this result of the change in aperture values.
F-Stop Represents the ratio of the focal length to aperture. Most cameras specify aperture size using the f-stop
measurement; thus, many photographers prefer to set the aperture size in f-stop units. When you modify F-Stop,
Aperture changes to match it.
Blur Level The amount of depth-of-field blur in an image. A setting of 100% creates a natural blur as dictated by the
camera settings. Lower values reduce the blur.
Film Size The size of the exposed area of film, which is directly related to the composition size. When you modify
Film Size, the Zoom value changes to match the perspective of a real camera.
Focal Length The distance from the film plane to the camera lens. In After Effects, the camera’s position represents
the center of the lens. When you modify Focal Length, the Zoom value changes to match the perspective of a real
camera. In addition, the Preset, Angle Of View, and Aperture values change accordingly.
Units The units of measurement in which the camera setting values are expressed.
Measure Film Size The dimensions used to depict the film size.
Create a light and change settings
Alight layer can affect the colors of the 3D layers that it shines on, depending on the light’s settings and the Material
Options properties of the 3D layers. Each light, by default, points to its point of interest.
Lights can be used to illuminate 3D layers and to cast shadows, either to match lighting conditions of the scene into
which you are compositing or to create more interesting visual results such as the appearance of light streaming
through a layer as if it were made of stained glass.
Parts of a light
A. Point of interest B. Spotlight cone C. Light
You can animate all of a light’s settings, except for Casts Shadows.
You can specify which 3D layers a light affects by designating the light as an adjustment layer—place the light in the
Timeline panel above the layers on which you want it to shine. Layers that are above a light adjustment layer in the
layer stacking order in the Timeline panel do not receive the light, regardless of the layers’ positions in the Compo-
sition panel.
A
B
C
AFTER EFFECTS CS3
User Guide
179
See also
“Working with 3D layers” on page 171
“Auto-Orientation options” on page 146
“Create an adjustment layer” on page 136
Create a light
❖Choose Layer > New > Light, or press Ctrl+Alt+Shift+L (Windows) or Command+Option+Shift+L (Mac OS).
Note: By default, new layers begin at the beginning of the composition duration. You can instead choose to have new
layers begin at the current time by deselecting the Create Layers At Composition Start Time preference (Edit >
Preferences > General (Windows) or After Effects > Preferences > General (Mac OS)).
Change light settings
❖ Double-click a light layer in the Timeline panel or select the layer and choose Layer > Light Settings.
Light settings
Light Type Parallel emits directional, unconstrained light from an infinitely distant source. Spot emits light from a
source that is constrained by a cone, like the spotlight used in stage productions. Point emits unconstrained omnidi-
rectional light, like the rays from a bare light bulb. Ambient creates light that has no source but rather contributes to
the overall brightness of a scene and casts no shadows.
Intensity The brightness of the light. Negative values create nonlight. Nonlight subtracts color from a layer. For
example, if a layer is already lit, creating a directional light with negative values also pointing at that layer darkens an
area on the layer.
Cone Angle The angle of the cone surrounding the source of a light, which determines the width of the beam at a
distance. This option is active only if Spot is selected for Light Type.
Cone Feather The edge softness of a spotlight. This option is active only if Spot is selected for Light Type.
Color The color of the light.
Casts Shadows Specifies whether the light source causes a layer to cast a shadow. The Accepts Shadows material
option must be On for a layer to receive a shadow; this is the default. The Casts Shadows material option must be On
for a layer to cast shadows; this is not the default.
Press Alt+Shift+C (Windows) or Option+Shift+C (Mac OS) to toggle Casts Shadows for selected layers. Press AA to
show Material Options properties in the Timeline panel.
Shadow Darkness Sets the darkness level of the shadow. This option is active only if Casts Shadows is selected.
Shadow Diffusion Sets the softness of a shadow based on its apparent distance from the shadowing layer. Larger
values create softer shadows. This option is active only if Casts Shadows is selected.
Move a camera, light, or point of interest
Camera layers and light layers each include a Point Of Interest property, which specifies the point in the composition
at which the camera or light points. By default, the point of interest is at the center of the composition. You can move
the point of interest at any time.
Before moving a camera, choose a view other than Active Camera so that you can see the point of interest icon and
the boundaries defining its angle.
1Select a camera or light layer.
AFTER EFFECTS CS3
User Guide
180
2(Optional) To set the camera or light to ignore the point of interest, choose Layer > Transform > Auto-Orient and
select an option other than Orient Towards Point Of Interest.
3Using the Selection or Rotation tool, do one of the following:
•
To move the camera or light and its point of interest, position the pointer over the axis you want to adjust, and drag.
•To move the camera or light along a single axis without moving the point of interest, Ctrl-drag (Windows) or
Command-drag (Mac OS) the axis.
•To move the camera or light freely without moving the point of interest, drag the camera icon or light icon.
•To move the point of interest, drag the point of interest icon .
Note: As with all properties, you can also modify a camera or light’s position, rotation, and orientation properties directly
in the Timeline panel.
When working with a camera or light layer, create a null object and use an expression to link the camera or light's
PointOfInterestpropertytothenulllayer'sPositionproperty.Then,youcananimatethePointOfInterestproperty
by moving the null object. It is often easier to select and see a null object than it is to select and see the point of interest.
See also
“Working with 3D layers” on page 171
“Auto-Orientation options” on page 146
Adjust a camera view
Use the camera tools to adjust the camera view. These tools are specifically for manipulating the 3D views and are
only available for compositions with 3D layers.
Note: If you adjust one of the fixed views (Front, Left, Top, Back, Right, or Bottom), no property values are affected. You
can’t use the Orbit Camera tool on the fixed views.
1In the 3D View menu, choose the camera view you want to adjust.
2In the Tools panel, select a camera tool:
Orbit Camera Rotate the current 3D view around the point of interest.
Track XY Camera Adjust the 3D view horizontally or vertically.
Track Z Camera tool Adjust the 3D view along the line leading to and from the point of interest or, if you are using
an orthogonal view, to adjust the scale of the view.
Hold down the mouse button on a camera tool to see all of the available tools.
3Drag in the Composition panel. You can drag outside the panel once you’ve begun dragging within it.
After you've modified a 3D view, you can reset it by choosing View > Reset 3D View.
See also
“Select a 3D view” on page 127
“Select a view layout and share view settings” on page 126
“Shortcuts for 3D layers” on page 649
AFTER EFFECTS CS3
User Guide
181
Material Options properties
3D layers have Material Options properties, which determine how a 3D layer interacts with light and shadow.
Casts Shadows Specifies whether a layer casts shadows on other layers. The direction and angle of the shadows are
determined by the direction and angle of the light sources. Set Casts Shadows to Only if you want the layer to be
invisible but still cast a shadow.
Use the Only setting and a non-zero Light Transmission setting to project the colors of an invisible layer onto another
layer.
Light Transmission The percentage of light that shines through the layer, casting the layer’s color on other layers as
a shadow. 0% specifies that no light passes through the layer, casting a black shadow. 100% specifies that the full color
value of the shadow-casting layer is projected onto the layer accepting the shadow.
Use partial light transmission to create the appearance of light passing through a stained glass window.
Accepts Shadows Specifies whether the layer shows shadows cast on it by other layers.
Accepts Lights Specifies whether the color of a layer is affected by light that reaches it. This setting does not affect
shadows.
Ambient Ambient (nondirectional) reflectivity of the layer. 100% specifies the most reflectivity; 0% specifies no
ambient reflectivity.
Diffuse Diffuse (omnidirectional) reflectivity of the layer. Applying diffuse reflectivity to a layer is like draping a
dull, plastic sheet over it. Light that falls on this layer reflects equally in all directions. 100% specifies the most reflec-
tivity; 0% specifies no diffuse reflectivity.
Specular Specular (directional) reflectivity of the layer. Specular light reflects from the layer as if from a mirror.
100% specifies the most reflectivity; 0% specifies no specular reflectivity.
Shininess Determines the size of the specular highlight. This value is active only if the Specular setting is greater
than zero. 100% specifies a reflection with a small specular highlight. 0% specifies a reflection with a large specular
highlight.
Metal The contribution of the layer color to the color of the specular highlight. 100% specifies that the highlight
color is the color of the layer. For example, with a Metal value of 100%, an image of a gold ring reflects golden light.
0% specifies that the color of the specular highlight is the color of the light source. For example, a layer with a Metal
value of 0% under a white light has a white highlight.
See also
“Working with 3D layers” on page 171
“Create a light and change settings” on page 178
Specify resolution to use for rendering shadows
The Advanced 3D rendering plug-in is used to render compositions containing intersecting 3D layers. To render
shadows, the plug-in uses shadow maps, which are images rendered from the point of view of each light source.
Normally, a shadow’s resolution is computed automatically based on the composition resolution and the layers’
quality settings. If normal resolution doesn’t create the quality you want, or renders too slowly, you can adjust the
shadow map resolution. For example, if shadows are blurry and the Shadow Diffusion material option is set to 0,
increase the shadow map resolution. Or, if shadows render too slowly, decrease the shadow map resolution.
AFTER EFFECTS CS3
User Guide
182
When a shadow-casting layer intersects another layer, sometimes there is a small gap behind the intersection that is
supposed to be shadowed. To decrease the size of the gap, increase the shadow map resolution.
1Choose Composition > Composition Settings, click the Advanced tab, and click Options.
2Choose a value (in pixels) from the Shadow Map Resolution menu.
Choose Comp Size or a resolution larger than the composition size for best results. Lower resolutions may result in
shadows that appear blurry.
183
Chapter 8: Animation
Animation basics
About animation, keyframes, and expressions
Animation ischangeovertime.Youanimatealayeroraneffectonalayerbychangingoneormoreofitsproperties
over time. For example, you can animate a layer’s Opacity property from 0% to 100% to make the layer fade in. Any
property with a stopwatch button to the left of its name in the Timeline panel or Effect Controls panel can be
animated.
Stopwatch icons
A. Active stopwatch B. Inactive stopwatch
You animate layer properties using keyframes, expressions, or both.
To see a video tutorial on animating using keyframes, visit the Adobe website at www.adobe.com/go/vid0227.
Some tools, such as Motion Sketch and the Puppet tools, automatically set keyframes for you to match motion that
you sketch.
Many animation presets include keyframes and expressions so that you can simply apply the animation preset to the
layer to achieve a complex animated result.
You work with keyframes and expressions in After Effects in one of two modes: layer bar mode or Graph Editor mode.
Layer bar mode is the default, which shows layers as duration bars, with keyframes and expressions aligned vertically
with their properties in the Timeline panel. Graph Editor mode does not show layer bars, and shows keyframes and
expression results in value graphs or speed graphs. (See “Work with the Graph Editor” on page 184.)
Keyframes
Keyframes are used to set parameters for motion, effects, audio, and many other properties, usually changing them
over time. A keyframe marks the point in time where you specify a value, such as spatial position, opacity, or audio
volume. Values between keyframes are interpolated. When you use keyframes to create a change over time, you
typicallyuseatleasttwokeyframes—oneforthestateatthebeginningofthechange,andoneforthenewstateatthe
end of the change. (See “Set keyframes” on page 187.)
When a keyframe is selected, information regarding its value, speed, and interpolation method are shown in the Info
panel. Different information is shown depending on whether the Timeline panel is in Graph Editor mode or layer
bar mode. You can also place the pointer over a keyframe in the Graph Editor to see some of this information.
Right-click (Windows) or Control-click (Mac OS) a keyframe to open its context menu. Alt-click (Windows) or
Option-click (Mac OS) two keyframes in layer bar mode to display the duration between them in the Info panel.
B
A
AFTER EFFECTS CS3
User Guide
184
When the stopwatch is active for a specific property, After Effects automatically sets or changes a keyframe for the
property at the current time whenever you change property value. When the stopwatch is inactive for a property, the
property has no keyframes. If you change the value for a layer property while the stopwatch is inactive, the value
remains in effect for the duration of the layer.
Ifyoudeselectthestopwatch,allkeyframesforthatlayerpropertyaredeleted,andtheconstantvaluefortheproperty
becomesthevalueatthecurrenttime.Don’tdeselectthestopwatchunlessyou’resurethatyouwanttopermanently
delete all of the keyframes for that property.
Change the keyframe icons in layer bar mode to numbers by choosing Use Keyframe Indices in the Timeline panel
menu.
Keyframes as icons compared to keyframes as numbers
Before you make any changes to a keyframe, make sure that the current-time indicator is positioned at an existing
keyframe. If you change a property value when the current-time indicator is not at an existing keyframe, After Effects
adds a new keyframe. However, if you double-click a keyframe to modify it, the current-time indicator location is
not relevant, nor is it relevant when you change a keyframe’s interpolation method.
Expressions
Expressions use a scripting language based on JavaScript to specify the values of a property and to relate properties
to one another. You can create simple expressions by connecting properties with the pick whip.
See also
“Interpolation” on page 204
“About animation presets” on page 347
“Shortcuts for keyframes” on page 650
Work with the Graph Editor
The Graph Editor represents property values using a two-dimensional graph, with composition time represented
horizontally (from left to right). In layer bar mode, on the other hand, the time graph represents only the horizontal
time element, without showing a graphical, vertical representation of changing values.
To toggle between layer bar mode and Graph Editor mode, click the Graph Editor button in the Timeline panel
or press Shift+F3.
AFTER EFFECTS CS3
User Guide
185
Two animated properties (Position and Scale) shown in the Graph Editor
There are two types of graphs available in the Graph Editor: value graphs, which show property values; and speed
graphs, which show rates of change of property values. For temporal properties, such as Opacity, the Graph Editor
defaults to the value graph. For spatial properties, After Effects defaults to the speed graph.
In the Graph Editor, each property is represented by its own curve. You can view and work on one property at a time,
or you can view multiple properties simultaneously. When more than one property is visible in the Graph Editor,
each property’s curve has the same color as the property’s value in the layer outline.
When you drag a keyframe in the Graph editor with the Snap button selected, the keyframe snaps to keyframe
values, keyframe times, the current time, In and Out points, markers, the beginning and end of the work area, and
the beginning and end of the composition. When the keyframe snaps to one of these items, an orange line appears
in the Graph Editor to indicate the object you’re snapping to. Hold Ctrl (Windows) or Command (Mac OS) after
you’ve begun dragging to temporarily toggle snapping behavior.
Keyframes in Graph Editor mode may have direction handles attached to one or both sides. Direction handles are
used to control Bezier interpolation.
Keyframes in the Graph Editor with direction handles
See also
“Interpolation” on page 204
“About speed graphs” on page 210
Select which properties are shown in the Graph Editor
❖Click the Show Properties button at the bottom of the Graph Editor, and select from the following options:
Show Selected Properties Displays selected properties in the Graph Editor.
Show Animated Properties Displays animated properties of selected layers in the Graph Editor.
Show Graph Editor Set Displays properties that have the Graph Editor switch selected. This switch is next to the
stopwatch, to the left of the property name.
AFTER EFFECTS CS3
User Guide
186
Graph Options in the Graph Editor
Click the Graph Options button at the bottom of the Graph Editor to select from the following options:
Auto-Select Graph Type Automatically selects the appropriate graph type for a property: speed graphs for spatial
properties (such as Position), and value graphs for other properties.
Edit Value Graph Displays the value graph for all properties.
Edit Speed Graph Displays the speed graph for all properties.
Show Reference Graph Displays the unselected graph type in the background for viewing only. (The gray numbers
to the right of the Graph Editor indicate the values for the reference graph.)
Show Audio Waveforms DisplaystheaudiowaveformforanylayerthathasatleastonepropertyintheGraphEditor.
Show Layer In/Out Points Displays In and Out points of all layers that have a property in the Graph Editor.
Show Layer Markers Displays layer-time markers in the Graph Editor, if they exist.
Show Graph Tool Tips Toggles the graph tool tips on and off.
Show Expression Editor Shows or hides the expression editor field.
Allow Keyframes Between Frames Allows placement of keyframes between frames for fine tuning animation.
Pan and zoom in the Graph Editor
•To pan vertically or horizontally, drag with the Hand tool .
To activate the Hand tool momentarily when using another tool, press and hold the spacebar.
•To pan vertically, spin the mouse scroll wheel.
•To pan horizontally, press the Shift key as you spin the mouse scroll wheel.
•To zoom in, click with the Zoom tool.
•To zoom out, Alt-click (Windows) or Option-click (Mac OS) with the Zoom tool.
•To zoom using the mouse scroll wheel, press Alt (Windows) or Option (Mac OS) while scrolling to zoom horizon-
tally; press Ctrl (Windows) or Command (Mac OS) to zoom vertically.
•To zoom horizontally, Alt-drag (Windows) or Option-drag to the left with the Zoom tool to zoom out or to the
right to zoom in.
•To zoom vertically, Alt-drag (Windows) or Option-drag up with the Zoom tool to zoom in or down to zoom out.
Note: You cannot pan or zoom vertically when Auto Zoom Height is selected.
Auto Zoom Height and Fit
Auto Zoom Height Toggles Auto Zoom Height mode, which automatically scales the height of the graph so that
it fits the height of the Graph Editor. The horizontal zoom must still be adjusted manually.
Fit Selection Adjusts the value (vertical) and time (horizontal) scale of the graph to fit the selected keyframes in
the Graph Editor.
Fit All Adjusts the value (vertical) and time (horizontal) scale of the graph to fit all of the graphs in the Graph
Editor.
AFTER EFFECTS CS3
User Guide
187
Setting, selecting, and deleting keyframes
Set keyframes
When the stopwatch is active for a specific property, After Effects automatically adds or changes a keyframe for the
property at the current time whenever you change the property value.
1Move the current-time indicator to the time where you want to begin the animation.
2Set the layer property to the value you want at that point in time; for example, move the layer to a new position.
3Do one of the following:
•Click the Stopwatch icon next to the property name to activate it. After Effects creates a keyframe at the current
time for that property value.
•Choose Animation > Add [x] Keyframe, where [x] is the name of the property you are animating.
4Move the current-time indicator to the time where you want to add an additional keyframe.
5Change the value for the property in the layer outline.
6Repeat steps 4 and 5 as many times as you want to add more keyframes.
See also
“About animation, keyframes, and expressions” on page 183
“Shortcuts for keyframes” on page 650
“Move the current-time indicator” on page 123
“Shortcuts for showing properties in the Timeline panel” on page 647
Add a keyframe without changing a value
1In the Timeline panel, select the layer that you want to animate.
2Show the layer property for which you want to add a keyframe. The property must already contain at least one
keyframe.
3Move the current-time indicator to the point where you want to add a new keyframe. If the current-time indicator
is after the last keyframe for that layer property, the new keyframe will have the same value as the preceding
keyframe. Otherwise, the new keyframe’s value will be an interpolated value based on the previous and next
keyframe values.
4Do one of the following:
•Click the keyframe navigator button for the layer property.
•Choose Animation > Add [x] Keyframe, where [x] is the name of the property you are animating.
•Click on a segment of the layer property’s graph in the Graph Editor with the Pen tool .
See also
“About animation, keyframes, and expressions” on page 183
“Work with the Graph Editor” on page 184
AFTER EFFECTS CS3
User Guide
188
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Move the current-time indicator to a keyframe
After you set the initial keyframe for a property, After Effects displays the keyframe navigator, which you can use to
move from keyframe to keyframe or to set or remove keyframes. When the keyframe navigator box is filled with a
yellow diamond , the current-time indicator lies precisely at a keyframe for that layer property. When the
keyframe navigator box is not filled , the current-time indicator lies between keyframes.
To detach the keyframe navigator from the A/V Features column to function as its own column, choose Column >
Keys from the Timeline panel menu.
Keyframe navigator in Timeline panel
A. Keyframe at current time B. No keyframe at current time C. No keyframes for layer property
•To move to the next or previous keyframe, click a keyframe navigator arrow.
•To snap to a keyframe or marker, Shift-drag the current-time indicator.
•To move to the next or previous visible item in the time ruler (keyframe, marker, or work area end), press K or J.
See also
“About animation, keyframes, and expressions” on page 183
“Work with the Graph Editor” on page 184
Select keyframes
In layer bar mode, selected keyframes are yellow. Unselected keyframes are gray.
In Graph Editor mode, the appearance of a keyframe icon depends on whether the keyframe is selected, unselected, or
semi-selected (another keyframe in the same property is selected). Selected keyframes are solid yellow. Unselected
keyframes retain the color of their corresponding graph. Semi-selected keyframes are represented by a hollow yellow box.
•To select a keyframe, click the keyframe icon.
•To select multiple keyframes, Shift-click the keyframes or drag a marquee around the keyframes.
Note: To toggle viewing of the free-transform bounding box in the Graph Editor, click the Show Transform Box
button at the bottom of the Graph Editor.
•To select all keyframes for a layer property, Alt-click (Windows) or Option-click (Mac OS) a segment between two
keyframes in the Graph Editor, or click the layer property name in the layer outline.
•To select all keyframes for a property that have the same value, right-click (Windows) or Control-click (Mac OS)
a keyframe, and choose Select Equal Keyframes.
A
B
C
AFTER EFFECTS CS3
User Guide
189
•To select all keyframes that follow or precede a selected keyframe, right-click (Windows) or Control-click (Mac
OS) a keyframe, and choose Select Previous Keyframes or Select Following Keyframes.
Note: The Select Previous/Following Keyframes commands aren’t available if more than one keyframe is selected.
See also
“About animation, keyframes, and expressions” on page 183
“Work with the Graph Editor” on page 184
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Keyframe menu commands
When you select one or more keyframes, the keyframe menu becomes available at the bottom of the Graph
Editor.
To open the keyframe menu, right-click (Windows) or Control-click (Mac OS) a keyframe.
[Value] Displays the value of the selected keyframe. If more than one keyframe is selected, the Display Value
command is available, which displays the value of the highlighted keyframe in the selection.
Edit Value Opens a dialog box in which you can edit the value of the keyframe.
Select Equal Keyframes Selects all keyframes in a property that have the same value.
Select Previous Keyframes Selects all keyframes preceding the currently selected keyframe.
Select Following Keyframes Selects all keyframes following the currently selected keyframe.
Toggle Hold Keyframe Holds the property value at the value of the current keyframe until the next keyframe is
reached.
Keyframe Interpolation Opens the Keyframe Interpolation dialog box.
Rove Across Time Toggles Rove Across Time for spatial properties.
Keyframe Velocity Opens the Keyframe Velocity dialog box.
Keyframe Assistant Opens a submenu with the following options:
•Convert Audio To Keyframes Analyzes amplitude within the composition work area and creates keyframes to
represent the audio.
•Convert Expression To Keyframes Analyzes the current expression and creates keyframes to represent the
property values it describes.
•Easy Ease Automatically adjusts the influence into and out of a keyframe to smooth out sudden changes.
•Easy Ease In Automatically adjusts the influence into a keyframe.
•Easy Ease Out Automatically adjusts the influence out of a keyframe.
•Exponential Scale Converts the rate of change in scale from linear to exponential.
•RPF Camera Import Imports RPF camera data from third-party 3D modeling applications.
•Sequence Layers Opens the Sequence Layers assistant.
AFTER EFFECTS CS3
User Guide
190
•Time-Reverse Keyframes Reverses selected keyframes in time.
See also
“Interpolation” on page 204
Delete or disable keyframes
•To delete any number of keyframes, select them, and then press the Delete key.
•To delete one keyframe in the Graph Editor, Ctrl-click (Windows) or Command-click (Mac OS) a keyframe with
the Selection tool.
•To delete all keyframes for one layer property, click the stopwatch button to the left of the name of the layer
property to deactivate it.
When you click the stopwatch button to deactivate it, keyframes for that property are permanently removed and the
value of that property becomes the value at the current time. You cannot restore deleted keyframes by clicking the
stopwatch button again. Deleting all keyframes does not delete or disable expressions.
•To temporarily disable keyframes for a property, add an expression that sets the property to a constant value. For
example, you can add this very simple expression to the Opacity property to set it to 100%: 100.
Click the Enable Expression button to toggle the expression on and off, which toggles the keyframes off and on as a
side effect.
If you accidentally delete keyframes, choose Edit > Undo.
See also
“About animation, keyframes, and expressions” on page 183
“Work with the Graph Editor” on page 184
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Editing, moving, and copying keyframes
Edit a keyframe in the Graph Editor
A value graph in the Graph Editor displays the values for each keyframe and the interpolated values between
keyframes. When the value graph of a layer property is level, the value of the property is unchanged between
keyframes. When the value graph goes up or down, the value of a layer property increases or decreases between
keyframes.
AFTER EFFECTS CS3
User Guide
191
Value graph
A. Keyframe. B. A level value graph indicates unchanging values. C. A rising graph indicates increasing values. D. Afallinggraphindicates
decreasing values.
You can change layer property values by moving the points (keyframes) on the value graph up or down. For example,
you can increase a Rotation keyframe’s value by dragging a keyframe marker on the Rotation property’s value graph
higher up on the graph.
Note: Values for the Anchor Point, Mask Path, effect control points, 3D Orientation, and Position properties are spatial,
so they use speed graphs by default instead of value graphs.
1In the Timeline panel, display a temporal property for a layer.
2If necessary, click the Graph Editor button or press Shift+F3 to enter Graph Editor mode.
3If necessary, add a keyframe at the point in time you want the change to occur.
4Drag the keyframe up or down to set a new value for the layer property.
See also
“Work with layer properties in the Timeline panel” on page 152
“Work with the Graph Editor” on page 184
View or edit a keyframe value
•Move the current-time indicator to the time of the keyframe. The value of the property appears next to the
property name, where you can edit it.
•In layer bar mode, right-click (Windows) or Control-click (Mac OS) the keyframe. The keyframe value appears at
the top of the context menu that appears. Choose Edit Value to edit the value, if desired.
See also
“Keyframe menu commands” on page 189
“Work with layer properties in the Timeline panel” on page 152
Copy and paste keyframes
Youcancopykeyframesfromonlyonelayeratatime.Whenyoupastekeyframesintoanotherlayer,theyappearin
the corresponding property in the destination layer. The earliest keyframe appears at the current time, and the other
keyframes follow in relative order. The keyframes remain selected after pasting, so you can immediately move them
in the destination layer.
You can copy keyframes between layers for the same property (such as Position) or between different properties that
use the same type of data.
B C D A
AFTER EFFECTS CS3
User Guide
192
Note: Whencopyingandpastingbetweenthesameproperties,youcancopyfrommorethanonepropertytomorethan
one property at a time. However, when copying and pasting to different properties, you can copy only from one property
to one property at a time.
1In the Timeline panel, display the layer property containing the keyframes you want to copy.
2Select one or more keyframes.
3Choose Edit > Copy.
4In the Timeline panel containing the destination layer, move the current-time indicator to the point in time where
you want the keyframes to appear.
5Do one of the following:
•To paste to the same property of the copied keyframes, select the destination layer.
•To paste to a different property, select the destination property.
6Choose Edit > Paste.
See also
“Work with layer properties in the Timeline panel” on page 152
“About animation, keyframes, and expressions” on page 183
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Edit keyframe values using a spreadsheet
You can copy and paste keyframe data as tab-delimited text for use in a spreadsheet (such as Microsoft Excel) or
other text-editing program. This allows you to take advantage of the powerful features of spreadsheet programs,
either for numerical analysis of keyframe data or for the creation or editing of keyframe values.
You can copy and paste most properties, including the Transform properties (such as Position and Opacity), Material
Options properties, and motion trackers.
Youcanusethemotiontrackingtoolstotrackthemotionofanobjectinalayer,andthenpastethetrackerdatainto
a spreadsheet to perform numerical analysis on the data.
You can copy keyframes from only one layer at a time as tab-delimited text.
1IntheTimelinepanel,selectkeyframesforoneormorepropertiesonthesamelayer.Toselectallkeyframesfora
property, click the property’s name.
2Move the current-time indicator to the first selected keyframe. Write down the time of this keyframe. (When you
paste the edited data back in, you will need to paste it at this time.)
3Choose Edit > Copy.
4Paste keyframe data into the spreadsheet. Assuming that the first column in the spreadsheet is labeled A and the
first row is labeled 1, you should paste into cell A1. Frame numbers appear in column B. Property values appear in
columns C, D, and E, depending on the dimensions of the property. (Position in a 3D layer has values in all three
columns; Opacity has only a value in column C.)
5Edit the numerical information for the keyframes. Do not change any text other than frame numbers and property
values.
AFTER EFFECTS CS3
User Guide
193
6Select the cells that contain your data. The top-left cell in your selection should be A1. The bottom row of your
selection should be the row that contains the text End of Keyframe Data.
7Copy the data from the spreadsheet.
8In After Effects, move the current-time indicator to the time at which you want to paste the new keyframe data.
This will usually be the time of the first keyframe that you selected and copied at the beginning of this procedure.
9Choose Edit > Paste.
See also
“Work with layer properties in the Timeline panel” on page 152
“About animation, keyframes, and expressions” on page 183
Move keyframes in to another time
With multiple keyframes selected, you can copy or delete them simultaneously or move the keyframes together
without changing their positions relative to each other.
1Select one or more keyframes.
2Drag any of the selected keyframe icons to the desired time. If you selected multiple keyframes, then all of the
selected keyframes maintain their relative distance from the keyframe that you drag.
See also
“Select keyframes” on page 188
“About animation, keyframes, and expressions” on page 183
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Move a keyframe to a specific time
1Move the current-time indicator to the desired time.
2Do one of the following:
•In layer bar mode, hold down Shift after you begin to drag a keyframe icon to the current-time indicator.
•In Graph Editor mode, drag a keyframe to the current-time indicator.
When you drag over the current-time indicator, the keyframe snaps to the current-time indicator.
See also
“About animation, keyframes, and expressions” on page 183
“Work with the Graph Editor” on page 184
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
AFTER EFFECTS CS3
User Guide
194
Expand or contract a group of keyframes in layer bar mode
1Select at least three keyframes.
2Hold down Alt (Windows) or Option (Mac OS) and drag the first or last selected keyframe to the desired time.
See also
“Select keyframes” on page 188
“About animation, keyframes, and expressions” on page 183
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Move a layer duration bar but not its keyframes
1Make a note of the time at which the first keyframe appears.
2In the layer outline, click the name of one or more layer properties containing the keyframes you want to keep at
the same times.
3Choose Edit > Cut.
4Move or stretch the layer duration bar to its new In and Out points.
5Move the current-time indicator to the time at which the first keyframe appeared before you cut the keyframes.
6Choose Edit > Paste.
See also
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Copy a value from a layer property that contains no keyframes
You can copy the current value of a layer property to another layer, even when the original layer contains no
keyframes. This can save you the time of having to set up a property the same way on various layers.
1In the Timeline panel, display the layer property containing the value you want to copy.
2Click the name of the layer property to select it.
Anchor Point property selected
3Choose Edit > Copy.
4Select the layer into which you want to paste the value.
AFTER EFFECTS CS3
User Guide
195
5If the target layer contains keyframes, move the current-time indicator to the time where you want to paste the
value. If the target layer does not contain keyframes, the new value applies to the entire duration of the layer.
6Choose Edit > Paste.
See also
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Change multiple keyframe values at once
You can change the values of multiple keyframes on multiple layers at one time; however, all keyframes you select
must belong to the same layer property. The way the values change depends on the method you use to make the
change:
•If you change a value numerically, all selected keyframes use the new value exactly. In other words, you make an
absolute change. For example, if you select several Position keyframes on a motion path and numerically specify
a Position value for one of them, all selected keyframes change to the same position value.
•If you change a value by dragging the underlined value, all selected keyframes change by the same amount. In
other words, you make a relative change. For example, if you select several Position keyframes on a motion path
and drag the underlined value for one of them, all selected keyframe values change by the same amount.
•If you change a value graphically in the Composition or Layer panel, all selected keyframes change using the
difference between the old and new values, not the values themselves. In other words, you make a relative change.
For example, if you select several Position keyframes on a motion path and then drag one of them 10 pixels to the
left, they all move 10 pixels to the left of their original positions.
You can also change the value of several layers at once in layer bar mode by parenting them.
1Select the keyframes you want to change. All keyframes you select must be on the same property.
2Change the value of any selected keyframe by one of the methods above. All other selected keyframes change
accordingly.
See also
“Work with parent and child layers” on page 158
“About animation, keyframes, and expressions” on page 183
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Edit multiple keyframes in the Graph Editor
You can edit and move multiple keyframes simultaneously using the Graph Editor. When you select multiple
keyframes with the Show Transform Box button toggled, a free-transform bounding box surrounds the selected
keyframes, and an anchor point appears in the center of the bounding box to mark the center point for the transfor-
mation. You can move the selected keyframes in time or value by dragging the bounding box or its handles. You can
also change the position of the anchor point.
Adjusting a free-transform bounding box in a value graph moves the selected keyframes in time and value. Adjusting
a free-transform bounding box in a speed graph moves the selected keyframes in time only.
AFTER EFFECTS CS3
User Guide
196
When you select multiple keyframes in the Graph Editor, a free-transform bounding box appears.
1Switch to the Graph Editor view and display the keyframes you want to adjust.
2Using the Selection tool, do one of the following:
•To select keyframes, Shift-click the keyframes or drag to draw a marquee around the keyframes.
•To select all keyframes for a property, Alt-click (Windows) or Option-click (Mac OS) a segment between two
keyframes.
3Do any of the following:
•To move keyframes in time or value, position the pointer inside the bounding box and drag. Shift-drag to
constrain the move horizontally or vertically.
•To move keyframes in time or value by scaling the bounding box, position the pointer on a bounding box handle.
When the pointer changes to a straight, double-sided arrow , drag the bounding box to a new size. Shift-drag to
constrain the ratio of width to height. Ctrl-drag (Windows) or Command-drag (Mac OS) to scale around the
bounding box’s anchor point. When dragging a corner handle, Alt-drag (Windows) or Option-drag (Mac OS) to
move only that handle.
Scale by negative amounts to reverse the keyframes in time.
•To taper keyframe values vertically, Ctrl+Alt-drag (Windows) or Command+Option-drag (Mac OS). Tapering
keyframe values allows you to reduce or expand the amplitude of a repeated animation.
•To move one side of the bounding box up or down, Ctrl+Alt+Shift-drag (Windows) or Command+Option+Shift-
drag (Mac OS).
•To move the bounding box’s anchor point, position the Selection tool over the anchor point until the tool changes
to the Move Anchor Point tool , and then drag to position the anchor point.
See also
“Work with the Graph Editor” on page 184
“About animation, keyframes, and expressions” on page 183
AFTER EFFECTS CS3
User Guide
197
Creating and modifying motion paths
Work with motion paths
When you animate spatial properties—including Position and Anchor Point properties, as well as effect control
point properties—the motion is shown as a motion path. Position motion paths appear in the Composition panel;
Anchor Point and effect control point motion paths appear in the Layer panel. A motion path appears as a sequence
of dots, where each dot marks the position of the layer at each frame. A box in the path marks the position of a
keyframe.
Note: The density of dots between the boxes in a motion path indicates the layer’s relative speed. Dots close together
indicate a lower speed; dots farther apart indicate a greater speed.
Motion paths are simply an alternative visual, spatial way of viewing and working with spatial properties and their
keyframes, in addition to the ways that you work with properties in the Timeline panel. You can modify a motion
path by changing an existing keyframe or adding a new keyframe. You can modify a motion path’s shape by changing
the spatial interpolation methods for its keyframes.
Note: Right-click (Windows) or Command-click (Mac OS) a keyframe to open its context menu.
Using the Pen tool or Selection tool to edit keyframes for a spatial property in the Composition or Layer panel is
similar to modifying a Bezier path for a mask or for a shape on a shape layer. (See “About paths” on page 313.)
A motion path is less complex and generally easier to modify when you use fewer keyframes to describe the path.
You can use The Smoother to remove extraneous keyframes from a motion path.
Jonas Hummelstrand and Dan Ebberts provide an animation preset and instructions for scaling and rotating a
motion path: www.adobe.com/go/learn_ae_jonasscalemotionpath.
See also
“Work with layer properties in the Timeline panel” on page 152
“About animation, keyframes, and expressions” on page 183
“Modify a Bezier mask path or shape path” on page 323
Show motion path controls
•To show motion path controls in the Composition panel, choose Composition > View Options, and select Effect
Controls, Keyframes, Motion Paths, and Motion Handles. To see a Position motion path in the Composition
panel, the Position property must be selected.
•ToshowmotionpathcontrolsintheLayerpanel,choosethepropertyoreffectfromtheViewmenuatthebottom
of the Layer panel.
•To specify how many keyframes to show for a motion path, choose Edit > Preferences > Display (Windows) or
After Effects > Preferences > Display (Mac OS), and select an option in the Motion Path section.
Move motion path keyframes
1In the Timeline panel, select the layer for which to modify the motion path.
2If you cannot see the keyframe you want to modify in the Composition panel or Layer panel, move the current-
time indicator to the keyframe.
3In the Composition panel or Layer panel, use the Selection tool to drag a keyframe or its handles.
AFTER EFFECTS CS3
User Guide
198
Note: The current-time indicator does not need to be located on a keyframe before you drag it.
Drag a keyframe in the Composition panel to move one Position keyframe.
You can move multiple keyframes at one time by selecting them in the Timeline panel before you drag them in the
Composition panel or Layer panel. To move the entire motion path, select all keyframes by clicking the property
name in the Timeline panel before dragging a keyframe in the Composition panel.
Dragging all keyframes on a motion path by one keyframe
Add a keyframe to a motion path using the Pen tool
1Display the motion path that you want to modify in the Composition panel or Layer panel.
2Select the Pen tool or Add Vertex tool from the Tools panel.
3In the Composition panel, move the Pen tool over the motion path where you want to add the new keyframe and
click to add the keyframe.
AFTER EFFECTS CS3
User Guide
199
A new keyframe appears at the frame you clicked, on the motion path and in the Timeline panel. To move the
keyframe, use the Selection tool.
Note: Though the results are different, the tools for manipulating motion-path curves with the Pen tool work in much
the same way as those used to create and modify other Bezier paths, such as mask and shape paths.
Sketch a motion path with Motion Sketch
You can draw a path for the motion of a selected layer using Motion Sketch, which records the position of the layer
and the speed at which you draw. As you draw, a Position keyframe is generated at each frame.
Motion Sketch does not affect keyframes that you have set for other properties. For example, if you set Rotation
keyframes for an image of a ball, you can use Motion Sketch to generate Position keyframes, so that the ball appears
to roll along the path you created.
1In the Composition or Timeline panel, select the layer for which you want to sketch a motion path.
2In the Timeline panel, set the work-area markers to the duration in which you want to sketch motion.
3Choose Window > Motion Sketch.
4Select the appropriate Motion Sketch options:
Show Wireframe Displays a wireframe view of the layer as you sketch the motion path.
Show Background DisplaysthestaticcontentsoftheframeatwhichyoustartedsketchingintheCompositionpanel
while you sketch. This is useful if you want to sketch motion relative to other images in your composition.
Smoothing Eliminates unnecessary keyframes from the motion path. This setting has the same result as using the
Tolerance setting with The Smoother. Higher values produce smoother curves, but too high a value may not preserve
the shape of the curve that you draw.
Note: You can smooth a motion path after it has been created by using the smooth expression or The Smoother.
Capture Speed At The ratio of the speed of the recorded motion to playback speed. If Capture Speed At is 100%, the
motion is played back at the speed at which it was recorded. If Capture Speed At is greater than 100%, the motion
plays back slower than it was recorded.
5Click Start Capture and then drag in the Composition panel to create the motion path. Release the mouse button
to stop capturing.
Note: After Effects automatically ends capturing when the capture time reaches the end of the work area (which, by
default, is the composition duration).
See also
“Set the work area” on page 112
“About animation, keyframes, and expressions” on page 183
Create a motion path from a mask, shape, or paint path
You can create a motion path from any of several types of paths:
•A Mask Path property
•A shape’s Path property on a shape layer
•A Path property for a paint stroke
AFTER EFFECTS CS3
User Guide
200
•A path copied from Illustrator or Photoshop
You can paste any of these paths into the Position or Anchor Point property for a layer, or into an effect control point’s
position property. The pasted keyframes are set to rove in time, except for the first and last ones, to create a constant
velocity along the path.
By default, the duration of the pasted motion path is 2 seconds. You can adjust the duration by dragging the first or
last keyframe in the Timeline panel.
1Copy a path to the clipboard:
•Select a Path property in the Timeline panel, and choose Edit > Copy.
•Select a path in Illustrator or Photoshop, and choose Edit > Copy.
2IntheTimelinepanel,selectthepropertyintowhichtopastethepath.Thepropertymustbeanimated—thatis,
it must have at least one keyframe or an expression.
3Place the current-time indicator at the time for the first keyframe of the motion path.
4Choose Edit > Paste.
See also
“Copy a path from Illustrator, Photoshop, or Fireworks” on page 324
“About paths” on page 313
Assorted animation tools
Use motion blur
When you view one frame of motion-picture film or video containing a moving object, the image is often blurred,
because a frame represents a sample of time (in film, a frame is 1/24 of a second long). In that time, a moving object
occupiesmorethanonepositionasittravelsacrosstheframe,soitdoesn’tappearasasharp,stillobject.Thefaster
theobjectmoves,themoreitisblurred.Thecamerashutterangleandshutterphasealsoaffecttheappearanceofthe
blur, determining how long the shutter stays open and when the shutter opens relative to the beginning of the frame.
In contrast, in a single frame of a computer-generated animation, you may not be able to tell which objects are
movingbecauseallmovingobjectsmayappearassharpandclearasnonmovingobjects.Withoutmotionblur,layer
animation produces a strobe-like effect of distinct steps instead of an appearance of continuous change. Adding
motion blur to layers you animate in After Effects makes motion appear smoother and more natural.
You enable motion blur for each layer individually, and you also determine whether the motion blur is rendered for
previews and final rendering. Use the Enable Motion Blur composition switch at the top of the Timeline panel to
enable or disable motion blur rendering for previews. Modify the render settings in the Render Queue panel to
enable or disable motion blur rendering for final output.
Motion blur slows rendering, so you may want to disable the composition switch while working, and only enable it
when you need to see the finished result.
AFTER EFFECTS CS3
User Guide
201
You can use motion blur when you animate a layer—for example, moving a layer of text across the screen. You cannot
addmotionblurtomotionthatalreadyexistswithinalayer,suchaslive-actionvideo,bymeansoftheMotionBlur
layerswitchandEnableMotionBlurcompositionswitch.Youcanaddmotionblurtomotionwithinalayerbyusing
an effect. The CC Force Motion blur effect, which is included in the full version of After Effects, analyzes motion
from frame to frame within a layer and uses this information to add motion blur to motion within the layer. The
ReelSmart Motion Blur effect from RE:Vision Effects performs a similar function:
www.adobe.com/go/learn_ae_reelsmartmotionblur.
If you want to smooth live-action video to which you assigned a frame rate much lower or higher than the original,
use frame blending.
Note: Previous versions of After Effects included an effect called Motion Blur. That effect is now named Directional Blur,
to avoid confusion with motion blur applied to layers.
•Click the Motion Blur layer switch for the layer in the Timeline panel.
•Select the layer and choose Layer > Switches > Motion Blur.
The number of samples that After Effects uses to calculate motion blur adapts for each layer, depending on the
motion of that layer. This provides high-quality motion blur without unnecessarily sampling the motion of a slow-
moving layer as frequently as that of a fast-moving layer. High sampling rates decrease rendering performance.
See also
“Apply frame blending to a layer” on page 225
“Apply motion blur to a mask” on page 267
“Work with render settings” on page 597
“About effects” on page 348
Motion blur settings in the Advanced tab of Composition Settings
Samples Per Frame The minimum number of samples. This is the number of samples used for frames for which
After Effects is not able to determine an adaptive sampling rate based on layer motion. This sample rate is used for
3D layers and shape layers.
Adaptive Sample Limit The maximum number of samples.
Shutter Angle
The shutter angle is measured in degrees, simulating the exposure allowed by a rotating shutter. The
shutter angle uses the footage frame rate to determine the simulated exposure, which affects the amount of motion
blur. For example, entering 90˚ (25% of 360˚) for 24-fps footage creates an effective exposure of 1/96 of a second (25%
of 1/24 of a second). Entering 1˚ applies almost no motion blur, and entering 720˚ applies a large amount of blur.
Shutter Phase The shutter phase is also measured in degrees. It defines an offset that determines when the shutter
opensrelativetothebeginningofaframe.Adjustingthisvaluecanhelpifanobjectwithmotionblurappliedappears
to lag behind the position of the object without motion blur applied.
A Shutter Phase value that is -1/2 of the Shutter Angle value is best for a layer that is composited on top of another
using motion tracking data. (For example, Shutter Phase = -90, Shutter Angle = 180.) This setting combination
causes a blur that is centered on the original object.
AFTER EFFECTS CS3
User Guide
202
Smooth motion and velocity
Smooth motion paths, value curves, and velocity curves to eliminate bumpiness or excess keyframes using The
Smoother, which adds keyframes or removes unnecessary keyframes. You can also use the smooth expression to
accomplish this.
Although you can smooth a curve for any property, The Smoother is most useful when applied to curves that have
been automatically generated by Motion Sketch, where you may have excess keyframes. Applying The Smoother to
keyframes that have been set manually may result in unexpected changes to the curve.
Note: To avoid the need to use The Smoother on a path generated by Motion Sketch, set the Smoothing option in the
Motion Sketch panel before sketching the motion path.
WhenyouapplyTheSmoothertopropertiesthatchangespatially(suchasPosition),youcansmoothonlythespatial
curve (the curve defined by the motion). When you apply The Smoother to properties that change only in time (such
as Opacity), you can smooth only the value and velocity curves (the curve defined by the value or the velocity).
In addition to adding keyframes or eliminating unnecessary keyframes, The Smoother also applies Bezier interpo-
lation at each keyframe when smoothing the temporal curve.
1In the Timeline panel, either select all the keyframes for a property to smooth the entire curve, or select at least
three keyframes to smooth only a portion of a curve.
2Choose Window > The Smoother. In the Apply To menu, The Smoother automatically selects Spatial Path or
Temporal Graph, depending on the type of property for which you selected keyframes in step 1.
3Set a value for Tolerance. The units of Tolerance match those of the property you are smoothing. New keyframe
values will vary no more than the specified value from the original curve. Higher values produce smoother curves,
but too high a value may not preserve the original shape of the curve.
4Click Apply and preview the results.
5If necessary, choose Edit > Undo The Smoother to reset the keyframes, adjust the value for Tolerance, and then
reapply The Smoother.
See also
“Sketch a motion path with Motion Sketch” on page 199
“Select keyframes” on page 188
Add randomness to a property with The Wiggler
You can add randomness to any property as it varies over time by using The Wiggler. You can also use the wiggle
expressiontoaccomplishthis.Inmostcases,itiseasiertousetheexpressionthantouseTheWiggler.(See“Property
attributes and methods” on page 576.)
Depending on the property and the options you specify, The Wiggler adds a certain number of deviations to a
property by adding keyframes and randomizing interpolations coming into or out of existing keyframes. You need
at least two keyframes to use The Wiggler.
Using The Wiggler, you can more closely simulate natural movement within specified limits. For example, add
randomness to an animated butterfly to produce fluttering. Add it to brightness or opacity to simulate the flicker of
an old projector.
1Select a range of keyframes for the property.
2Choose Window > The Wiggler.
AFTER EFFECTS CS3
User Guide
203
3For Apply To, select the type of curve you want The Wiggler to change. If you selected keyframes for a property
that varies spatially, you can select Spatial Path to add deviations to the motion, or Temporal Graph to add deviations
to the velocity. If you selected keyframes for a property that does not vary spatially, you can select only Temporal
Graph.
4Select a Noise Type option to specify the type of deviation due to randomly distributed pixel values (noise):
Smooth Noise Produces deviations that occur more gradually, without sudden changes.
Jagged Noise Produces sudden changes.
5Select the dimensions of the property you want to affect:
One Dimension Adds deviations to only one dimension of the selected property. Choose the dimension from the
menu.
All Dimensions Independently adds a different set of deviations to each dimension.
All Dimensions The Same Adds the same set of deviations to all dimensions.
6Set Frequency to specify how many deviations (keyframes) per second After Effects adds to the selected
keyframes. A low value produces only occasional deviations, while a high value produces more erratic results. A
value between 0 and 1 creates keyframes at intervals of less than one per second. For example, a value of 0.5 creates
one keyframe every 2 seconds.
7Set Magnitude to specify the maximum size of the deviations. After Effects sets the specified magnitude to the
units of the selected property, so a value for one property may produce very different results in another property.
8Click Apply and preview the results.
9If necessary, choose Edit > Undo The Wiggler to reset the keyframes, adjust the values for Frequency and
Magnitude, and then reapply The Wiggler.
See also
“Select keyframes” on page 188
Convert audio to keyframes
The Convert Audio To Keyframes keyframe assistant analyzes audio amplitude within the work area and creates
keyframes for audio amplitude.
❖Select the Timeline panel, and then choose Animation > Keyframe Assistant > Convert Audio To Keyframes.
This keyframe assistant creates a new Audio Amplitude layer representing all audio sources in the composition, with
three Expression Controls effects with Slider properties that contain the keyframes: Left Channel, Right Channel,
and Both Channels.
To make use of the keyframes created by this keyframe assistant, you must link the changes in audio amplitude to
other layer properties. For example, use an expression to link the audio keyframes to the Scale property of a layer to
make the layer grow and shrink as the amplitude increases and decreases.
Aharon Rabinowitz provides a video tutorial that shows how to link the audio amplitude keyframes to other
properties, in this case the properties of the Wave Warp effect, to synchronize animation with sound:
www.adobe.com/go/learn_ae_aharonwaveform.
The Trapcode Sound Keys effect also converts audio values to keyframes, but provides more control than the built-
in Convert Audio To Keyframes keyframe assistant: www.adobe.com/go/learn_ae_trapcodesoundkeys.
AFTER EFFECTS CS3
User Guide
204
See also
“Set the work area” on page 112
Interpolation
Controlling change with interpolation
After you create keyframes and motion paths to change values over time, you may want to make more precise adjust-
ments to the way that change occurs. After Effects provides several interpolation methods that affect how change
occurs through and between keyframes. For example, if you are setting up motion, you can choose to make a layer
change direction abruptly or smoothly through a curve. After Effects interpolates values for a change using the values
of the keyframes on both ends of the change.
Interpolation is the process of filling in the unknown data between two known values. This usually means generating
new values between two keyframes. For example, if you want a graphic element (such as a title) to move fifty pixels
across the screen to the left, and you want it to do so in 15 frames, you’d set the position of the graphic in the first
and 15th frames, and mark them both as keyframes. Then the software would complete the work of interpolating the
frames in between to make the movement appear smooth. Because interpolation generates all the frames between
the two keyframes, interpolation is sometimes called tweening. Interpolation between keyframes can be used to
animate movement, effects, audio levels, image adjustments, transparency, color changes, and many other visual and
audio elements.
You can control interpolation between keyframe values over time for all layer properties. For spatial properties—
whicharelayerpropertiesthatinvolvemovement,suchasPosition,AnchorPoint,andeffectpointproperties—you
can also control interpolation between motion-path keyframes through space.
Temporal interpolation and the value graph
Using the value graph in the Graph Editor, you can make precise adjustments to the temporal property keyframes
you’ve created for your animation. The value graph displays x values as red, y values as green, and z values (3D only)
as blue. The value graph provides complete information about the value of keyframes at any point in time in a
composition and allows you to control it. In addition, the Info panel displays the temporal interpolation method of
a selected keyframe.
Spatial interpolation and the motion path
When you apply or change spatial interpolation for a property such as Position, you adjust the motion path in the
Composition panel. The different keyframes on the motion path provide information about the type of interpolation
at any point in time. The Info panel displays the spatial interpolation method of a selected keyframe.
When you create spatial changes in a layer, After Effects uses Auto Bezier as the default spatial interpolation.
To change the default to linear interpolation, choose Edit > Preferences > General (Windows) or After Effects >
Preferences > General (Mac OS), and select Default Spatial Interpolation To Linear.
AFTER EFFECTS CS3
User Guide
205
Motion path interpolation
A. Linear B. Auto Bezier C. Continuous Bezier D. Bezier E. Hold
Note: In some cases, the Auto Bezier spatial interpolation for Position keyframes can cause undesired back-and-forth
(boomerang) motion between two keyframes with equal values. In such a case, you can change the earlier keyframe to
use Hold interpolation or change both keyframes to use Linear interpolation.
See also
“About changes in speed” on page 210
“Work with the Graph Editor” on page 184
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Keyframe interpolation methods
In layer bar mode, the appearance of a keyframe icon depends on the interpolation method you choose for the
interval between keyframes. When half of the icon is dark gray , the dark half indicates that there is no keyframe
adjacent to that side, or that its interpolation is overridden by the Hold interpolation applied to the preceding
keyframe.
By default, a keyframe uses one interpolation method, but you can apply two methods: the incoming method applies
to the property value as the current time approaches a keyframe, and the outgoing method applies to the property
value as the current time leaves a keyframe. When you set different incoming and outgoing interpolation methods,
the keyframe icon in layer bar mode changes accordingly. It displays the left half of the incoming interpolation icon
and the right half of the outgoing interpolation icon.
To toggle between keyframe icons and keyframe numbers, select Use Keyframe Icons or Use Keyframe Indices from
the Timeline panel menu.
Examples of keyframe icons in Timeline panel in layer bar mode
A. Linear B. Linear in, Hold out C. Auto Bezier D. Continuous Bezier or Bezier E. Linear in, Bezier out
AB
CDE
ABC DE
AFTER EFFECTS CS3
User Guide
206
All interpolation methods used by After Effects are based on the Bezier interpolation method, which provides
direction handles so that you can control the transitions between keyframes. Interpolation methods that don’t use
direction handles are constrained versions of Bezier interpolation and are convenient for certain tasks.
To learn more about how different interpolation methods affect temporal properties, experiment by setting up at
least three keyframes with different values for a temporal layer property—such as Opacity—and change the interpo-
lation methods as you view the value graph in Graph Editor mode in the Timeline panel.
To learn more about how different interpolation methods affect a motion path, experiment by setting up three
keyframes for a spatial property—such as Position—with different values on a motion path, and change the interpo-
lation methods as you preview the motion in the Composition panel.
Note: To change interpolation methods, right-click a keyframe, select Keyframe Interpolation from the menu that
appears, and then select an option from the Temporal Interpolation drop-down menu.
In the following descriptions of interpolation methods, the result of each method is described as if you had applied
it to all of the keyframes for a layer property. This is done to clarify the examples. In practice, you can apply any
available interpolation method to any keyframe.
See also
“About animation, keyframes, and expressions” on page 183
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
“Work with the Graph Editor” on page 184
No interpolation
No interpolation is the state in which there are no keyframes for a layer property—when the stopwatch is turned off
and the I-beam icon appears in the Timeline panel under the current-time indicator. In this state, when you set
the value of a layer property, it maintains that value for the layer’s duration, unless overridden by an expression. By
default, no interpolation is applied to a layer property. If any keyframes are present for a layer property, some kind
of interpolation is in use.
Linear interpolation
Linear interpolation creates a uniform rate of change between keyframes, which can add a mechanical look to anima-
tions. After Effects interpolates the values between two adjacent keyframes as directly as possible without accounting
for the values of other keyframes.
If you apply Linear interpolation to all keyframes of a temporal layer property, change begins instantly at the first
keyframeandcontinuestothenextkeyframeataconstantspeed.Atthesecondkeyframe,therateofchangeswitches
immediately to the rate between it and the third keyframe. When the layer reaches the final keyframe value, change
stops instantly. In the value graph, the segment connecting two keyframes with Linear interpolation appears as a
straight line.
Bezier interpolation
Bezier interpolation provides the most precise control because you manually adjust the shape of the value graph or
motion path segments on either side of the keyframe. Unlike Auto Bezier or Continuous Bezier, the two direction
handles on a Bezier keyframe operate independently in both the value graph and motion path.
AFTER EFFECTS CS3
User Guide
207
If you apply Bezier interpolation to all keyframes of a layer property, After Effects creates a smooth transition
between keyframes. The initial position of the direction handles is calculated using the same method used in Auto
Bezier interpolation. After Effects maintains existing direction handle positions as you change a Bezier keyframe
value.
Unlike other interpolation methods, Bezier interpolation lets you create any combination of curves and straight lines
along the motion path. Because the two Bezier direction handles operate independently, a curving motion path can
suddenly turn into a sharp corner at a Bezier keyframe. Bezier spatial interpolation is ideal for drawing a motion
path that follows a complex shape, such as a map route or the outline of a logo.
Existing direction handle positions persist as you move a motion-path keyframe. The speed of motion along the path
is controlled by the temporal interpolation applied at each keyframe.
Auto Bezier interpolation
Auto Bezier interpolation creates a smooth rate of change through a keyframe. You might use Auto Bezier spatial
interpolation to create the path of a car turning on a curving road.
As you change an Auto Bezier keyframe value, the positions of Auto Bezier direction handles change automati-
cally to maintain a smooth transition between keyframes. The automatic adjustments change the shape of the value
graph or motion path segments on either side of the keyframe. If the previous and next keyframes also use Auto
Bezier interpolation, the shape of the segments on the far side of the previous or next keyframes also changes. If you
adjust an Auto Bezier direction handle manually, you convert it to a Continuous Bezier keyframe .
Auto Bezier is the default spatial interpolation.
Continuous Bezier interpolation
Like Auto Bezier interpolation, Continuous Bezier interpolation creates a smooth rate of change through a keyframe.
However, you set the positions of Continuous Bezier direction handles manually. Adjustments you make change the
shape of the value graph or motion path segments on either side of the keyframe.
If you apply Continuous Bezier interpolation to all keyframes of a property, After Effects adjusts the values at each
keyframe to create smooth transitions. After Effects maintains these smooth transitions as you move a Continuous
Bezier keyframe on either the motion path or the value graph.
Hold interpolation
Hold interpolation is available only as a temporal interpolation method. Use it to change the value of a layer property
over time, but without a gradual transition. This method is useful for strobe effects, or when you want layers to
appear or disappear suddenly.
If you apply Hold temporal interpolation to all keyframes of a layer property, the value of the first keyframe holds
steady until the next keyframe, when the values change immediately. In the value graph, the graph segment following
a Hold keyframe appears as a horizontal straight line.
Even though Hold interpolation is available only as a temporal interpolation method, the keyframes on the motion
path are visible, but they are not connected by layer-position dots. For example, if you animate a layer’s Position
property using Hold interpolation, the layer holds at the position value of the previous keyframe until the current-
time indicator reaches the next keyframe, at which point the layer disappears from the old position and appears at
the new position.
AFTER EFFECTS CS3
User Guide
208
You can easily freeze the current frame for the duration of the layer using the Freeze Frame command. To freeze a
frame, position the current time indicator at the frame you want to freeze. Make sure the layer is selected and then
choose Layer > Time > Freeze Frame. Time-remapping is enabled, and a Hold keyframe is placed at the position of
the current time indicator to freeze the frame.
Note: If you previously enabled time-remapping on the layer, any keyframes you created will be deleted when you apply
the Freeze Frame command.
You can use Hold interpolation only for outgoing temporal interpolation (for the frames following a keyframe). If
you create a new keyframe following a Hold keyframe, the new keyframe will use incoming Hold interpolation.
To apply or remove Hold interpolation as outgoing interpolation for a keyframe, select the keyframe in the Timeline
panel, and choose Animation > Toggle Hold Keyframe.
Apply and change keyframe interpolation methods
You can apply and change the interpolation method for any keyframe. You can apply changes using the Keyframe
Interpolation dialog box, or you can apply them directly to a keyframe in layer bar mode, in a motion path, or in the
Graph Editor. You can also change the default interpolation After Effects uses for spatial properties.
See also
“Select keyframes” on page 188
“About animation, keyframes, and expressions” on page 183
“Shortcuts for keyframes” on page 650
“Shortcuts for showing properties in the Timeline panel” on page 647
Change interpolation method with the Keyframe Interpolation dialog box
The Keyframe Interpolation dialog box provides options for setting temporal and spatial interpolation and—for
spatial properties only—roving settings.
1In layer bar mode or in the Graph Editor, select the keyframes you want to change.
2Choose Animation > Keyframe Interpolation.
3For Temporal Interpolation, choose one of the following options:
Current Settings Preserves the interpolation values already applied to the selected keyframes. Choose this option
when multiple or manually adjusted keyframes are selected and you do not want to change the existing settings.
Linear, Bezier, Continuous Bezier, Auto Bezier, and Hold Apply a temporal interpolation method using default
values.
4If you selected keyframes of a spatial layer property, choose one of the following options for Spatial Interpolation:
Current Settings Preserves the interpolation settings already applied to the selected keyframes.
Linear, Bezier, Continuous Bezier, and Auto Bezier Apply a spatial interpolation method using default values.
5If you selected keyframes of a spatial layer property, use the Roving menu to choose how a keyframe determines
its position in time, and then click OK:
Current Settings Preserves the currently applied method of positioning the selected keyframes in time.
Rove Across Time Smooths the rate of change through the selected keyframes by automatically varying their
position in time, based on the positions of the keyframes immediately before and after the selection.
AFTER EFFECTS CS3
User Guide
209
Lock To Time keeps the selected keyframes at their current position in time. They stay in place unless you move them
manually.
For more information on smoothing the rate of change through selected keyframes, see “Smooth motion with roving
keyframes” on page 216.
Change interpolation method with the Selection tool in layer bar mode
❖Using the Selection tool, do one of the following:
•If the keyframe uses Linear interpolation, Ctrl-click (Windows) or Command-click (Mac OS) the keyframe to
change it to Auto Bezier .
•If the keyframe uses Bezier, Continuous Bezier, or Auto Bezier interpolation, Ctrl-click (Windows) or Command-
click (Mac OS) the keyframe to change it to Linear.
Change interpolation method in the Graph Editor
•Click the keyframe with the Convert Vertex tool to toggle between linear and Auto Bezier interpolation.
•Select one or more keyframes, and then click the Hold, Linear, or Auto Bezier button at the bottom of the screen
to change the interpolation method.
Interpolation buttons in the Graph Editor
A. Hold B. Linear C. Auto-Bezier
Modify Bezier direction handles
In the Graph Editor, keyframes that use Bezier interpolation have direction handles attached to them. You can
retract, extend, or rotate the direction handles to fine-tune the Bezier interpolation curve.
Retracting a direction handle makes a tighter, sharper Bezier curve. Extending a direction handle makes a larger,
smoother Bezier curve. By default, when you retract or extend a direction handle, the opposite handle on the
keyframe moves with it. Splitting direction handles makes the two direction handles attached to a keyframe behave
independently.
•To retract or extend direction handles, drag the direction handle toward or away from the center of its keyframe
with the Selection tool.
•To split direction handles, Alt-drag (Windows) or Option-drag (Mac OS) a keyframe with the Selection tool. You
can also Alt-drag (Windows) or Option-drag (Mac OS) outside a keyframe to draw new handles, whether or not
there are existing handles.
•To manipulate the direction handles of two neighboring keyframes simultaneously, drag the value graph segment
between the keyframes.
A B C
AFTER EFFECTS CS3
User Guide
210
Modifying a Bezier direction handle
See also
“Work with the Graph Editor” on page 184
“About animation, keyframes, and expressions” on page 183
Speed
About speed graphs
You can fine-tune changes over time using the speed graph in the Graph Editor. The speed graph provides infor-
mation about and control of the value and rate of change for all spatial and temporal values at any frame in a compo-
sition. To view the speed graph, choose Edit Speed Graph from the Choose Graph Type menu .
Speed graph controls
A. Value at the current-time indicator B. Speed graph C. Direction handle (controls speed)
See also
“Work with the Graph Editor” on page 184
“About animation, keyframes, and expressions” on page 183
About changes in speed
When you animate a property in the Graph Editor, you can view and adjust the rate of change of the property in the
speed graph, or on the motion path in the Composition or Layer panel. As you adjust the rate in one panel, you can
view the changes in the other. In the speed graph, changes in the graph height indicate changes in speed. Level values
indicate constant speed; higher values indicate increased speed.
In the Composition or Layer panel, the spacing between dots in a motion path indicates speed. Each dot represents
a frame, based on the frame rate of the composition. Even spacing indicates a constant speed, and wider spacing
indicates a higher speed. Keyframes using Hold interpolation display no dots because there is no intermediate
transition between keyframe values; the layer simply appears at the next keyframe’s position.
AB C
AFTER EFFECTS CS3
User Guide
211
Motion path in Composition panel (top) compared to speed graph in Graph Editor (bottom)
A. Dots are close together, indicating lower speed (top); speed is constant (bottom). B. Dots are far apart, indicating greater speed (top); speed
is constant (bottom). C. Inconsistent spacing of dots indicates changing speed (top); speed decreases and then increases (bottom).
The change of speed over time is affected by the following factors:
•The time difference between keyframes in the Timeline panel. The shorter the time interval between keyframes,
themorequicklythelayerhastochangetoreachthenextkeyframevalue.Iftheintervalislonger,thelayerchanges
more slowly, because it must make the change over a longer period of time. You can adjust the rate of change by
moving keyframes forward or backward along the timeline.
•The difference between the values of adjacent keyframes. A large difference between keyframe values, such as the
difference between 75% and 20% opacity, creates a faster rate of change than a smaller difference, such as the
difference between 30% and 20% opacity. You can adjust the rate of change by increasing or decreasing the value
of a layer property at a keyframe.
•The interpolation type applied for a keyframe. For example, it is difficult to make a value change smoothly through
a keyframe when the keyframe is set to Linear interpolation, but you can switch to Bezier interpolation at any time,
which provides a smooth change through a keyframe. If you use Bezier interpolation, you can adjust the rate of
change even more precisely using direction handles.
A B
C
ABC
AFTER EFFECTS CS3
User Guide
212
Linear interpolation (top) causes sharp changes; Bezier interpolation (bottom) creates smoother changes.
See also
“Work with the Graph Editor” on page 184
“About animation, keyframes, and expressions” on page 183
Control speed between keyframes
•In the Composition or Layer panel, adjust the spatial distance between two keyframes on the motion path.
Increase speed by moving one keyframe position farther away from the other, or decrease speed by moving one
keyframe position closer to the other.
More spatial distance between keyframes increases layer speed.
•In layer bar mode or in the Graph Editor, adjust the time difference between two keyframes. Decrease speed by
movingonekeyframefartherawayfromtheother,orincreasespeedbymovingonekeyframeclosertotheother.
AFTER EFFECTS CS3
User Guide
213
Shorter temporal distance between keyframes increases layer speed.
•Apply the Easy Ease keyframe assistant, which automatically adjusts the speed of change as motion advances
toward and retreats from a keyframe.
See also
“Work with the Graph Editor” on page 184
“About animation, keyframes, and expressions” on page 183
Work with the speed graph
After you have set the shape of a motion path or created keyframes for a property, you can adjust the speed. Using
the speed graph, you can adjust the rate of change of a value.
Forexample,youcanchangethemotionofalayersothatitslowsjustbeforeakeyframeandthenspeedsupjustafter
the keyframe, or so that it moves quickly over a certain distance and then slows down smoothly. By adjusting the rise
and fall of the speed graph, you can control how fast or slow a value changes from keyframe to keyframe.
Note: Like the value graph, the speed graph displays x, y, and z (3D only) values in different colors: x values are red, y
values are green, and z values are blue.
You can control the values approaching and leaving a keyframe together, or you can control each value separately.
The incoming handle increases the speed or velocity when you drag it up, and decreases the speed or velocity when
you drag it down. The outgoing handle influences the next keyframe in the same way. You can also control the
influence on speed by dragging the handles left or right.
Direction handles in speed graphs
A. Incoming direction handle B. Speed control C. Outgoing direction handle
Note: If you want a handle to have influence over more than one keyframe, use roving keyframes.
A B C
AFTER EFFECTS CS3
User Guide
214
See also
“Work with the Graph Editor” on page 184
“Modify Bezier direction handles” on page 209
Adjust the rate of change with the speed graph
1In the Timeline panel, expand the outline for the keyframe you want to adjust.
2Click the Graph Editor button and select Edit Speed Graph from the Graph Options menu .
3Using the Selection tool, click the keyframe you want to adjust.
4(Optional) Do one of the following:
•To split the incoming and outgoing direction handles, Alt-drag (Windows) or Option-drag (Mac OS) a direction
handle.
•To join the direction handles, Alt-drag (Windows) or Option-drag (Mac OS) a split direction handle up or down
until it meets the other handle.
5Do any of the following:
•Drag a keyframe with joined direction handles up to accelerate or down to decelerate entering and leaving the
keyframe.
•Drag a split direction handle up to accelerate or down to decelerate the speed entering or leaving a keyframe.
•To increase the influence of the keyframe, drag the direction handle away from the center of the keyframe. To
decrease the influence, drag the direction handle toward the center of the keyframe.
Note: WhenyoudragadirectionhandlebeyondthetoporbottomoftheGraphEditorwithAutoZoomGraphHeight
on, After Effects calculates a new minimum or maximum value based on how far you dragged outside the graph,
and it redraws the graph so that all the values you specify for that layer property are visible in the graph by default.
Create a bounce or peak
Use direction handles to simulate the type of acceleration seen in a bouncing ball. When you create this type of effect,
the speed graph appears to rise quickly and peak.
1In the Timeline panel, expand the outline for the keyframe you want to adjust.
2Click the Graph Editor button and display the speed graph for the property.
3Make sure the interpolation method for the keyframe you want to peak is set to Continuous Bezier or Bezier.
4Drag the desired keyframe (with joined direction handles) up until it is near the top of the graph.
5Drag the direction handles on either side of the keyframe toward the center of the keyframe.
AFTER EFFECTS CS3
User Guide
215
Dragging direction handle to create a peak
Start or stop change gradually
Direction handles can create gradual starts and stops, such as a boat slowing to a stop and then starting again. When
you use this technique, the speed graph resembles a smooth U shape.
1In the Timeline panel, expand the outline for the keyframe you want to adjust.
2Click the Graph Editor button and display the speed graph for the property.
3Make sure the interpolation method for the keyframe you want to adjust is set to Continuous Bezier or Bezier.
4At the desired keyframe, drag the direction handle down until it is near the bottom of the graph.
5Drag the direction handles on either side of the keyframe away from the center of the keyframe.
Dragging the direction handle to make a gradual change
Adjust influence of a direction handle on an adjacent keyframe
Along with controlling the level of acceleration and deceleration, you can also extend the influence of a keyframe
outward or inward in relation to an adjacent keyframe. Influence determines how quickly the speed graph reaches
the value you set at the keyframe, giving you an additional degree of control over the shape of the graph. The
direction handle increases the influence of a keyframe value in relation to the neighboring keyframe when you drag
it toward the neighboring keyframe, and it decreases the influence on the neighboring keyframe when you drag it
toward the center of its own keyframe.
1In the Timeline panel, expand the outline for the keyframe you want to adjust.
AFTER EFFECTS CS3
User Guide
216
2Click the Graph Editor button and display the speed graph for the property.
3Using the Selection tool, click a keyframe and drag the direction handle left or right.
Change speed numerically
You may want to specify speed more precisely than you can by dragging keyframes in the speed graph. In such cases,
specify speed numerically in the Keyframe Velocity dialog box.
The options and units in the dialog box vary depending on the layer property you are editing and may also vary for
plug-ins.
1Display the speed graph for the keyframe you want to adjust.
2Select the keyframe you want to edit, and then choose Animation > Keyframe Velocity.
3Enter values for Speed for Incoming and Outgoing Velocity.
4Enter a value for Influence to specify the amount of influence toward the previous keyframe (for incoming inter-
polation) or the next keyframe (for outgoing interpolation).
5To create a smooth transition by maintaining equal incoming and outgoing velocities, select Continuous.
Note: Bydefault,theproportionsofthecurrentScaleorMaskFeathervaluesarepreservedasyoueditthevalues.Ifyou
don’twanttopreserveproportions,clickthelinkiconnexttothepropertyvaluesintheTimelinepaneltoremovetheicon.
See also
“Work with the Graph Editor” on page 184
“About animation, keyframes, and expressions” on page 183
Smooth motion with roving keyframes
Using the roving keyframe option in After Effects, you can easily create smooth movement across several keyframes
at once. Roving keyframes are keyframes that are not linked to a specific time; their speed and timing are determined
by adjacent keyframes. When you change the position of a keyframe adjacent to a roving keyframe in a motion path,
the timing of the roving keyframe may change.
Roving keyframes are available only for spatial layer properties such as Position. In addition, a keyframe can rove
only if it is not the first or last keyframe in a layer, because a roving keyframe must interpolate its speed from the
previous and next keyframes.
AFTER EFFECTS CS3
User Guide
217
The original motion path (top) shows different velocities between keyframes. After the keyframes are set to rove (bottom), the motion path
shows consistent speed over the range of keyframes.
1In layer bar mode or in the Graph Editor, set up the keyframes for the motion you want to smooth.
2Determine the beginning and ending keyframes for the range you want to smooth.
3Do one of the following:
•For every keyframe in the range (except the beginning and ending keyframes), select Rove Across Time in the
keyframe menu .
•SelectthekeyframesyouwanttoroveandchooseAnimation>KeyframeInterpolation.ThenchooseRoveAcross
Time from the Roving menu.
Theintermediatekeyframesadjusttheirpositionsonthetimeline to smooth the speed curve between the beginning
and ending keyframes.
Revert to a nonroving keyframe
•Select the roving keyframe option from the keyframe menu, or drag the roving keyframe left or right.
•Select the keyframes you want to change, and choose Animation > Keyframe Interpolation. Then choose Lock To
Time from the Roving menu.
Automatically ease speed
Although you can manually adjust the speed of a keyframe by dragging direction handles, using Easy Ease automates
the work.
After you apply Easy Ease, each keyframe has a speed of 0 with an influence of 33.33% on either side. When you ease
the speed of an object, for example, the object slows down as it approaches a keyframe, and gradually accelerates as
it leaves. You can ease speed when coming into or out of a keyframe, or both.
1In the Graph Editor or in layer bar mode, select a range of keyframes.
2Do one of the following:
•Choose Animation > Keyframe Assistant > Easy Ease (to ease speed coming both into and out of selected
keyframes), Easy Ease In (to ease speed coming into selected keyframes), or Easy Ease Out (to ease speed coming
out of selected keyframes).
AFTER EFFECTS CS3
User Guide
218
•Click the Easy Ease , Easy Ease In , or Easy Ease Out button located at the bottom of the Graph Editor.
Use Exponential Scale
You can simulate a realistic acceleration of a zoom lens when working with 2D layers by using Exponential Scale,
which converts linear scaling of a layer to exponential scaling. This is useful for creating a cosmic zoom, for example.
Zooming optically with a lens is not linear—the rate of change of scaling increases as you zoom. To simulate this
acceleration, Exponential Scale converts the velocity of the scaling to an exponential curve.
1In layer bar mode or in the Graph Editor, hold down the Shift key and select starting and ending keyframes for
the scale property.
2Choose Animation > Keyframe Assistant > Exponential Scale.
Note: Exponential Scale replaces any existing keyframes between the selected starting and ending keyframes.
Time-stretching and time-remapping
Time-stretch a layer
Speeding up or slowing down a layer is known as time-stretching. When you time-stretch a layer, the audio or the
original frames in the footage (and all keyframes that belong to the layer) are redistributed along the new duration.
Use this command only when you want the layer and all layer keyframes to change to the new duration.
Time-stretching a layer redistributes keyframes along the new duration.
AFTER EFFECTS CS3
User Guide
219
If you time-stretch a layer so that the resulting frame rate is significantly different from the original frame rate, the
quality of motion within the layer may suffer. For best results when time-remapping a layer, use the Timewarp effect.
See also
“Apply frame blending to a layer” on page 225
“Timewarp effect” on page 535
Time-stretch a layer from a specific time
1In the Timeline or Composition panel, select the layer.
2Choose Layer > Time > Time Stretch.
3Type a new duration for the layer, or type a Stretch Factor.
4To specify the point in time from which the layer will be time-stretched, click one of the Hold In Place options,
and then click OK.
Layer In-point Holds the layer’s current starting time, and time-stretches the layer by moving the Out point.
Current Frame Holds the layer at the position of the current-time indicator (also the frame displayed in the Compo-
sition panel), and time-stretches the layer by moving the In and Out points.
Layer Out-point Holds the layer’s current ending time and time-stretches the layer by moving the In point.
Time-stretch a layer to a specific time
1In the Timeline panel, move the current-time indicator to the frame where you want the layer to begin or end.
2Display the In and Out columns by choosing Columns > In and Columns > Out from the Timeline panel menu.
3Do one of the following:
•To stretch the In point to the current time, press Ctrl (Windows) or Command (Mac OS) as you click the In time
for the layer in the In column.
•To stretch the Out point to the current time, press Ctrl (Windows) or Command (Mac OS) as you click the Out
time for the layer in the Out column.
Time-stretch a layer but not its keyframes
When you time-stretch a layer, the positions of its keyframes stretch with it by default. You can circumvent this
behavior by cutting and pasting keyframes.
1Make a note of the time at which the first keyframe appears.
2In the Timeline panel, click the name of one or more layer properties containing the keyframes you want to keep
at the same times.
3Choose Edit > Cut.
4Move or stretch the layer to its new In and Out points.
5Move the current-time indicator to the time at which the first keyframe appeared before you cut the keyframes.
6Choose Edit > Paste.
AFTER EFFECTS CS3
User Guide
220
Reverse a layer’s playback direction
When you reverse a layer’s playback direction, all keyframes for all properties on the selected layer also reverse order.
The layer itself maintains its original In and Out points relative to the composition.
Note: For best results, precompose the layer and then reverse the layer inside the precomposition. This is the most
accurate way to reverse footage. For more information on this process, see “About nesting and precomposing” on
page 113.
1In a Timeline panel, select the layer you want to reverse.
2Choose Layer > Time > Time-Reverse Layer, or press Ctrl+Alt+R (Windows) or Command+Option+R (Mac OS).
Reverse keyframes without reversing layer playback
You can select and reverse keyframes across multiple layers and properties, but each set of keyframes for a property
is reversed only within its original time range and not that of any other selected property. Markers in the Timeline
panel are not reversed, so you might need to move markers after reversing keyframes.
1In the Timeline panel, select a range of keyframes you want to reverse.
2Choose Animation > Keyframe Assistant > Time-Reverse Keyframes.
About time-remapping
You can expand, compress, play backward, or freeze a portion of a layer’s duration using a process known as time-
remapping. For example, if you are using footage of a person walking, you can play footage of the person moving
forward, and then play a few frames backward to make the person retreat, and then play forward again to have the
person resume walking.
When you apply time-remapping to a layer containing audio and video, the audio and video remain synchronized.
You can remap audio files to gradually decrease or increase the pitch, play audio backward, or create a warbled or
scratchy sound. Still-image layers cannot be time-remapped.
Aharon Rabinowitz provides a tutorial that shows how to use time-remapping to do lip-synching; this same basic
concept can be used for many kinds of character animation: www.adobe.com/go/learn_ae_aharonlipsynch.
YoucanremaptimeineithertheLayerpanelortheGraphEditor.Remappingvideoinonepaneldisplaystheresults
in both. Each provides a different view of the layer duration:
•The Layer panel provides a visual reference of the frames you change, as well as the frame number. The panel
displays the current-time indicator and a remap-time marker, which you move to select the frame you want to play
at the current time.
AFTER EFFECTS CS3
User Guide
221
Layer panel for time remapping
A. Current-time indicator B. Time-remap value C. Remap-time marker D. Navigator bar
•The Graph Editor provides a view of the changes you specify over time by marking your changes with keyframes
and a graph similar to the one displayed for other layer properties.
When remapping time in the Graph Editor, use the values represented in the Time Remap graph to determine and
control which frame of the movie plays at which point in time. Each Time Remap keyframe has a time value
associated with it that corresponds to a specific frame in the layer; this value is represented vertically on the Time
Remap value graph. When you enable time remapping for a layer, After Effects adds a Time Remap keyframe at the
start and end points of the layer. These initial Time Remap keyframes have vertical time values equal to their
horizontal position on the timeline.
By setting additional Time Remap keyframes, you can create complex motion results. Each time you add a Time
Remap keyframe, you create another point at which you can change the playback speed or direction. As you move
the keyframe up or down in the value graph, you adjust which frame of the video is set to play at the current time.
After Effects then interpolates intermediate frames and plays the footage forward or backward from that point to the
next Time Remap keyframe. In the value graph, reading from left to right, an upward angle indicates forward
playback, while a downward angle indicates reverse playback. The amount of the upward or downward angle corre-
sponds to the speed of playback.
Time-remapping graph
A. No change B. Fast motion C. Freeze frame D. Backward motion
Similarly, the value that appears next to the Time Remap property name indicates which frame plays at the current
time. As you drag a value graph marker up or down, this value changes accordingly and a Time Remap keyframe is
set, if necessary. You can click this value and type a new one, or click and drag the value to adjust it.
ABC
D
CD
B
A
AFTER EFFECTS CS3
User Guide
222
Theoriginaldurationofthesourcefootagemaynolongerbevalidwhenremappingtime,becausepartsofthelayer
no longer play at the original rate. If necessary, set a new duration for the layer before you remap time.
Aswithotherlayerproperties,youcanviewthevaluesoftheTimeRemapgraphaseitheravaluegraphoraspeed
graph.
If you remap time and the resulting frame rate is significantly different from the original, the quality of motion within
the layer may suffer. Apply frame blending to improve slow- or fast-motion effects.
Note: Use the information shown in the Info panel to guide you as you work with time-remapping. The ratio given in
the units of seconds/sec indicates the current speed of playback—the number of seconds of the original layer being played
for each second after time-remapping.
See also
“About animation, keyframes, and expressions” on page 183
“Work with the Graph Editor” on page 184
Time-remap a layer
You can time-remap all or part of a layer. For example, you can time-remap a frame at the beginning or end of the
layer, creating a freeze-frame result, or you can time-remap frames in the middle of the layer, creating a slow-motion
result that only lasts for a few seconds.
See also
“About animation, keyframes, and expressions” on page 183
“Work with the Graph Editor” on page 184
Freeze the first frame without changing the speed
1In a Composition or Timeline panel, select the layer that you want to remap.
2Choose Layer > Time > Enable Time Remapping.
This adds two Time Remap keyframes by default, one at the beginning of the layer and one at the end.
3Move the current-time indicator to where you want the movie to begin.
4Click the Time Remap property name to select the start and end keyframes.
5Drag the first keyframe to the current-time indicator, which moves the start and end keyframes. (If you are
working in the Graph Editor, drag the bounding box—not the keyframe or a handle—so that both keyframes move.)
Freeze a frame in the middle of a layer’s duration
1In a Composition or Timeline panel, select the layer that you want to remap.
2Choose Layer > Time > Enable Time Remapping.
This adds two Time Remap keyframes by default, one at the beginning of the layer and one at the end.
3Move the current-time indicator to the frame that you want to freeze, and set a Time Remap keyframe at the
current time by clicking the keyframe navigator diamond for the Time Remap property.
4Select the last two Time Remap keyframes (the second and third keyframes) and drag them to the right.
5Press F2 to deselect the keyframes, and then click the second (middle) keyframe to select it.
AFTER EFFECTS CS3
User Guide
223
6Press Ctrl+C (Windows) or Command+C (Mac OS) to copy the keyframe.
7Press Ctrl+V (Windows) or Command+V (Mac OS) to paste the keyframe at the current time. You should not
have moved the current-time indicator since step 3.
8(Optional) To extend the layer so that its duration is increased to accommodate the time added by the freeze-
frame operation, press the K key twice to move the current-time indicator to the last Time Remap keyframe, and
press Alt+] (Windows) or Option+] (Mac OS).
Theportionofthelayerbetweenthefirstandsecondkeyframesplaysatanunalteredrate(thesameasforthenon-
time-remapped layer), as does the portion of the layer between the third and fourth keyframes. The second and third
keyframes are identical, so a single frozen frame plays during the time between those two keyframes.
Remap time using the Graph Editor
To switch between Graph Editor mode and layer bar mode, press Shift+F3.
1In a Composition or Timeline panel, select the layer you want to remap.
2Choose Layer > Time > Enable Time Remapping.
3In the Timeline panel, click the name of the Time Remap property to select it.
4Move the current-time indicator to the time at which to add a keyframe, and click the keyframe button in the
keyframe navigator to add a keyframe.
5In the Graph Editor, drag the keyframe marker up or down, watching the Time Remap value as you drag. To snap
to other keyframes, Shift-drag.
Dragging the keyframe down slows down the layer.
•To slow the layer down, drag the keyframe down. (If the layer is playing in reverse, drag up.)
•To speed the layer up, drag the keyframe up. (If the layer is playing in reverse, drag down.)
•To play frames backward, drag the keyframe down to a value below the previous keyframe value.
•To play frames forward, drag the keyframe up to a value above the previous keyframe value.
AFTER EFFECTS CS3
User Guide
224
•Tofreezethepreviouskeyframe,dragthecurrentkeyframemarkertoavalueequaltothepreviouskeyframevalue
so that the graph line is flat. Another method is to select the keyframe and choose Animation > Toggle Hold
Keyframe, and then add another keyframe where you want the motion to start again.
Before you move a time-remap keyframe, it’s a good idea to select all subsequent time-remap keyframes in the layer
first. This will preserve the timing of the rest of the layer when you remap time for the current keyframe.
Remap time in a Layer panel
1Open the Layer panel for the layer you want to remap.
2Choose Layer > Time > Enable Time Remapping. A second time ruler appears in the Layer panel above the default
time ruler and the navigator bar.
3On the lower time ruler, move the current-time indicator to the first frame where you want the change to occur.
4On the upper time ruler, the remap-time marker indicates the frame currently mapped to the time indicated on
the lower time ruler. To display a different frame at the time indicated on the lower time ruler, move the remap-time
marker accordingly.
Drag the remap-time marker to replace the frame at the current time marker.
5Move the current-time indicator on the lower time ruler to the last frame where you want change to occur.
6Move the remap-time marker on the upper time ruler to the frame you want to display at the time indicated on
the lower time ruler:
•To move the preceding portion of the layer forward, set the remap-time marker to a later time than the current-
time indicator.
•To move the preceding portion of the layer backward, set the remap-time marker to an earlier time than the
current-time indicator.
•To freeze a frame, set the remap-time marker to the frame you want frozen. Then, move the current-time indicator
(lower ruler) to the last point in time where the frame will appear frozen and move the remap-time marker again
to the frame you want frozen.
Time-remap audio pitch
The speed graph of the Time Remap property directly relates to the pitch of an audio file. By making subtle changes
to the speed graph, you can create a variety of interesting effects. To avoid screeching audio, you may want to keep
the Speed value below 200%. When the speed is too high, use the Levels controls, located under the Audio property,
to control the volume.
You may hear clicks at the beginning and end of an audio (or an audio and video) layer after setting new In and Out
points in the Time Remap graph. Use the Levels controls to remove these clicks.
AFTER EFFECTS CS3
User Guide
225
See also
“Preview video and audio” on page 120
Change the pitch of an audio layer
1In a Composition or Timeline panel, select the layer you want to remap.
2Choose Layer > Time > Enable Time Remapping.
3Click the Graph Editor button in the Timeline panel to display the Graph Editor, if necessary.
4Click the Choose Graph Type And Options button at the bottom of the Graph Editor and choose Edit Speed
Graph.
5Move the current-time indicator to the frame where you want change to begin, and then click the Add A Keyframe
button.
6On the speed graph below the keyframe, drag a marker, watching the Speed value as you drag.
•To lower the pitch, drag the speed graph marker down.
•To increase the pitch, drag the speed graph marker up.
Remove clicks from new In and Out points
1If necessary, choose panel > Audio.
2In the Timeline panel, select the audio (or audio and video) layer to which you applied time-remapping.
3Expand the layer outline to display the Audio property and then the Audio Levels property.
4Move the current-time indicator to the new In point and choose Animation > Add Audio Levels Keyframe.
5In the Audio panel, change the decibel value to 0.0.
6Press the Page Up key on your keyboard to move the current-time indicator to the previous frame.
7In the Audio panel, change the decibel level to -96.0.
8Move the current time to the new Out point and set the decibel level to 0.
9Press the Page Down key to move the current-time indicator to the next frame.
10 In the Audio panel, change the decibel level to -96.0.
You can change the decibel Slider Minimum value in the Audio Options dialog box, which is available from the
Audio panel menu.
Apply frame blending to a layer
When you time-stretch footage to a slower frame rate or to a rate lower than that of its composition, movement can
appear jerky. This jerky appearance results because the layer now has fewer frames per second than the composition.
Likewise, the same jerky appearance can occur when you time-stretch or time-remap footage to a frame rate that is
faster than that of its composition. To create smoother motion when you slow down or speed up a layer, use frame
blending.
After Effects provides two types of frame blending: Frame Mix and Pixel Motion. Frame Mix takes less time to
render, but Pixel Motion provides much better results, especially for footage that has been drastically slowed down.
Frame blending slows previewing and rendering. To speed things up, you can apply frame blending without using it
to redraw or render.
AFTER EFFECTS CS3
User Guide
226
The Quality setting you select also affects frame blending. When the layer is set to Best quality, frame blending results
in smoother motion but may take longer to render than when set to Draft quality.
Note: When working with a frame-blended layer in Draft mode, After Effects will always use Frame Mix interpolation
to increase rendering speed.
You can also enable frame blending for all compositions when you render a movie.
Use frame blending to enhance the quality of time-altered motion in a layer that contains live-action footage—video,
for example. You can apply frame blending to a sequence of still images, but not to a single still image. If you are
animating a layer—for example, moving a text layer across the screen—use motion blur.
1Select the layer in the Timeline panel.
2Do one of the following:
•Choose Layer > Frame Blending > Frame Mix.
•Choose Layer > Frame Blending > Pixel Motion.
A check mark by the appropriate Frame Blending command (Frame Mix or Pixel Motion) indicates that it is applied
to the selected layer. Also, the Frame Blending switch appears in the Switches column for the layer in the Timeline
panel. Remove frame blending either by clicking the Frame Blending switch or by choosing the appropriate Frame
Blending command again.
Regardless of the state of the layer switches, if frame blending is off for the composition, it is off for all layers in the
composition. You set frame blending for the composition by choosing Enable Frame Blending from the Timeline
panel menu, or clicking the Enable Frame Blending button at the top of the Timeline panel.
See also
“About animation, keyframes, and expressions” on page 183
“Layer image quality” on page 150
“Timewarp effect” on page 535
Animating with Puppet tools
About the Puppet tools
Use the Puppet tools to quickly add natural motion to raster images and vector graphics, including still images,
shapes, and text characters.
To see a video tutorial on using the Puppet tools, visit the Adobe website at www.adobe.com/go/vid0274.
Note: Though the Puppet tools work within an effect (the Puppet effect), you will seldom need to apply the effect using
the Effect menu or the Effects & Presets panel. Use the Puppet tools in the Tools panel to directly apply and work with
the effect in the Layer panel or Composition panel.
ThePuppeteffectworksbydeformingpartofanimageaccordingtothepositionsofpinsthatyouplaceandmove.
These pins define what parts of the image should move, what parts should remain rigid, and what parts should be in
front when parts overlap.
AFTER EFFECTS CS3
User Guide
227
Each Puppet tool is used to place and modify a specific kind of pin:
Puppet Pin tool Use this tool to place and move Deform pins.
Puppet Overlap tool Use this tool to place Overlap pins, which indicate which parts of an image should appear
in front of others when distortion causes parts of the image to overlap one another.
Puppet Starch tool
UsethistooltoplaceStarchpins,whichstiffenpartsoftheimagesothattheyaredistortedless.
Puppet mesh created by placing Deform pins (left), and result of dragging a Deform pin
When you place the first pin, the area within an outline is automatically divided into a mesh of triangles. An outline
is only visible when the Puppet effect has been applied and a Puppet tool pointer is over the area that the outline
defines. (See “How the Puppet effect creates outlines” on page 230.) Each part of the mesh is also associated with the
pixels of the image, so the image’s pixels move with the mesh.
Note: To show the mesh, select Show in the Tools panel.
WhenyoumoveoneormoreDeformpins,themeshchangesshapetoaccommodatethismovement,whilekeeping
the overall mesh as rigid as possible. The result is that a movement in one part of the image causes natural, life-like
movement in other parts of the image.
For example, if you place Deform pins in a person’s feet and hands and then move one of the hands to make it wave,
the motion in the attached arm will be large, but the motion in the waist will be small, just as in the real world.
If a single animated Deform pin is selected, its Position keyframes are visible in the Composition panel and Layer
panel as a motion path. You can work with these motion paths as you work with other motion paths, including
setting keyframes to rove across time. (See “Smooth motion with roving keyframes” on page 216.)
You can have multiple meshes on one layer. This is useful for deforming several parts of an image individually—such
as text characters—as well as for deforming multiple instances of the same part of an image, each with a different
deformation.
Theoriginal,undistortedmeshiscalculatedatthecurrentframeatthetimeatwhichyouapplytheeffect.Themesh
does not change to accommodate motion in a layer based on motion footage, nor does the mesh update if you replace
a layer’s source footage item.
Note: Because the render order for continuously rasterized layers—such as shape layers and text layers—is different than
the render order for raster layers, you should not animate the position or scale of a continuously rasterized layer with
layer transformations if you are also animating the layer with the Puppet tools. You can precompose the shape layer and
use the Puppet tools on the precomposition layer, or you can use the Puppet tools to transform the shapes within the layer.
(See “Render order and collapsing transformations” on page 115 and “Continuously rasterize a layer containing vector
graphics” on page 151.)
The motion created by the Puppet tools is sampled by motion blur if motion blur is enabled for the layer and the
composition, though the number of samples used is half of the value specified by the Samples Per Frame value. (See
“Use motion blur” on page 200.)
AFTER EFFECTS CS3
User Guide
228
You can use expressions to link the positions of Deform pins to motion tracking data, audio amplitude keyframes, or
any other properties.
Aharon Rabinowitz provides a tutorial that shows a creative way to use the Puppet tools with a particle generator to
simulate airflow over a car: www.adobe.com/go/learn_ae_aharonpuppetparticles.
See also
“Creating and modifying motion paths” on page 197
Manually animate an image with the Puppet tools
The stopwatch switch is automatically set for the Position property of a Deform pin as soon as the pin is created.
This means that a keyframe is set or modified each time that you change the position of a Deform pin. This is unlike
most properties in After Effects, for which you must explicitly set the stopwatch switch by adding a keyframe or an
expression to animate each property. The auto-animation of Deform pins makes it convenient to add them and
animate them in the Composition panel or Layer panel, without manipulating the properties in the Timeline panel.
1Select the layer that contains the image to animate.
2Using the Puppet Pin tool , do one of the following in the Composition panel or the Layer panel:
•Click any nontransparent pixel of a raster layer to apply the Puppet effect and create a mesh for the outline created
by auto-tracing the layer’s alpha channel.
•Click within a closed path on a vector layer to apply the Puppet effect and create a mesh for the outline defined by
that path.
•Click within a closed, unlocked mask to apply the Puppet effect and create a mesh for the outline defined by the
mask path.
•Click outside all closed paths on a vector layer to apply the Puppet effect without creating a mesh. Outlines are
createdforpathsonthelayer,thoughanoutlineisonlyvisiblewhenaPuppettoolpointerisovertheareathatthe
outlinedefines.Placethepointerovertheareaenclosedbyapathtoseetheoutlineinwhichameshwillbecreated
if you click that point. (See “How the Puppet effect creates outlines” on page 230.) Click within an outline to create
a mesh.
A Deform pin is placed where you clicked to create the mesh.
Note: If an image is too complex for the Puppet effect to generate a mesh with the current Triangle value, a “Mesh Gener-
ation Failed” message appears in the Info panel. Increase the Triangle value in the Tools panel and try again.
3Click in one or more places within the outline to add more Deform pins.
Use as few pins as possible to achieve your desired result. The natural deformation provided by the Puppet effect can
be lost if you over-constrain the image. Just add pins to the parts of the figure that you know that you want to control.
Forexample,whenanimatingapersonwaving,addapintoeachfoottoholdthemtotheground,andaddapinto
the waving hand.
4Go to another time in the composition, and move the position of one or more of the Deform pins by dragging
them in the Composition or Layer panel with the Puppet Pin tool. Repeat this step until you have completed your
animation.
You can modify the Deform pins’ motion paths as you would any other motion paths.
AFTER EFFECTS CS3
User Guide
229
See also
“Work with pins and the distortion mesh” on page 231
“Creating and modifying motion paths” on page 197
Record animation by sketching motion with the Puppet Pin tool
You can sketch the motion path of one or more Deform pins in real time—or at a speed that you specify—much as
you can sketch the motion path of a layer using Motion Sketch.
If your composition contains audio, you can sketch motion in time with the audio.
Before you begin recording motion, you may want to configure settings for recording. To open the Puppet Record
Options dialog box, click Record Options in the Tools panel.
Speed The ratio of the speed of the recorded motion to playback speed. If Speed is 100%, the motion is played back
at the speed at which it was recorded. If Speed is greater than 100%, the motion plays back slower than it was
recorded.
Smoothness Set this value higher to remove more extraneous keyframes from the motion path as it’s drawn.
Creating fewer keyframes makes motion smoother.
Use Draft Deformation The distorted outline that is shown during recording does not take Starch pins into account.
This can improve performance for a complex mesh.
Note: This procedure assumes that you have already placed Deform pins in the object to animate. For information on
placing Deform pins, see “Manually animate an image with the Puppet tools” on page 228.
1Select one or more Deform pins.
2Go to the time at which to begin recording motion.
3In the Composition panel or Layer panel, hold the Ctrl (Windows) or Command (Mac OS) key to activate the
Puppet Sketch tool. Ctrl-drag (Windows) or Command-drag (Mac OS) the pins to animate.
Recording of motion begins when you click to begin the drag. Recording ends when you release the mouse button.
Thecoloroftheoutlineforthemeshforwhichmotionisbeingsketchedisthesameasthecolorofthepin(yellow).
Reference outlines, for other meshes on the same layer, are the color of the layer’s label.
The current-time indicator returns to the time at which recording began, so that you can repeat the recording
operation with more Deform pins or redo the recording operation with the same pins.
You can modify the Deform pins’ motion paths as you would any other motion paths. A pin’s motion path is shown
only if it is the only pin selected.
Try creating several duplicate meshes and sketching motion for each mesh. When you have multiple meshes in the
same instance of the Puppet effect, you can sketch motion for one mesh while seeing the reference outlines of the
others, allowing you to follow their movements, either roughly or precisely.
See also
“Work with pins and the distortion mesh” on page 231
“Creating and modifying motion paths” on page 197
AFTER EFFECTS CS3
User Guide
230
How the Puppet effect creates outlines
When a Puppet mesh is created, its boundaries are determined by an outline, which can be defined by any of the
following types of closed paths:
•An unlocked mask path
•A shape path on a shape layer
•A text character’s outline
If a layer has no unlocked masks, shapes, or text characters on it when you apply the Puppet effect, it will use Auto-
trace to create paths from the alpha channel. These paths are only used by the Puppet effect in the determination of
outlines and do not appear as masks on the layer. If the layer is a raster layer with no alpha channel, the result is a
single rectangular path around the layer’s bounds. For a complex image, or to configure Auto-trace settings, use
Auto-trace before using the Puppet tools. (See “Create a mask from a channel with Auto-trace” on page 256.)
A text character that consists of multiple disjoint closed paths (such as the letter i) is treated as multiple separate
paths.
A shape or character’s stroke is not used in the determination of outlines; only the path is used. To encompass a stroke
within a mesh created from such items, increase the Expansion value. The default value of 3 pixels for Expansion
encompasses a stroke that extends 3 pixels or less from its path.
Apply paint strokes to a layer using the Brush tool with the Paint On Transparent option. This creates a raster layer
with only the paint strokes, defined by an alpha channel. You can then use the Puppet tools to animate the paint
strokes. Do not use a mask on the layer.
If multiple masks, shapes, or characters overlap on the same layer, an outline is created from the union of the
overlapping shapes, overlapping characters, or overlapping masks. If a mask overlaps a text character or shape,
outlinesarecreatedfortheentirecharacterorshape,fortheportionofthecharacterorshapethatisinsidethemask,
and for the mask itself.
To distort multiple disjoint characters or shapes as one object, surround the individual objects with a mask (with
maskmodesettoNone),andusethemaskpathastheoutlinewithwhichtocreatethemesh.Youcandeletethemask
after you have created the mesh.
If the Puppet effect has already been applied to a layer, outlines appear with a yellow highlight as you move a Puppet
tool pointer over them. You can choose the outline in which to place an initial pin to create a mesh. A mesh is created
each time that you click within an outline with a Puppet tool.
If the Puppet effect has not already been applied to a layer, outlines for that layer have not yet been calculated. When
you click, the Puppet effect calculates outlines and determines whether you have clicked within an outline. If so, it
creates a mesh defined by the outline in which you clicked. Otherwise, you can move the pointer around the layer to
select the outline in which to place a pin and create a mesh. This is very useful for seeing the outlines of various
objects and choosing which outlines to use to create a mesh.
Outline for union of two shape paths, indicated by yellow highlight, visible because Puppet tool pointer is within area defined by outline
AFTER EFFECTS CS3
User Guide
231
Work with pins and the distortion mesh
•To show the mesh for the Puppet effect, select Show in the options section of the Tools panel.
•To select or move a pin, click or drag it with the Move tool . To activate the Move tool, place the pointer on a
pin while either the Selection tool or the corresponding Puppet tool is active.
•To select multiple pins, Shift-click them, or use the marquee-selection tool to drag a marquee-selection box
around them. To activate the marquee-selection tool, place the pointer for a Puppet tool outside all meshes and
outlines or hold the Alt (Windows) or Option (Mac OS) key.
•To select all pins of one kind (Deform, Starch, or Overlap), select one pin of that kind and press Ctrl+A (Windows)
or Command+A (Mac OS).
•To delete selected pins, press the Delete key. If the pin has multiple keyframes, and only the keyframe at the current
time is selected, pressing Delete will delete only that keyframe; pressing Delete again will delete the pin.
•To reset Deform pins to their original locations at the current time, click Reset for the Puppet effect in the Timeline
panel or Effect Controls panel. To remove all pins and meshes from an instance of the Puppet effect, click Reset
again.
Sometimes, you want to animate an image from an initial position, through an intermediate position, and back to
the initial position. Rather than manually dragging the pins back to their initial positions at the end of the animation,
place the current-time indicator at the end time and click Reset. Only the keyframes at the current time are reset.
•To increase or decrease the number of triangles used in a mesh, modify the Triangle value in the options section
of the Tools panel or in the Timeline panel. This modifies the value for a selected mesh or, if no mesh is selected,
sets the value for meshes created later.
A higher number of triangles gives smoother results but takes longer to render. Small objects, like text characters,
usually distort well with only 50 triangles, whereas a large figure may require 500. The number of triangles used may
not match the Triangle value exactly; this value is a target only.
•To expand the mesh beyond the original outline, increase the Expansion property in the options section of the
Tools panel or in the Timeline panel. This modifies the value for a selected mesh or, if no mesh is selected, sets the
value for meshes created later. Expanding the mesh is useful for encompassing a path’s stroke.
•To duplicate an object using Puppet Pin tool, click within the original outline. This creates a new mesh, with its
own copy of the pixels from within the original outline. You can also duplicate a Mesh group in the Timeline panel
to achieve the same result, which is sometimes easier than clicking within the original outline without clicking on
the mesh to create a pin.
Puppet Overlap controls
When you are distorting one part of an image, you may want to control which parts of the image appear in front of
other parts. For example, you may want to keep an arm in front of the face as you make the arm wave. Use the Puppet
Overlap tool to apply Overlap pins to the parts of an object for which you want to control apparent depth.
You apply Puppet Overlap pins to the original outline, not to the deformed image.
AFTER EFFECTS CS3
User Guide
232
Overlap pin with positive In Front value (top), and Overlap pin with negative In Front value (bottom)
Each Overlap pin has the following properties:
In Front The apparent proximity to the viewer. The influence of Overlap pins is cumulative, meaning that the In
Front values are added together for places on the mesh where extents overlap. You can use negative In Front values
to cancel out the influence of another Overlap pin at a specific location.
Extent How far from the Overlap pin its influence extends. The influence ends abruptly; it does not decrease
graduallywithdistancefromthepin.Extentisindicatedvisuallybyafillintheaffectedpartsofthemesh.Thefillis
dark if In Front is negative; the fill is light if In Front is positive.
Puppet Starch controls
When you are distorting one part of an image, you may want to prevent other parts from being distorted. For
example, you may want to preserve the rigidity of an arm as you move a hand to make it wave. Use the Puppet Starch
tool to apply Starch pins to the part of an object that you want to keep rigid.
You apply Puppet Starch pins to the original outline, not to the deformed image.
AFTER EFFECTS CS3
User Guide
233
Unwanted distortion in figure (top left) is prevented with Starch pin (upper right and lower left)
Each Starch pin has the following properties:
Amount The strength of the stiffening agent. The influence of Starch pins is cumulative, meaning that the Amount
values are added together for places on the mesh where extents overlap. You can use negative Amount values to
cancel out the influence of another Starch pin at a specific location.
If you notice image tearing near a Deform pin, use a Starch pin with a very small Amount value (less than 0.1) near
the Deform pin. Small Amount values are good for maintaining image integrity without introducing much rigidity.
Extent HowfarfromtheStarchpinitsinfluenceextends.Theinfluenceendsabruptly;itdoesnotdecreasegradually
with distance from the pin. Extent is indicated visually by a pale fill in the affected parts of the mesh.
In addition to animating still images, you can use the Puppet effect on a layer with motion footage as its source. For
example, you could distort the contents of the entire composition frame to match the motion of an object within the
frame. In this case, consider creating a mesh for the entire layer, using the layer boundaries as the outline, and using
the Puppet Starch tool around the edges to prevent the edges of the layer from distorting.
234
Chapter 9: Color
Color basics
Set the color depth
Color depth (or bit depth) is the number of bits per channel (bpc) used to represent the color of a pixel. The more bits
for each RGB channel (red, green, and blue), the more colors can be represented.
In After Effects, you can work in 8-bpc, 16-bpc, or 32-bpc color.
In addition to bit depth, a separate characteristic of the numbers used to represent pixel values is whether the
numbers are integers or floating-point numbers. Floating-point numbers can represent a larger range of numbers
with the same number of bits. In After Effects, 32-bpc pixel values are floating-point values.
8-bpc pixels can have values for each color channel from 0 (black) to 255 (pure color). 16-bpc pixels can have values
for each color channel from 0 (black) to 32,768 (pure color). If all three color channels have the maximum, pure-
color value, the result is white. 32-bpc pixels can have values under 0.0 and values over 1.0 (pure color); this means
that 32-bpc color in After Effects is also high dynamic range (HDR) color. HDR values can be much brighter than
white. (See “High dynamic range color” on page 235.)
Glow effect and Gaussian Blur effect applied to image in 32-bpc project (left) and 16-bpc project (right)
Set the project color depth to 32 bpc to work with HDR footage or to work with over-range values—values above 1.0
(white) that aren’t supported in 8- or 16-bpc mode. Over-range values preserve the intensity of highlights, which is
just as useful for synthetic effects such as lights, blurs, and glows as it is for working with HDR footage. The headroom
provided by working in 32 bpc prevents many kinds of data loss during operations from color correction to color
profile conversion. Even if you’re using 8-bpc footage and are creating movies in 8-bpc formats, you can obtain better
results by having the project color depth set to 16 or 32 bpc. Working in a higher bit depth provides higher precision
for calculations and greatly reduces quantization artifacts, such as banding in gradients.
Because 16-bpc frames use half the memory of 32-bpc frames, rendering previews in a 16-bpc project is faster, and
RAM previews can be longer than in a 32-bpc project. 8-bpc frames use even less memory, but the tradeoff between
quality and performance can be quite visible in some images at a project color depth of 8 bpc.
•Alt-click (Windows) or Option-click (Mac OS) the Project Settings button in the Project panel.
•Choose File > Project Settings or click the Project Settings button in the Project panel, and choose a color depth
from the Depth menu.
AFTER EFFECTS CS3
User Guide
235
Project Settings button in the Project panel
You can specify a color depth for each render item, which overrides the project color depth when rendering for final
output. You can also specify the color depth to use for each output item in the output module settings.
Though many effects can work with all color depths, some effects work only with lower color depths. You can set the
Effects & Presets panel to only show effects that work with your current project color depth. (See “Effects & Presets
panel overview” on page 350.)
Note: To change the format in which color values are shown in the Info panel and in some effect controls, choose an
option such as Percent or Web from the Info panel menu. Choosing Auto Color Display automatically switches between
8 bpc, 16 bpc, and 32 bpc, depending on the project’s color depth.
See also
“Work with render settings” on page 597
“Work with output module settings” on page 599
High dynamic range color
The dynamic range (ratio between dark and bright regions) in the physical world far exceeds the range of human
vision and of images that are printed on paper or displayed on a monitor. Low dynamic range 8-bpc and 16-bpc color
values can represent RGB levels only from black to white; this represents an extremely small segment of the dynamic
range in the real world.
High dynamic range (HDR), 32-bpc floating-point color values can represent brightness levels much greater than
white, including objects as bright as a candle flame or the Sun.
Because we can see only a subset of the luminance values in a real-world scene in an HDR image on a monitor, it is
sometimes necessary to adjust the exposure, or the amount of light captured in an image, when working with an HDR
image. Adjusting the exposure of an HDR image is like adjusting the exposure when photographing a scene in the
real world, allowing you to bring detail out of very dark areas or very bright areas.
You can use the HDR Compander effect to compress the dynamic range of a layer with an HDR footage item as its
source. In this way, you can use tools that don’t support HDR, such as 8-bpc and 16-bit effects. When you’re done,
use the HDR Compander to undo the dynamic range compression. The HDR Highlight Compression effect lets you
compress the highlight values in an HDR image so that they fall within the value range of a low dynamic range image.
Jonas Hummelstrand’s website provides a collection of resources for understanding and using HDR color in After
Effects: www.adobe.com/go/learn_ae_jonas32bpc.
See also
“Adjust exposure for previews” on page 129
“Exposure effect” on page 397
“HDR Compander effect” on page 545
“HDR Highlight Compression effect” on page 546
AFTER EFFECTS CS3
User Guide
236
Select a color or edit a gradient
In many contexts, you can click an eyedropper button to activate the eyedropper tool, or you can click a color
swatch to open a color picker. If you use the Adobe Color Picker, you can also activate the eyedropper from the
Adobe Color Picker dialog box.
If you click a gradient swatch for a shape layer’s stroke or fill, or click Edit Gradient in the Timeline panel, the Adobe
Color Picker opens as the Gradient Editor, with additional controls for editing gradients included at the top of the
dialog box.
Note: The sampleImage expression samples the color values in a way similar to that of the eyedropper. Use this method
to use color values of specific pixels as input into an expression. (See “Layer General attributes and methods” on
page 570.)
A. Opacity stop B. Color stop C. Opacity midpoint D. Eyedropper E. New-color rectangle F. Original-color rectangle
Choose a color picker
❖Choose Edit > Preferences > General (Windows) or After Effects > Preferences > General (Mac OS), and do one
of the following:
•To use the color picker provided by the operating system, select Use System Color Picker.
•To use the Adobe Color Picker, deselect Use System Color Picker.
Select a color with the eyedropper tool
1Click the eyedropper button, and move the pointer to the pixel that you want to sample. The color swatch next to
the eyedropper button dynamically changes to the color under the eyedropper.
2Do one of the following:
•To select the color of a single pixel, click the pixel.
•To sample the color average of a 5-pixel-by-5-pixel area, Ctrl-click (Windows) or Command-click (Mac OS) the area.
Press the Escape key to deselect the eyedropper.
C
A
B
D
E
F
AFTER EFFECTS CS3
User Guide
237
Select a color with the Adobe Color Picker
1Click a color swatch to display the Adobe Color Picker.
2(Optional) To prevent panels from updating with the results of your color selection until you accept the color by
clicking OK, deselect Preview in the Color Picker dialog box. The Preview option is not available in all contexts.
Note: Selecting Preview is convenient for seeing the results of your color selections before you commit them, but it can
also decrease performance, as new images are rendered for the preview in the Composition panel or Layer panel.
3Select the component you want to use to display the color spectrum:
HDisplays all hues in the color slider. Selecting a hue in the color slider displays the saturation and brightness range
of the selected hue in the color spectrum, with the saturation increasing from left to right and brightness increasing
from bottom to top.
SDisplays all hues in the color spectrum with their maximum brightness at the top of the color spectrum,
decreasing to their minimum at the bottom. The color slider displays the color that’s selected in the color spectrum
with its maximum saturation at the top of the slider and its minimum saturation at the bottom.
B (in the HSB section) Displays all hues in the color spectrum with their maximum saturation at the top of the color
spectrum, decreasing to their minimum saturation at the bottom. The color slider displays the color that’s selected
in the color spectrum with its maximum brightness at the top of the slider and its minimum brightness at the bottom.
RDisplays the red color component in the color slider with its maximum brightness at the top of the slider and its
minimum brightness at the bottom. When the color slider is set to minimum brightness, the color spectrum displays
colors created by the green and blue color components. Using the color slider to increase the red brightness mixes
more red into the colors displayed in the color spectrum.
GDisplays the green color component in the color slider with its maximum brightness at the top of the slider and
its minimum brightness at the bottom. When the color slider is set to minimum brightness, the color spectrum
displays colors created by the red and blue color components. Using the color slider to increase the green brightness
mixes more green into the colors displayed in the color spectrum.
B (in the RGB section) Displays the blue color component in the color slider with its maximum brightness at the top
of the slider and its minimum brightness at the bottom. When the color slider is set to minimum brightness, the color
spectrum displays colors created by the green and red color components. Using the color slider to increase the blue
brightness mixes more blue into the colors displayed in the color spectrum.
4Do any of the following:
•Drag the triangles along the color slider, or click inside the color slider to adjust the colors displayed in the color
spectrum.
•Click or drag inside the large square color spectrum to select a color. A circular marker indicates the color's
position in the color spectrum.
Note: As you adjust the color using the color slider and color spectrum, the numeric values change to indicate the new
color. The top rectangle to the right of the color slider displays the new color; the bottom rectangle displays the original
color. Click the bottom rectangle to reset the color to the original color.
•For HSB, specify hue (H) as an angle, from 0˚ to 360˚, that corresponds to a location on the color wheel. Specify
saturation (S) and brightness (B) as percentages (0 to 100).
•For RGB, specify component values. You can set colors to under-range and over-range values (outside of the range
of 0.0 to 1.0) in an HDR project.
•For #, enter a color value in hexadecimal form. This color format is common in web workflows.
AFTER EFFECTS CS3
User Guide
238
Edit a gradient
A gradient is defined by color stops and opacity stops. Each stop has a location along the gradient and a value for color
or opacity. The values between stops are interpolated. By default, the interpolation is linear, but you can drag the
opacity midpoint or color midpoint between two stops to alter the interpolation.
•To add a color stop or opacity stop, click below or above the gradient bar in the Gradient Editor dialog box.
•To remove a stop, drag it away from the gradient bar, or select the stop and click Delete.
•To edit a stop’s value, select it and adjust the Opacity value or use the Adobe Color Picker controls beneath the
gradient editor controls.
•To choose a gradient type, click the Linear Gradient or Radial Gradient button in the upper-left corner of the
Gradient Editor dialog box.
Note: Use the Style property to choose a gradient type for the Gradient Overlay layer style.
About color correction and adjustment
When you assemble a composition, you often need to adjust the colors of one or more of the layers to correct their
colors. Such adjustments can be for any of a number of reasons. Some examples:
•You need to make it seem as if multiple footage items were shot under the same conditions so that they can be
composited or edited together.
•You need to adjust the colors of a shot so that it seems to have been shot at dusk instead of noon.
•You need to adjust the exposure of an image to recover detail from the over-exposed highlights.
•Youneedtoenhanceonecolorinashotbecauseyouwillbecompositingagraphicelementoveritwiththatcolor.
•You need to restrict colors to a particular range, such as the broadcast-safe range.
After Effects includes many built-in effects for color correction. See “Color Correction effects” on page 387.
The Color Finesse plug-in included with After Effects includes excellent color-correction tools. For more infor-
mation, see the Color Finesse documentation in the following folder: Adobe After Effects CS3/Additional
Documentation/Color Finesse 2.
The Camera Raw plug-in can be used to correct and adjust still images in JPEG, TIFF, and various camera raw
formats.
JohnDickinsonprovidesvisualaidsonhiswebsitethatillustratehowtousetheCurvesandLevelseffectsforcolor
adjustments: www.adobe.com/go/learn_ae_jdcurves and www.adobe.com/go/learn_ae_jdlevels.
See also
“Introduction to Camera Raw” on page 86
“Broadcast-safe colors” on page 250
About color spaces
Acolor model is a way of describing color using numbers so that computers can operate on them. The color model
used within After Effects is the RGB color model, in which each color is described in terms of amounts of red, green,
and blue light added together to make the color. Other color models include CMYK, HSB, Y'CbCr, and XYZ.
AFTER EFFECTS CS3
User Guide
239
Acolor space is a variant of a color model. A color space is distinguished by a gamut (range of colors), a set of primary
colors (primaries), a white point,andatone response. For example, within the RGB color model are a number of color
spaces, including—in decreasing order of gamut size—ProPhoto RGB, Adobe RGB, sRGB IEC61966-2.1, and Apple
RGB. Although each of these color spaces defines color using the same three axes (R, G, and B), their gamuts and
tone response curves are different.
HarryFrankprovidesavideotutorialthatshowshowandwhytousecolorconversionexpressionstoconvertcolors
from RGB to HSL when randomly varying colors; the specific example that he shows uses the Radio Waves effect:
www.adobe.com/go/learn_ae_harryrgb2hsl.
Though many devices use red, green, and blue components to record or express color, the components have different
characteristics—for example, one camera’s blue is not exactly the same as another camera’s blue. Each device that
records or expresses color has its own color space. When an image moves from one device to another, image colors
may look different because each device interprets the RGB values in its own color space.
Color management uses color profiles to convert colors from one color space to another, so colors look the same
from one device to another.
For information on color spaces and color management in After Effects, go to the Adobe website at
www.adobe.com/go/learn_ae_colormanagementpaper.
See also
“Color management” on page 241
About gamma and tone response
A color space’s tone response is the relationship of light intensity to the signal that creates or records (perceives) the
light.
The human visual system does not respond linearly to light. In other words, our perception of how bright a light is
does not double when twice as many photons hit our eyes. Similarly, a CRT monitor’s display elements do not emit
light that is twice as bright when a voltage twice as great is applied. The relationship of light intensity to signal
intensity for a display device is expressed by a power function. The exponent of this power function is called gamma.
The relationship of light intensity to signal intensity for an input device is the inverse of the relationship for an output
device, though the gamma values may differ for input and output devices to accommodate the difference between
scene lighting and lighting of the viewing environment.
Raising any number to the power of 1 gives the original number as a result. A gamma of 1.0 is used to express the
behavior of light in the natural world, outside the context of our nonlinear perceptual systems. A system with gamma
of 1.0 is sometimes said to operate in linear light, whereas a system encoded with a gamma other than 1.0 to match
the human visual system is said to be perceptual.
Note: Moving the midtone slider (such as the Levels effect’s Gamma control) in a color-correction histogram has the same
result as modifying gamma, changing the tone response curve without moving the white point. Modifying the curve in
the Curves effect also modifies tone response, but not necessarily with a gamma curve.
If you have enabled color management (by specifying a working color space), you can perform all color operations
in linear light by linearizing the working color space. A linearized color space uses the same primaries and white
point as the nonlinear version; the tone response curve is just made straight.
If you have not enabled color management, you can still perform blending operations using a gamma of 1.0.
AFTER EFFECTS CS3
User Guide
240
The gamma value for an entire system—from capture, through production, to display in the viewing environment—
is the product of the gamma values used for each of the phases in the system. This product is not always 1.0, as it
would be if the operations performed for encoding exactly matched (inverted) the operations performed for
decoding. One reason for a system gamma other than 1.0 is that there is often a difference between the lighting
conditions in which a scene is captured and the lighting conditions in which it is viewed. (Consider that you usually
watch a movie in a dim environment, but the scenes aren’t normally shot in a dim environment.)
For example, the device gamma for an HD camera is approximately 1/1.9, and the device gamma for an HD display
is approximately 2.2. Multiplying these values gives a system gamma of approximately 1.15, which is appropriate for
the somewhat dim television viewing conditions of a typical living room. The system gamma for motion picture
production is much higher (approximately 1.5–2.5) to accommodate the darker viewing environment of a movie
theater. The gamma for the film negative is approximately 1/1.7, and the gamma for the projection film is approxi-
mately 3–4.
QuickTime and gamma in non-color-managed projects
After Effects 7.0 and earlier used QuickTime codecs to decode several kinds of media, and the gamma adjustments
performed by QuickTime on Windows were different from the gamma adjustments performed on Mac OS. The
gamma adjustments performed by After Effects CS3 differ from the gamma adjustments performed by these
QuickTime codecs. Gamma adjustments performed by After Effects CS3 on Windows are the same as gamma
adjustments performed by After Effects CS3 on Mac OS. Also, by not using QuickTime codecs, After Effects
preserves over-range values in 32-bpc projects.
Select Match Legacy After Effects QuickTime Gamma Adjustments in the Project Settings dialog box to accomplish
any of the following:
•Avoid color shifts when working with projects created in After Effects 7.0 or earlier
•Match the colors in a project created in After Effects 7.0 or earlier
•Ensure that colors in Composition panel match colors in QuickTime player
The Match Legacy After Effects QuickTime Gamma Adjustments option is selected by default for projects created
in After Effects 7.0 or earlier. You should create new projects without this option selected.
Note: On Mac OS running on a PowerPC processor, QuickTime codecs are used for some formats (including DV, 2vuy,
and v210), whether or not you select Match Legacy After Effects QuickTime Gamma Adjustments. However, selecting
this option does modify the gamma adjustments used so that they match the behavior of After Effects 7.0 and earlier.
Important: Install the most recent updates for After Effects CS3. Versions 8.0.0 and 8.0.1 of After Effects CS3 do not
correctly export data for some QuickTime RGB codecs.
For current and detailed information on issues related to QuickTime Player and gamma adjustments, go to the
Adobe website at www.adobe.com/go/learn_ae_quicktimegamma.
Mark Christiansen has a blog post about QuickTime and gamma:
www.adobe.com/go/learn_ae_markquicktimegamma.
See also
“Linearize working space and enable linear blending” on page 244
AFTER EFFECTS CS3
User Guide
241
Color management
Why you should use color management
To see a video tutorial on color management in After Effects, go to the Adobe website at
www.adobe.com/go/vid0260.
For step-by-step instructions on using color management to create movies for Flash, HDTV, motion-picture film,
and other common media, go to the Adobe website at www.adobe.com/go/learn_ae_colormanagementpaper.
Color management provides many benefits, including the following:
•The colors in imported images appear as the creators of the images intended.
•You have more control over how colors are blended within your project, for everything from motion blur to anti-
aliasing.
•The movies that you create will look as you intend when viewed on devices other than your computer monitor.
If you don’t enable color management for your project, then the colors in your composition are dependent on the
color characteristics of your monitor: the colors that you see are the colors that your monitor displays based on RGB
numbers in your footage items. Because different color spaces use the same RGB numbers to represent different
colors, the colors that you see and composite may not be the colors that the creator of the footage intended. In fact,
the colors may be very far from the intended colors.
By setting a working color space for the project (which enables color management), you do two things:
•You define a common color space for compositing and other color operations.
•You control the appearance of colors in your composition.
If a footage item has an embedded color profile (for example, the footage item is a Photoshop PSD file), then the
colors intended by the person who created the image can be accurately reproduced in your composition. The color
profile contains the information that determines how to convert the RGB numbers in the image file into a device-
independent color space; the monitor’s color profile can then be used to determine which RGB numbers in your
monitor’scolorspacerepresentthecolorsintendedforthefootageitem.Thisbecomesevenmoreimportantasyou
import footage items with many different color profiles, from many different sources.
The color conversion process takes no effort on your part. The colors simply appear on your monitor just like they
appeared when the image was created. Your monitor may, of course, have a limited gamut compared to the color
space that you choose for the working space, and colors can be clipped when displayed on the monitor. However, you
still have the full range of color data in your project, and the colors are not clipped internally.
When you are ready to output your composition, you can use color management to transform your colors into the
space appropriate for your output media. At this stage, you are preserving the appearance of colors as you intend
them to look.
Be sure to read the helpful text in the Interpret Footage, Project Settings, and Output Module Settings dialog boxes.
This text helps you to understand the color conversions that will be done as you interpret footage, composite, and
output rendered movies.
See also
“About color spaces” on page 238
AFTER EFFECTS CS3
User Guide
242
Color management and color profiles
Color information is communicated using numbers. Because different devices use different methods to record and
display color, the same numbers can be interpreted differently and appear to us as different colors. A color
management system keeps track of all of these different ways of interpreting color and translates between them so
that images can look the same regardless of the device used to display them.
In general, a color profile is a description of a device-specific color space in terms of the transformations required to
convert its color information to a device-independent color space.
In the specific case of working within After Effects, ICC color profiles are used to convert to and from the working
color space in the following general workflow:
1An input color profile is used to convert each footage item from its color space into the working color space. A
footage item may contain an embedded input color profile, or you can assign the input color profile in the Interpret
Footage dialog box or interpretation rules file.
2After Effects performs all of its color operations in the working color space. You assign a working color space in
the Project Settings dialog box.
3Colors are converted from the working color space to the color space of your computer monitor through the
monitor profile. This means that your composition will look identical on two different monitors, as long as the
monitors have been properly profiled. This conversion does not change the data within the composition. You can
choose whether to convert colors for your monitor using the View > Use Display Color Management menu
command.
4Optionally, After Effects uses a simulation profile to show you on your computer monitor how the composition
will look in its final output form on a different device. You control output simulation for each view through the View
> Simulate Output menu.
5An output color profile for each output module is used to convert the rendered composition from the working
color space to the color space of the output medium. You choose an output color profile in the Output Module
Settings dialog box.
The file format for color profiles is standardized by the ICC (International Color Consortium), and the files that
contain them usually end with the .icc filename extension. After Effects comes with a large number of color profiles
for color spaces for common (and some not so common) input and output types.
For information on color profiles, see the International Color Consortium website at www.color.org.
After Effects loads color profiles from multiple locations, including the following:
•Mac OS: Library/ColorSync/Profiles
•Windows: WINDOWS\system32\spool\drivers\color
When you create or install new profiles, put them in these folders. You can create a custom ICC profile using Adobe
Photoshop.
When you choose a profile—for input, output, or simulation—you will not see the motion-picture film profiles
unless your footage is Cineon footage or you select Show All Available profiles. If your footage is Cineon footage, you
will see only the motion-picture film profiles, unless you select Show All Available Profiles.The DPX Theater Preview
and DPX Standard Camera profiles provided by After Effects 7 for use with the Proof Colors command have been
replaced by the Kodak 2383 and Kodak 5218 profiles used with the Simulate Output command. Proof Colors has
been replaced by Output Simulation. (See “Simulate how colors will appear on a different output device” on
page 248.) If you open an After Effects 7 project that uses DPX Scene and DPX Theater color profiles in the Color
AFTER EFFECTS CS3
User Guide
243
ProfileConvertereffect,AfterEffectsCS3willnotautomaticallyupdatetheseprofilestothenewequivalentprofiles
(Kodak 5218/7218 Printing Density and Kodak 2383 Theater Preview). Instead, the profiles will be listed as
Embedded. You can convert your project by manually assigning the new profiles in After Effects CS3. However, if
the same profiles were assigned to the footage or selected in Proof Colors in After Effects 7, they will be automatically
updated to the new profiles in After Effects CS3.
Note: The NTSC (1953) color profile corresponds to obsolete television equipment and should not be used. For standard-
definition NTSC television, use one of the SDTV NTSC color profiles.
Make sure that your work environment provides a consistent light level and color temperature. For example, the color
characteristics of sunlight change throughout the day, which can alter the way colors appear on your screen, so keep
shades closed or work in a windowless room.
All color profiles used in a project are saved in the project, so you do not need to manually transfer color profiles
from one system to another to open the project on another system.
See also
“Interpret footage items” on page 51
Calibrate and profile your monitor
When you calibrate your monitor, you’re adjusting it so that it conforms to a known specification. After your monitor
is calibrated, the profiling utility lets you save a color profile. The profile describes the color behavior of the
monitor—what colors can be reproduced on the monitor and how the color values in an image must be converted
so that colors are displayed accurately.
Note: Monitor performance changes and declines over time; recalibrate and profile your monitor every month or so. If
you find it difficult or impossible to calibrate your monitor to a standard, it may be too old and faded.
1Make sure that your monitor has been turned on for at least half an hour. This gives it sufficient time to warm up
and produce more consistent output.
2Make sure that your monitor is displaying millions of colors (24 bits per pixel) or higher.
3If you do not have profiling software that uses a hardware measuring device, remove colorful background patterns
on your monitor desktop and set your desktop to display neutral grays. Busy patterns or bright colors surrounding
a document interfere with accurate color perception.
4Do one of the following to calibrate and profile your monitor:
•For best results, use third-party software and measuring devices. In general, using a measuring device such as a
colorimeteralongwithsoftwarecancreatemoreaccurateprofilesbecauseaninstrumentcanmeasurethecolors
displayed on a monitor far more accurately than the human eye can.
Most profiling software automatically assigns the new profile as the default monitor profile. For instructions on how
to manually assign the monitor profile, refer to the Help system for your operating system.
•In Mac OS, use the Calibrate utility, located in the System Preferences > Displays > Color tab.
Choose a working color space and enable color management
You turn color management on for a project by choosing a working color space (Working Space) in the Project Settings
dialog box. You control color management for each footage item with the Interpret Footage dialog box or interpretation
rules file. You control color management for each output item in the Output Module Settings dialog box.
If Working Space is set to None in the Project Settings dialog box, color management is off for the project.
AFTER EFFECTS CS3
User Guide
244
Choosing a working color space is an essential step in managing color in a project. Footage items’ colors are
converted into the working color space as a common color space for compositing.
For best results, when working with 8-bpc color, match the working color space to the output color space. If you are
outputting to more than one output color space, you should set the project color depth to 16 or 32 bpc, at least for
rendering for final output. The working color space should match the output color space that has the largest gamut.
For example, if you plan to output to Adobe RGB and sRGB, then use Adobe RGB as your working color space,
because Adobe RGB has a larger gamut and can therefore represent more saturated colors. To preserve over-range
values, work in 32-bpc color for its high dynamic range.
Suggestions for color working space choices:
•SDTV NTSC or SDTV PAL is a good choice if you’re making a movie for standard-definition broadcast television,
including standard-definition DVD.
•HDTV (Rec. 709) is a good choice if you’re making a movie for high-definition television. This color space uses
the same primaries as sRGB, but it has a larger gamut, so it makes a good working space for many kinds of work.
•ProPhoto RGB with a linear (1.0) gamma is a good choice for digital cinema work.
•sRGB IEC61966-2.1 is a good choice if you’re making a movie for the Web, especially cartoons.
The color spaces available in After Effects vary based on the color profiles installed on your computer.
1Choose File > Project Settings.
2Choose a working color space from the Working Space menu.
Previews sent to an external video monitor are not color managed. The color values sent to the video monitor are
from the project’s working color space. To preview video colors, choose a value for Working Space in the Project
Settings dialog box that matches the color space of the preview device.
Similarly, colors in a composition sent to Adobe Premiere Pro or Encore using Dynamic Link are in the After Effects
project’s working color space. To manage colors in a dynamically linked composition, create a new composition and
nest your composition within it; then apply the Color Profile Converter effect to the containing composition, with
Input Profile set to Project Working Space.
See also
“About color spaces” on page 238
“Set the color depth” on page 234
Linearize working space and enable linear blending
If you have enabled color management (by specifying a working color space), you can perform all color operations
in linear light by linearizing the working color space. A linearized color space uses the same primaries and white
point as the nonlinear version; it just doesn’t use a tone response curve. (See “About gamma and tone response” on
page 239.)
If you have not enabled color management, you can still perform blending operations using a gamma of 1.0.
By performing operations in a linear color space, you can prevent certain edge and halo artifacts, such as the fringing
that appears when high-contrast, saturated colors are blended together. Many color operations benefit from working
in a linear color space, including those involved in image re-sampling, blending between layers with blending modes,
motion blur, and anti-aliasing.
AFTER EFFECTS CS3
User Guide
245
Stu Maschwitz's blog has several posts that are useful for learning about how, when, and why to work in a linear color
space versus a non-linear color space. In this post, he lists several categories of color operations and whether they
should be performed in a linear or non-linear working color space: www.adobe.com/go/learn_ae_stuloglin.
If you want to use a linearized working color space, do so when you set up the project, instead of switching later.
Otherwise, colors chosen in the color picker will change when you switch to a linear working color space, because
colors inside After Effects are interpreted to be in the working color space.
Note: Alinearizedworkingcolorspaceworksbestwithhighercolordepths,16bpcand32bpc,andisnotrecommended
for 8 bpc color.
❖Choose File > Project Settings, and do one of the following:
•To linearize the working color space, choose Linearize Working Space.
•To blend colors in a linear color space, choose Blend Colors Using 1.0 Gamma. This affects only blending between
layers. The result is that opacity fades, motion blur, and other features that rely on blending modes are affected.
See also
“Blending modes” on page 163
Interpret a footage item by assigning an input color profile
You control color management for each footage item using the Interpret Footage dialog box.
You can prevent the conversion of colors into the working color space for a single footage item by selecting Preserve
RGB in the Color Management tab of the Interpret Footage dialog box. This option preserves RGB numbers; color
appearance is not preserved. Turning off color management for a specific footage item is useful when the footage item
is not intended for visual display, but is instead intended for use as a control layer—for example, a displacement map.
The input color profile determines what calculations are performed when converting the footage item’s colors into
the project’s working color space. If a working space has not been set—that is, if color management is not on for the
project—then you cannot assign an input color profile.
In some cases, files that you import will have ICC profiles embedded in them. When you import these files, you can
beconfidentthatthecolorsthatyouseeareastheproducerofthefootageoriginallyintended.AfterEffectscanread
and write embedded color profiles for Photoshop (PSD), TIFF, PNG, and JPEG files.
Ifafootageitemdoesnothaveanembeddedcolorprofile,youcanassignaninputcolorprofileusingtheInterpret
Footage dialog box or by adding or modifying a rule in the interpretation rules file (interpretation rules.txt). After
Effects interprets the footage item as if the source footage was created using this color profile, so be certain to assign
a profile that matches (or at least approximates) that used to create the source footage.
Non-RGB footage items (e.g., CMYK, Y'CbCr, and camera raw images) cannot be assigned an input profile. Their
native color space is displayed in the Interpret Footage dialog box. Conversion of non-RGB color values to RGB color
values is handled automatically for each format.
If you don’t assign an input color profile, and After Effects doesn’t have a rule in the interpretation rules file with
which to make an interpretation, the footage item’s colors are assumed to be in the project’s working color space.
When color management is enabled, a footage item’s input color profile is shown in the information area at the top
of the Project panel.
AFTER EFFECTS CS3
User Guide
246
The Interpret As Linear Light option determines whether the assigned input color profile is interpreted as being
linear (gamma equals 1.0). This option also works when color management is turned off for the project. (See “About
gamma and tone response” on page 239.)
1Select a footage item in the Project panel.
2Choose File > Interpret Footage > Main.
3In the Color Management tab of the Interpret Footage dialog box, choose a value from the Assign Profile menu.
If you don’t see the profile that you want in the Assign Profile menu, select Show All Available Profiles.
4Read the information in the Description area of the dialog box to confirm that the conversion is the one that you
want, and click OK.
See also
“Interpret footage items” on page 51
“Introduction to Camera Raw” on page 86
Assign an output color profile
You control color management for each output item using the Output Module Settings dialog box.
Important: When you export to Flash SWF format, you use the Export menu, not the Render Queue panel, so the
output module settings are not available for this output type. If color management is enabled for the project, After Effects
automatically converts colors from the project’s working color space to the sRGB IEC61966-2.1 color space when
exporting to SWF.
You can prevent the conversion of colors from the working color space for a single output item by selecting Preserve
RGBintheColorManagementtaboftheOutputModuleSettingsdialogbox.ThisoptionpreservesRGBnumbers;
color appearance is not preserved. Turning off color management for a specific footage item is useful when the
footage item is not intended for visual display, but is instead intended for use as a control layer—for example, a
displacement map.
The output color profile for a render item determines what calculations are performed when converting a rendered
composition’s colors from the project’s working color space to the color space for the output medium. If a working
space has not been set—that is, if color management is not on for the project—then you cannot assign an output
color profile.
For example, after creating a movie in an HDTV (Rec. 709) working color space for output to film, you likely want
to output to a log-encoded Cineon/DPX color space using a film output color profile. If, on the other hand, you’re
creating a movie for high-definition television, you should choose an HDTV (Rec. 709) output profile.
Arenderitem’soutputcolorprofileispartofanoutputmoduleandisdisplayedintheoutputmodulegroupinthe
Render Queue panel. You can assign multiple output modules to one render item, each with its own output color
profile, allowing you to create output movies for various media from one rendered movie.
TheConvertToLinearLightoptiondetermineswhetherthecolorsareoutputtoalinearcolorprofile(gammaequals
1.0). It is seldom a good idea to output to linear light for 8-bpc or 16-bpc color, so the default setting for Convert To
Linear Light is On For 32 bpc. (See “About gamma and tone response” on page 239.)
Some file formats—such as Photoshop (PSD), PNG, TIFF, and JPEG—allow for the embedding of a color profile. If
youembedacolorprofileinanoutputfile,thenyoucanbemorecertainthatprogramsthatusethefilewillcorrectly
interpret its color information.
AFTER EFFECTS CS3
User Guide
247
After Effects chooses a rendering intent based on the output color profile that you choose. For most output types,
the rendering intent is relative colorimetric (with black point compensation); for output to film negative, the
rendering intent is absolute colorimetric.
1Click the underlined text next to the render item’s Output Module heading in the Render Queue panel.
2In the Color Management tab of the Output Module Settings dialog box, choose a value from the Output Profile menu:
sRGB IEC61966-2.1 For display in web browsers and other web-based environments.
SDTV NTSC or SDTV PAL For display on standard-definition television. If luma levels are not adjusted by the codec
you are using, choose a 16-235 profile to compress luma levels.
Kodak 5218/7218 Printing Density
For film-out corresponding to the scene capture of Kodak 5218 camera negative film.
Ifyoudon’tseetheprofilethatyouwantintheOutputProfilemenu,selectShowAllAvailableProfiles.Thisoption
shows the motion-picture film color profiles.
3Read the information in the Description area of the dialog box to confirm that the conversion is the one that you
want, and click OK.
See also
“Work with output module settings” on page 599
“Render and export a movie using the render queue” on page 590
Enable or disable display color management
When color management is on, the default behavior is for RGB pixel values to be converted to your computer
monitor’s color space from the project’s working color space. Color appearance is preserved; RGB numbers are not
preserved. This is adequate for most uses, but you sometimes need to see how the colors are actually going to look
when viewed through a system that does not use color management. For example, you may need to see how the
colors will appear when viewed in a web browser.
When display color management is off, the RGB color values are sent directly to your monitor, without any
conversion through the monitor profile. RGB numbers are preserved; color appearance is not preserved.
When display color management is on for a viewer, a yellow plus sign appears in the Show Channel button at the
bottom of the viewer.
For each viewer (Composition, Layer, or Footage panel), you can choose whether to manage display colors, which
involves the conversion of colors from the working color space to the monitor’s color space.
1Activate a Composition, Layer, or Footage panel.
2Do one of the following to toggle between enabling and disabling display color management:
•Choose View > Use Display Color Management.
•Press Shift+/ (on the numeric keypad).
Output simulation settings (including No Output Simulation) are remembered.
See also
“Work with viewers” on page 19
“Previewing” on page 120
AFTER EFFECTS CS3
User Guide
248
Simulate how colors will appear on a different output device
Often, you need to preview how a movie will appear on a device other than your computer monitor. One purpose of
color management is to ensure that colors look the same on every device, but color management in After Effects can’t
overcome scenarios like the following:
•An output device for which you’re creating your movie has a smaller gamut than your project’s working color
space, so the device is unable to represent some colors.
•The colors in your movie are displayed by a device or software that does not use color management to convert
colors.
Forexample,whenyouarecreatingamovieonWindows,youmaywanttoseehowthemoviewilllookonMacOS
without color management. (Colors tend to look lighter on computer systems running Mac OS.) An even more
extreme example: When you are creating a movie using a computer monitor and a high-definition video monitor,
you may need to see how the movie will look when transferred to a specific film stock and projected under standard
theater viewing conditions.
In situations like these, you’ll want to preview how colors will appear when they’re displayed on a device other than
your computer monitor. Output simulation requires display color management.
During output simulation, colors are converted from the project’s working color space to the monitor’s color space
through the following flow:
1. Colors are converted from project’s working color space to output color space. Colors are converted from the
workingcolorspacetothecolorspaceoftheoutputtypeusingtheoutputcolorprofile(thesameprofilethatwillbe
used for rendering to final output).
2. Colors are converted from output color space to simulated playback device’s color space. If Preserve RGB is not
selected, colors are converted from the output color space to the color space of the presentation medium using the
simulation profile. This presumes that the simulated device also performs color management and will convert colors
for display. Color appearance is preserved; RGB numbers are not preserved.
IfPreserveRGBisselected,thecolorvaluesarenotconvertedinthisstep.Instead,thenumericalRGBcolorvalues
are preserved and are re-interpreted to be in the color space of the simulated device. One use of this simulation is to
see how a movie will look when played back on a device other than the one for which it was intended or a device that
does not perform color management.
Note: Preserve RGB is also used when simulating the combination of a capture film stock and a print film stock.
3. Colors are converted from simulated playback device’s color space to your monitor’s color space Colors are
converted from the presentation device color space to the color space of your computer monitor using the monitor
profile.
When you create an output simulation preset, you can choose a profile to use for each of these steps.
Even if you’re using a preset output simulation, you can choose the Custom option in the View > Simulate Output
menu after selecting the preset to see a representation of which color conversions and reinterpretations are occurring
for that simulation type.
Output simulation applies only to a specific viewer (Composition, Layer, or Footage panel) and works only for
previews. Color conversions for output simulation are performed when values are sent to the display. Actual color
numbers in the project are not changed.
As with all color space conversions, simulating output decreases performance somewhat, so you may not want to
simulate output when performing tasks that require real-time interaction.
AFTER EFFECTS CS3
User Guide
249
Note: Merely applying the correct profiles can’t compensate for different color gamuts for different devices. For example,
common LCD monitors do not have the gamut necessary to fully simulate HDTV output.
You can press Shift+/ (on the numeric keypad) to turn display color management on or off. Turning display color
management off also turns output simulation off. Simulation settings (including No Output Simulation) are remem-
bered.
See also
“Previewing” on page 120
“Color Profile Converter effect” on page 543
Simulate output for previews
1Activate a Composition, Layer, or Footage panel.
2Choose View > Simulate Output, and choose an output type to simulate.
Note: Output simulation relies on display color management, which is on by default. If display color management is off,
choose View > Use Display Color Management.
No Output Simulation Display color management is on, but no conversion is performed to simulate an output type.
Macintosh RGB Show how colors will appear when displayed by a non–color managed application on a Macintosh
computer (with a gamma of 1.8). This option is not available if Linearize Working Space is selected.
Windows RGB Show how colors will appear when displayed by a non–color managed application on Windows (with
a gamma of 2.2). This option is not available if Linearize Working Space is selected.
Kodak 5218 To Kodak 2383 Show how colors will appear when output to the Kodak 5218 negative film stock and
then projected from Kodak 2383 positive film stock in a theater environment.
Note: The DPX Theater Preview and DPX Standard Camera profiles provided by After Effects 7.0 for use with the Proof
Colors command have been replaced by the Kodak 2383 and Kodak 5218 profiles used with the Simulate Output
command.
Custom If you don’t see an entry for the output type that you want to simulate, you can create your own output
simulation preset by choosing Custom. You can specify a profile to use for each of the conversion or reinterpretation
steps.
•To preview how a movie will look if you output the movie to a device and view it on that device, use the same value
for Output Profile and Simulation Profile.
•To preview how a movie will look if you output the movie to one device and then view it on another, color-
managed device, use different values for Output Profile and Simulation Profile, and deselect Preserve RGB.
•Topreviewhowamoviewilllookifyououtputthemovietoonedeviceandviewitonanotherdevice,usedifferent
values for Output Profile and Simulation Profile, and select Preserve RGB.
You can choose an output simulation preset for each view. Custom output simulation settings are shared between all
views.
AFTER EFFECTS CS3
User Guide
250
Simulate an output type in a movie rendered for final output
Color management for output simulation is only for previews, but you can render a movie with a look that simulates
a particular output type. For example, you can render a movie for HDTV that simulates a film appearance. This is
especially useful for creating dailies when doing film work.
1Choose Layer > New > Adjustment Layer to create a new adjustment layer at the top of your composition.
2Choose Effect > Utility > Color Profile Converter to apply the Color Profile Converter to the adjustment layer.
3Choose Edit > Duplicate to duplicate the effect.
4In the Effect Controls panel, set the following options for the first instance of the effect:
Input Profile Project Working Space
Output Profile The type of output to simulate; for example, a film printing density profile, such as Kodak 5218/7218
Printing Density
Intent Absolute Colorimetric
5In the Effect Controls panel, set the following options for the second instance of the effect:
Input Profile The type of playback to simulate; for example, a theater preview profile
Output Profile The color space of the output medium; for example HDTV (Rec. 709)
Intent Relative Colorimetric
Toenableanddisablethiskindofoutputsimulation,youcanturntheadjustmentlayeronandoffbyselectingand
deselecting its Video switch in the Timeline panel.
Broadcast-safe colors
Analog video signal amplitude is expressed in IRE units (or volts in PAL video). Values between 7.5 and 100 IRE
units are considered broadcast-safe; colors in this range do not cause undesired artifacts such as audio noise and color
smearing. (In practice, some spikes over 100 IRE are legal, but for simplicity 100 IRE is considered the legal
maximum here.) This range of 7.5-100 IRE is equivalent to a range from black to white of 64-940 in 10-bpc values
for Y' in Y'CbCr, which corresponds to 16-235 in 8-bpc values. Therefore, many common video devices and software
systems interpret 16 as black and 235 as white, instead of 0 and 255. These numbers don’t directly correspond to RGB
values.
If you notice that colors of imported footage look wrong—blacks don’t look black enough, and whites don’t look
white enough—make sure that you’ve assigned the correct input color profile. The common video color profiles
included with After Effects include variants that account for these limited ranges, such as the HDTV (Rec. 709) 16-
235 color profile, which interprets 16 as black and 235 as white.
Note: Some video cards and encoders assume that output is in the range 0-255, so limiting colors in your composition
and rendered movie may be redundant and lead to an undesired compression of the color range. If colors of your output
movie look dull, try assigning an output color profile that uses the full range of colors.
You can use the Broadcast Colors effect to reduce luminance or saturation to a safe level, but the best way to limit
output colors to the broadcast-safe range is to create your composition to not use colors out of this range. Keep the
following guidelines in mind:
•Avoid pure black and pure white values.
•Avoid using highly saturated colors.
•Render a test movie and play it on a video monitor to ensure that colors are represented accurately.
AFTER EFFECTS CS3
User Guide
251
The Color Finesse plug-in included with After Effects includes excellent tools that can help you keep your colors
within the broadcast-safe range. For more information, see the Color Finesse documentation in the folder containing
the Color Finesse plug-in.
Note: After Effects 7.0 had an Expand ITU-R 601 Luma Levels option in the Interpret Footage dialog box. When opened
in After Effects CS3 or later, footage items in projects created with this option will have a corresponding assigned profile.
Working with Cineon footage items
A common part of the motion-picture film production workflow is scanning the film and encoding the frames into
the Cineon file format. The DPX (Digital Picture Exchange) format is a standard format closely related to the Cineon
format.
Cineon data is stored in a logarithmic format, with each color channel taking up 10 bits.
Stu Maschwitz has a blog post that goes into some of the finer details of what it means to say that Cineon files' color
values are in a logarithmic color space: www.adobe.com/go/learn_ae_stucineonlog.
Cineon data has a 10-bit white point of 685 and a 10-bit black point of 95. Values above 685 are retained, but are
treated as highlights. Rather than abruptly clipping highlights to white, After Effects interprets highlights using a
gradual ramp defined by the Highlight Rolloff value. You can modify the 10-bit white point and 10-bit black point
input levels and the output (converted) white point and black point levels to match your specific footage items or
creative needs.
Use a project color depth of 32 bpc when working with Cineon footage items so that highlights are preserved, in
which case you don’t need to roll off the highlights.
There are three basic ways of working with Cineon footage items in After Effects:
•The easiest—and recommended—way is to enable color management and assign an input color profile to a
Cineon footage item in the Color Management tab of the Interpret Footage dialog box, corresponding to the film
stock on which the footage was recorded. Of course, if creating output for film, you should use the same profile as
theoutputcolorprofilesothattheoutputfilematchesthefilmstock.Oneadvantageofusingcolormanagement
features to work with Cineon footage items is that compositing with images from other footage types is made
easier. See “Interpret a footage item by assigning an input color profile” on page 245.
•If you need to manually modify the settings for a Cineon footage item, or if you don’t want to use color
management, then you can use the Cineon Settings dialog box. To open this dialog box, click the Cineon Settings
button in the Color Management tab of the Interpret Footage dialog box.
•IfyouneedthesettingsfortheinterpretationoftheCineonfootageitemtochangeovertime,thenyoucanapply
the Cineon Converter effect to a layer that uses the Cineon footage item as its source.
See also
“Cineon Converter effect” on page 542
252
Chapter 10: Masks, transparency, and
keying
Transparency overview
Use masks, keying effects, and mattes to determine which parts of a layer are transparent, allowing other layers to
show through.
About transparency
Before you can create a composite from multiple images, parts of one or more of the images must be transparent. You
can use alpha channels,masks,mattes, or keying to define which parts of an image are transparent and which parts
of an image can be used to obscure parts of another image. By manipulating transparency and choosing blending
modes, you can create a variety of visual effects.
About alpha channels and mattes
Color information is contained in three channels: red, green, and blue. In addition, an image can include an invisible
fourth channel, called an alpha channel, that contains transparency information.
Channels at a glance
A. Separated color channels B. Alpha channel C. All channels viewed together
An alpha channel provides a way to store images and their transparency information in a single file without
disturbing the color channels.
WhenyouviewanalphachannelintheAfterEffectsCompositionpaneloranAdobePremiereProMonitorpanel,
white indicates complete opacity, black indicates complete transparency, and shades of gray indicate partial trans-
parency.
A
BC
AFTER EFFECTS CS3
User Guide
253
Amatte is a layer (or any of its channels) that defines the transparent areas of that layer or another layer. White
defines opaque areas, and black defines transparent areas. An alpha channel is often used as a matte, but you can use
amatteotherthanthealphachannelifyouhaveachannelorlayerthatdefinesthedesiredareaoftransparencybetter
than the alpha channel does, or in cases where the source image doesn’t include an alpha channel.
Many file formats can include an alpha channel, including Adobe Photoshop, ElectricImage, Adobe Flash Video
(FLV), TGA, TIFF, EPS, PDF, and Adobe Illustrator. AVI and QuickTime (saved at a bit depth of Millions Of
Colors+), also can contain alpha channels, depending upon the codecs used to generate these file types. For Adobe
Illustrator EPS and PDF files, After Effects automatically converts empty areas to an alpha channel.
About straight and premultiplied channels
Alpha channels store transparency information in files in one of two ways: straight or premultiplied. Although the
alpha channels are the same, the color channels differ.
With straight (or unmatted)channels,transparencyinformationisstoredonlyinthealphachannel,notinanyofthe
visiblecolorchannels.Withstraightchannels,theeffectsoftransparencyaren’tvisibleuntiltheimageisdisplayedin
an application that supports straight channels.
With premultiplied (or matted) channels, transparency information is stored in the alpha channel and also in the
visible RGB channels, which are multiplied with a background color. The colors of semitransparent areas, such as
feathered edges, are shifted toward the background color in proportion to their degree of transparency.
Some software lets you specify the background color with which the channels are premultiplied; otherwise, the
background color is usually black or white.
Straight channels retain more accurate color information than premultiplied channels. Premultiplied channels are
compatible with a wider range of programs, such as Apple QuickTime Player. Often, the choice of whether to use
images with straight or premultiplied channels has been made before you receive the assets to edit and composite.
Adobe Premiere Pro and After Effects recognize both straight and premultiplied channels, but only the first alpha
channel they encounter in a file containing multiple alpha channels. Adobe Flash recognizes only premultiplied
alpha channels.
About keying
Keying isdefiningtransparencybyaparticularcolorvalue(withacolorkeyorchromakey)orbrightnessvalue(with
a luminance key) in an image. When you key out a value, all pixels that have similar colors or luminance values
become transparent.
Keying makes it easy to replace a background of a consistent color or brightness with another image, an especially
usefultechniquewhenyouworkwithobjectstoocomplextomaskeasily.Thetechniqueofkeyingoutabackground
of a consistent color is often called bluescreening or greenscreening, although you don’t have to use blue or green; you
can use any solid color for a background.
Difference keying defines transparency with respect to a particular baseline background image. Instead of keying out
a single-color screen, you can key out an arbitrary background.
About masks
Amask in After Effects is a path that is used as a parameter to modify layer effects and properties. The most common
use of a mask is the modification of a layer’s alpha channel, which determines the layer’s transparency at each pixel.
Another common use of a mask is as a path along which to animate text. (See “Creating and animating text on a path”
on page 293.)
AFTER EFFECTS CS3
User Guide
254
A mask path consists of segments and vertices. Segments are the lines or curves that connect vertices. Vertices are
where each segment of a path starts and ends. For more information on paths, see “About paths” on page 313.
Closed-path masks can create transparent areas for a layer. Open paths cannot create transparent areas for a layer but
are useful as parameters for an effect. Some effects can use an open or closed mask path as input; these include Stroke,
Path Text, Audio Waveform, Audio Spectrum, and Vegas. Others can use closed masks only; these include Fill,
Smear, Reshape, Particle Playground, and Inner/Outer Key.
A mask belongs to a specific layer. Each layer can contain multiple masks.
You can draw masks in common geometric shapes—including polygons, ellipses, and stars—with the shape tools, or
you can use the Pen tool to draw an arbitrary path.
In most ways, drawing mask paths is the same as drawing shape paths on shape layers, though the editing and inter-
polation of mask paths has a few additional features. You can link a mask path to a shape path using expressions,
which allows you to bring the benefits of masks into shape layers, and vice versa.
The position of a mask in the stacking order in the Timeline panel affects how it interacts with other masks. You can
drag a mask to different positions within the Masks property group in the Timeline panel.
A mask’s Mask Opacity property determines the influence that a closed mask has on a layer’s alpha channel inside
the mask area. A Mask Opacity value of 100% corresponds to an interior area that is completely opaque. The area
outside the mask is always completely transparent. To invert what is considered inside and what is considered outside
for a specific mask, select Invert next to the mask name in the Timeline panel.
Default behavior for a drawn mask (left); same mask inverted (right)
See also
“Creating shapes and masks” on page 318
Creating and importing masks
Creating masks
You can create one or more masks for each layer in a composition using any of the following methods:
•Draw a path using the shape tools or Pen tool from the Tools panel. Drawing a mask path is very similar to drawing
a shape path. (See “Creating shapes and masks” on page 318.)
•Specify the dimensions of the mask shape numerically in the Mask Shape dialog box.
•Convert a shape path to a mask path.
•Convert a motion path to a mask path.
•Trace a color or alpha channel’s values to create a mask using the Auto-trace command.
AFTER EFFECTS CS3
User Guide
255
•Paste a path copied from another layer or from Adobe Illustrator, Photoshop, or Fireworks. (See “Copy a path from
Illustrator, Photoshop, or Fireworks” on page 324.)
•Convert a text layer to one or more editable masks by using the Create Outlines command and then linking the
mask paths to the resulting shape paths.
When you create masks on a layer, the mask names appear in the Timeline panel outline in the order in which you
create the masks. To organize and keep track of your masks, rename them.
To rename a mask, select it and press Enter (Windows) or Return (Mac OS).
When creating additional masks for one layer in the Layer panel, make sure that the Target menu in the Layer panel
is set to None; otherwise, you will replace the targeted mask instead of creating a new mask. You can also lock a mask
to prevent changes to it.
Menu selections to specify a mask to target in the Layer panel
A. View menu B. Targ et menu
To create a mask that you can move independently of the primary layer that it’s masking, create the mask on a
separatewhitesolidlayer,andusethatsolidlayerasatrackmattefortheprimarylayer.Thenuseparentingtomake
the solid layer a child of the primary layer, so that the mask moves with the primary layer as if it were applied directly.
Because the solid layer is a child layer, it can also be animated independently of its parent. You can use motion tracking
to make the solid layer (and therefore the mask) follow moving objects in the primary layer. (See “Convert a layer into
a track matte” on page 264 and “Work with parent and child layers” on page 158.)
Create a rectangular or elliptical mask numerically
1Select a layer in the Composition panel, or display a layer in the Layer panel.
2Choose Layer > Mask > New Mask. A new mask appears in the Composition or Layer panel with its handles at
the outer edges of the frame.
3Choose Layer > Mask > Mask Shape.
4Select Rectangle or Ellipse, and specify the size and location of the mask’s bounding box.
Create a mask from a motion path
You can copy position keyframes, anchor point keyframes, or an effect control point’s position keyframes and paste
thosekeyframesonaselectedmask.Thisisusefulforcreatinganimationsthatfollowtheedgesofamask.Whenyou
create masks from motion paths, make sure that you copy keyframes from a single position property only—do not
copy the keyframes of any other property.
A
B
AFTER EFFECTS CS3
User Guide
256
The motion path of the spaceship (top) is copied to the background layer (bottom left) and used by the Vegas effect (bottom right).
1In the Timeline panel, click the name of the Position property or Anchor Point property from which you want to
copy the motion path. (This selects all keyframes. To select only some of the motion path’s keyframes, Shift-click
them.)
2Choose Edit > Copy.
3To create a new mask, select the layer on which to create the mask, and choose Layer > Mask > New Mask.
4In the Timeline panel, click the name of the Mask Path property for the mask to which to paste the motion path
keyframes.
5Choose Edit > Paste.
Selecting and copying Position keyframes (left); then pasting them in the selected Mask Path property (right)
See also
“Work with motion paths” on page 197
Create a mask from a channel with Auto-trace
You can convert the alpha, red, green, blue, or luminance channel of a layer to one or more masks by using the Auto-
trace command. Auto-trace creates as many Bezier masks as necessary to outline the specified channel values in the
layer. Auto-trace creates masks with the smallest number of vertices possible while conforming to the settings that
you choose. You can modify a mask created with Auto-trace as you would any other mask, and you can link its path
to other path types, such as shape paths on a shape layer, using expressions.
When you apply Auto-trace, affected layers are automatically set to Best Quality to ensure accurate results.
To reduce the number of masks created by Auto-trace, apply a keying effect to the layer to isolate your subject before
applying Auto-trace.
1In the Timeline panel, do one of the following:
•To create mask keyframes at a single frame, drag the current-time indicator to the desired frame.
AFTER EFFECTS CS3
User Guide
257
•To create mask keyframes across a range of frames, set a work area that spans that range.
2Select one or more layers.
3Choose Layer > Auto-trace.
4Select one of the following:
Current Frame Creates mask keyframes at only the current frame.
Work Area Creates mask keyframes for frames within the work area.
5Set any of the following options:
Invert Inverts the input layer prior to searching for edges.
Blur Blurs the original image before generating the tracing result. Select this option to reduce small artifacts and to
smooth jagged edges in the tracing result. Deselect this option to closely trace details in a high-contrast image.
Specify the radius, in pixels, of the area used for the blurring operation. Larger values result in more blur.
Tolerance How far, in pixels, the traced path is allowed to deviate from the contours of the channel.
Threshold Specifies,asapercentage,thevaluethatapixel’schannelmusthaveforthatpixeltobeconsideredpartof
an edge. Pixels with channel values over the threshold are mapped to white and are opaque; pixels with values under
the threshold are mapped to black and are transparent.
Minimum Area Specifies the smallest feature in the original image that will be traced. For example, a value of 4
removes features smaller than 2 pixels wide by 2 pixels high from the tracing result.
Corner Roundness Specifies the roundness of the mask curve at vertices. Enter a higher value for smoother curves.
Apply To New Layer Appliesthemasktoanewsolidthesamesizeastheselectedlayer.Thiscontrolisautomatically
selected for layers that have Collapse Transformations enabled—it creates a new layer the same size as the compo-
sition that contains the layer.
Preview Select to preview the mask results and the results of the Auto-trace command’s various options.
See also
“Keying overview and tips” on page 268
“Set the work area” on page 112
“About alpha channels and mattes” on page 252
Working with masks and mattes
View mask paths
•To view mask paths for selected layers in the Timeline panel, press M.
•To view selected masks in the Timeline panel, press SS (press the S key twice).
•To view mask paths in the Composition panel, click the Toggle Mask And Shape Path Visibility button at the
bottom of the Composition panel.
•To view mask paths in the Layer panel, choose Masks from the Layer panel View menu.
•To hide a mask path while showing others, lock the mask by selecting its Lock switch in the Timeline panel,
and then choose Layer > Mask > Hide Locked Masks.
AFTER EFFECTS CS3
User Guide
258
Select masks, segments, and vertices
Unlikelayers,maskscanhavemorethanonelevelofselection.Youcanselectamaskasawholepath,whichisappro-
priate when you want to move or resize a mask. However, if you want to change the path of a mask, select one or
more points on it. Selected points appear solid, and unselected points appear hollow.
Select or deselect masks in the Layer or Composition panel
•
To select a vertex on a mask, click the vertex with the Selection tool . To add vertices to the selection, Shift-click them.
•
To select a mask segment, click the segment with the Selection tool. To add segments to the selection, Shift-click them.
•To select an entire mask, Alt-click (Windows) or Option-click (Mac OS) a segment, vertex, or handle of a mask
with the Selection tool, or select any portion of the mask and choose Edit > Select All or press Crl+A (Windows)
or Command+A (Mac OS). To add masks to the selection, Alt+Shift-click (Windows) or Option+Shift-click
(Mac OS) them.
•To select masks by dragging, select a mask or portion of a mask to enter mask editing mode and then drag with
the Selection tool to draw a marquee-selection box completely around the vertices or masks that you want to
select. To add masks or vertices to the selection, hold down the Shift key as you draw additional marquee-selection
boxes.
•To select all masks on a layer, select a mask on the layer, and choose Edit > Select All or press Ctrl+A (Windows)
or Command+A (Mac OS).
•To deselect all masks, press Ctrl+Shift+A (Windows) or Command+Shift+A (Mac OS).
•To select an adjacent mask on a layer, press Alt+tilde (~) (Windows) or Option+tilde (~) (Mac OS) to select the
next mask, or Shift+Alt+tilde (~) (Windows) or Shift+Option+tilde (~) (Mac OS) to select the previous mask.
•To deselect a mask, click anywhere other than on the mask.
•To remove a vertex or segment from a selection, Shift-click the vertex or segment.
To use the Selection tool when the Pen tool is selected, hold down Ctrl (Windows) or Command (Mac OS).
Select masks in the Timeline panel
1Click the right arrow next to a layer name to expand it.
2Click the right arrow next to the Masks heading to expand it, revealing all masks on that layer.
3Do any of the following:
•To select one mask, click its name.
•To select a contiguous range of masks, Shift-click the names of the first and last masks in the range.
•To select discontiguous masks together, Ctrl-click (Windows) or Command-click (Mac OS) the names of any
masks you want to include.
Note: You can select only whole masks in the Timeline panel. To select individual vertices on a mask, use the Compo-
sition or Layer panel.
Change a mask path numerically
1Select the mask.
2In the Timeline panel, expand the Mask properties.
3Next to the Mask Path property, click the underlined word, and specify the changes in the Mask Path dialog box.
AFTER EFFECTS CS3
User Guide
259
Lock or unlock masks
Locking a mask prevents you from selecting it in the Timeline, Composition, and Layer panels or setting it as a target
in the Layer panel. Use this feature to avoid unwanted changes to the mask.
1In the Timeline panel, expand the Masks property group.
2In the A/V Features column, click the box underneath the Lock icon next to the mask you want to lock or
unlock. A mask is locked and cannot be selected when its Lock switch is selected—i.e., when the Lock icon appears
in the box.
Note: To unlock multiple masks at one time, select one or more layers and choose Layer > Mask > Unlock All Masks.
Copy, cut, save, reuse, and delete masks
You can reuse masks in other layers and compositions—particularly Bezier masks you’ve spent a long time
perfecting. Mask paths are stored inside a composition in a project file. It can be useful to create a project with
compositionsjustforstoringcomplexlayermasks.Whenyouwanttouseamaskfromanotherproject,importthat
project into your current project.
Copy, cut, duplicate, or paste a mask
•To copy or cut selected masks to the clipboard, choose Edit > Copy or Edit > Cut.
•To duplicate selected masks, choose Edit > Duplicate.
•To paste a mask onto a layer, select the layer and then choose Edit > Paste. If a mask is selected, this replaces the
selected mask.
Save a mask
1In the Timeline panel for the composition containing the layer and mask you want to save, expand the layer and
its mask properties.
2Do one of the following:
•To save an animated mask, select the mask keyframes you want to save.
•To save a nonanimated mask, select the mask.
3Copythemaskorkeyframes,andpastethemaskorkeyframestoanewlayer.Thenewlayercanbeasimplesolid.
Reuse a mask
1Open the composition containing the mask you want to reuse. If you saved the mask in another project, import
the project and then open the mask’s composition.
2In the Timeline panel, expand the saved mask’s layer and mask properties.
3Select the mask or keyframes.
4Copy the mask or keyframes, and paste the mask or keyframes to the layer to which you want to apply the mask.
Delete masks
•To delete one mask, select the mask in the Timeline panel and press Delete.
•Todeleteallmasks,selectthelayercontainingthemasksyouwanttoremoveandchooseLayer>Masks>Remove
All Masks.
AFTER EFFECTS CS3
User Guide
260
Control mask path color
To help you identify and work with masks, the Composition and Layer panels outline a mask’s path with color, and
the Timeline panel displays that same color next to the mask’s name. By default, After Effects uses the color yellow
for all masks. To make each mask more distinctive, you can manually change a mask’s color using the Timeline panel,
or you can set After Effects to cycle through mask colors for new masks.
Apply a new color to a mask outline
To make it easier to work with multiple masks in the Composition panel, you can apply different colors to each mask
outline.
1Select the mask in the Timeline panel.
2Click the color swatch to the left of the mask name, pick a new color, and click OK.
Set After Effects to cycle through mask colors
1Choose Edit > Preferences > User Interface Colors.
2Select Cycle Mask Colors.
After Effects cycles through different mask colors.
Mask modes
Blending modes for masks (mask modes) control how masks within a layer interact with one another. By default, all
masksaresettoAdd,whichcombinesthetransparencyvaluesofanymasksthatoverlaponthesamelayer.Youcan
apply a mode to each mask, but you can’t animate a mask’s mode—that is, you can’t change a mask mode over time.
You choose a mask mode for a mask from the menu next to the mask name in the Timeline panel.
Thefirstmaskthatyoucreateinteractswiththelayer’salphachannel.Ifthatchanneldoesn’tdefinetheentireimage
as opaque, then the mask interacts with the layer frame. Each additional mask you create interacts with masks located
above it in the stacking order in the Timeline panel. The results of mask modes vary depending on the modes set for
the masks higher up in the stacking order. Mask modes only operate between masks on the same layer.
Using mask modes, you can create complex compound masks with multiple transparent areas. For example, you can
set a mask mode that combines two masks and sets the opaque area to the areas where the two masks intersect.
AFTER EFFECTS CS3
User Guide
261
Compound masks that result when different modes are applied to the circle mask. The masks in this illustration have different Mask Opacity
values.
A. Original masks B. None C. Add D. Subtract E. Intersect F. Lighten G. Darken H. Difference
None The mask has no direct influence on the alpha channel of the layer. This option is useful when you are only
usingthemask’spathforaneffectsuchasStrokeorFill,orifyouareusingthemaskpathasthebasisforashapepath.
Add Themaskisaddedtothemasksaboveitinthestackingorder.Theinfluenceofthemaskiscumulativewiththe
masks above it.
Subtract The influence of the mask is subtracted from the masks above it. This option is useful when you want to
create the appearance of a hole in the center of another mask.
Intersect The mask is added to the masks above it in the stacking order. In areas where the mask overlaps the masks
aboveit,theinfluenceofthemaskiscumulativewiththemasksaboveit.Inareaswherethemaskdoesnotoverlap
with the masks above it, the result is complete opacity.
Lighten The mask is added to the masks above it in the stacking order. Where multiple masks intersect, the highest
transparency value is used.
Darken The mask is added to the masks above it in the stacking order. Where multiple masks intersect, the lowest
transparency value is used.
AB
CD
EF
GH
AFTER EFFECTS CS3
User Guide
262
Difference Themaskisaddedtothemasksaboveitinthestackingorder.Inareaswherethemaskdoesnotoverlap
the masks above it, the mask operates as it would alone on the layer. In areas where the mask overlaps the masks
above it, the influence of the mask is subtracted from the masks above it.
Adjust the edges of a mask
To finely expand or contract all edges of a mask, use the Mask Expansion property. This property’s value represents,
in pixels, how far from the original mask edge you are expanding or contracting the adjusted edge.
1In the Timeline panel, expand the Mask properties of the layer you want to adjust.
2Drag the underlined value for Mask Expansion.
Note: To reset a mask to its default boundaries, select the mask in the Timeline panel and choose Layer > Mask > Reset Mask.
Adjust mask feather
Feathering softens the edges of a mask by fading it from more transparent to less transparent over a user-defined
distance. Using the Mask Feather property, you make mask edges hard-edged or soft-edged (feathered). By default,
the feather width straddles the mask edge, half inside and half outside. For example, if you set the feather width to
25, the feathering extends 12.5 pixels inside the mask edge and 12.5 pixels outside it. You can also extend or contract
the mask edges using the Mask Expansion property to control where the mask feathering appears.
Setting the Mask Feather property
A. Masked layer with 5-pixel feather B. Masked layer with 40-pixel feather C. Result with 5-pixel feather D. Result with 40-pixel feather
Mask feathering takes place only within the dimensions of the layer. Therefore, a feathered mask’s path should always
be slightly smaller than the layer area and should never move to the very edge of the layer. If a mask feather extends
beyond the layer area, the feathered edge ends abruptly.
1To display the Mask Feather property for selected layers, press F.
2 (Optional) To constrain horizontal and vertical feather amounts to change proportionally, select the Constrain
Proportions switch next to the Mask Feather property.
3Modify the Mask Feather property as you would any other property—by dragging the underlined value or clicking
the underlined value and entering an amount in the text box.
CD
BA
AFTER EFFECTS CS3
User Guide
263
The PV Feather plug-in from RE:Vision Effects provides the ability to control the feather amount for each vertex of
a mask path independently. For information, see the RE:Vision Effects website:
www.adobe.com/go/learn_ae_revisionfxpvfeather.
About track mattes and traveling mattes
When you want one layer to show through a hole in another layer, set up a track matte. You’ll need two layers—one
to act as a matte, and another to fill the hole in the matte. You can animate either the track matte layer or the fill layer.
When you animate the track matte layer, you create a traveling matte. If you want to animate the track matte and fill
layers using identical settings, consider precomposing them.
Define transparency in a track matte using values from either its alpha channel or the luminance of its pixels. Using
luminance is useful when you want to create a track matte using a layer without an alpha channel or a layer imported
from a program that can’t create an alpha channel. In both alpha channel mattes and luminance mattes, pixels with
highervaluesaremoretransparent.Inmostcases,youuseahigh-contrastmattesothatareasareeithercompletely
transparent or completely opaque. Intermediate shades should appear only where you want partial or gradual trans-
parency, such as along a soft edge.
After Effects preserves the order of a layer and its track matte after you duplicate or split the layer. Within the dupli-
cated or split layers, the track matte layer remains on top of the fill layer. For example, if your composition contains
layers A and B, where A is the track matte and B the fill layer, duplicating or splitting both of these layers results in
the layer order ABAB.
A track matte only applies to the layer directly beneath it. To apply a track matte to multiple layers, first precompose
the multiple layers, and then apply the track matte to the precomposition layer.
Traveling matte
A. Track matte layer: a solid with a rectangular mask, set to Luma Matte. The mask is animated to travel across the screen. B. Fill layer: a
solid with a pattern effect. C. Result:thepatternisseeninthetrackmatte’sshapeandaddedtotheimagelayer,whichisbelowthetrackmatte
layer.
To animate a track matte to move with the layer that it’s matting, make the track matte a child of the layer that it’s
matting. (See “Work with parent and child layers” on page 158.)
AB
C
AFTER EFFECTS CS3
User Guide
264
See also
“About alpha channels and mattes” on page 252
“Split a layer” on page 146
Convert a layer into a track matte
1Drag the layer that will be the track matte directly above the layer that will be the fill layer.
2Define transparency for the track matte by choosing one of the following options from the TrkMat menu for the
fill layer:
No Track Matte No transparency created; next layer above acts as a normal layer.
Alpha Matte Opaque when alpha channel pixel value is 100%.
Alpha Inverted Matte Opaque when alpha channel pixel value is 0%.
Luma Matte Opaque when a pixel’s luminance value is 100%.
Luma Inverted Matte Opaque when a pixel’s luminance value is 0%.
AfterEffectsconvertsthenextlayeraboveintoatrackmatte,turnsoffthevideoofthetrackmattelayer,andaddsa
track matte icon next to the track matte layer’s name in the Timeline panel. The Composition panel displays the
fill layer viewed through the alpha channel of the matte layer.
Note: Although the video is turned off for the matte layer, you can still select the layer to reposition, scale, or rotate it.
Select the layer in the Timeline panel, and then drag the center (indicated by a circle with an X) of the layer in the
Composition panel.
See also
“About alpha channels and mattes” on page 252
Preserve underlying transparency during compositing
The Preserve Underlying Transparency option causes the opaque areas of a layer to appear only when positioned
over opaque areas in underlying layers. With this option, you can make a layer visible only when it is positioned over
the layer below it. It’s useful for creating effects such as glints or light reflecting off a polished surface.
❖Select the T option in the Modes column for the appropriate layer.
Animating masks
Alejandro Pérez provides a script on the AE Enhancers forum with which you can use tracking data to position
individual mask vertices: www.adobe.com/go/learn_ae_alejandrotrackmaskvertices.
Scott Squires provides a pair of movies that show how to rotoscope, both painting and masking:
•www.adobe.com/go/learn_ae_scottsquiresrotoscope1
•www.adobe.com/go/learn_ae_scottsquiresrotoscope2
AFTER EFFECTS CS3
User Guide
265
Use Smart Mask Interpolation
Smart Mask Interpolation provides a high level of control for creating mask path keyframes and smooth, realistic
animation. After you select the mask path keyframes to interpolate, Smart Mask Interpolation creates intermediate
keyframes based on settings you provide. The Info panel displays the progress of the interpolation and the number
of keyframes created.
The Smart Mask Interpolation panel
1Choose Window > Smart Mask Interpolation.
2Select at least two adjacent mask path keyframes.
3Set options in the Smart Mask Interpolation panel, and then click Apply.
Note: To interrupt the interpolation process, press Esc. The Info panel indicates that the process has been interrupted and
reports the number of keyframes created.
Keyframe Rate Specifies the number of keyframes that Smart Mask Interpolation creates per second between the
selected keyframes. For example, a value of 10 creates a new keyframe every 1/10 of a second. Choose Auto to set the
keyframe rate equal to the composition frame rate, which appears in parentheses. Create more keyframes for
smoother animation; create fewer keyframes to reduce render time.
Note: Regardless of the keyframe rate you choose, Smart Mask Interpolation always adds keyframes at the frame just
after the first mask path keyframe and at the frame just before the second mask path keyframe. For example, if you inter-
polate between keyframes at 0 seconds and 1 second in a 30-fps composition with a keyframe rate of 10 keyframes per
second, mask path keyframes are added at frame numbers 1, 3, 6, 9, 12, 15, 18, 21, 24, 27, and 29.
Keyframe Fields Doubles the keyframe rate. When this option is selected, and Keyframe Rate is set to the compo-
sition frame rate, a keyframe is added at each video field. Select this option for animated masking for interlaced
video. If this option is not selected, the mask may slip off the object that you are attempting to key out. For more
information about fields in interlaced video, see “About interlaced and noninterlaced video” on page 70.
Use Linear Vertex Paths Specifies that vertices in the first keyframe move along a straight path to their corre-
sponding vertices in the second keyframe. Leave this option unselected if you want some vertices to interpolate along
curved paths; for example, when the desired interpolation involves rotating parts. If this option is not selected, Smart
Mask Interpolation creates a natural path for the mask.
Bending Resistance Specifies how susceptible the interpolated mask path is to bending instead of stretching. A value
of 0 specifies that, as the mask path animates, it bends more than it stretches; a value of 100 specifies that the mask
path stretches more than it bends.
AFTER EFFECTS CS3
User Guide
266
Quality SpecifieshowstrictlySmartMaskInterpolationmatchesverticesfromonekeyframetoanother.Avalueof
0 specifies that a particular vertex in the first keyframe matches only the same-numbered vertex in the second
keyframe. For example, the tenth vertex in the first keyframe must match the tenth vertex in the second keyframe.
A value of 100 means that a vertex in the first keyframe can potentially match any vertex in the second keyframe.
Higher values usually yield better interpolations; however, the higher the value, the longer the processing time.
Add Mask Shape Vertices Specifies that Smart Mask Interpolation adds vertices to facilitate quality interpolations.
Ingeneral,SmartMaskInterpolationworksbestwhenthemask paths have dense sets of vertices. Also, a vertex on
the first mask path cannot match the middle of a curve or straight-line segment on the second mask path, so
sometimesyoumustaddverticesbeforematchingtoproducethedesiredresult.SmartMaskInterpolationdoesnot
modify the original keyframes. Only the new mask path keyframes computed by Smart Mask Interpolation have
additional vertices.
The value you set specifies how finely the input mask paths are subdivided. Pixels Between Vertices specifies the
distance, in pixels, between vertices on the larger perimeter mask path after subdivision. Total Vertices specifies the
number of vertices on the interpolated mask paths. Percentage Of Outline specifies that a vertex is added at each
indicated percent of the mask path outline length. For example, a value of 5 means that a vertex is added at each
successive segment of the outline that represents 5% of the total perimeter. To use only the vertices that were on the
path at the first frame, do not select this option.
Note: Smart Mask Interpolation may add vertices at existing vertex locations even if Add Mask Shape Vertices is not
selected. If two vertices on one mask path match a single vertex on the other, the single vertex is duplicated at the same
location so that the segment between the two vertices shrinks to that location.
Matching Method Specifies the algorithm that Smart Mask Interpolation uses to match vertices on one mask path
to vertices on the other. Auto applies the matching algorithm for curves if either of the two selected keyframes has a
curved segment; otherwise, it applies the polylines algorithm. Curve applies the algorithm for mask paths that have
curved segments. Polyline applies the algorithm for mask paths that have only straight segments.
Note: The mask path keyframes added by Smart Mask Interpolation are polylines when Polyline Matching Method is
selected, regardless of whether the input mask paths contained curved segments.
Use 1:1 Vertex Matches Specifies that Smart Mask Interpolation creates a vertex on one mask path that matches the
same-numbered vertex on the other mask path. On each of the input mask paths, Smart Mask Interpolation matches
the first vertices, the second vertices, the third vertices, and so forth. If the two paths have unequal numbers of
vertices, this action may produce undesirable results.
First Vertices Match Specifies that Smart Mask Interpolation matches the first vertices in the two mask path
keyframes. If not selected, Smart Mask Interpolation searches for the best first-vertex match between the two input
mask paths.
Note: To ensure good results, make sure that the first vertices of the input mask paths match, and then select First Vertices
Match.
See also
“Interpolation” on page 204
Move a mask or pan a layer behind a mask
YoucanadjusttheareathatisvisiblethroughamaskbyeithermovingthemaskintheLayerorCompositionpanel
or panning (moving) the layer behind the mask in the Composition panel. When you move a mask, the mask layer’s
Position values remain constant, and the mask moves in relation to other objects in the Composition panel.
AFTER EFFECTS CS3
User Guide
267
When you use the Pan Behind tool to pan a layer behind a mask, the mask’s position remains constant in the Compo-
sitionpanelbutchangesintheLayerpanel.Themaskedlayer’sPositionvalueschangeinrelationtothecomposition.
As you pan past the edges of the layer’s frame, the layer’s Mask Path values also change. Using the Pan Behind tool
savessteps;withoutit,youwouldhavetochangethemaskedlayer’sPositionandMaskPathpropertiesmanually.You
can animate a layer panning behind another layer by setting keyframes for the masked layer’s Position and Mask Path
properties.
When you use the Pan Behind tool in the Composition panel, After Effects automatically makes two adjustments. In the Layer panel, the mask
is moved in relation to its layer (top), and in the Composition panel, the layer is moved in relation to the composition (bottom).
Move a mask
1Select the mask or masks you want to move.
2In the Composition panel, drag the mask or masks to a new location. To constrain the movement of the mask or
masks to horizontal or vertical, hold down Shift after you start dragging.
Pan a layer behind its mask
1Select the Pan Behind tool in the Tools panel .
2Click inside the mask area in the Composition panel and drag the layer to a new position.
Apply motion blur to a mask
Motion blur creates a blur based on a mask’s movement in the composition. You can apply motion blur to individual
masks. The composition’s Enable Motion Blur switch must be selected for any layer or any mask within a layer to
exhibit motion blur.
AFTER EFFECTS CS3
User Guide
268
Motion blur settings for a layer and a composition
A. Enable Motion Blur composition switch B. Motion Blur layer switch
1Select one or more masks.
2Choose Layer > Masks > Motion Blur, and choose one of the following options:
Same As Layer The mask will have motion blur only if the layer’s Motion Blur switch is selected.
OnThe mask will have motion blur regardless of the setting of the layer’s Motion Blur switch.
Off The mask will not have motion blur.
See also
“Use motion blur” on page 200
Keying
Keying overview and tips
Keying is defining transparency by a particular color value or luminance value in an image. When you key out avalue,
all pixels that have colors or luminance values similar to that value become transparent. Keying makes it easy to
replace a background, which is especially useful when you work with objects too complex to mask easily. When you
place a keyed layer over another layer, the result forms a composite, in which the background is visible wherever the
keyed layer is transparent.
After Effects includes several built-in keying effects, as well as the Academy Award-winning Keylight effect, which
excels at professional-quality color keying. For information on the Keylight effect, see its documentation in this
folder: Adobe After Effects CS3/Additional Documentation/Keylight.
To see a video tutorial on keying with Keylight, visit the Adobe website at www.adobe.com/go/vid0229.
Adobe® Creative Suite® Production Premium Edition also includes Adobe Ultra®, which can quickly key out a poorly
lit background shot with a low-quality webcam. For more information on Adobe Ultra, visit the Adobe website at
www.adobe.com/go/learn_ae_ultra.
Youoftenseecompositesmadewithkeyingtechniquesinmovies,forexample,whenanactorappearstodanglefrom
a helicopter or float in outer space. To create this effect, the actor is filmed in an appropriate position against a solid-
color background screen. The background color is then keyed out and the actor’s scene is composited over a new
background.
The technique of keying out a background of a consistent color is often called bluescreening or greenscreening,
although you don’t have to use blue or green; you can use any solid color for a background. Magenta screens have
been used for keying work in some very successful feature films. Other common terms for this sort of keying are
color keying and chroma keying.
A
B
AFTER EFFECTS CS3
User Guide
269
Difference keying works somewhat differently from color keying. Difference keying defines transparency with
respect to a particular baseline background image. Instead of keying out a single-color screen, you can key out an
arbitrary background. To use difference keying, you must have at least one frame that contains only the background;
other frames are compared to this frame, and the background pixels are made transparent, leaving the foreground
objects.
Keep in mind that generating a high-quality key can require the application of multiple keying effects in sequence
and careful modification of their properties, especially if the footage was shot without considering the requirements
of the compositor.
Here are some tips to help you as you work with keying effects:
•To help you view transparency, temporarily change the background color of the composition, or include a
background layer behind the layer you are keying out. As you apply the keying effect to the layer in the foreground,
the composition background (or a background layer) shows through, making it easy to view transparent areas.
(See “Set composition background color” on page 111.)
•Once you have used a key to create transparency, use Matte effects to remove traces of key color and create clean
edges.
•Start with the highest-quality materials you can gather, such as film that you scan and digitize.
•Use uncompressed footage (or, at least, files with the least possible amount of compression). Many compression
algorithms, especially those used in DV and Motion JPEG, discard subtle variations in blue—which may be
necessary to create a good key from a bluescreen.
•Noise and compression artifacts can cause problems for keying, especially difference keying. Often, applying a
slight blur before keying can reduce noise and compression artifacts enough to improve keying results. For
example, blurring the blue channel for DV footage can smooth out noise in a bluescreen.
The KeyerforDV animation preset available through the AE Enhancers forum automates the process of blurring the
blue and green channels before keying, which can be crucial for keying DV footage:
www.adobe.com/go/learn_ae_aeenhacersdvkeyer. This animation preset was written for an earlier version of the
Keylight effect, but you can simply drag and drop the Keylight (1.2) effect from the Effects & Presets panel to replace
the older effect, which may be reported as missing if you're using After Effects CS3.
•Blurring the alpha channel after keying can soften the edges of the matte, which can improve compositing results.
•Light your greenscreen or bluescreen uniformly, and keep it free of wrinkles.
•Use a garbage matte to roughly outline your subject so that you don’t have to waste time keying out parts of the
background far from the foreground subject. (See “Use a garbage matte” on page 270.)
•For evenly lit greenscreen or bluescreen footage, adjust keying controls on only one frame. Choose the most
intricate frame of the scene, one involving fine detail such as hair and transparent or semitransparent objects, such
as smoke or glass. If the lighting is constant, the same settings you apply to the first frame are applied to all subse-
quent frames. If lighting changes, you may need to adjust keying controls for other frames. Place keyframes for the
firstsetofkeyingpropertiesatthestartofthebluescreenscene.Ifyouaresettingkeyframesforonepropertyonly,
use Linear interpolation. For footage that requires keyframes for multiple interacting properties, use Hold inter-
polation. If you set keyframes for keying properties, you may want to check the results frame by frame. Interme-
diate keying values may appear, producing unexpected results.
•To key well-lit footage shot against a bluescreen or greenscreen, start with the Color Difference Key. Add the Spill
Suppressor to remove traces of the key color, and then use one or more of the other Matte effects, if necessary. If
you are not satisfied with the results, try starting again with the Linear Color Key.
AFTER EFFECTS CS3
User Guide
270
•To key well-lit footage shot against multiple colors or unevenly lit footage shot against a bluescreen or greenscreen,
start with the Color Range key. Add the Spill Suppressor and other effects to refine the matte. If you are not
completely satisfied with the results, try starting with or adding the Linear Color Key.
•To key dark areas or shadows, use the Extract Key on the Luminance channel.
•To make a static background scene transparent, use the Difference Matte Key. Add the Simple Choker and other
effects as needed to refine the matte.
For tips on shooting footage so that color keying is easier and more successful, see Jonas Hummelstrand’s website:
www.adobe.com/go/learn_ae_jonasshootingforcolorkeying.
See also
“Keying effects” on page 440
“Matte effects” on page 450
Use a garbage matte
Agarbage matte removes unneeded portions of the scene, resulting in a rough area that contains only the subject that
youwanttokeep.Whenyouareworkingwithapoorlylitorunevenbluescreenorgreenscreen,sketchingagarbage
mattearoundthesubjectcangreatlyreducetheamountofworkthatyouhavetodoinkeyingoutthebackground.
However, if you spend a lot of time making a perfect garbage matte that exactly outlines the subject—essentially
rotoscoping—you lose the time-saving advantage of color keying.
1Create a mask to roughly outline a subject.
2Apply one or more keying effects to mask out the remainder of the background.
3Apply Matte effects as necessary to fine-tune the matte.
Aharon Rabinowitz shows how to create a super-tight garbage matte using Auto-trace in this video tutorial:
www.adobe.com/go/learn_ae_aharonsupertightmattes.
See also
“Creating and importing masks” on page 254
“Keying overview and tips” on page 268
“Matte effects” on page 450
Use a hold-out matte
Use a hold-out matte (also known as a hold-back matte) to patch a scene to which a keying effect has been applied.
A hold-out matte is a masked-out portion of a duplicate of a layer that you have keyed. The duplicate is masked to
include only the area of the image that contains the key color that you want to preserve as opaque. The hold-out matte
is then placed directly on top of the keyed layer.
AFTER EFFECTS CS3
User Guide
271
Example of using a hold-out matte
A. Original bluescreen image. The number’s background is also blue. B. After keying, the number’s background is also transparent. C. Hold-
out matte containing the part of the image you want to remain opaque D. When the hold-out matte is placed on top of the keyed image, the
number’s background is now opaque.
1Duplicate the layer containing the color screen.
Note: Don’t change Transform properties of only one of the layers after making the duplicate; keep the layers moving
together.
2Apply keying effects and Matte effects to the original layer to create transparency.
3On the duplicate layer, create masks to mask out everything in the image except the area that you want to preserve.
4Make sure that the copy (the hold-out matte) is positioned directly on top of the keyed layer and contains exactly
the same keyframes with the same values. Then render the movie.
See also
“Creating and importing masks” on page 254
“Keying overview and tips” on page 268
“Matte effects” on page 450
Close a hole in a matte
The sequence of choking and spreading occurs in two stages, each with its own set of identical controls. Typically,
stage two does the opposite of stage one. After a specified number of back-and-forth adjustments (which are handled
automatically by Matte Choker), the hole is filled and the matte shape is preserved.
1Select the layer, and choose Effect > Matte > Matte Choker.
2Set stage-one controls (the first three properties) to spread the matte as far as possible without altering its shape,
as follows:
Geometric Softness Specifies (in pixels) the largest spread or choke.
Choke Sets the amount of choke. Negative values spread the matte; positive values choke it.
AB
CD
AFTER EFFECTS CS3
User Guide
272
Gray Level Softness Specifies how soft to make the edges of the matte. At 0%, the matte edges contain only fully
opaque and fully transparent values. At 100%, the matte edges have a full range of gray values but may appear
blurred.
3Set stage-two controls (the next three properties) to choke the matte by the same amount as that by which you
spread it in stage one.
4(Optional) Use the Iterations property to specify how many times After Effects repeats the spread-and-choke
sequence. You may need to try a few different settings so that the sequence is repeated as many times as necessary to
close any unwanted holes.
See also
“Keying overview and tips” on page 268
“Matte effects” on page 450
273
Chapter 11: Text
Creating and editing text layers
About text layers
You can add text to a composition and animate the properties of entire text layers or individual characters, such as
color, size, and position.
After Effects uses two kinds of text: point text and paragraph text. Point text is useful for entering a single word or a
line of characters; paragraph text is useful for entering and formatting the text as one or more paragraphs.
Vertical and horizontal point text (left), and paragraph text in a bounding box (right)
You work with text on text layers, which in many ways are like other layers in After Effects. You can apply effects and
expressions to text layers, animate them, designate them as 3D layers, and edit 3D text while viewing it in multiple
views. As with shape layers and other vector layers, text layers are continuously rasterized, so when you scale the layer
or resize the text, it retains crisp, resolution-independent edges.
To see a video tutorial on animating text, visit the Adobe website at www.adobe.com/go/vid0226.
You cannot open a text layer in its own Layer panel. You animate text using text animator properties and selectors.
3D text layers can optionally contain 3D sublayers, one for each character. (See “Animate text with text animators”
on page 286 and “Work with per-character 3D text properties” on page 293.)
You can copy text from other applications such as Adobe Photoshop, Adobe Illustrator, Adobe InDesign, or any text
editor,andpasteitintoatextlayerinAfterEffects.BecauseAfterEffectsalsosupportsUnicodecharacters,youcan
copy and paste these characters between After Effects and any other application that also supports Unicode (which
includes all Adobe applications).
Text formatting is included in the Source Text property. Use the Source Text property to animate formatting and to
change the characters themselves (for example, change the letter b to the letter c). Because you can mix and match
formatting within a text layer, you can easily create animations that transform every detail of a word or phrase.
Sequential frames in which Source Text has been animated
When working with text, you may find it useful to hide the layer controls, such as highlights and vertices, while
showing grids, guides, and safe zones. (See “Show or hide layer controls in the Composition panel” on page 127 and
“Work with safe zones, grids, guides, and rulers” on page 130.)
AFTER EFFECTS CS3
User Guide
274
Paul Tuersley provides a script for importing Substation Alpha (SSA) karaoke files and automatically creating
animated text layers from them: www.adobe.com/go/learn_ae_paulssakaraoke.
Aharon Rabinowitz provides a video tutorial that shows a few ways to make 3D extruded text in After Effects, using
duplicate layers or the Shatter effect: www.adobe.com/go/learn_ae_aharonextrusionhacks.
See also
“Examples of text animation” on page 295
Best practices for creating text and vector graphics for video
Text that looks good on your computer screen as you are creating it can sometimes look bad when viewed in a final
outputmovie.Thesedifferencescanarisefromthedeviceusedtoviewthemovieorfromthecompressionscheme
used to encode the movie. The same is true for other vector graphics, such as shapes in shape layers. Keep the
following in mind as you create and animate text and vector graphics for video:
•You should always preview your movie on the same sort of device that your audience will use to view it, such as
an NTSC video monitor. (See “Preview on an external video monitor” on page 126.)
•Avoid sharp color transitions, especially from one highly saturated color to its complementary color. Sharp color
transitions are difficult for many compression schemes—such as those used by MPEG and JPEG standards—to
encode. This can cause visual noise near sharp transitions. For analog television, the same sharp transitions can
cause spikes outside the allowed range for the signal, also causing noise.
•When text will be over moving images, make sure that the text has a contrasting border (such as a glow or a stroke)
so that the text is still readable when something the same color as the fill passes behind the text.
•Avoid thin horizontal elements, which can vanish from the frame if they happen to be on an even scan line during
an odd field, or vice versa. The height of the horizontal bar in a capital H, for example, should be three pixels or
greater. You can thicken horizontal elements by increasing font size, using a bold (or faux bold) style, or applying
a stroke. (See “Formatting characters” on page 278.)
•When animating text to move vertically—for scrolling credits, for example—move the text vertically at a rate in
pixelspersecondthatisanevenmultipleofthefieldratefortheinterlacedvideoformat.Thispreventsakindof
twitter that can come from the text movement being out of phase with the scan lines. For NTSC, good values
include 0, 119.88, and 239.76 pixels per second; for PAL, good values include 0, 100, and 200 pixels per second.
Apply the Autoscroll - Vertical animation preset in the Behaviors category to quickly create a vertical text crawl.
Fortunately, many problems with text in video and compressed movie formats can be solved with one simple
technique: Apply Fast Blur to the text layer, with a Blurriness setting between 1 and 2. A slight blur can soften color
transitions and cause thin horizontal elements to expand.
See also
“Apply an effect or animation preset” on page 351
Enter point text
When you enter point text, each line of text is independent—the length of a line increases or decreases as you edit
the text, but it doesn’t wrap to the next line.
AFTER EFFECTS CS3
User Guide
275
The small line through the type tool pointer marks the position of the text baseline. For horizontal text, the
baseline marks the line on which the text rests; for vertical text, the baseline marks the center axis of the characters.
When you enter point text, it is created using the properties currently set in the Character panel. You can change
these properties later by selecting the text and modifying settings in the Character panel.
1Do one of the following to create a text layer:
•Choose Layer > New > Text. A new text layer is created and an insertion point for the Horizontal Type tool appears
in the center of the Composition panel.
•Select the Horizontal Type tool or the Vertical Type tool , and then click in the Composition panel to set
an insertion point for the text.
2
Enter text characters by typing. Press Enter on the main keyboard (Windows) or Return (Mac OS) to begin a new line.
Note: You can also choose Edit > Paste to paste text that you have copied from any application that uses Unicode
characters. Text receives the formatting of the first character in the text layer into which it is pasted.
3To end text-editing mode, press Enter on the numeric keypad, select another tool, or press Ctrl+Enter (Windows)
or Command+Return (Mac OS).
Enter paragraph text
When you enter paragraph text, the lines of text wrap to fit the dimensions of the bounding box. You can enter
multiple paragraphs and apply paragraph formatting.
You can resize the bounding box at any time, which causes the text to reflow within the adjusted rectangle.
When you enter paragraph text, it has the properties set in the Character and Paragraph panels. You can change these
properties later by selecting the text and modifying settings in the Character and Paragraph panels.
1Select the Horizontal Type tool or the Vertical Type tool .
2Do one of the following in the Composition panel to create a text layer:
•Drag to define a bounding box from a corner.
•Alt-drag (Windows) or Option-drag (Mac OS) to define a bounding box around a center point.
3Enter text by typing. Press Enter on the main keyboard (Windows) or Return (Mac OS) to begin a new paragraph.
Press Shift+Enter on the main keyboard (Windows) or Shift+Return (Mac OS) to create a soft carriage return, which
begins a new line without beginning a new paragraph. If you enter more text than can fit in the bounding box, the
overflow icon appears on the bounding box.
Note: You can also choose Edit > Paste to paste text that you have copied from any application that uses Unicode
characters. Text receives the formatting of the first character in the text layer into which it is pasted.
4To end text-editing mode, press Enter on the numeric keypad, select another tool, or press Ctrl+Enter (Windows)
or Command+Return (Mac OS).
After Effects doesn’t have a direct way to enter a non-breaking space between two words, but you can create a non-
breaking space in Photoshop and copy it into After Effects. Select the two words in Photoshop (or at least the space
and the following character), and then use the Photoshop Character panel's No Break option to prevent the text from
breaking after that space. Then copy the text from Photoshop and paste it into After Effects. The two words will be treated
as independent words from the point of view of a word-based selector, but they will also stay together on a line of
paragraph text.
AFTER EFFECTS CS3
User Guide
276
Resize a text bounding box
1With a type tool active, select the text layer in the Composition panel to display the bounding box handles.
2Position the pointer over a handle—the pointer turns into a double arrow —and do one of the following:
•Drag to resize in one direction.
•Shift-drag to maintain the proportion of the bounding box.
•Ctrl-drag (Windows) or Command-drag (Mac OS) to scale from the center.
Convert point or paragraph text
Note: When you convert paragraph text to point text, all characters outside the bounding box are deleted. To avoid losing
text, resize the bounding box so that all text is visible prior to conversion.
1Using the Selection tool , select the text layer.
Note: You can’t convert the text layer if it’s in text-editing mode.
2Using a type tool, right-click (Windows) or Control-click (Mac OS) anywhere in the Composition panel, and
choose Convert To Paragraph Text or Convert To Point Text.
When you convert from paragraph text to point text, a carriage return is added at the end of each line of text, except
the last line.
To display the bounding box of paragraph text and automatically select a type tool, double-click the text layer in the
Timeline panel.
Change the direction of text
Horizontal text flows from left to right; multiple lines of horizontal text lie from top to bottom. Vertical text flows
from top to bottom; multiple lines of text lie from right to left.
A. Horizontal point text B. Horizontal point text converted to vertical C. Horizontal paragraph text D. Horizontal paragraph text converted
to vertical
1Using the Selection tool , select the text layer.
AB
CD
AFTER EFFECTS CS3
User Guide
277
Note: You can’t convert text in text-editing mode.
2Using a type tool, right-click (Windows) or Control-click (Mac OS) anywhere in the Composition panel, and
choose Horizontal or Vertical.
Convert text from Photoshop to editable text
Text layers from Photoshop retain their style and remain editable in After Effects.
If you imported the Photoshop document as merged layers, then you must first select the layer and choose Layer >
Convert To Layered Comp to decompose the imported Photoshop document into its layers.
1Add the Photoshop text layer to your composition and select it.
2Choose Layer > Convert To Editable Text.
The layer becomes an After Effects text layer and no longer uses the Photoshop text layer as its source footage item.
If the layer contains layer styles, the layer styles are converted to editable layer styles as if the Layer > Layer Styles >
Convert To Editable Styles command had been used on the layer before converting the text to editable text.
See also
“Preparing and importing Photoshop files” on page 83
“Layer styles” on page 168
Select text
1Double-click the text layer in the Timeline panel to select all text in the layer.
2Do one of the following:
•To select text, drag over the text.
•To select a range of text, click, move the pointer, and then Shift-click.
•To select a word, double-click it. To select a line, triple-click it. To select a paragraph, quadruple-click it. To select
all text in a layer, quintuple-click anywhere in the text.
•Tousethearrowkeystoselecttext,holddownShiftandpresstheRightArroworLeftArrowkey.Tousethearrow
keys to select words, hold down Shift+Ctrl (Windows) or Shift+Command (Mac OS) and press the Right Arrow
or Left Arrow key.
Edit and move text in text layers
You can edit text in text layers at any time. If you set the text to follow a path, designate it as a 3D layer, transform it,
or animate it, you can still continue to edit it.
The pointer for a type tool changes as you move it around the Composition panel. When it is directly over a text layer,
it appears as the edit text pointer ; click to edit the existing text. When the pointer is not directly over a text layer,
it appears as a new text pointer ; click to create a new text layer. Shift-click always creates a new layer.
You can drag with the move pointer in the Composition panel to move text. To activate the move pointer without
leavingtexteditingmode,movethetypetoolawayfromthetextintheCompositionpanel;whenyouseethemove
pointer , drag to move the text. You can also hold down the Ctrl (Windows) or Command (Mac OS) key to
momentarily activate the move pointer.
1To select the text and activate the type tool, double-click the text layer in the Timeline panel.
AFTER EFFECTS CS3
User Guide
278
2Edit text.
Formatting characters
Using the Character panel
Use the Character panel to format characters. If text is selected, changes you make in the Character panel affect only
the selected text. If no text is selected, changes you make in the Character panel affect the selected text layers and the
text layer’s selected Source Text keyframes, if any exist. If no text is selected and no text layers are selected, the
changes you make in the Character panel become the new defaults for the next text entry.
•To display the Character panel, choose Window > Character; or, with a type tool selected, click the panel
button in the Tools panel.
To open the Character and Paragraph panels automatically when a type tool is active, select Auto-Open Panels in
the Tools panel.
•To reset Character panel values to the default values, choose Reset Character from the Character panel menu.
Work with fonts
A font is a complete set of characters—letters, numbers, and symbols—that share a common weight, width, and style.
In addition to the fonts installed on your system, After Effects uses font files in this local folder:
Windows Program Files\Common Files\Adobe\Fonts
Mac OS X Library/Application Support/Adobe/Fonts
If you install a Type 1, TrueType, OpenType®, or CID font into the local Fonts folder, the font appears in Adobe appli-
cations only.
If the formatting for a character specifies a font that is unavailable on your computer system, another font will be
substituted, and the missing font name will appear in brackets. This sometimes occurs when you open a project on
Mac OS that was created on Windows, because the set of default fonts differs between the two operating systems.
Whenyouselectafont,youcanselectthefontfamilyanditsfontstyleindependently.Thefont family is a collection
of fonts sharing an overall typeface design; for example, Times. A font style is a variant version of an individual font
in the font family; for example, regular, bold, or italic. The range of available font styles varies with each font. If a font
doesn’t include the style you want, you can apply faux styles—simulated versions of bold, italic, superscript,
subscript, all caps, and small caps styles. If more than one copy of a font is installed on your computer, an abbrevi-
ation follows the font name: (T1) for Type 1 fonts, (TT) for TrueType fonts, or (OT) for OpenType fonts.
The font size determineshowlargethetypeappearsintheimage.InAfterEffects,theunitofmeasurementforfonts
is pixels. When a text layer is at 100% scale value, the pixel values match composition pixels one-to-one. So if you
scale the text layer to 200%, the font size will appear to double; for example, a font size of 10 pixels will look like 20
pixels. Because After Effects continuously rasterizes text, the resolution remains high when you increase the scale
values.
Note: When choosing fonts and styles from the menus in the Character panel, press Enter (Windows) or Return
(Mac OS) to accept an entry, or press Esc to exit the menu without applying a change.
AFTER EFFECTS CS3
User Guide
279
Choose a font family
•Click in the Font Family menu text box, and begin typing the name. Continue typing until the desired font family
name appears.
•To choose the previous or next font family in the menu, place the pointer over the Font Family menu text box and
use your mouse scroll wheel; or click in the Font Family menu text box, and press the Up Arrow or Down Arrow.
•ClickthearrowtotherightoftheFontFamilymenutextbox,andpressthekeyforthefirstletterofthefontfamily
name. Press the key again to advance through the font families with names that begin with that letter.
Choose a font style
•Choose from the Font Style menu in the Character panel.
•If the font family you chose does not include a bold or italic style, you can click the Faux Bold button or the
Faux Italic button in the Character panel to apply a simulated style.
Choose a font size
•Enter or select a new value for Size in the Character panel.
Use smart quotes
Smart quotes, or printer’s quotation marks, use a curved left or right quotation mark instead of straight quotation
marks.
❖Choose Use Smart Quotes from the Character panel menu.
Specify leading to control spacing between lines
❖In the Character panel, do one of the following:
•Choose the desired leading from the Leading menu .
•Select the existing leading value, and enter a new value.
•Drag the underlined leading value.
Work with text fills and strokes
For text, a fill is applied to the area inside the shape of an individual character; a stroke is applied to the outline of the
character. After Effects applies a stroke to a character by centering the stroke on the character’s path; half of the stroke
appears on one side of the path, and the other half of the stroke appears on the other side of the path.
The Character panel lets you apply both color fill and color stroke to text, control the stroke width, and control the
stacking position of the fill and stroke. You can change these properties for individual, selected characters; selected
Source Text keyframes; all text in a layer; or all text across multiple selected layers.
You can also control the compositing order of a text layer’s fill and stroke using the All Fills Over All Strokes or All
Strokes Over All Fills options, which override the Fill Over Stroke or Stroke Over Fill properties of individual
characters.
Note: For text that has per-character 3D properties, you cannot control the order of stroke and fill operations between
characters; the Fill & Stroke menu in the More Options property group in the Timeline panel is unavailable, and the All
Fills Over All Strokes and All Strokes Over All Fills options in the Character panel do nothing.
AFTER EFFECTS CS3
User Guide
280
Add a stroke (outline) to text
1Select the characters to which you want to add a stroke.
2Set a stroke size with the Stroke Width property in the Character panel.
3Set the stroke color with the Stroke Color control in the Character panel.
4Choose one of the following in the Character panel to control the stroke’s position:
Stroke Over Fill, Fill Over Stroke The stroke of only selected text appears over or behind the fill.
All Strokes Over All Fills, All Fills Over All Strokes Strokes appear over or behind fills in the entire text layer.
Change text fill or stroke color
The text you enter gets its color from the Fill Color and Stroke Color controls in the upper-right corner of the
Character panel. Select text to change its color after the text has already been entered.
•To set fill or stroke color using the color picker, click the Fill Color or Stroke Color control. To set fill or stroke
color using the eyedropper, click the eyedropper button and then click anywhere on-screen to sample the
color.
•To swap colors for fill and stroke, click the Swap Fill And Stroke button .
•To remove fill or stroke, click the No Fill Color button or No Stroke Button. Only one of these buttons is available,
depending on whether the Fill Color or Stroke Color box is forward.
•To set the fill or stroke to black or white, click the Set To Black or Set To White button.
•To bring the Fill Color or Stroke Color box forward, click it.
Specify kerning and tracking
Kerning is the process of adding or subtracting space between specific letter pairs. Tracking is the process of creating
an equal amount of spacing across a range of letters. Positive kerning or tracking values move characters apart
(increasing the spacing from the default); negative values move characters closer together (reducing the spacing from
the default).
Note: When you open a project that was last saved in After Effects 6.0, text in the project may lie differently than in After
Effects 6.0 because of improvements in kerning behavior.
You can automatically kern type using metrics kerning or optical kerning. Metrics kerning uses kern pairs, which are
included with most fonts. Kern pairs contain information about the spacing of specific pairs of letters such as LA,To,
Tr,Ta,Tu,Te,Ty,Wa,WA ,We,Wo,Ya ,andYo . After Effects uses metrics kerning by default so that specific pairs are
automatically kerned when you import or type text.
Some fonts include robust kern-pair specifications. For other fonts, or for two different typefaces or sizes in a line,
you may want to use the optical kerning option. Optical kerning adjusts the spacing between adjacent characters
based on their shapes. You can also use manual kerning, which is ideal for adjusting the space between two letters.
Tracking and manual kerning are cumulative, so you can first adjust individual pairs of letters and then tighten or
loosen a block of text without affecting the relative kerning of the letter pairs.
Note: Values for kerning and tracking affect Japanese text, but normally these options are used to adjust the aki (spacing)
between Roman characters.
Alan Shisko provides a blog post and video tutorial on kerning: www.adobe.com/go/learn_ae_alankerning.
AFTER EFFECTS CS3
User Guide
281
Tracking set to default value of 0 (left), Tracking set to -50 (center), and Tracking set to 200 (right)
•To use a font’s built-in kerning information, choose Metrics from the Kerning menu in the Character panel.
•To adjust kerning manually, click between two characters with a type tool, and set a numeric value for Kerning
in the Character panel.
Note: If a range of text is selected, you can’t manually kern the characters. Instead, use tracking.
•To specify tracking, set a numeric value for Tracking in the Character panel.
Adjust scale or specify baseline shift
Horizontal scale and vertical scale specify the proportion between the height and width of the text. Unscaled
characters have a value of 100%. You can adjust scale to compress or expand selected characters in both width and
height.
Baseline shift controls the distance that text appears from its baseline, either raising or lowering the selected text to
create superscripts or subscripts.
•To adjust scale, enter a new percentage for Horizontal Scale or Vertical Scale in the Character panel, or
drag the underlined value.
•To specify baseline shift, set a value for Baseline Shift in the Character panel. A positive value moves horizontal
text above and vertical text to the right of the baseline; a negative value moves text below or to the left of the
baseline.
Change the case of text
You can enter or format text as uppercase characters, either all caps or small caps. When you format text as small
caps, After Effects uses the small caps designed as part of the font, if they are available. If the font does not include
small caps, After Effects generates faux small caps.
Note: Small Caps formatting will not change characters that were originally typed in uppercase.
•Click the All Caps button or the Small Caps button in the Character panel.
•Choose All Caps or Small Caps from the Character panel menu.
Format as superscript or subscript
Superscript characters are reduced in size and shifted above the text baseline; subscript characters are reduced in size
and shifted below the text baseline. If the font does not include superscript or subscript characters, After Effects
generates faux superscript or subscript characters.
•Click the Superscript button or the Subscript button in the Character panel.
•Choose Superscript or Subscript from the Character panel menu.
AFTER EFFECTS CS3
User Guide
282
Blend overlapping characters in a text layer
1In the Timeline panel, expand the text layer and the More Options group.
2Choose a blending mode from the Inter-Character Blending menu.
Note: To blend a text layer with the layers beneath it, specify a blending mode from the Modes column in the Timeline
panel.
Inter-character blending is not available for text layers with per-character 3D properties.
See also
“Blending modes” on page 163
“Work with per-character 3D text properties” on page 293
Work with Chinese, Japanese, and Korean text
After Effects provides several options for working with Chinese, Japanese, and Korean (CJK) text. Characters in CJK
fonts are often referred to as double-byte characters because they require more than one byte of information to
express each character.
To display CJK font name in English, choose Show Font Names In English from the Character panel menu.
Adjust tsume
Tsume reduces the space around a character by a specified percentage value. The character itself is not stretched or
squeezed as a result. When tsume is added to a character, spacing around both sides of the character is reduced by
an equal percentage.
1Select the characters you want to adjust.
2In the Character panel, enter or select a percentage for Tsume . The greater the percentage, the tighter the
compression between characters. At 100% (the maximum value), there is no space between the character’s bounding
box and its em box.
Specify how leading is measured
1Select the paragraphs you want to adjust.
2Choose Top-To-Top Leading or Bottom-To-Bottom Leading from the Paragraph panel menu. A check mark
indicates which option is selected.
Use tate-chuu-yoko
Tate-chuu-yoko (also called kumimoji and renmoji) is a block of horizontal text laid out within a vertical text line.
AFTER EFFECTS CS3
User Guide
283
Original layer (left) and after tate-chuu-yoko is applied (right)
1Select the characters that you want to rotate.
2Choose Tate-Chuu-Yoko from the Character panel menu. (A check mark indicates that the option is turned on.
To turn the option off, choose Tate-Chuu-Yoko again.)
Using tate-chuu-yoko does not prevent you from editing and formatting text; you can edit and apply formatting
options to rotated characters as you do to other characters.
Formatting paragraphs
Work with the Paragraph panel
A paragraph is any range of text with a carriage return at the end. Use the Paragraph panel to set options that apply
to entire paragraphs, such as the alignment, indentation, and leading (line spacing). For point text, each line is a
separate paragraph. For paragraph text, each paragraph can have multiple lines, depending on the dimensions of the
bounding box.
If the insertion point is in a paragraph or text is selected, changes you make in the Paragraph panel affect only
paragraphs that are at least partially selected. If no text is selected, changes you make in the Paragraph panel affect
the selected text layers and the text layer’s selected Source Text keyframes, if any exist. If no text is selected and no
text layers are selected, the changes you make in the Paragraph panel become the new defaults for the next text entry.
•To display the Paragraph panel, choose Window > Paragraph; or, with a type tool selected, click the panel
button in the Tools panel.
To open the Character and Paragraph panels automatically when a type tool is active, select Auto-Open Panels in
the Tools panel.
•To reset values in the Paragraph panel to the default values, choose Reset Paragraph from the Paragraph panel menu.
Align and justify text
You can align text to one edge of a paragraph (left, center, or right for horizontal text; top, center, or bottom for
vertical text) and justify text to both edges of a paragraph. Alignment options are available for both point text and
paragraph text; justification options are available only for paragraph text.
•To specify alignment, in the Paragraph panel, click an alignment option:
Aligns horizontal text to the left, leaving the right edge of the paragraph ragged.
Aligns horizontal text to the center, leaving both edges of the paragraph ragged.
AFTER EFFECTS CS3
User Guide
284
Aligns horizontal text to the right, leaving the left edge of the paragraph ragged.
Aligns vertical text to the top, leaving the bottom edge of the paragraph ragged.
Aligns vertical text to the center, leaving both the top and bottom edges of the paragraph ragged.
Aligns vertical text to the bottom, leaving the top edge of the paragraph ragged.
•To specify justification for paragraph text, in the Paragraph panel, click a justification option:
Justifies all horizontal lines except the last, which is left-aligned.
Justifies all horizontal lines except the last, which is center-aligned.
Justifies all horizontal lines except the last, which is right-aligned.
Justifies all horizontal lines including the last, which is force-justified.
Justifies all vertical lines except the last, which is top-aligned.
Justifies all vertical lines except the last, which is center-aligned.
Justifies all vertical lines except the last, which is bottom-aligned.
Justifies all vertical lines including the last, which is force-justified.
Indent and space paragraphs
Indentation specifies the amount of space between text and the bounding box or line that contains the text. Inden-
tation affects only the selected paragraph or paragraphs, so you can easily set different indentations for paragraphs.
•To indent paragraphs, enter a value in the Paragraph panel for an indentation option:
Indent Left Margin Indents text from the left edge of the paragraph. For vertical text, this option controls the inden-
tation from the top of the paragraph.
Indent Right Margin Indents text from the right edge of the paragraph. For vertical text, this option controls the
indentation from the bottom of the paragraph.
Indent First Line Indents the first line of text in the paragraph. For horizontal text, the first line indent is relative to
the left indent; for vertical text, the first line indent is relative to the top indent. To create a first line hanging inden-
tation, enter a negative value.
•To change space above or below paragraphs, enter a value in the Paragraph panel for Space Before and Space
After .
Specify hanging punctuation for Roman fonts
Hanging punctuation controls whether punctuation marks fall inside or outside the margins. If hanging punctuation
is turned on for Roman fonts, then periods, commas, single quotation marks, double quotation marks, apostrophes,
hyphens, em dashes, en dashes, colons, and semicolons appear outside the margins.
❖Choose Roman Hanging Punctuation from the Paragraph panel menu. A check mark indicates that the option is
selected.
Note: When you use Roman Hanging Punctuation, any double-byte punctuation marks available in Chinese, Japanese,
and Korean fonts in the selected range will not appear outside the margins.
AFTER EFFECTS CS3
User Guide
285
Text composition methods
Theappearanceoftextonthepagedependsonacomplexinteractionofprocessescalledtext composition.Usingthe
word spacing, letter spacing, and glyph spacing options you’ve selected, After Effects evaluates possible line breaks
and chooses the one that best supports the specified parameters.
After Effects offers two composition methods, which you choose from the Paragraph panel menu:
Adobe Single-line Composer Offers a traditional approach to composing text one line at a time. This option is useful
if you prefer to have manual control over how lines break. If spacing must be adjusted, the Single-line Composer first
tries to compress, rather than expand text.
Adobe Every-line Composer Considers a network of break points for a range of lines and thus can optimize earlier
lines in the paragraph in order to eliminate especially unattractive breaks later on. Working with multiple lines of
text results in more even spacing and fewer hyphens. The Every-line Composer approaches composition by identi-
fying possible breakpoints, evaluating them, and assigning a weighted penalty based on these principles:
•Highest importance is given to evenness of letter and word spacing. Possible breakpoints are evaluated and
penalized according to how much they deviate from optimal spacing.
•After breakpoint penalty values are identified for a range of lines, they are squared, magnifying the bad break-
points. The composer then uses the good breakpoints.
Animating text
About text animation
As with other layers in After Effects, you can animate text layers. However, text layers offer additional animation
options. You can animate text layers by using any of the following methods:
•Animate the Transform properties, as you would any other layer, to change the entire layer, not its text contents.
•Apply text animation presets.
•Animate the source text of the layer, so that the characters themselves change to different characters or use
different character or paragraph formats over time.
•Use text animators and selectors to animate many properties of individual characters or a range of characters.
To see a video tutorial on animating text, visit the Adobe website at www.adobe.com/go/vid0226.
To smooth the edges and movement of animated text, enable motion blur for the text layer. See “Use motion blur”
on page 200 for more information.
See also
“About animation, keyframes, and expressions” on page 183
“Apply an effect or animation preset” on page 351
Text animation presets
Browse and apply text animation presets as you would any other animation presets.
AFTER EFFECTS CS3
User Guide
286
The text animation presets were created in an NTSC DV 720 x 480 composition, and each text layer uses 72-point
Myriad Pro. Some preset animations move the text on, off, or through the composition. The animation preset
position values may not be appropriate for a composition that is much larger or smaller than 720 x 480; for example,
an animation that is supposed to start off-screen may start on-screen. You may need to adjust the text animator’s
position values.
If the text isn't positioned as expected or the text disappears unexpectedly, adjust the text animator's position values
in the Timeline panel or Composition panel.
After you apply a 3D Text animation preset, you may need to rotate the layer or add a camera to rotate around the
layer to see the results of the 3D animation.
Text animation presets in the Paths category automatically replace the source text with the preset's name, change the
font color to white, and may change other character properties.
The Fill And Stroke category of animation presets contains presets that may change the fill color and stroke
properties of the preset that you apply. If the animation preset requires a stroke or fill color, the animation works only
if you have assigned one to your text.
You can download additional animation presets that take advantage of per-character 3D text animation from the
Adobe After Effects Exchange: www.adobe.com/go/learn_ae_cs3additionalanimationpresets.
See also
“About animation presets” on page 347
“Apply an effect or animation preset” on page 351
Animate text with text animators
Animating text with animators and selectors consists of three basic steps:
•Add an animator to specify which properties to animate.
•Use a selector to specify how much each character is affected by the animator.
•Adjust the animator properties.
Note: To always affect all characters in the layer, delete the default selector. In this case, animating a text layer is not
significantly different from animating any other layer.
Usually, you don’t need to set keyframes or expressions for the animator properties. It’s common to only set
keyframes or expressions for the selector and specify only the ending values for the animator properties.
For example, to animate opacity gradually from the first character to the last, you can add an animator for Opacity,
set the Opacity value (in the Animator property group) to 0, and then set keyframes for the default selector’s End
property to 0% at 0 seconds and 100% at a later time.
You may find it easier to think in terms of numbers of characters than percentages for a range selector’s Start and
End properties. To show these properties in numbers of characters (including spaces), choose Index for Units in the
Advanced property group of a range selector.
You can create elaborate animations using several animators and several selectors, each of which adds its influence
to the text animation.
To download a project that demonstrates and explains the use of text animators and selectors, see the After Effects
Exchange website: www.adobe.com/go/learn_ae_textanimationproject.
AFTER EFFECTS CS3
User Guide
287
Harry Frank provides a tutorial on animating text with text animators on the Digital Arts Online website:
www.adobe.com/go/learn_ae_harrytextanimators.
Animating the opacity of a text layer using the Opacity animator and the End property
1Select a text layer in the Timeline panel, or select the specific characters that you want to animate in the Compo-
sition panel.
2Do one of the following:
•Choose Animation > Animate Text and then choose a property from the menu.
Note: The Enable Per-Character 3D menu item does not add an animator. It adds 3D properties to the layer and to the
individual characters, for which you can then add animators.
•Choose a property from the Animate menu, located in the Switches/Mode column of the Timeline panel.
Animate menu
3In the Timeline panel, adjust the animator property values. Often, you simply set the property that you want to
animate to its ending value and then use the selectors to control everything else.
4Expand the Range Selector property group and set keyframes for Start or End properties by clicking the stopwatch
for the property and doing one of the following:
•Set the values for Start and End in the Timeline panel.
•Drag the selector bars in the Composition panel. The pointer changes to the selector movement pointer when
it is over the middle of a selector bar.
5To refine the selection, expand Advanced and specify options and values as desired.
AFTER EFFECTS CS3
User Guide
288
Work with animator properties
Animator properties work much like other layer properties, except that their values only influence the characters that
are selected by the animator group’s selectors. Choose Enable Per-Character 3D to add 3D properties to a text layer;
this does not add properties to an animator group.
•To add an animator group to a text layer, select the text layer in the Timeline panel, and choose a property from
the Animation > Animate Text menu or from the layer’s Animate menu in the Switches/Modes column in the
Timeline panel. A new animator group, along with a default selector and the chosen animator property, appears
in the Timeline panel.
•To add a new animator property to an existing animator group, select the animator group in the Timeline panel,
and choose the property from Animation > Animate Text menu or from the animator group’s Add menu in the
Timeline panel. The new animator property appears within the same group as the existing animator property and
shares the existing selectors.
•To delete an animator property or animator group, select it in the Timeline panel and press Delete.
•To remove animators from a text layer, select the text layer in the Timeline panel, and choose Animation > Remove
All Text Animators.
•Tocopyananimatorgroup,selectitintheTimelinepanelandchooseEdit>Copy.Topastetheananimatorgroup,
select a layer and choose Edit > Paste.
•To rename an animator group, make sure that it is the only thing selected, and then press Enter (Windows) or
Return (Mac OS).
•To reorder an animator group, drag it to a new location in the stacking order in the Timeline panel.
Animator properties
Anchor Point Anchor point for the characters. This is the point about which transformations—such as scaling and
rotation—are performed.
Position The position of the characters. You can specify values for this property in the Timeline panel, or you can
modify it by selecting it in the Timeline panel and then dragging the layer in the Composition panel using the
Selection tool, which changes to a move tool when positioned over text characters. Dragging with the move tool
does not affect the z (depth) component of Position.
Scale Thescaleofthecharacters.Becausescaleisrelativetotheanchorpoint,changestothezcomponentofScale
have no apparent result unless the text also has an Anchor Point animator with a non-zero z value.
Skew The slant of the characters. The Skew Axis specifies the axis along which the character is skewed.
Rotation, X Rotation, Y Rotation, Z Rotation If per-character 3D properties are enabled, you can set the rotation
about each axis individually. Otherwise, only Rotation (which is the same as Z Rotation) is available.
All Transform Properties All of the Transform properties are added at once to the animator group.
Line Anchor The alignment for the tracking in each line of text. A value of 0% specifies left alignment, 50% specifies
center alignment, and 100% specifies right alignment.
Line Spacing The space between lines of text in a multiline text layer.
Character Offset The number of Unicode values to offset selected characters. For example, a value of 5 moves the
characters in the word forward five steps alphabetically, so the word offset becomes tkkxjy.
Character Value The new Unicode value for selected characters, replacing each character with one character repre-
sented by the new value. For example, a value of 65 replaces all of the characters in a word with the 65th Unicode
character (A), so the word value becomes AAAAA.
AFTER EFFECTS CS3
User Guide
289
Character Range Specifies limits on the character. This property appears whenever you add the Character Offset or
Character Value property to a layer. Choose Preserve Case & Digits to keep characters in their respective groups.
Groups include uppercase Roman, lowercase Roman, digits, symbols, Japanese katakana, and so forth. Choose Full
Unicode to allow for unlimited character changes.
Blur The amount of Gaussian blur to be added to the characters. Horizontal and vertical blur amounts can be
specified separately.
Work with selectors
Each animator group includes a default range selector. You can replace the default selector, add additional selectors
to an animator group, and remove selectors from a group.
To download a project that demonstrates and explains the use of text animators and selectors, see the After Effects
Exchange website: www.adobe.com/go/learn_ae_textanimationproject.
Selectors are a lot like masks: You use selectors to specify which part of a range of text you want to affect, and by how
much. You can use multiple selectors and specify a Mode setting for each one to determine how it interacts with the
text and with other selectors in the same animator group. If you have only one selector, Mode specifies the interaction
between the selector and the text—Add is the default behavior; and Subtract inverts the influence of the selector.
If you delete all selectors from an animator group, the values of the animator properties apply to all characters in the
layer. This is useful because properties of the text specified by the Character panel cannot otherwise be animated
(except by using Hold keyframes on the Source Text property itself).
Use a Wiggly selector to vary a selection within a specified amount over time. Use expression selectors to use expres-
sions to dynamically specify how much you want characters to be affected by an animator property.
•To add a selector using the Timeline panel, select an animator group in the Timeline panel and choose Selector
from the animator group’s Add menu, or choose Animation > Add Text Selector. Choose Range, Wiggly, or
Expression from the submenu.
•To add a selector using the Composition panel, select a range of characters in the Composition panel, right-click
(Windows) or Control-click (Mac OS) the text, and choose Add Text Selector from the context menu. Choose
Range, Wiggly, or Expression from the submenu.
•To delete a selector, select it in the Timeline panel and press Delete.
•To rename a selector, make sure that it is the only thing selected, and then press Enter (Windows) or Return
(Mac OS).
•To copy a selector, select it in the Timeline panel and choose Edit > Copy. To paste the selector, select a layer and
choose Edit > Paste.
•To reorder a selector, drag it to a new location in the stacking order in the Timeline panel.
Adding a new range selector to an animator group
AFTER EFFECTS CS3
User Guide
290
See also
“Working with expressions” on page 547
“Mask modes” on page 260
Common selector properties
Mode Specifies how each selector combines with the text and with selector above it, similar to how multiple masks
combine when you apply a mask mode. For example, if you want to wiggle only a specific word, use a range selector
on that word and then add a Wiggly selector and set it to Intersect mode.
Amount Specifies how much the range of characters is affected by animator properties. At 0%, the animator
properties do not affect the characters. At 50%, half of each property value affects the characters. This option is useful
for animating the result of animator properties over time. Using an expression selector, you can use expressions to
dynamically set this option.
Units and Based OnThe units for Start, End, and Offset. You can use either the percentage or index units and base
the selection on the characters, characters excluding spaces, words, or lines. If you select Characters, After Effects
counts spaces and effectively pauses the animation between words as it animates the spaces between words.
Original (left) and with VEN selected by the range selectors, Based On set to Character, Shape set to Triangle, and Scale set to 40% (right)
Range selector properties
Range selectors include the following properties, in addition to properties common with other selectors:
Start and End The beginning and end of the selection. You can modify the Start and End properties by dragging the
selector bars in the Composition panel when the selector is selected in the Timeline panel.
Offset
The amount to offset the selection from that specified by the Start and End properties. To set Offset in the Compo-
sition panel while you edit the Start or End values, Shift-click the Start or End selector bars with the Selection tool.
Shape Controls how characters are selected between the Start and End of the range. Each option modifies the
selection by creating transitions between selected characters using the chosen shape. For example, when animating
the y Position values of text characters using Ramp Down, the characters gradually move at an angle from bottom
left to upper right. You can specify Square, Ramp Up, Ramp Down, Triangle, Round, and Smooth.
Original (left) and after selecting the entire word, setting Based On to Characters, animating the y Position value so that the word is at the
bottom of the frame, and setting Shape to Ramp Down (right)
Using different Shape options, you can significantly change the appearance of an animation.
AFTER EFFECTS CS3
User Guide
291
Setting Shape to Triangle
Smoothness Determines the amount of time the animation takes to transition from one character to another when
you use the Square shape.
Ease High and Ease Low Determines the speed of change as selection values change from fully included (high) to
fully excluded (low). For example, when Ease High is 100%, the character changes more gradually (eases into the
change) while it is fully to partially selected. When Ease High is -100%, the character changes quickly while it is fully
to partially selected. When Ease Low is 100%, the character changes more gradually (eases into the change) while it
is partially selected to unselected. When Ease Low is -100%, the character changes quickly while it is partially
selected to unselected.
Randomize Order Randomizes the order in which the property is applied to the characters specified by the Range
selector. (By contrast, when you use the Wiggly selector, the value of the animator property is randomized.)
Random Seed Calculates the randomized order of a range selector when the Randomize Order option is set to On.
When Random Seed is zero, the seed is based on its animator group. If you want to duplicate an animator group and
retain the same randomized order as in the original animator group, set Random Seed to a value other than zero.
Wiggly selector properties
The Wiggly selector includes the following properties, in addition to properties common with other selectors:
Max Amount and Min Amount Specifies the amount of variation from the selection.
Wiggles/Second How many variations from the set selection occur per second.
Correlation Correlation between variations for each character. At 100%, all characters wiggle by the same amount at
the same time, and at 0%, all characters wiggle independently.
Temporal and Spatial Phase (revolutions + degrees) The variation of wiggle, based on the phase of your animation
in time (temporal) or per character (spatial).
Lock Dimensions Scales the wiggled selection’s dimensions by the same value. This is useful when wiggling the Scale
property.
Random Seed Changes the starting time for the animation by a specified value. When the seed is left at zero, a
default value is derived based on the layer index and stream path.
Expression selector properties
Expand the Expression Selector property group and the Amount property group to reveal the expression field in the
Timeline panel. By default, the Amount property begins with the expression selectorValue *
textIndex/textTotal.
Expression selectors allow you to express the selector values for each character. The expression is evaluated once per
character. Each time it is evaluated, the input parameter textIndex is updated to match the index of the character.
Apply the Text Bounce or Inch Worm animation preset to a text layer to see how expression selectors can be used. To
see all expressions on a layer, select the layer and press EE.
AFTER EFFECTS CS3
User Guide
292
Inadditiontotheexpressionelementsyouuseelsewhere,youcanusethefollowingattributestoanimateselections
in any number of interesting ways:
textIndex Returns the index of the character, word, or line.
textTotal Returns the total number of characters, words, or lines.
selectorValue Returns the value of the previous selector. Think of this as the input from the selector above the
expression selector in the stacking order.
Note: The attributes textIndex,textTotal,andselectorValue canbeusedonlywiththeexpressionselector.Using
them elsewhere results in a syntax error.
Fill color changes randomly using an expression animator.
Set a text layer’s anchor point properties
Text animators animate character position, rotation, and size-related properties relative to an anchor point. You can
use the text property, Anchor Point Grouping, to specify whether the anchor point used for transformations is that
of each character, each word, each line, or the entire text block. In addition, you can control the alignment of the
characters’ anchor points relative to the anchor point of the group with the Grouping Alignment property.
Original text, then rotated and with Grouping Alignment set to Character, Word, and Line
1Expand the text layer in the Timeline panel, and expand the More Options property group.
AFTER EFFECTS CS3
User Guide
293
2Do any of the following:
•Choose how to group the text layer’s character anchor points from the Anchor Point Grouping menu.
•Lower the Grouping Alignment values to move each anchor point up and to the left.
•Raise the Grouping Alignment values to move each anchor point down and to the right.
To center the anchor point in a string of capital letters, try a Grouping Alignment value of 0%, -50%. To center the
anchor point in a string of lowercase letters, or if you’re using both lowercase and uppercase letters, try 0%, -25%.
Work with per-character 3D text properties
You can move, scale, and rotate individual characters in three dimensions using 3D animator properties. These
properties become available when you enable per-character 3D properties for the layer. Position, Anchor Point, and
Scale gain a third dimension; and two additional Rotation properties (X Rotation and Y Rotation) become available.
The single Rotation property for 2D layers is renamed to Z Rotation.
Enabling per-character 3D properties causes each character in the text layer to behave like an individual 3D layer
within the text layer, which behaves like a precomposition with collapsed transformations. Per-character 3D layers
intersect with other 3D layers following the standard rules for 3D precompositions with collapsed transformations.
A text layer itself automatically becomes a 3D layer when you enable 3D properties for its characters; this occurs
implicitly whenever a per-character 3D property is added to the layer—whether by copying and pasting the Y
Rotation property from another layer or applying a 3D Text animation preset.
A per-character 3D layer is designated by a special icon in the layer’s Switches column.
Inter-character blending and the Fill & Stroke options in the More Options property group are not available for per-
character 3D layers.
Per-character 3D layers can decrease rendering performance. When you convert a layer from per-character 3D to
2D, the animator properties and dimensions specific to per-character 3D layers are lost. Re-enabling per-character
3D will not restore values for these properties.
You can download additional animation presets that take advantage of per-character 3D text animation from the
Adobe After Effects Exchange: www.adobe.com/go/learn_ae_cs3additionalanimationpresets.
•To enable per-character 3D animator properties for a text layer, select the layer and choose Enable Per-character
3D from the Animation > Animate Text menu or from the layer’s Animate menu in the Timeline panel.
•To disable per-character 3D animator properties for a text layer and convert the layer to a 2D layer, click the layer’s
Per-character 3D switch in Switches column in the Timeline panel.
•To disable per-character 3D animator properties for a text layer but keep it as a 3D layer, choose Enable Per-
character 3D to deselect it.
See also
“Example: Animate characters with per-character 3D properties” on page 295
Creating and animating text on a path
Once you create a mask on a text layer, you can make the text follow the mask as a path. You can then animate the
text along that path, or animate the path itself. You can use open or closed masks to create paths for text. After you
create the path, you can modify it at any time. When using a closed mask as a text path, make sure to set the mask
mode to None.
AFTER EFFECTS CS3
User Guide
294
See also
“Creating and importing masks” on page 254
“Mask modes” on page 260
Position text along a mask’s path
1Create a text layer and enter text.
2With the text layer selected, use the Pen tool or a mask tool to draw a mask in the Composition panel.
3In the Timeline panel, expand the Path Options property group for the text layer and select the mask from the
Path menu. The text automatically uses the alignment specified in the Paragraph panel.
4To reposition the text on the path, change the text margins using the First Margin and Last Margin properties in
the Timeline panel, or do one of the following in the Composition panel:
•Drag the left margin control , center margin control , or right margin control to move text along the path.
•Shift-drag any margin control to snap the control to the mask vertices.
Note: Select a property in the Text property group in the Timeline panel to see the margin controls in the Composition
panel. The text alignment determines which controls are available.
Changing the Last Margin of path text in the Composition panel
Text path properties
Use the Path Options properties to specify a path and alter the way that individual characters appear on the path—
perpendicular to the path, aligned to the left or right, reversed, and so on. Animating Path Options properties is an
easy way to animate text along a path.
Reverse Path Reverses the direction of the path.
Perpendicular To Path Rotates each character so that it is perpendicular to the path.
Force Alignment Positions the first character at the beginning of the path (or at the specified First Margin location),
positions the last character at the end of the path (or at the specified Last Margin location), and evenly spaces the
remaining characters between the first and last characters.
First Margin Specifies the position of the first character in pixels, relative to the start of the path. First Margin is
ignored when text is right-aligned and Force Alignment is Off.
Last Margin Specifies the position of the last character in pixels, relative to the end of the path. Last Margin is
ignored when text is left-aligned and Force Alignment is Off.
AFTER EFFECTS CS3
User Guide
295
Examples of text animation
For examples of using an expression on the Source Text property to animate text to overcome some of the limitations
of the Numbers effect, see these posts by Rick Gerard on the Adobe user-to-user forums:
www.adobe.com/go/learn_ae_rickcountingexpression1 and
www.adobe.com/go/learn_ae_rickcountingexpression2. Colin Brailey provides a tutorial and example project that
show how to use an expression on the Source Text property and a null control layer to achieve a similar result:
www.adobe.com/go/learn_ae_colincountingexpression.
Example: Animate characters with per-character 3D properties
This example illustrates how you can easily animate individual characters in 3D so that each character steps out of
line and takes a bow.
1Create a new composition.
2Create a new text layer with the word ovation.
3Choose Animation > Animate Text > Enable Per-character 3D.
4Choose Animation > Animate Text > Position.
5Choose Animation > Animate Text > Rotation.
6In the Timeline panel, in the Animator group, set the X Rotation property to 45, and set the Position value to (0.0,
0.0, -100.0).
7Expand Range Selector 1.
8Click the stopwatch icon for the Offset property to set an initial keyframe with the value at 0 seconds.
9Set the Offset property value to -15%.
10 Set the End property value to 15%.
11 Move the current-time indicator to 10 seconds, and set the Offset value to 100%.
12 Press the R key to show the Rotation properties for the entire layer.
13 Set the Y Rotation value for the layer to -45. This rotates the entire layer so that you can more easily see the 3D
motion of the characters.
14 Preview the composition.
Example: Offset characters
Thisexampleillustrateshowyoucaneasilyanimaterandomcharacterssothattheygraduallyformalegiblewordor
phrase. To do this, specify a Character Offset value and animate the range selector.
AFTER EFFECTS CS3
User Guide
296
Animating the offset values for the characters in the word Galaxy
1Create a new composition.
2Create a new text layer with the word Galaxy.
3Choose Animation > Animate Text > Character Offset.
4In the Timeline panel, set the Character Offset value to 5.
5Expand Range Selector 1.
6Click the Start stopwatch to set an initial keyframe at 0 seconds and set the value to 0%.
7Move the current-time indicator to 5 seconds and set the Start value to 100%.
8Set Character Alignment to Center.
9Preview the composition.
See also
“Create a composition” on page 108
“Enter point text” on page 274
“Work with selectors” on page 289
“Set keyframes” on page 187
“Preview video and audio” on page 120
Example: Animate characters with the Wiggly selector
This example demonstrates how easy it is to animate the position of individual characters. It also shows how the
Wiggly selector can create a dramatic change to the animation simply by adding it to the layer.
AFTER EFFECTS CS3
User Guide
297
Animating the color and position of the characters in the word Galaxy
1Create a new composition.
2Create a new text layer with the word Galaxy and set the color to blue in the Character panel.
3Choose Animation > Animate Text > Position.
4In the Timeline panel, drag the Position property’s y value to the left until all the characters are off the screen.
5Expand Range Selector 1.
6Click the Start stopwatch and leave it at 0% at 0 seconds; then move the current-time indicator to 5 seconds and
set Start to 100%.
7Preview the composition.
8Collapse the Animator 1 group.
9Make sure that nothing is selected except the text layer name in the Timeline panel, and choose Fill Color > Hue
from the Animate menu. A new animator group, Animator 2, appears in the Timeline panel.
10 Set Fill Hue to 1 x +0.0.
11 Expand the Range Selector 1 for Animator 2.
12 Click the Start stopwatch and leave it at 0% at 0 seconds; then move the current-time indicator to 5 seconds and
set Start to 100%.
13 Preview the animation. The colors change now as they drop from the top of the screen, but they all use the same
color and end up the same, original color.
14 With Fill Hue selected, choose Selector > Wiggly from the Add menu.
15 Expand the Wiggly Selector 1 property and choose Add from the Mode menu.
16 Preview the composition.
Note: If you add the Fill Hue property to Animator 1 and then add the Wiggly selector, both the position and the colors
wiggle, instead of just the colors.
See also
“Create a composition” on page 108
“Enter point text” on page 274
“Work with selectors” on page 289
“Set keyframes” on page 187
“Preview video and audio” on page 120
Example: Animate text tracking
This example shows you how easy it is to isolate characters when tracking a line of text. Using the Tracking and Line
Anchor animator properties, you can easily move all but one or a few characters.
AFTER EFFECTS CS3
User Guide
298
Animating the tracking values for the characters 3579 (left and center) so that only the 7 in the middle remains (right)
1Create a new composition.
2Create a new text layer and type 3579.
3With the text layer selected, click the Center Text button in the Paragraph panel.
4Choose View > Show Grid.
5In the Timeline panel, select the text layer and choose Animation > Animate Text > Tracking.
6Make sure that Before & After is specified in the Track Type menu.
7Click the Tracking Amount stopwatch and leave the value 0 at 0 seconds.
8Move the current-time indicator to 5 seconds and drag the Tracking Amount value until all characters are off the
screen.
9Preview the animation.
10 With the current-time indicator at 0, take a snapshot of the Composition panel. You will use this, and the grids,
to determine the original location of the number 7 at the end of the animation.
11 Move the current-time indicator to 5 seconds.
12 Click the Show Last Snapshot button.
13 In the Timeline panel, select Animator 1 and choose Line Anchor from the Add menu.
14 Drag the Line Anchor value until the 7 is positioned in approximately its original position in the center of the
Composition panel.
15 Click the Show Last Snapshot button in the Composition panel to see the exact location of the 7 in its original
location. Adjust the Line Anchor value to position the character in the original location.
16 Preview the animation.
See also
“Create a composition” on page 108
“Enter point text” on page 274
“Work with selectors” on page 289
“Work with snapshots” on page 125
“Set keyframes” on page 187
“Preview video and audio” on page 120
Example: Use selectors to animate specific words
There are many ways to use selectors. This example shows how you can use them to limit an animation to a specific word.
AFTER EFFECTS CS3
User Guide
299
Animating the skew values in the characters in the word Speeding
1Create a new composition.
2Create a new text layer with the words Speeding Saucer.
3Choose Animation > Animate Text > Skew.
4In the Timeline panel, set the Skew value to 35.
5Expand Range Selector 1.
6Make sure the current-time indicator is at 0 seconds and click the End stopwatch.
7In the Composition panel, drag both selector bars to the left side of the S in Speeding.
8Move the current-time indicator to 2 seconds and drag the right selector bar to the right side of the gin Speeding.
9Preview the composition.
See also
“Create a composition” on page 108
“Enter point text” on page 274
“Work with selectors” on page 289
“Set keyframes” on page 187
“Preview video and audio” on page 120
Example: Create a write-on animation
You can easily create the appearance of writing on the screen by using the Opacity animator property.
Writing text on using the Opacity property
1Create a new composition.
2Create a text layer with the characters 01234.
3Choose Animation > Animate Text > Opacity.
4Set Opacity to 0%.
5Expand the Range Selector 1 and click the stopwatch icon for Start.
6In the Composition panel, drag the start selector to the left edge of the text (the value will be at 0).
AFTER EFFECTS CS3
User Guide
300
7Move the current-time indicator to 5 seconds and drag the start selector in the Composition panel to the right
edge of the text (the value will be 5).
8Preview the composition.
Note: By default, the Smoothness property is set to 100%. To create a typewriter appearance, expand the Advanced
property and set Smoothness to 0%.
See also
“Create a composition” on page 108
“Enter point text” on page 274
“Work with selectors” on page 289
“Set keyframes” on page 187
“Preview video and audio” on page 120
Example: Animate text with multiple selectors
This example uses the selectorValue parameter with the Wiggly selector to make a string of characters flash on
and off randomly.
1Create a new composition.
2Create a new text layer.
3In the Timeline panel, choose Opacity from the text layer’s Animate menu.
4Expand the text layer and its animator in the Timeline panel.
5Select the Range Selector and delete it.
6Choose Add > Selector > Wiggly next to the text layer’s Animator property group.
7Choose Add > Selector > Expression. If the Wiggly selector doesn’t come before the Expression selector, drag the
Wiggly selector above the Expression selector.
8Expand the Expression Selector.
9Expand the Amount property to reveal the expression. The following expression appears by default:
selectorValue * textIndex/textTotal
10 Replace the default expression text with the following expression:
r_val=selectorValue[0];
if(r_val < 50)r_val=0;
if(r_val > 50)r_val=100;
r_val
11 Set the opacity to 0%, and preview the composition.
See also
“Create a composition” on page 108
“Enter point text” on page 274
“Work with selectors” on page 289
“Set keyframes” on page 187
“Preview video and audio” on page 120
AFTER EFFECTS CS3
User Guide
301
Example: Animate text position with expressions
This example uses the textIndex and textTotal attributes with the wiggle expression to animate a line of text.
1Create a new composition.
2Create a new text layer.
3Expand the text layer in the Timeline panel to view the text properties. Add a Position animator group from the
Animate menu.
4Delete the default Range selector, Range Selector 1.
5Add an Expression selector by selecting the Add menu, then choosing Selector > Expression. Expand the
Expression selector to reveal its options.
6Expand the Amount property to reveal the expression. The following expression appears by default:
selectorValue * textIndex/textTotal
7Replace the default expression with the following expression:
seedRandom(textIndex);
amt=linear(time, 0, 5, 200*textIndex/textTotal, 0);
wiggle(1, amt);
The linear method is used in this example to ramp down the maximum wiggle amount over time.
8Set the vertical position value. The greater the value, the more the characters wiggle.
9Preview your composition.
See also
“Create a composition” on page 108
“Enter point text” on page 274
“Work with selectors” on page 289
“Set keyframes” on page 187
“Preview video and audio” on page 120
Example: Animate text as a timecode display
❖With no layers selected in the Timeline panel, double-click the Current Time Format animation preset in the
Effects & Presets panel. (You can locate the animation preset by typing its name in the Contains field in the Effects
& Presets panel.)
Anewtextlayeriscreated,withanexpressionontheSourceTextpropertythatmakesthetextshowthecurrenttime
in the project’s current time display format.
You can use other expressions in the Global category to display time in another format.
To see the expressions on a layer, select the layer and press EE.
See also
“Global objects” on page 560
302
Chapter 12: Drawing and painting
Using paint tools
Scott Squires provides a pair of movies that show how to rotoscope, both painting and masking:
•www.adobe.com/go/learn_ae_scottsquiresrotoscope1
•www.adobe.com/go/learn_ae_scottsquiresrotoscope2
Work with paint tools and paint strokes
The Brush tool , Clone Stamp tool , and Eraser tool are all paint tools. You use each in the Layer panel to
apply paint strokes to a layer. Each paint stroke’s brush marks add or remove pixels from the layer or modify the
layer’s transparency without modifying the layer source.
Each paint stroke has its own duration bar, Stroke Options properties, and Transform properties, which you can see
and modify in the Timeline panel. Each paint stroke is, by default, named for the tool that created it, with a number
that indicates the order in which it was drawn.
At any time after you draw a paint stroke, you can modify and animate each of its properties using the same
techniques that you use to modify a layer’s properties and duration. You can copy paint stroke path properties to and
from properties for mask paths, shape layer paths, and motion paths. For even more power and flexibility, you can
link these properties using expressions. (See “Creating shapes and masks” on page 318 and “Add, edit, and remove
expressions” on page 549.)
Important: To specify settings for a paint stroke before you apply it, use the Paint and Brush Tips panels. To change and
animate properties for a paint stroke after you’ve applied it, use the stroke’s properties in the Timeline panel.
Individual brush marks are distributed along each paint stroke—though the marks may appear to merge together to
form a continuous stroke with the default settings. Brush settings for each brush in the Brush Tips panel determine
the shape, spacing, and other properties of brush marks; you can also modify these Stroke Options properties for
each stroke in the Timeline panel.
Groups of paint strokes appear in the Timeline panel as instances of the Paint effect. Each instance of the Paint effect
has a Paint On Transparent option. If you select this option, the layer source image and all effects that precede this
instance of the Paint effect in the effect stacking order are ignored; the paint strokes are applied on a transparent
layer.
To see a video tutorial on using the drawing and painting tools, go to the Adobe website at
www.adobe.com/go/vid0223.
•To show selected layers’ paint strokes in the Timeline panel, press PP.
•To select paint strokes in the Layer panel, use the Selection tool to click a paint stroke or drag a box around
portions of multiple paint strokes.
To momentarily activate the Selection tool, press and hold V.
•To show only selected paint strokes in the Timeline panel, select paint strokes and press SS.
AFTER EFFECTS CS3
User Guide
303
•To rename a paint stroke, select the paint stroke in the Timeline panel and press Enter on the main keyboard
(Windows) or Return (Mac OS).
•ToreorderpaintstrokeswithinaninstanceofthePainteffect,dragaPaintstroketoanewlocationinthestacking
order in the Timeline panel.
•To reorder an instance of the Paint effect to interleave it with other effects, drag the effect to a new location in the
stacking order in the Timeline panel.
•To target a specific instance of the Paint effect for the addition of new paint strokes, choose from the View menu
at the bottom of the Layer panel.
•To hide a paint stroke from view (and from rendered output), deselect the paint stroke’s Video switch .
•To open or close the Paint panel and Brush Tips panel when a paint tool is selected, click the Toggle The Paint
Panels button .
For some painting, drawing, cloning, and retouching tasks, you may want to take advantage of the sophisticated paint
tools provided by Adobe Photoshop. See “Working with Photoshop and After Effects” on page 32.
See also
“Blending mode reference” on page 164
“Work with layer properties in the Timeline panel” on page 152
Common paint tool settings in the Paint panel
To use the Paint panel, first select a paint tool from the Tools panel.
Opacity For Brush and Clone strokes, the maximum amount of paint applied. For Eraser strokes, the maximum
amount of paint and layer color removed.
Flow For Brush and Clone strokes, how quickly paint is applied. For Eraser strokes, how quickly paint and layer color
are removed.
Mode How pixels in the underlying image are blended with the pixels painted on by the Brush or Clone stroke. (See
“Blending mode reference” on page 164.)
Channels Which channels of the layer are affected by the Brush stroke or Clone stroke. When you choose Alpha, the
stroke only affects opacity, so swatches are grayscale. Painting the alpha channel with pure black has the same result
as using the Eraser tool.
Duration The duration of the paint stroke. Constant applies the stroke from the current frame to the end of the
layer’s duration. Single Frame applies the stroke to the current frame only. Custom applies the stroke to the specified
number of frames, beginning with the current frame. Write On applies the stroke from the current frame to the end
of the layer’s duration and animates the End property of the stroke to match the motion with which the stroke was
drawn.
See also
“Work with brushes” on page 303
Work with brushes
To use the Brush Tips panel, first select a paint tool from the Tools panel.
AFTER EFFECTS CS3
User Guide
304
See also
“Work with paint tools and paint strokes” on page 302
“Common paint tool settings in the Paint panel” on page 303
Choose a brush gallery display mode
❖Choose a display mode from the Brush Tips panel menu: Text Only, Small Thumbnail, Large Thumbnail, Small
List, or Large List.
Create and manage preset brushes
•To create a new preset brush, specify the desired settings in the Brush Tips panel, and then choose New Brush from
the Brush Tips panel menu or click the Save Current Settings As New Brush button .
•To rename a preset brush, select the brush and choose Rename Brush from the panel menu.
•To delete a preset brush, choose Delete Brush from the panel menu or click the Delete Brush button .
•To restore the default set of preset brushes, choose Reset Brush Tips from the Brush Tips panel menu. To retain
the custom brushes you created, click Append when the dialog box prompts you to replace current brushes with
the default brushes.
Note: Preset brushes are saved in the preferences file, so they persist between projects.
Brush properties
Ctrl-drag (Windows) or Command-drag (Mac OS) the brush in the Layer panel to adjust Diameter; release the key
and continue to drag to adjust Hardness.
Diameter Controls the size of the brush.
Strokes with low Diameter values (left) and high Diameter values (right)
Angle The angle by which an elliptical brush’s long axis is rotated from horizontal.
Note: Brush angles can be expressed in both positive and negative values. For example, a brush with a 45º angle is equiv-
alent to a brush with a -135º angle.
Angled brushes create chiseled strokes: 45-degree brush (left), and -45-degree brush (right).
AFTER EFFECTS CS3
User Guide
305
Roundness The ratio between the brush’s short and long axes. A value of 100% indicates a circular brush, a value of
0% indicates a linear brush, and intermediate values indicate elliptical brushes.
Brush strokes using 100% roundness (left) and varying percentages (right)
Hardness Controls the brush stroke’s transition from 100% opaque at the center to 100% transparent at the edges.
Even with high hardness settings, only the center is fully opaque.
Hardness settings at 100% (left) and 0% hardness (right)
Spacing The distance between the brush marks in a stroke, measured as a percentage of the brush diameter. When
this option is deselected, the speed at which you drag to create the stroke determines the spacing.
Decrease spacing for continuous strokes (left); increase spacing for dashed strokes (right).
Brush Dynamics These settings determine how brush marks are controlled by the features of a pressure-sensitive
digitizing tablet, such as a Wacom pen tablet. For each brush, you can choose Pen Pressure, Pen Tilt, or Stylus Wheel
for Size, Angle, Roundness, Opacity, and Flow to indicate what features of the pen tablet you would like to use to
control brush marks. For example, you can vary the thickness of brush marks by setting Size to Pen Pressure and
pressing more firmly when drawing some portions of the stroke. If Size is not set to Off, Minimum Size specifies the
size of the thinnest brush mark.
Paint with the Brush tool
Use the Brush tool to paint on a layer in the Layer panel with the current foreground color.
Important: To specify settings for a paint stroke before you apply it, use the Paint and Brush Tips panels. To change and
animate properties for a paint stroke after you’ve applied it, use the stroke’s properties in the Timeline panel.
AFTER EFFECTS CS3
User Guide
306
See also
“Common paint tool settings in the Paint panel” on page 303
“Select a color or edit a gradient” on page 236
“Blending mode reference” on page 164
“Work with layer properties in the Timeline panel” on page 152
Select a color for the Brush tool
Do any of the following with the Brush tool active:
•To select a foreground color with the Color Picker, click the Set Foreground Color button in the Paint panel.
•To select a foreground color from anywhere on the screen with the eyedropper, select the eyedropper in the
Paint panel and then click to sample the color under the pointer. Ctrl-click (Windows) or Command-click
(Mac OS) to sample the average color of a square three pixels on a side.
You can quickly activate the eyedropper for use within the Layer panel by pressing Alt (Windows) or Option
(Mac OS) when the pointer is in the Layer panel.
•To switch the foreground color with the background color, press X or click the Switch Foreground And
Background Colors button .
•To reset the foreground color and background color to black and white, press D.
Note: To change or animate the color of a brush stroke after painting, use the Color property in the Stroke Options group
in the Timeline panel.
Paint with the Brush tool
1Select the Brush tool .
2Choose settings and a brush in the Paint panel and Brush Tips panel.
3In the Layer panel, drag with the Brush tool to paint on the layer.
Each time you release the mouse button, you stop drawing a stroke. When you drag again, you create a new stroke.
Shift-drag to resume drawing the previous stroke.
Paint on individual frames with the Brush tool
You can paint on individual frames over a series of frames to create an animation or to obscure unwanted details in
your footage. Rotoscoping is a special case of painting or drawing on individual frames in which some item in the
frame is being traced.
If your output will be interlaced, double the frame rate of your composition before painting on individual frames.
(See “Change frame rate” on page 53.)
1Select the Brush tool.
2In the Paint panel, choose Custom from the Duration menu, and specify the duration in frames. To paint on each
frame, set the Duration value to 1. Set other options in the Paint panel and Brush Tips panel as desired.
3In the Layer panel, drag with the Brush tool to paint on the layer.
Each time you release the mouse button, you stop drawing a stroke. When you drag again, you create a new stroke.
Shift-drag to resume drawing the previous stroke.
AFTER EFFECTS CS3
User Guide
307
4Press 2 on the main keyboard to advance the number of frames specified by the Custom duration setting, and then
repeat the previous step.
Note: To move back the Custom number of frames, press 1 on the main keyboard.
If you use a graphics tablet, map the keyboard shortcuts to the buttons on your pen to work more efficiently. Refer to
your tablet’s documentation for instructions.
Use the Clone Stamp tool
You can use the Clone Stamp tool to copy pixel values from one place and time and apply them at another place and
time. For example, you can use the Clone Stamp tool to remove wires by copying from a clear patch of sky, or you
can create a herd of cows from one cow in the source footage and offset the copies in time.
The Clone Stamp tool samples the pixels from a source layer and applies the sampled pixel values to a target layer;
thetargetlayercanbethesamelayeroradifferentlayerinthesamecomposition.Ifthesourcelayerandtargetlayer
are the same, the Clone Stamp tool samples paint strokes and effects in the source layer, in addition to the layer source
image.
As with all paint tools, you use the Clone Stamp tool in the Layer panel.
If the source layer and target layer are different layers, open each layer in a different viewer. Press Ctrl+Alt+Shift+N
(Windows) or Command+Option+Shift+N (Mac OS) to split and lock the current viewer.
You can identify what result a stroke will have before you make it by using the clone source overlay, a semi-trans-
parent image of the source layer.
AFTER EFFECTS CS3
User Guide
308
Displaying the clone source overlay while cloning between two different layers
A. Clone source overlay B. Current stroke point C. Current sample point
Important: To specify settings for a paint stroke before you apply it, use the Paint and Brush Tips panels. To change and
animate properties for a paint stroke after you’ve applied it, use the stroke’s properties in the Timeline panel.
Select Aligned in the Paint panel to make the position of the sample point (Clone Position) change for subsequent
strokestomatchthemovementoftheCloneStamptoolinthetargetLayerpanel.Inotherwords,withtheAligned
option selected, you can use multiple strokes to paint on one copy of the sampled pixels. In contrast, deselecting the
Aligned option causes the sample point to stay the same between strokes, meaning that you begin painting on pixels
from the original sample point each time you drag again to create a new clone stroke.
For example, select Aligned to use multiple clone strokes to copy one whole cow—which would be difficult to do in
one continuous stroke—and deselect Aligned to copy one flower into dozens of places in the target layer to make a
field of flowers, using one clone stroke per copy.
Select Lock Source Time to clone a single source frame (at composition time Source Time); deselect Lock Source
Time to clone subsequent frames, with a time offset (Source Time Shift) between the source frame and the target
frame. The clone source time automatically loops back to the starting sample point when the current sampling point
goes beyond the end of the source layer's duration. This is especially helpful when you have a lot of frames to repair
in the target layer but only a few good frames in the source layer.
1Open a composition that contains both the source layer and the target layer.
A
C
B
AFTER EFFECTS CS3
User Guide
309
2Open the source layer in a Layer panel and move the current-time indicator to the frame from which to begin
sampling.
Note: You can manually manipulate the time and coordinates from which sampling begins by modifying the Offset,
Source Time Shift, Source Position, or Source Time values in the Paint panel. You can reset them to zero with the Reset
button.
3Alt-click (Windows) or Option-click (Mac OS) with the Clone Stamp tool on the source layer in the Layer panel
to set the sampling point.
4Open the target layer in a Layer panel and move the current-time indicator to the frame to which to begin painting
the clone stroke.
5Drag in the target layer to paint on cloned pixel values from the source layer. To help you identify what the Clone
Stamp tool is sampling as you apply clone strokes, a cross-hair identifies the point being sampled.
Each time you release the mouse button, you stop drawing a stroke. When you drag again, you create a new stroke.
Shift-drag to resume drawing the previous stroke.
Click the Difference Mode button next to the Clone Source Overlay option in the Paint panel or modify the
overlay’sopacitytohelpyoubetterlineupelementsandseetheresultsofyourclonestrokes.Totemporarilyshowthe
clone source overlay, press Alt+Shift (Windows) or Option+Shift (Mac OS). Alt+Shift-drag (Windows) or Option+Shift-
drag (Mac OS) to change the position of the source layer.
EachclonestrokeincludespropertiesintheTimelinepanelthatareuniquetotheCloneStamptoolandcorrespond
to settings made in the Paint panel before the clone stroke is created:
Clone Source The sampled layer.
Clone Position The x, y location of the sample point within the source layer.
Clone Time The composition time at which the source layer is sampled. This property appears only when Lock
Source Time is selected.
Clone Time Shift Thetimeoffsetbetweenthesampledframeandthetargetframe.Thispropertyappearsonlywhen
Lock Source Time is not selected.
After clone strokes have been created, their properties in the Timeline panel can be modified and animated. For
example, you can clone a bird flying across the screen by cloning it in one frame, tracking the bird’s motion, and then
linking the Clone Position property to the tracker’s Attach Point property with an expression.
See also
“Common paint tool settings in the Paint panel” on page 303
“Work with viewers” on page 19
“Add, edit, and remove expressions” on page 549
“Work with layer properties in the Timeline panel” on page 152
AFTER EFFECTS CS3
User Guide
310
Work with clone presets
Use clone presets to save and reuse clone source settings: Source Layer, Aligned, Lock Source Time, Source Time
Shift, Offset, and Source Position values. Clone presets are saved in the preferences file, so they can be reused in other
projects. To work with clone presets, you must first select the Clone Stamp tool.
•To select a clone preset, press 3, 4, 5, 6, or 7 on the main keyboard, or click a Clone Preset button in the Brush
Tips panel.
•To modify a clone preset, select it and adjust the Clone Options settings as desired.
•To copy the settings from one clone preset to another, select the clone preset from which to copy, and Alt-click
(Windows) or Option-click (Mac OS) the Clone Preset button for the clone preset to which you want to paste the
settings.
Use the Eraser tool
If you use the Eraser tool in Layer Source & Paint or Paint Only mode, it creates Eraser strokes that can be modified
and animated. In contrast, using the Eraser tool in Last Stroke Only mode only affects the last paint stroke drawn
and does not create an Eraser stroke.
To temporarily use the Eraser tool in Last Stroke Only mode, Ctrl+Shift-drag (Windows) or Command+Shift-drag
(Mac OS).
1Select the Eraser tool from the Tools panel.
2Choose settings in the Paint panel.
3Select a brush in the Brush Tips panel, and set brush options.
4Drag through the area you want to erase in the Layer panel.
Each time you release the mouse button, you stop drawing a stroke. When you drag again, you create a new stroke.
Shift-drag to resume drawing the previous stroke.
Note: If you use a graphics tablet, pressing the eraser side of the pen to the tablet temporarily activates the Eraser tool.
See also
“Work with layer properties in the Timeline panel” on page 152
Animate paint strokes
You animate a paint stroke by setting keyframes or expressions for its properties. After Effects animates paint stroke
properties—even the paint stroke’s Path property—by interpolating values for all frames between keyframes.
By modifying and animating a paint stroke’s Start and End properties, you can control how much of a stroke is shown
at any time. For example, by automatically animating the End property from 0% to 100% with the Write On setting,
you can make a paint stroke appear to be drawn on over time.
As with all properties, you can link paint stroke properties to other properties using expressions. For example, you
can make a paint stroke follow a moving element in your footage by tracking the moving element and then linking
the paint stroke’s Position property to the tracker’s Attach Point property.
AFTER EFFECTS CS3
User Guide
311
See also
“Work with layer properties in the Timeline panel” on page 152
“Add, edit, and remove expressions” on page 549
Animate a paint stroke by sketching with Write On
If you choose Write On from the Duration menu in the Paint panel, the End property is automatically animated to
match the motion that you used to draw the stroke.
Note: After Effects also includes a Write-on effect. (See “Write-on effect” on page 439.)
1Select a paint tool in the Tools panel.
2In the Paint panel, choose Write On from the Duration menu.
3Drag in the Layer panel to apply a paint stroke to the layer.
As you paint, your movements are recorded in real time and determine the rate at which the resulting stroke is drawn
to the screen for output. Recording begins when you click on the layer in Layer panel. When you release the mouse
button,thecurrenttimereturnstothetimeatwhichyoustartedpainting;thisissothatyoucanrecordmorepaint
strokes for animated playback starting from the same time.
Animate a paint stroke path
1Select a paint tool in the Tools panel.
2In the Paint panel, choose Single Frame, Constant, or Custom from the Duration menu.
3In the Layer panel, drag to create a paint stroke.
4Using the Selection tool, select the paint stroke.
To momentarily activate the Selection tool, press and hold V.
5Press SS to show the selected paint stroke in the Timeline panel.
6Click the triangle next to the paint stroke name to expand its list of properties.
7Click the stopwatch for the Path property to create an initial Path keyframe.
8Drag the current-time indicator to another time.
9While the stroke is still selected, drag in the Layer panel using a paint tool to create a paint stroke. A second Path
keyframe appears in the Timeline panel.
By creating a stroke while a stroke is selected, you replace the selected stroke. This is sometimes referred to as stroke
targeting.
If you are not satisfied with the way that the path is interpolated, consider creating your path as a mask, using Smart
Mask Interpolation to fine-tune the interpolation, and then copying the Mask Path property keyframes to the paint
stroke Path property. (See “Use Smart Mask Interpolation” on page 265.)
After Effects interpolates a paint stroke (center) between two different shapes created with the same brush (left and right).
AFTER EFFECTS CS3
User Guide
312
Shape layers overview
About vector graphics and raster images
Vector graphics are made up of lines and curves defined by mathematical objects called vectors, which describe an
image according to its geometric characteristics. Examples of vector graphics elements within After Effects include
mask paths, shapes on shape layers, and text on text layers.
Raster images (sometimes called bitmap images) use a rectangular grid of picture elements (pixels) to represent
images. Each pixel is assigned a specific location and color value. Video footage, image sequences transferred from
film, and many other types of images imported into After Effects are raster images.
Vector graphics maintain crisp edges and lose no detail when resized, because they are resolution-independent. This
makes vector graphics a good choice for visual elements, such as logos, that will be used at various sizes.
Example of a vector graphic at different levels of magnification
Raster images each consist of a fixed number of pixels, and are therefore resolution-dependent. Raster images can
lose detail and appear jagged (pixelated) if they are scaled up.
Example of a raster image at different levels of magnification
Some images are created as vector graphics in another application but are converted to pixels (rasterized)whenthey
are imported into After Effects. If a layer is continuously rasterized, After Effects reconverts the vector graphics to
pixels when the layer is resized, preserving sharp edges. Vector graphics from Flash SWF, PDF, EPS, and Illustrator
files can be continuously rasterized.
To see a video tutorial on using the drawing and painting tools, go to the Adobe website at
www.adobe.com/go/vid0223.
See also
“Continuously rasterize a layer containing vector graphics” on page 151
24:1
3:1
24:1
3:1
AFTER EFFECTS CS3
User Guide
313
About paths
Several features of After Effects, including masks and shapes, rely on the concept of a path. A path consists of
segments and vertices. Segments are the lines or curves that connect vertices. Vertices define where each segment of
a path starts and ends. Some Adobe applications use the terms anchor point and path point to refer to a vertex.
You change the shape of a path by dragging its vertices, the direction handles at the end of each vertex’s direction lines
(or tangents), or the path segment itself.
You can draw paths in common geometric shapes—including polygons, ellipses, and stars—with the shape tools, or
you can use the Pen tool to draw an arbitrary path. Paths drawn with the Pen tool are either manual Bezier paths or
RotoBezier paths. The main difference between RotoBezier and manual Bezier paths is that direction lines are calcu-
lated automatically for RotoBezier paths, making them easier and faster to draw.
As a path exits a vertex, the angle and length of that vertex’s outgoing direction line determine the path. As the path
approaches the next vertex, the path is less influenced by the previous vertex’s direction line and more influenced by
the next vertex’s incoming direction line.
Components of a path
A. Selected vertex B. Selected vertex C. Unselected vertex D. Curved path segment E. Direction line (tangent) F. Direction handle
Paths can have two kinds of vertices: corner points and smooth points. At a smooth point, path segments are
connected as a smooth curve; the incoming and outgoing direction lines are on the same line. At a corner point, a
path abruptly changes direction; the incoming and outgoing direction lines are on different lines. You can draw a
path using any combination of corner and smooth points. If you draw the wrong kind of point, you can change it
later.
Points on a path
A. Four corner points B. Four smooth points C. Combination of corner and smooth points
When you move a direction line for a smooth point, the curves on both sides of the point adjust simultaneously. By
contrast, when you move a direction line on a corner point, only the curve on the same side of the point as the
direction line is adjusted.
A
B
D
C
E
F
A B C
AFTER EFFECTS CS3
User Guide
314
Adjusting the direction lines on a smooth point (left) and a corner point (right)
A path can either be open or closed. An open path has a beginning point that is not the same as its end point; for
example, a straight line is an open path. A closed path is continuous and has no beginning or end; for example, a
circle is a closed path.
For shape paths, you can use the Merge Paths path operation (similar to the Pathfinder effects in Adobe Illustrator)
to combine multiple paths into one path. (See “Merge Paths options” on page 333.)
A path itself has no visual appearance in rendered output; it is essentially a collection of information about how to
placeormodifyothervisualelements.Tomakeapathvisible,youapplyastroketoit.Inthecaseofamaskpath,you
can apply the Stroke effect. In the case of a path for a shape layer object, the default is for a path to be created with a
stroke property group (attribute) after the path property group in the Timeline panel.
A color or gradient applied to the area inside the area bounded by a path is a fill.
When you use the shape tools (Rectangle, Rounded Rectangle, Ellipse, Polygon, or Star) to draw a shape path on a
shape layer, you can create one of two kinds of paths: a parametric shape path or a Bezier shape path. (See “About
shapes and shape layers” on page 314.)
You can link mask paths, paint stroke paths, and Bezier shape paths using expressions. You can also copy and paste
between mask paths, paint stroke paths, Bezier shape paths, motion paths, and paths from Adobe Illustrator,
Photoshop, and Adobe Fireworks®. (See “Creating shapes and masks” on page 318.)
See also
“Creating shapes and masks” on page 318
“Add, edit, and remove expressions” on page 549
About shapes and shape layers
Shape layers contain vector graphics objects called shapes. By default, a shape consists of a path, a stroke, and a fill.
You create a shape layer by drawing in the Composition panel with the shape tools or the Pen tool.
There are two varieties of shape paths: parametric shape paths and Bezier shape paths. Parametric shape paths are
defined numerically, by properties that you can modify and animate after drawing, in the Timeline panel. Bezier
shape paths are defined by a collection of vertices (path points) and segments that you can modify in the Compo-
sition panel. You work with Bezier shape paths in the same way that you work with mask paths. All mask paths are
Bezier paths.
You can modify a shape path by applying path operations, such as Wiggle Paths and Pucker & Bloat. You apply a
stroke to a path or fill the area defined by a path with color by applying paint operations.
AFTER EFFECTS CS3
User Guide
315
Shape paths, paint operations, and path operations for shapes are collectively called shape attributes.Youaddshape
attributes using the Add menu in the Tools panel or in the Timeline panel. Each shape attribute is represented as a
property group in the Timeline panel, with properties that you can animate, just as you do with any other layer
property. (See “About animation, keyframes, and expressions” on page 183.)
Shapelayersarenotbasedonfootageitems.Layersthatarenotbasedonfootageitemsaresometimescalledsynthetic
layers. Text layers are also synthetic layers and are also composed of vector graphics objects, so many of the rules and
guidelines that apply to text layers also apply to shape layers. For example, you can’t open a shape layer in a Layer
panel, just as you can’t open a text layer in a Layer panel.
You can save your favorite shapes as animation presets. (See “Save an animation preset” on page 353.)
To see a video tutorial introducing shape layers, go to the Adobe website at www.adobe.com/go/vid0224.
To see a video tutorial on animating shapes, go to the Adobe website at www.adobe.com/go/vid0225.
You can download additional animation presets that take advantage of per-character 3D text animation from the
Adobe After Effects Exchange: www.adobe.com/go/learn_ae_cs3additionalanimationpresets.
See also
“Creating and importing masks” on page 254
“Best practices for creating text and vector graphics for video” on page 274
“Create a shape or mask by dragging with shape tools” on page 318
About groups and render order for shapes
Though the default is for a shape to consist of a single path, a single stroke, and a single fill—arranged from top to
bottom in the Timeline panel—much of the power and flexibility of shape layers arises from your ability to add and
reorder shape attributes and create more complex compound shapes.
Agroup isacollectionofshapeattributes:paths,fills,strokes,pathoperations,andothergroups.Eachgrouphasits
own blending mode and its own set of transform properties. By assembling shapes into groups, you can work with
multiple shapes simultaneously—such as scaling all shapes in the group by the same amount or applying the same
stroke to each shape. You can even place individual shapes or individual shape attributes within their own groups to
isolate transformations. For example, you can scale a path without scaling its stroke by grouping the path by itself.
AFTER EFFECTS CS3
User Guide
316
A. Two shapes in a group B. Two paths in a compound shape C. Circle path with Wiggle Paths applied D. One stroke applied to all paths
above it E. Star path in a group by itself F. One fill applied to all paths above it G. One path with two strokes
When you add a shape attribute using the Add menu in the Tools panel or Timeline panel, the attribute is added
within the group that is selected. You can drag groups and attributes to reorder them in the Timeline panel. By
reordering and grouping shapes and shape attributes, you can affect their rendering order with respect to other
shapes and shape attributes.
Render order for shapes within a shape layer
Therulesforrenderingashapelayeraresimilartotherulesforrenderingacompositionthatcontainsnestedcompo-
sitions:
•Within a group, the shape at the bottom of the Timeline panel stacking order is rendered first.
•All path operations within a group are performed before paint operations. This means, for example, that the stroke
follows the distortions in the path made by the Wiggle Paths path operation. Path operations within a group are
performed from top to bottom. (See “Alter shape paths with path operations” on page 332.)
B
G
C
A
D
E
F
AFTER EFFECTS CS3
User Guide
317
•Paint operations within a group are performed from the bottom to the top in the Timeline panel stacking order.
This means, for example, that a stroke is rendered on top of (in front of) a stroke that appears after it in the
Timeline panel. To override this default behavior for a specific fill or stroke, choose Above Previous In Same
Group for the fill or stroke’s Composite property in the Timeline panel. (See “Work with strokes and fills for
shapes” on page 328.)
Path operations and paint operations apply to all paths above them in the same group.
Transform properties for shape groups and shape paths
Each group has its own Transform property group. This Transform property group is represented in the Timeline
panel with a property group named Transform: [group name] and in the Composition panel as a dashed box with
handles. You can group a path by itself and transform only the path using its new Transform property group.
Introducing an additional Transform property group for a single path is useful, for example, for creating complex
motion—such as spinning about one anchor point while also revolving along an orbit. The transformations of a
group affect all shapes within the group; this is the same behavior as that of layer parenting. (See “Work with parent
and child layers” on page 158.)
Each shape path also has intrinsic properties that affect the position and shape of the path. For parametric shape
paths, these properties (such as Position and Size) are parameters visible in the Timeline panel. For Bezier shape
paths, these properties are defined for each vertex but are contained within the Path property. When you modify a
Bezier path using the free-transform bounding box, you modify these intrinsic properties for the vertices that
constitute that path.
Group and ungroup shapes and shape attributes
You can group shapes or shape attributes that are at the same grouping level within a single shape layer.
See also
“About groups and render order for shapes” on page 315
Group shapes or shape attributes
❖Select one or more shapes or shape attributes, and do one of the following:
•Choose Layer > Group Shapes.
•Press Ctrl+G (Windows) or Command+G (Mac OS).
When you group shapes, the anchor point for the group is placed in the center of the group’s bounding box.
Ungroup shapes or shape attributes
❖ Select a single group, and do one of the following:
•Choose Layer > Ungroup Shapes.
•Press Ctrl+Shift+G (Windows) or Command+Shift+G (Mac OS).
Create an empty shape group
❖Choose Group (Emtpy) from the Add menu in the Tools panel or in the Timeline panel.
AFTER EFFECTS CS3
User Guide
318
Creating shapes and masks
Creating shapes and shape layers
You create a shape layer by drawing in the Composition panel with a shape tool or the Pen tool. You can then add
shape attributes to existing shapes or create new shapes within that shape layer. By default, if you draw in the Compo-
sition panel when a shape layer is selected, you create a new shape within that shape layer, above the selected shapes
or group of shapes. If you draw in the Composition panel using a shape tool or Pen tool when an image layer other
than a shape layer is selected, you create a mask.
Press F2 to deselect all layers before drawing in the Composition panel to create a new shape layer.
AnewshapehasafillandastrokethatcorrespondtotheFillandStrokesettingsintheToolspanelatthetimethat
the shape is drawn. You can use the same controls in the Tools panel to change these attributes for a selected shape
after it has been drawn.
Note: To draw a mask on a shape layer, click the Tool Creates Mask button in the Tools panel with a shape tool or
Pen tool active. For more information about creating masks, see “Creating and importing masks” on page 254.
You can create a new, empty shape layer by choosing Layer > New > Shape Layer.
See also
“About shapes and shape layers” on page 314
“About masks” on page 253
Create a shape or mask by dragging with shape tools
The shape tools are the Rectangle , Rounded Rectangle , Ellipse , Polygon , and Star tools.
To activate and cycle through the shape tools, press Q.
A polygon is a star without an Inner Radius or Inner Roundness property, so the name of the shape created for a
polygon or a star is the same: polystar.
You can create a mask by dragging with a shape tool on a selected layer in the Composition panel or Layer panel. You
can create a shape by dragging with a shape tool on a selected shape layer in the Composition panel. If you drag with
a shape tool in the Composition panel with no layer selected, you create a shape on a new shape layer.
Note: Todrawamaskonashapelayer,clicktheToolCreatesMask buttonintheToolspanelwithashapetoolactive.
WhenyoucreateashapebydraggingwithashapetoolintheCompositionpanel,youcreateaparametricshapepath.
To instead create a Bezier shape path, press the Alt (Windows) or Option (Mac OS) key before you click to begin
dragging. You can release the key before you complete the drag operation. All mask paths are Bezier paths.
Dragging starts when you click in the Composition panel or Layer panel to begin drawing, and ends when you release
the mouse button. Pressing modifier keys at different times during a single dragging operation achieves different
results:
•To reposition a shape or mask as you are drawing, hold the spacebar or the middle mouse button while dragging.
AFTER EFFECTS CS3
User Guide
319
•To scale a circle, ellipse, square, rounded square, rectangle, or rounded rectangle around its center while drawing,
hold the Ctrl (Windows) or Command (Mac OS) key after you begin dragging. Don’t release the key until you have
released the mouse button to finish drawing.
•To cancel the drawing operation, press Esc.
Note: Each shape tool retains the settings of the most recent drawing operation with that tool. For example, if you draw
a star and modify the number of points to be 10, then the next star that you draw will also have 10 points. To reset a
tool’s settings and create a shape with the default settings, double-click the tool in the Tools panel. (See “Create a shape
or mask the size of the layer” on page 320.)
See also
“Creating and importing masks” on page 254
“Shortcuts for working with shape layers” on page 655
Draw rectangles, rounded rectangles, squares, and rounded squares
1Select the Rectangle tool or the Rounded Rectangle tool , and do one of the following:
•To draw a rectangle or rounded rectangle, drag diagonally.
•To draw a square or rounded square, Shift-drag diagonally.
2(Optional) If drawing a rounded rectangle or rounded square, do the following before releasing the mouse button:
•To increase or decrease the corner roundness, press the Up Arrow key or the Down Arrow key, or roll the mouse
wheel forward or backward.
•To set corner roundness to the minimum or maximum, press the Left Arrow key or the Right Arrow key.
3Release the mouse button to finish drawing. If drawing a square or rounded square, release the Shift key after
releasing the mouse button.
Note: Squares are created to be square according to the pixel aspect ratio of the composition. If the composition’s pixel
aspect ratio is not 1, then squares only appear square in the Composition panel if the Toggle Pixel Aspect Ratio button
is selected at the bottom of the Composition panel.
Draw ellipses and circles
1Select the Ellipse tool , and do one of the following:
•To draw an ellipse, drag diagonally.
•To draw a circle, Shift-drag diagonally.
2Release the mouse button to finish drawing. If drawing a circle, release the Shift key after releasing the mouse
button.
Note: Circles are created to be circular according to the pixel aspect ratio of the composition. If the composition’s pixel
aspect ratio is not 1, then circles only appear circular in the Composition panel if the Toggle Pixel Aspect Ratio button
is selected at the bottom of the Composition panel.
Draw polygons and stars
1Select the Polygon tool or the Star tool , and do one of the following:
•Drag to scale and rotate the polygon or star as you draw it.
•Shift-drag to scale the polygon or star as you draw it, preventing rotation.
AFTER EFFECTS CS3
User Guide
320
2(Optional) Do the following before releasing the mouse button:
•To add or remove points, press the Up Arrow key or the Down Arrow key, or roll the mouse wheel forward or
backward.
•To increase or decrease the outer roundness, press the Left Arrow key or the Right Arrow key.
•To keep the inner radius of a star constant as you move the mouse to increase the outer radius, hold the Ctrl
(Windows) or Command (Mac OS) key.
•To increase or decrease the inner roundness of a star, press the Page Up key or the Page Down key.
3Release the mouse button to finish drawing. If Shift-dragging to prevent rotation, release the Shift key after
releasing the mouse button.
Create a shape or mask the size of the layer
1Select the destination for the new mask or shape:
•To create a shape on an existing shape layer, select the shape layer.
•To create a shape on a new shape layer with the dimensions of the composition, deselect all layers by pressing F2.
•To create a mask, select a layer in the Timeline panel, Layer panel, or Composition panel. To create a mask on a
shape layer, you must also click the Tool Creates Mask button in the Tools panel with a shape tool active.
•To replace a mask path, select the mask in the Timeline panel, Layer panel, or Composition panel.
•To replace a shape path, select the shape path (not the group) in the Composition panel or Timeline panel.
2
In the Tools panel, double-click the Rectangle , Rounded Rectangle , Ellipse , Polygon , or Star tool.
Create shapes from text characters
The Create Outlines command extracts the outlines for each character, creates shapes from the outlines, and puts the
shapes on a new shape layer. You can then use these shapes as you would any other shape.
Thenewshapelayeriscreatedatthetopofthelayerstackingorder.Thenewlayercontainsoneshapegroupforeach
selected character, plus fill and stroke properties that match those of the text.
For characters that consist of compound paths—such as iand e—multiple paths are created and combined with the
Merge Paths path operation.
Effects, masks, layer styles, and keyframes and expressions for properties in the text layer’s Transform property group
are copied to the new shape layer. The Video switch for the text layer is turned off.
Some font families, such as Webdings, include characters that are graphical images, rather than text. Converting text
from these font families can be a good way to get started with simple graphical elements in shape layers.
1Select the text to convert to shapes:
•To create shapes for all characters in a text layer, select the text layer in the Timeline panel or Composition panel.
•To create shapes for specific characters, select the characters in the Composition panel.
2Choose Layer > Create Outlines.
The Create Outlines menu command in versions of After Effects previous to After Effects CS3 created masks on a
solid layer instead of creating shapes. To achieve the same result in After Effects CS3, you can run a script to convert
theshapescreatedbytheCreateOutlinescommandtomasksonasolidlayer.ThescriptisavailableonJeffAlmasol’s
website: www.adobe.com/go/learn_ae_jeffshapestomasks.
AFTER EFFECTS CS3
User Guide
321
See also
“About text layers” on page 273
Create a Bezier shape or mask using the Pen tool
You can create a Bezier mask using the Pen tool on a selected layer in the Composition panel or Layer panel. You can
create a shape with a Bezier path using the Pen tool on a selected shape layer in the Composition panel. If you draw
with the Pen tool in the Composition panel with no layer selected, you create a shape on a new shape layer.
Creating a RotoBezier path is similar to creating a manual Bezier path. The primary difference is that direction lines
for vertices and curvature for path segments are automatically calculated.
Create a manual Bezier path using the Pen tool
1With the Pen tool selected and the RotoBezier option deselected in the Tools panel, click in the Composition panel
where you want to place the first vertex.
2Click where you want to place the next vertex. To create a curved segment, drag the direction line handle to create
the curve that you want.
Torepositionavertexafteryou’veclickedtoplaceitbutbeforeyou’vereleasedthemousebutton,holdthespacebar
while dragging.
Thelastvertexthatyouaddappearsasasolidsquare,indicatingthatitisselected.Previouslyaddedverticesbecome
hollow, and deselected, as you add more vertices.
3Repeat step 2 until you are ready to complete the path.
4Complete the path by doing one of the following:
•To close the path, place the pointer over the first vertex and, when a closed circle icon appears next to the
pointer , click the vertex.
Note: You can also close a path by double-clicking the last vertex or choosing Layer > Mask And Shape Path > Closed.
•To leave the path open, activate a different tool, or press F2 to deselect the path.
Draw straight manual Bezier path segments with the Pen tool
The simplest path that you can draw with the Pen tool is a straight line, made by clicking with the Pen tool to create
two vertices. By continuing to click, you create a path made of straight line segments connected by corner points.
Clicking with Pen tool creates straight segments.
1Place the Pen tool where you want the straight segment to begin, and click to place a vertex. (Do not drag.)
2Click again where you want the segment to end. (Shift-click to constrain the angle between segments at the corner
point to a whole multiple of 45˚.)
3Continue clicking to set vertices for additional straight segments.
AFTER EFFECTS CS3
User Guide
322
Draw curved manual Bezier path segments with the Pen tool
You create a curved path segment by dragging direction lines. The length and direction of the direction lines
determine the shape of the curve.
Shift-drag to constrain the angle of the direction lines to whole multiples of 45˚. Alt-drag (Windows) or Option-drag
(Mac OS) to modify only the outgoing direction line.
1Place the Pen tool where you want the curve to begin, and hold the mouse button down.
A vertex appears, and the Pen tool pointer changes to an arrowhead.
2Drag to modify the length and direction of both direction lines for a vertex, and then release the mouse button.
Drawing the first vertex in a curved path
A. Positioning Pen tool B. Starting to drag (mouse button pressed) C. Dragging to extend direction lines
3Place the Pen tool where you want the curved segment to end, and do one of the following:
•To create a C-shaped curve, drag in the direction opposite from the direction that you dragged the previous
direction line, and then release the mouse button.
Drawing the second vertex in a curved path
A. Starting to drag B. Dragging away from previous direction line, creating a C curve C. Result after releasing mouse button
•To create an S-shaped curve, drag in the same direction as the previous direction line, and then release the mouse
button.
Drawing an S curve
A. Starting to drag B. Dragging in same direction as previous direction line, creating an S curve C. Result after releasing mouse button
4Continue dragging the Pen tool from different locations to create a series of smooth curves.
A B C
ABC
ABC
AFTER EFFECTS CS3
User Guide
323
Convert a path between manual Bezier and RotoBezier
You can convert any manual Bezier mask path or manual Bezier shape path to a RotoBezier path. If the manual
Bezier path has direction handles that have been adjusted, this conversion changes the shape of the path, because
After Effects calculates the curvature of RotoBezier segments automatically.
The conversion of a RotoBezier path to a manual Bezier path does not change the shape of the path.
1Select a mask in the Layer, Composition, or Timeline panel, or select a shape path in the Composition or Timeline
panel.
2Choose Layer > Mask And Shape Path > RotoBezier.
Modify a Bezier mask path or shape path
You can change a Bezier mask path using the Selection tool and pen tools in the Layer or Composition panel. You
can change a Bezier shape path using the Selection tool and pen tools in the Composition panel.
The pen tools—Add Vertex, Delete Vertex, and Convert Vertex tools—are grouped with the Pen tool in the Tools
panel. To reveal these tools in the Tools panel, click and hold the Pen tool in the Tools panel.
In most cases, the appropriate pen tool becomes active when you place the Pen tool pointer in a particular context.
For example, the Delete Vertex tool becomes active when you place the Pen tool pointer over an existing vertex, and
the Add Vertex tool becomes active when you place the Pen tool pointer over a path segment. To manually activate and
cycle through these tools, press G.
When modifying a path, make sure that you click only existing vertices or segments; otherwise, you may create a new
path instead.
Move, add, or delete a vertex
❖Do one of the following:
•To move a vertex, drag the vertex with the Selection tool .
To temporarily switch from the Pen tool to the Selection tool, press V or Ctrl (Windows) or Command (Mac OS).
•To add a vertex to a mask, use the Add Vertex tool to click the segment between two existing vertices.
•To delete a vertex from a mask, use the Delete Vertex tool to click the vertex.
Adjust a path segment
❖Do one of the following with the Selection tool:
•Drag a vertex.
•Drag the direction handles extending from an adjoining smooth vertex.
•Drag a curved segment.
Dragging a curved segment on a RotoBezier mask also moves the vertices.
Toggle a vertex between a smooth point and a corner point
❖Click the vertex with the Convert Vertex tool .
To activate the Convert Vertex tool when the Pen tool is selected, hold down Alt (Windows) or Option (Mac OS).
AFTER EFFECTS CS3
User Guide
324
Adjust the tension of a RotoBezier mask
1If you want to adjust the tension of more than one vertex simultaneously, then select them.
2Using the Convert Vertex tool , drag a vertex.
To activate the Convert Vertex tool when the Pen tool is selected, hold down Alt (Windows) or Option (Mac OS).
The Adjust Tension pointer appears as you drag a vertex of the RotoBezier mask.
Clicking a vertex instead of dragging sets the vertex to a corner point (100% tension); clicking again sets the vertex
to a smooth point (33% tension). Dragging up or to the right decreases the selection’s tension, increasing the curve
of adjacent path segments; dragging down or to the left increases the selection’s tension, decreasing the curve of
adjacent path segments.
To view the tension value of a vertex, look in the Info panel as you adjust the tension.
Copy a path from Illustrator, Photoshop, or Fireworks
You can copy a path from Illustrator, Photoshop, or Fireworks and paste it into After Effects as a mask path or shape
path.
TomakethedatacopiedfromIllustratorcompatiblewithAfterEffects,theAICBoptionmustbeselectedintheFiles
& Clipboard section of the Adobe Illustrator Preferences dialog box.
For a path imported from Photoshop to be scaled correctly, the Photoshop document must have a resolution of
72dpi. This is the Resolution setting of documents created in Photoshop using a Film & Video preset.
1In Illustrator, Photoshop, or Fireworks, select an entire path, and then choose Edit > Copy.
2In After Effects, do one of the following to define a target for the paste operation:
•To create a new mask, select a layer.
•To replace an existing mask path or shape path, select its Path property.
Note: To paste a path as a shape path, you must select the Path property of an existing shape in a shape layer. This
selection tells After Effects what the target of the paste operation is; if the target isn't specified in this way, After Effects
assumes that the target is the entire layer and therefore draws a new mask. If there is no Path property—perhaps because
the shape layer is empty—then you can draw a placeholder path with the Pen tool and then paste the path from
Illustrator into that.
3Choose Edit > Paste.
If you paste multiple paths into a shape path, the first path goes into the shape path, and the remaining paths are
pastedintonewmaskpaths.Thisisbecausethepathsotherthanthefirstonedon'thaveaclearlydefinedtarget,so
they are added to the entire layer as masks.
Path drawn in Adobe Illustrator (left) and pasted into After Effects as a mask (right)
AFTER EFFECTS CS3
User Guide
325
Note: YoucanalsouseacopiedIllustrator,Photoshop,orFireworkspathasanAfterEffectsmotionpath.See“Createa
motion path from a mask, shape, or paint path” on page 199 for more information.
See also
“Preparing and importing Illustrator files” on page 85
Designate the first vertex for a Bezier path
To animate a path, After Effects designates the topmost vertex at the initial keyframe as the first vertex and numbers
each successive vertex in ascending order from the first vertex. After Effects then assigns the same numbers to the
corresponding vertices at all successive keyframes. After Effects interpolates the movement of each vertex from its
initial position at one keyframe to the position of the correspondingly numbered vertex at the next keyframe. At any
time during an animation, you can designate another vertex as the first vertex; this causes After Effects to renumber
the vertices of the path. Renumbering vertices causes path animation to change, because After Effects then maps the
new vertex numbers to the corresponding old vertex numbers still saved at successive keyframes.
Some shape path operations, such as Trim Paths, also use the first vertex as input to determine how to modify the path.
Note: By default, when you add a vertex to a path, the new vertex appears on the path throughout the path’s duration
but reshapes the path only at the time at which it was added. When you delete a vertex from a path at a specific point
in time, the vertex is deleted from the path throughout the path’s duration. Prevent After Effects from adding and deleting
vertices throughout the path’s duration by choosing Edit > Preferences > General (Windows) or After Effects >
Preferences > General (Mac OS), and deselecting Preserve Constant Vertex Count When Editing Masks.
1Create an animated path.
2In the Timeline panel, move the current-time indicator to the point where you want to designate a new first vertex.
3Select the vertex to designate as the first vertex.
4Choose Layer > Mask And Shape Path > Set First Vertex.
Note: The vertex designated as the first vertex appears slightly larger than the other vertices in the Composition panel.
Managing and editing shapes
Select paths, shapes, and groups
You can select shape layers and their components at any of four levels of selection, referred to as selection modes:
Layer selection mode The entire shape layer is selected. Transformations apply to the transform properties for the
layer, in the Transform property group that is at the same level as the Contents property group.
Group selection mode An entire shape group is selected. Transformations apply to the transform properties for the
group, in the Transform property group within the shape group in the Timeline panel.
Free-transform mode Multiple vertices on one or more Bezier paths are selected. A free-transform bounding box is
shownaroundtheverticesintheCompositionpanel.Byoperatingonthisbox,youcanmovemultipleverticeswith
a single transformation. Transformations apply to the vertices themselves, which are contained within the Path
property in the Timeline panel.
Path-editing mode Only vertices are selected. In this mode, you can perform path-editing operations, such as
adding vertices to a path and moving individual vertices.
AFTER EFFECTS CS3
User Guide
326
When a pen tool is active, path-editing mode is active. To remain in path-editing mode, select the Pen tool; press V
or Ctrl (Windows) or Command (Mac OS) to temporarily activate the Selection tool as needed.
Selection modes for shapes on shape layers
A. Layer selection B. Group selection C. Free-transform D. Path editing
For information on selecting masks, see “Select masks, segments, and vertices” on page 258.
Press Ctrl+A (Windows) or Command+A (Mac OS) with a shape vertex selected to select all vertices on that path.
Press again to select all shapes. Press again to select all layers.
Select a shape layer
•Click the layer name or layer duration bar in the Timeline panel.
•Using the Selection tool, click within the layer’s bounds in the Composition panel.
•To deselect all shapes on a layer but leave the shape layer selected, click within the layer’s bounds but outside all
shape paths.
Select a shape group in group selection mode
•Using the Selection tool, double-click a member of the group in the Composition panel. Each time that you
double-click, you descend another level in the group hierarchy.
•To activate the Direct Selection tool , hold Ctrl (Windows) or Command (Mac OS) with the Selection tool
selected. Click a shape in the Composition panel with the Direct Selection tool to directly select that shape’s group,
regardless of how deeply nested the shape is in the group hierarchy.
•To select a group that is contained within the same group as the group that is already selected, click the group to
select.
•To add a group to a selection, Shift-click it. You can combine the Shift key with double-clicking and with the Direct
Selection tool to add more deeply nested groups to the selection.
Select paths and vertices in path-editing mode
•To select a vertex, click the vertex with the Selection tool. To add vertices to the selection, Shift-click them.
•
To select a path segment, click the segment with the Selection tool. To add segments to the selection, Shift-click them.
AB
CD
AFTER EFFECTS CS3
User Guide
327
•To select an entire path, Alt-click (Windows) or Option-click (Mac OS) a segment or vertex of the path with the
Selection tool, or select any portion of the path and press Ctrl+A (Windows) or Command+A (Mac OS).
•To select vertices by dragging, select a path or portion of a path to enter path-editing mode, and then drag with
the marquee-selection tool to draw a marquee-selection box around the vertices to select. To add vertices to
the selection, hold down the Shift key as you draw additional marquee-selection boxes.
Select all points on a path and enter free-transform mode
•Double-click a path segment while in path-editing mode or in group selection mode for a single shape.
•Select the Path property in the Timeline panel and press Ctrl+T (Windows) or Command+T (Mac OS).
Move vertices in free-transform mode
You can scale and rotate an entire mask or shape path (or selected vertices in one or more paths) using the Free
Transform Points command. When you use this command, a free-transform bounding box surrounds the selected
vertices, and an anchor point appears in the center of the bounding box to mark the anchor point for the current
transformation. You can scale and rotate the selected vertices by dragging the bounding box or its handles. You can
also change the reference point from which the vertices are rotated or scaled by moving the bounding box anchor
point. The free-transform bounding box handles and anchor point exist independently of the handles and anchor
point for the layer.
Note: When you animate rotation using Free Transform Points, the vertices of the mask are interpolated in a straight
line from keyframe to keyframe. For this reason, the results may be different from what you expect.
1Display the layer containing the paths that you want to transform in the Composition or Layer panel.
2Using the Selection tool, do one of the following:
•Totransformanynumberofvertices,selecttheverticesthatyouwanttotransformandchooseLayer>MaskAnd
Shape Path > Free Transform Points.
•To transform an entire mask or shape path, select it in the Timeline panel and choose Layer > Mask And Shape
Path > Free Transform Points.
3To move the bounding box’s anchor point, position the Selection tool over the bounding box anchor point
until the Selection tool changes to a move anchor point icon . Drag to position the anchor point.
4Do any combination of the following:
•To move the path or selected vertices, position the pointer inside the bounding box and drag.
•To scale the path or selected vertices, position the pointer on a bounding box handle and, when the pointer
changes to a straight, double-sided arrow , drag to a new size. Hold down Shift as you drag to constrain the
scale. Hold down Ctrl (Windows) or Command (Mac OS) as you drag to scale around the bounding box’s anchor
point.
•To rotate the path or selected vertices, position the pointer just outside the free-transform bounding box and,
when the pointer changes to a curved double-sided arrow , drag to rotate.
5To exit free-transform mode, press Esc, Enter (Windows), or Return (Mac OS).
Duplicate a shape group while transforming
When a shape group is selected in group selection mode, you can duplicate the group while moving, rotating, or
scaling it in the Composition panel.
•Hold the Alt (Windows) or Option (Mac OS) key as you drag to transform a group.
AFTER EFFECTS CS3
User Guide
328
The pointer changes to a duplication pointer ( or ) as you hold the key and place the pointer near the group
transform box.
Adding attributes to shape layers
After a shape layer has been created, you can add attributes by using the Add menu in the Tools panel or in the
Timeline panel.
By default, the new attributes are inserted into the selected shape group or groups according to the following rules:
•New paths are added below existing paths and groups.
•New path operations—such as Zig Zag and Wiggle Paths—are added below existing path operations. If no path
operations are present, new path operations are added below existing paths.
•New paint operations—strokes and fills—are added below existing paths and above existing strokes and fills.
Tooverridetheserulesandplaceanewattributeattheendofthegroup,belowallattributes,holdtheAlt(Windows)
or Option (Mac OS) key as you click to choose an item from the Add menu.
The Repeater operation is always added at the end of the group.
See also
“About groups and render order for shapes” on page 315
Work with strokes and fills for shapes
Strokes and fills for shapes are paint operations that add colored pixels to a path or to the area defined by a path. A
stroke or a fill can consist of a solid color, or it can use a gradient of colors. Strokes can be continuous, or they can
consist of a periodic series of dashes and gaps. Each stroke and fill has its own blending mode, which determines how
it interacts with other paint operations in the same group.
By default, paint operations within a group are performed from the bottom to the top in the Timeline panel stacking
order. This means, for example, that a stroke is rendered on top of (in front of) a stroke that appears after it in the
Timeline panel. To override this default behavior for a specific fill or stroke, choose Above Previous In Same Group
for the fill or stroke’s Composite property in the Timeline panel.
Note: When you add a stroke or fill using the Add menu in the Tools panel or Timeline panel, the paint operation is
added below existing paths and above existing strokes and fills. To place a new stroke at the end of the group, hold the
Alt (Windows) or Option (Mac OS) key as you click to choose an item from the Add menu.
New shapes are created with fill and stroke properties depicted by the swatch buttons next to the underlined Fill and
Stroke text controls in the Tools panel. You can also modify the fill colors, stroke colors, fill type, and stroke type for
selected shapes using these controls. The Fill and Stroke controls are only visible in the Tools panel when a shape
layer is selected or a drawing tool is active.
If multiple shapes are selected, with different fill or stroke properties, then the swatch button next to the Fill or Stroke
control contains a question mark. You can still modify the fill and stroke properties using these controls, and the
corresponding properties for all selected shapes are set to the same value.
Fills and strokes can be any of four types:
None No paint operation is performed.
Solid color The entire fill or stroke consists of one color.
AFTER EFFECTS CS3
User Guide
329
Linear gradient The fill or stroke consists of colors and opacity values defined by a linear gradient and then mapped
onto the composition along a single axis from the Start Point to the End Point.
Radial gradient The fill or stroke consists of colors and opacity values defined by a linear gradient, which are
mapped onto the composition along a radius extending outward from the Start Point at the center to the End Point
at the circumference of a circle. You can offset the starting point by modifying the Highlight Length and Highlight
Angle values.
You can animate and interpolate gradients by adding keyframes to the Colors property and using the Color Picker
in Gradient Editor mode to add, modify, and remove color stops and opacity stops. You can also save gradients as
animation presets. (See “Save an animation preset” on page 353.)
The colors of strokes and fills for shape layers are not rendered as high-dynamic range colors. Color values under 0.0
or over 1.0 are clipped to fall within the range of 0.0 to 1.0.
See also
“Select a color or edit a gradient” on page 236
Choose stroke or fill type and blending options
•To choose a fill type or stroke type for new shapes, or set the blending mode or opacity for a fill or stroke for new
shapes, click the underlined Fill or Stroke text control in the Tools panel. To cycle through fill types or stroke types
for existing shapes, select the shapes before using these controls.
•To cycle through fill types or stroke types for new shapes, Alt-click (Windows) or Option-click (Mac OS) the
swatch button next to the underlined Fill or Stroke text control in the Tools panel. To choose a fill type or stroke
type for existing shapes, select the shapes before using these controls.
Choose a solid color or edit a gradient for a stroke or fill
•To choose a solid color or gradient for fills or strokes for new shapes, click the swatch button next to the underlined
Fill or Stroke text control in the Tools panel. To choose a solid color or gradient for fills or strokes for existing
shapes, select the shapes before using the controls.
Modify a gradient’s color mapping
A gradient is a range of color and opacity values that you can customize in the Gradient Editor dialog box. You can
also customize how those colors are applied to a stroke or fill by modifying the Start Point and End Point, which
determine the direction and scale of the gradient. For example, you can modify these points to stretch the colors of
a gradient out over a larger area, or orient a linear gradient so that colors fade from top to bottom instead of from
left to right. For a radial gradient, you define the center of gradient, its radius, and the offset of a highlight.
By default, when you create a shape path by drawing with the Pen tool, the control points for the gradient are placed
in the center of the layer. You can adjust these points after you finish drawing.
You can modify the Start Point, End Point, Highlight Angle, and Highlight Length properties in the Timeline panel.
You can also modify these properties directly in the Composition panel.
AFTER EFFECTS CS3
User Guide
330
Controls for mapping gradient colors in Composition panel
A. Highlight control point B. Start Point C. End Point
1Select the group in which the gradient is contained.
2With the Selection tool active, drag the Start Point, End Point, or Highlight controls in the Composition panel.
The Selection tool turns to a gradient control pointer or when placed over a gradient control.
Set stroke width
•To set stroke width for new shapes in pixels (px), drag the underlined Stroke Width control (which is located to
the right of the Stroke controls in the Tools panel), or click the control and enter a value in the box. To set the stroke
width for existing shapes, select them before using the Stroke Width control.
Create a dashed stroke
You create a dashed stroke by adding any number of dashes and gaps to the Dashes property group for the stroke.
The dashes and gaps in this property group are repeated as many times as necessary to cover the entire path. The
Offset property determines at what point on the path the stroke begins.
Animate the Offset property to create a moving trail of dashes, like the lights on a marquee.
1Expand the stroke’s property group in the Timeline panel.
2Click the Add A Dash Or Gap button to add a dash and gap to one cycle of the dashed-line pattern that you
want to create. You can add up to three dashes for each stroke pattern.
3Modify the Dash and Gap properties to make the dashes and gaps the lengths that you want.
Line Cap options for strokes
The Line Cap property for a dashed stroke determines the appearance of the ends of the stroke segments (dashes).
Butt Cap The stroke ends at the end of the path.
Round Cap Thestrokeextendsbeyondtheendofthepathforanumberofpixelsequaltothestroke’swidth.Thecap
is a semicircle.
Projecting Cap The stroke extends beyond the end of the path for a number of pixels equal to the stroke’s width. The
end is squared off.
AB C
AFTER EFFECTS CS3
User Guide
331
Line Join options for strokes
The Line Join property for a stroke determines the appearance of the stroke where the path suddenly changes
direction (turns a corner).
Miter Join A pointed connection. The Miter Limit value determines the conditions under which a beveled join is
used instead of a miter join. If the miter limit is 4, then when the length of the point reaches four times the stroke
weight, a bevel join is used instead. A miter limit of 1 causes a bevel join.
Round Join A rounded connection.
Bevel Join A squared-off connection.
Fill rules for shapes
A fill operation works by painting color in the area defined as inside a path. Determining what is considered inside
a path is easy when the path is something simple, like a circle. However, when a path intersects itself, or when a
compound path consists of paths enclosed by other paths, determining what is considered inside is not as easy.
After Effects uses one of two rules to determine what is considered inside a path for the purpose of creating fills. Both
rules count the number of times that a straight line drawn from a point crosses the path on its way out of the area
surrounded by a path. The nonzero winding fill rule considers path direction; the even-odd fill rule does not.
After Effects and Illustrator use the nonzero winding fill rule as the default.
Self-intersecting path with Fill Rule set to Non-Zero Winding Fill Rule (left) compared with Even-Odd Fill Rule (right)
Even-odd fill rule If a line drawn from a point in any direction crosses the path an odd number of times, then the
point is inside; otherwise, the point is outside.
Nonzero winding fill rule The crossing count for a line is the total number of times that the line crosses a left-to-right
portion of the path minus the total number of times that the line crosses a right-to-left portion of the path. If a line
drawn in any direction from the point has a crossing count of zero, then the point is outside; otherwise, the point is
inside.
A more intuitive way to think of the nonzero winding rule is to think of a path as a loop of string. A point is
considered outside the path if you can put your finger at that point and then pull the string away without it being
caught, wrapped around your finger.
Because the nonzero winding fill rule takes path direction into account, using this fill rule and reversing the direction
of one or more paths in a compound path is useful for creating holes in compound paths. To reverse a path’s
direction, click the Reverse Path Direction On button for the path in the Timeline panel.
AFTER EFFECTS CS3
User Guide
332
Alter shape paths with path operations
Path operations are live, which means that you can modify or remove them at any time. Path operations apply to all
paths above them in the same group; as with all shape attributes, you can reorder path operations by dragging,
cutting, copying, and pasting in the Timeline panel.
1In the Composition panel or Timeline panel, select the shape group into which to add the path operation.
2Choose a path operation from the Add menu in the Tools panel or the Timeline panel:
Merge Paths Combines paths into a compound path. (See “Merge Paths options” on page 333.)
Offset Paths Expands or contracts a shape by offsetting the path from the original path. For a closed path, a positive
Amount value expands the shape; a negative Amount value contracts it. The Line Join property specifies the
appearance of the path where offset path segments come together. A bevel join is a squared-off connection. A miter
join is a pointed connection. The miter limit determines the conditions under which a beveled join is used instead
of a miter join. If the miter limit is 4, then when the length of the point reaches four times the stroke weight, a bevel
join is used instead. A miter limit of 1 causes a bevel join.
Pucker & Bloat Pulls a path’s vertices outward while curving the segments inward (Pucker), or pulls a path’s vertices
inward while curving the segments outward (Bloat).
Repeater Creates multiple copies of a shape, applying a specified transformation to each copy. (See “Using the
Repeater to replicate shapes” on page 333.)
Round Corners Rounds corners of paths. Higher Radius values cause greater roundness.
Trim Paths Animate the Start, End, and Offset properties to trim a path to create results similar to those achieved
with the Write-on effect and the Write On setting for paint strokes. If the Trim Paths path operation is below multiple
paths in a group, then you can choose to have the paths trimmed simultaneously or treated as a compound path and
trimmed individually.
Twist Rotates a path more sharply in the center than at the edges. Entering a positive value twists clockwise; entering
a negative value twists counterclockwise.
Wiggle Paths Turns a path into a series of jagged peaks and valleys of various sizes. The distortion is auto-animated,
meaning that it changes over time without the need to set any keyframes or add expressions. Several properties for
this path operation behave the same as properties of the same name for the Wiggly selector for text animation. The
Correlation property specifies the amount of correlation between a vertex’s movement and that of its neighbors;
smaller values create more jagged results, as the position of a vertex depends less on the position of its neighbors.
The Correlation property is similar to Correlation for the Wiggly selector, except that the Wiggle Paths version
specifies the correlation between neighboring vertices instead of neighboring characters. Set the maximum length
for segment paths using an absolute or relative size. Set the density of jagged edges (Detail) and choose between soft
edges (Smooth) or sharp edges (Corner).
Animate the Size property to fade the wiggling up or down. To smoothly accelerate or decelerate the wiggling, set
Wiggles/Second to a constant value of 0, and animate the Temporal Phase property.
Zig Zag Turns a path into a series of jagged peaks and valleys of uniform size. Set the length between peaks and
valleys using an absolute or relative size. Set the number of ridges per path segment, and choose between wavy edges
(Smooth) or jagged edges (Corner).
AFTER EFFECTS CS3
User Guide
333
Merge Paths options
The Merge Paths path operation takes all of the paths above it in the same group as input. The output is a single path
that combines the input paths. The input paths are still visible in the Timeline panel, but they are essentially removed
from the rendering of the shape layer, so they don’t appear in the Composition panel. A fill and stroke are added after
the Merge Paths property group in the Timeline panel if a fill and stroke are not already present; otherwise, the
output path wouldn’t be visible.
Merge Paths options
A. Add for all shapes B. Subtract for squares C. Intersect for squares D. Exclude Intersections for squares
The Merge Paths path operation has the following options, each of which performs different calculations to
determine the output path:
Merge Merges all input paths into a single compound path. This is the default used for shapes created from text
characters made up of multiple paths, like the letter e, when using the Create Outlines command.
Add Creates a path that encompasses the union of the areas of the input paths.
Subtract Creates a path that encompasses only the areas defined by the topmost path, subtracting the area defined
by underlying paths.
Intersect Creates a path that encompasses only the areas defined by intersections between all input paths.
Exclude Intersections Creates a path that is the union of the areas defined by all input paths, minus the areas defined
by intersections between all input paths.
Using the Repeater to replicate shapes
The Repeater path operation creates virtual copies of all paths, strokes, and fills above it in the same group. The
virtual copies are not represented by separate entries in the Timeline panel, but they are rendered in the Composition
panel. Each copy is transformed according to its order in the set of copies and the values of the properties in the
Transform property group for that instance of the Repeater.
AB
CD
AFTER EFFECTS CS3
User Guide
334
Original shape (top left), one instance of the Repeater operation applied (top right), and two instances of the Repeater operation applied
(bottom right)
If the original shape is numbered 0, the next copy is numbered 1, and so on, then the result of the Repeater is to apply
each transformation in the Transform property group n times to copy number n.
Consider the example of the Repeater applied to a shape with the Copies value set to 10 and the Position property in
the Transform property group for the Repeater set to (0.0, 8.0). The original shape remains in its original position,
(0.0, 0.0). The first copy appears at (0.0, 8.0), the second copy appears at (0.0, 16.0), the third copy appears at (0.0,
24.0), and so on until the ninth copy at (0.0, 72.0), for a total of ten shapes.
You can apply multiple instances of the Repeater within the same group. In other words, you can repeat the Repeater.
This is an easy way to create a grid of virtual copies of a single shape: just set the Position property for one instance
of the Repeater to modify the horizontal values, and another instance to modify vertical values.
The Offset property value is used to offset the transformations by a number of copies. For example, if the Copies
value is 10 and the Offset value is 3, then the original shape is transformed by 3 times the amount specified in the
Transform property group, and the last copy is transformed by 12 times the amount specified in the Transform
property group.
Animating the Offset property is a good way to easily create interesting results.
The Composite option determines whether copies are rendered above (in front of) or below (behind) the copies that
precede them.
Use the Start Opacity value to set the opacity of the original shape, and the End Opacity value to set the opacity for
the last copy. Opacity values for copies in between are interpolated.
If you place the Repeater after a path, above the fill and stroke property groups for a shape, then the set of virtual
copies is filled or stroked as a compound path. If you leave the Repeater below the fill and stroke, then each copy is
filled and stroked individually. The difference is most apparent with gradient fills and strokes.
335
Chapter 13: Motion tracking
Motion tracking overview
About motion tracking
With motion tracking, you can track the movement of an object and then apply the tracking data for that movement
to another object—such as another layer or an effect control point—to create compositions in which images and
effects follow the motion. You can also stabilize motion, in which case the tracking data is used to animate the
tracked layer to compensate for movement of an object in that layer. You can link properties to tracking data using
expressions, which opens up a wide variety of uses.
After Effects tracks motion by matching image data from a selected area in a frame to image data in each succeeding
frame. You can apply the same tracking data to different layers or effects. You can also track multiple objects in the
same layer.
Motion tracking has many uses. Here are some examples:
•Combining elements filmed separately, such as adding video to the side of a moving city bus or a star to the end
of a sweeping wand.
•Animating a still image to match the motion of action footage, such as making a cartoon bumblebee sit on a
swaying flower.
•Animating effects to follow a moving element, such as making a moving ball glow. Michele Yamazaki provides a
tutorial on the Toolfarm website that shows how to use motion tracking to obscure a logo in motion footage:
www.adobe.com/go/learn_ae_micheletracklogo.
•Linking the tracked object’s position to other properties, such as making stereo audio pan from left to right as a
car races across the screen.
•Stabilizing footage to hold a moving object stationary in the frame to examine how a moving object changes over
time, which can be useful in scientific imaging work.
•Stabilizing footage to remove the jostling of a handheld camera.
Depending on the encoder you use, it is possible to decrease the size of your final output file by stabilizing motion
footage. Random motion, such as from the jostling of a handheld camera, can make it difficult for many compression
algorithms to compress your video.
You set up, initiate, and apply motion tracking with the Tracker Controls panel.
As with all properties, you can modify, animate, manage, and link tracking properties in the Timeline panel.
You specify areas to track by setting track points in the Layer panel. Each track point contains a feature region,asearch
region, and an attach point. A set of track points is a tracker.
AFTER EFFECTS CS3
User Guide
336
Layer panel with track point
A. Search region B. Feature region C. Attach point
Feature region The feature region defines the element in the layer to be tracked. The feature region should surround
a distinct visual element, preferably one object in the real world. After Effects must be able to clearly identify the
tracked feature throughout the duration of the track, despite changes in light, background, and angle.
Search region The search region defines the area that After Effects will search to locate the tracked feature. The
trackedfeatureneedstobedistinctonlywithinthesearchregion,notwithintheentireframe.Confiningthesearch
to a small search region saves search time and makes the search process easier, but runs the risk of the tracked feature
leaving the search region entirely between frames.
Attach point The attach point designates the place of attachment for the target —the layer or effect control point to
synchronize with the moving feature in the tracked layer.
Note: Whenyoubegintracking,AfterEffectssetsthequalityofthemotionsourcelayertoBestandtheresolutiontoFull
in the Composition and Layer panels, which makes the tracked feature easier to find and enables subpixel processing and
positioning.
After Effects uses one track point to track position, two track points to track scale and rotation, and four points to
perform tracking using corner pinning.
Motion tracking workflow
The implicit first step of any workflow is to determine the result that you want to achieve before you begin. What
sort of motion will you track, and what will you apply the tracking data to?
As with many workflows in the real world, you may have to repeat some of these steps. You can track a layer as many
times as desired and apply any combination of tracking results.
1. Set up the shot
For motion tracking to go smoothly, you must have a good feature to track, preferably a distinctive object or region.
ABC
AFTER EFFECTS CS3
User Guide
337
For best results, prepare the object or region that you are tracking before you begin shooting. Because After Effects
compares image data from one frame to the next to produce an accurate track, attaching high-contrast markers to
the object or region lets After Effects more easily follow the motion from frame to frame. Lightweight, brightly
colored balls (such as ping-pong balls) placed on the feature work particularly well, in part because their appearance
is the same from all angles. The number of markers that you use corresponds to the number of points you are
tracking. For example, if you’re tracking four points using the Perspective Corner Pinning option, you’ll track four
features, to correspond to the four corners of the layer to attach. The more markers you add to your subject before
shooting, the more features you’ll have for tracking—but the more items you might have to remove later from the
image with the Clone Stamp tool. You don’t need to add a marker for each feature if there is already a distinctive
object or region at the appropriate location.
2. Add the appropriate number of track points
When you choose a mode from the Track Type menu in the Tracker Controls panel, After Effects places the appro-
priate number of track points in the Layer panel for that mode. You can add more track points to track additional
features with one tracker.
3. Select features to track, and place feature regions
Before you begin tracking, view the entire duration of the shot to determine the best features to track. What is clearly
identifiable in the first frame may later blend into the background because the angle, lighting, or surrounding
elements have changed. A tracked feature may disappear off-screen or be obscured by another element at some point
in the scene. Though After Effects can extrapolate the feature’s motion, your chances for successful tracking are
highest if you step through the entire shot to select the best candidates for tracking.
A good tracked feature has these characteristics:
•Visible for the entire shot
•A contrasting color from the surrounding area in the search region
•A distinct shape within the search region
•A consistent shape and color throughout the shot
4. Set the attach point offset
The attach point is where the target layer or effect control point will be placed. The default attach point position is in
the center of the feature region. You can move the attach point to offset the target’s position relative to the tracked
feature’s position by dragging the attach point in the Layer panel before tracking.
Forexample,toanimateacloudaboveaperson’shead,positionthefeatureregionontheheadandmovetheattach
pointabovethehead.Ifyoulefttheattachpointcenteredinthefeatureregion,thecloudwouldbeattachedtothat
point and would obscure the person’s head.
Attach point centered in feature region
AFTER EFFECTS CS3
User Guide
338
Attach point offset from feature region
5. Adjust the feature region, search region, and tracking options
Place each feature region control tightly around its tracked feature, completely enclosing the tracked feature, but
including as little of the surrounding image as possible.
The size and position of the search region depend on the movement of the feature you want to track. The search
region must accommodate the movement of the tracked feature, but only the frame-to-frame movement, not its
movement throughout the shot. As After Effects locates the tracked feature in a frame, both the feature region and
search region move to the new location. Therefore, if the frame-to-frame movement of the tracked feature is gradual,
then the search region needs to be only slightly larger than the feature region. If the feature changes position and
direction quickly, then the search region needs to be big enough to encompass the largest position and direction
change in any pair of frames.
You can also set tracking options that determine such things as which color channels are compared to find a match
to the feature region.
6. Analyze
You perform the actual motion tracking step by clicking one of the Analyze buttons in the Tracker Controls panel.
When tracking a tricky set of features, you may want to analyze a frame at a time.
7. Repeat as necessary
Because of the changing nature of an image in motion, automatic tracking is rarely perfect. In moving footage, the
shape of a feature changes, along with the lighting and surrounding objects. Even with careful preparation, a feature
generally changes during a shot and at some point no longer matches the original feature. If the change is too great,
After Effects may not be able to track the feature, and the track point will wander or drift.
When the analysis begins to fail, return to the frame where tracking was still accurate and repeat steps 5 and 6 above:
adjust and analyze.
8. Apply tracking data
If you’re using any Track Type setting other than Raw, you apply tracking data by clicking Apply, after making sure
that the correct target is shown for Motion Target. You apply tracking data from a Raw tracking operation by copying
keyframes from the trackers to other properties or by linking properties with expressions.
You can also adjust the Attach Point or Attach Point Offset property after tracking in the Timeline panel, which can
be useful when applying the same tracking data to multiple targets that you want to distribute around the tracked
feature.
AFTER EFFECTS CS3
User Guide
339
Note: If the layer that you’re attaching has motion blur enabled, make sure that the Shutter Phase value is set to -1/2
times the Shutter Angle value. This centers the motion blur on the attach point. Otherwise, the attached object may
appear to lead or lag the object that it’s attached to.
See also
“Use motion blur” on page 200
Motion tracking controls
You set up, initiate, and apply motion tracking with the Tracker Controls panel.
Motion Source The layer that contains the motion to track.
Note: Layers are available in the Motion Source menu if they have source footage items that can contain motion or if
they are composition layers. You can precompose a layer to make it available in the Motion Source menu.
Current Track
The active tracker. You can modify settings for a tracker at any time by selecting the tracker from this menu.
Track Type Thetrackingmodetouse.Themotiontrackingitselfisthesameforeachofthesemodes;theydifferin
the number of track points and how the tracking data is applied to the target:
•Stabilize tracks position, rotation, and/or scale to compensate for movement in the tracked (source) layer. When
tracking position, this mode creates one track point and generates Anchor Point keyframes for the source layer.
Whentrackingrotation,thismodecreatestwotrackpointsandproducesRotationkeyframesforthesourcelayer.
When tracking scale, this mode creates two track points and produces Scale keyframes for the source layer.
•Transform tracks position, rotation, and/or scale to apply to another layer. When tracking position, this mode
creates one track point on the tracked layer and sets Position keyframes for the target. When tracking rotation,
this mode creates two track points on the tracked layer and sets Rotation keyframes for the target. When tracking
scale, this mode creates two track points and produces Scale keyframes for the target.
•Parallel Corner Pin tracks skew and rotation, but not perspective; parallel lines remain parallel, and relative
distances are preserved. This mode uses three track points in the Layer panel—and calculates the position of the
fourth—and sets keyframes for four corner points in a Corner Pin effect property group, which is added to the
target. The four attach points mark the placement of the four corner points.
•Perspective Corner Pin tracks skew, rotation, and perspective changes in the tracked layer. This mode uses four
track points in the Layer panel and sets keyframes for four corner points in a Corner Pin effect property group,
which is added to the target. The four attach points mark the placement of the four corner points. This option is
useful for attaching an image to an opening door or the side of a bus that’s turning a corner.
•Raw tracks position only. Use Raw to generate tracking data that you won’t apply using the Apply button. For
example,youcancopyandpastethekeyframesfortheAttachPointpropertytothePositionpropertyforapaint
stroke; or, you can link effect properties for the Stereo Mixer effect to the x coordinate of the Attach Point property
using expressions. Tracking data is stored on the tracked layer. The Edit Target button and the Apply button are
not available with this tracking option. You can add track points to a tracker by choosing New Track Point from
the Tracker Controls panel menu.
Motion Target The layer or effect control point that the tracking data is applied to. After Effects adds properties and
keyframes to the target to move or stabilize it. Change the target by clicking Edit Target. No target is associated with
a tracker if Raw is selected for Track Type.
Analyze buttons Begins the frame-to-frame analysis of the track point in the source footage:
•Analyze 1 Frame Backward : Analyze the current frame by moving back to the previous frame.
AFTER EFFECTS CS3
User Guide
340
•Analyze Backward : Analyze from the current-time indicator backward to the beginning of the trimmed layer
duration.
•Analyze Forward : Analyze from the current-time indicator to the end of the trimmed layer duration.
•Analyze 1 Frame Forward : Analyze the current frame by advancing to the next frame.
Note: While analysis is in progress, the Analyze Backward and Analyze Forward buttons change to a Stop button, with
which you can stop analysis when the track drifts or otherwise fails.
Reset Restores the feature region, search region, and attach point to their default positions and deletes the tracking
data from the currently selected track. Tracker Control settings and keyframes already applied to the target layer
remain unchanged.
Apply Sends the tracking data (in the form of keyframes) to the target layer or effect control point.
See also
“Corner Pin effect” on page 405
Motion tracking options
These settings apply to a tracker, a group of track points that is generated in one tracking session. You can modify
these settings by clicking Options in the Tracker Controls panel.
Track Name The name for a tracker. You can also rename a tracker by selecting it in the Timeline panel and pressing
Enter on the main keyboard (Windows) or Return (Mac OS).
Tracker Plug-in The plug-in used to perform motion tracking for this tracker. By default, this option displays Built-
in, the only tracking plug-in included with After Effects.
Channel The components of the image data to use for comparison when searching for a match for the feature region.
Select RGB if the tracked feature is a distinct color. Select Luminance if the tracked feature has a different brightness
than the surrounding image (such as a burning candle carried through a room). Select Saturation if the tracked
feature has a high concentration of color, surrounded by variations of the same color (such as a bright red scarf
against a brick wall).
Process Before Match Temporarily blurs or sharpens an image to improve tracking. Blur reduces noise in the
footage. Usually a value of 2 to 3 pixels is enough to produce better tracks in grainy or noisy footage. Enhance
exaggerates or refines the edges of an image and makes them easier to track.
Note: After Effects blurs or enhances the layer only for tracking. This does not affect the motion source layer.
Track Fields Temporarily doubles the frame rate of the composition and interpolates each field to a full frame to
track motion in both fields of interlaced video.
Subpixel Positioning When selected, keyframes are generated to a precision of a fraction of a pixel. When
deselected, the tracker rounds off values to the nearest pixel for generated keyframes.
Adapt Feature On Every Frame Causes After Effects to adapt the tracked feature for each frame. The image data that
is searched for within the search region is the image data that was within the feature region in the previous frame,
rather than the image data that was in the feature region at the beginning of analysis.
If Confidence Is Below SpecifiestheactiontoperformwhentheConfidencepropertyvalueisbelowthepercentage
value that you specify.
AFTER EFFECTS CS3
User Guide
341
Note: To determine an acceptable confidence threshold, track the motion and then examine the Confidence values for
the track point in the Timeline panel for problematic frames. Specify a confidence value that is slightly larger than the
largest confidence value for the problematic frames.
•Select Continue Tracking to ignore the Confidence value. This is the default behavior.
•Select Stop Tracking to stop the motion tracking.
•Select Extrapolate Motion to estimate the position of the feature region. Attach-point keyframes aren’t created for
low-confidence frames, and attach-point keyframes for the low-confidence frames from previous tracks are
deleted.
•Select Adapt Feature to use the original tracked feature until the confidence level falls below the specified
threshold. At that point, After Effects adapts the tracked feature to be the contents of the feature region in the
frame preceding the one that has low confidence and continues tracking. This option isn’t available if Adapt
Feature On Every Frame is selected in the Motion Tracker Options dialog box; enabling feature adaptiveness
causes After Effects to adapt the feature region with every frame regardless of the confidence level.
Options Opens the Tracker Plug-in Options dialog box, which includes options for the AE Original Built-in Tracker.
This command is only available if you choose to use the older After Effects tracker plug-in.
Motion tracking properties in the Timeline panel
Each time you click Track Motion or Stabilize Motion in the Tracker Controls panel (or choose Animation > Track
Motion or Animation > Stabilize Motion), a new tracker is created for the layer in the Timeline panel. Each tracker
contains track points, which are property groups that store the tracking data after tracking has been performed.
Trackers are grouped in the Motion Trackers property group for each layer in the Timeline panel.
To show a tracker in the Timeline panel, select the tracker from the Current Track menu in the Tracker Controls panel
and press SS.
You can rename trackers and track points and modify and animate their property values in the Timeline panel just
as you do for other layer properties and property groups. You must click Apply in the Tracker Controls panel to apply
the property changes to the target.
Feature Center Position of the center of the feature region.
Feature Size Width and height of the feature region.
Search Offset Position of the center of the search region relative to the center of the feature region.
Search Size Width and height of the search region.
Confidence Property through which After Effects reports the amount of certainty regarding the match made for
each frame. In general, this is not a property that you modify.
Attach Point Position assigned to the target layer or effect control point.
Attach Point Offset Position of the attach point relative to the center of the feature region.
AFTER EFFECTS CS3
User Guide
342
Tracking motion
Track or stabilize motion
Tracking motion and stabilizing motion are essentially the same process, only with a different target and result. Use
Track Motion to track motion and apply the results to a different layer or effect control point. Use Stabilize Motion
to track motion and apply the results to the tracked layer to compensate for that motion.
To stabilize a layer, After Effects tracks the motion of a feature in the layer that should be stationary in the frame, and
then uses the tracking data to set keyframes to perform the opposite motion. You can stabilize to remove any combi-
nation of changes in position, rotation, and scale, while leaving desired motion unaffected. For example, if the
camera is panning, deselect Position but select Scale and Rotation as the properties to stabilize.
When you select Rotation or Scale in the Tracker Controls panel, you set two track points in the Layer panel. A line
connectstheattachpoints;anarrowpointsfromthefirstattachpoint(thebase)tothesecond.Ifpossible,placethe
featureregionsonoppositesidesofthesameobject,oratleastonobjectsthatarethesamedistancefromthecamera.
The farther apart the regions, the more accurate the calculations and the better the result.
After Effects calculates rotation by measuring the change of angle of the line between the attach points. When you
apply the tracking data to the target, After Effects creates keyframes for the Rotation property.
After Effects calculates scale by comparing the distance between attach points on each frame with the distance
between the attach points on the start frame. When you apply the tracking data to the target, After Effects creates
keyframes for the Scale property.
When you track motion using either parallel or perspective corner pinning, After Effects applies keyframes for the
Corner Pin effect to the layer to scale and skew the target layer as necessary to fit the four-sided area defined by the
feature regions. The feature regions should lie in a single plane in the real world—for example, on the side of a bus,
onthesamewall,oronthefloor.Theattachpointsshouldalsoalllieinasingleplane,butnotnecessarilythesame
plane as the feature regions.
Note: For parallel corner pinning only: To change which point is inactive, Alt-click (Windows) or Option-click (Mac OS)
the feature region of the point to make inactive. (One point must remain inactive to keep the lines parallel.)
1Select the layer to track in the Timeline panel.
2Do one of the following:
•Click Track Motion in the Tracker Controls panel (or choose Animation > Track Motion), click Edit Target, and
choose the target to apply the tracking data to.
•Click Stabilize Motion in the Tracker Controls panel (or choose Animation > Stabilize Motion). The target layer
is the tracked (source) layer.
3Select Position, Rotation, and/or Scale to specify what kinds of keyframes to generate for the target.
4Move the current-time indicator to the frame from which to begin tracking.
5Using the Selection tool, adjust the feature region, search region, and attach point for each track point.
6In the Tracker Controls panel, click either the Analyze Forward or Analyze Backward button to begin tracking.
If the tracking ceases to be accurate, click the Stop button , correct the problem as described in “Correct a motion
track” on page 345, and resume analysis.
7When you are satisfied with the position of the feature region and attach point throughout the track, click the
Apply button to apply the motion to the specified target.
AFTER EFFECTS CS3
User Guide
343
After Effects creates keyframes for the target layer.
When tracking position and applying this position data to a target, you can choose to apply only the x (horizontal)
or y (vertical) component of motion. For example, you can apply the tracking data to the x axis to make a speech
bubble (the motion target) remain at the top of the frame even when the actor’s head (the motion source) moves
downward.
•X And Y (default) allows motion along both axes.
•X Only restricts the motion target to horizontal movement.
•Y Only restricts the motion target to vertical movement.
To bypass the Motion Tracker Apply Options dialog box and use the previous setting, hold Alt (Windows) or Option
(Mac OS) as you click Apply.
When you stabilize a layer, the compensating motion may itself cause the layer to move too far in one direction,
exposing the background in the composition or moving action out of the action-safe zone. You can correct this with
a small change in scale for the layer. Find the frame where the problem is most severe, and then increase or decrease
thescaleofthelayeruntiltheproblemisresolved.Thistechniqueadjuststhescaleforthedurationofthelayer;you
can also animate scale to correct this problem by zooming in and out at different times.
This post on the AE Enhancers forum describes and links to an animation preset from Donat van Bellinghen for
scaling a set of Corner Pin effect points: www.adobe.com/go/learn_ae_donatscalecornerpin.
This post on the AE Enhancers forum describes and links to a script from Paul Tuersley that takes a stabilized layer,
precomposes it, and then adds expressions that counter the stabilization:
www.adobe.com/go/learn_ae_paulstabilizefortracking.
This post on the AE Enhancers forum describes and links to a script from Paul Tuersley that can make a difficult
tracking job easier by averaging multiple sets of tracking data: www.adobe.com/go/learn_ae_paulaveragetracks.
See also
“Motion tracking workflow” on page 336
“Set the work area” on page 112
“Scale a layer” on page 155
Adjust the track point
When you set up motion tracking, it’s often necessary to refine your track point by adjusting the feature region,
search region, and attach point. You can resize or move these items independently or in groups by dragging using
theSelectiontool.Tohelpyoudefinetheareatobetracked,theimageareawithinthefeatureregionismagnifiedto
400% while you move the region.
AFTER EFFECTS CS3
User Guide
344
Track point components and Selection tool pointer icons
A. Search region B. Feature region C. Keyframe marker D. Attach point E. Moves search region F. Moves both regions G. Moves entire track
point H. Moves attach point I. Moves entire track point J. Resizes region
•To turn on or off feature region magnification, choose Magnify Feature When Dragging from the Tracker
Controls panel menu.
•To move the feature region, search region, and attach point together, drag inside the track point area (avoiding the
regionedgesandtheattachpoint),orpresstheUp,Down,Left,orRightArrowkey.HoldShiftwhilepressingan
arrow key to move by an increment 10 times as large.
•To move only the feature and search regions together, drag the edge of the feature region, or Alt-drag (Windows)
or Option-drag (Mac OS) with the Selection tool inside the feature or search region. You can also hold Alt
(Windows) or Option (Mac OS) while pressing the Up, Down, Left, or Right Arrow key. Hold Alt+Shift
(Windows) or Option+Shift (Mac OS) while pressing an arrow key to move by an increment 10 times as large.
•To move only the search region, drag the edge of the search region.
Offsetthesearchregioncenterfromthefeatureregioncenterinthedirectioninwhichthetrackedfeatureistraveling.
•To move only the attach point, drag the attach point.
•To resize the feature or search region, drag a corner handle.
•Tomakealloftheregion’ssidesmatchthelengthofthelongestside,andtoresizetheregionrelativetotheoriginal
region’s center point, Shift-drag a corner handle.
•To make all of the region’s sides match the length of the longest side, and to resize the region relative to a particular
corner handle, Ctrl+Shift-drag (Windows) or Command+Shift-drag (Mac (OS) the opposite corner handle.
To restrict the movement of the track point to the x (horizontal) or y (vertical) axis during tracking, resize the height
or width of the search region to match the height or width of the feature region.
CDA
E
F
H
G
I
J
B
AFTER EFFECTS CS3
User Guide
345
Apply tracking data to a new target
After you’ve tracked a motion source layer, you can apply that layer’s stored tracking data to any number of other
target layers and effect control points. For example, you can apply the track to a light bulb’s position and to the Lens
Flare effect’s control point.
1In the Tracker Controls panel, choose the tracked layer from the Motion Source menu.
2Choose the track that contains the tracking data you want from the Current Track menu.
3Click Edit Target, and choose the target.
4In the Tracker Controls panel, click the Apply button.
Correct a motion track
As an image moves in a shot, the lighting, surrounding objects, and angle of the object can all change, making the
once distinct feature no longer identifiable at the subpixel level. Also, if the search region is too small, the tracked
feature may leave its bounds from one frame to the next.
Learning to choose a trackable feature takes time. Even with careful planning and practice, the feature region can
drift away from the desired feature. Re-adjusting the feature and search regions, changing the tracking settings, and
trying again is a standard part of automatic tracking. It’s not necessary to get a single good track in one try. You may
need to track the shot in sections, redefining the feature region in places where the feature changes and the region
drifts. You may even need to choose a different feature to track, one with movement that closely matches that of the
feature to track, and use the attach point offset to place the target.
After you’ve tracked motion, each track point has a motion path in the Layer panel that shows the position of the
center of the feature region. You can fine-tune the motion path’s keyframes in the Layer panel as you would any other
motion path. This is most useful when you want to manually change the motion tracking data before applying it to
a target. In some cases, it may be easier to manually modify the motion path created by the motion tracker than to
get a perfect track.
Motion source and its motion path
A. Moving the feature and search regions B. Keyframe marker
See also
“Creating and modifying motion paths” on page 197
Correct drifting by adjusting the feature and search regions
1Move the current-time indicator to the last well-tracked frame.
A
B
AFTER EFFECTS CS3
User Guide
346
2Alt-drag (Windows) or Option-drag (Mac OS) the feature and search regions only (not the attach point) to the
correct location.
3If you are correcting the track for one frame, go to step 4. If you are correcting the track for several contiguous
frames, adjust the feature region and search region if necessary, and click Analyze. Watch the tracking to make sure
that it is accurate. If the tracking is not accurate, then click the button again to stop tracking, adjust the feature region,
and begin again.
4When you are satisfied with the track, click Apply to apply the keyframes to the target layer or effect control point.
Correct drifting by modifying tracking settings
1Move the current-time indicator to the last well-tracked frame.
2In the Tracker Controls panel, click Options.
3Change settings in the Motion Tracker dialog box as appropriate. (See “Motion tracking options” on page 340.)
4In the Tracker Controls panel, click the Analyze Forward or the Analyze Backward button.
5Watch the tracking to make sure that it is accurate. If the tracking is not accurate, then click the button again to
stop tracking, adjust the settings, and begin again.
6When you are satisfied with the track, click Apply to apply the keyframes to the target layer or effect control point.
347
Chapter 14: Effects and animation presets
Effects and animation presets overview
About animation presets
Animation presets let you save and reuse specific configurations of layer properties and animations, including
keyframes, effects, and expressions. After Effects includes hundreds of animation presets that you can drop into your
projects and then modify to suit your needs.
You can browse and apply animation presets in After Effects using the Effects & Presets panel or Adobe Bridge. To
open the Presets folder in Adobe Bridge, choose Browse Presets from the Effects & Presets panel menu or from the
Animation menu.
Many animation presets don’t contain animation; rather, they contain combinations of effects, transform properties,
and so on. A behavior animation preset uses expressions instead of keyframes to animate layer properties.
Animation presets can be saved and transferred from one computer to another. The filename extension for an
animation preset is .ffx.
The animation presets that are installed with After Effects are in the Presets folder located in the Program
Files\Adobe\Adobe After Effects CS3\Support Files (Windows) or Applications/Adobe After Effects CS3 (Mac OS)
folder. Animation presets that you create are saved by default in the Presets folder located in My
Documents\Adobe\After Effects CS3 (Windows) or Documents/Adobe/After Effects CS3.
You can download additional animation presets—including a set of animation presets that make use of shape layers
and per-character 3D text animation—from the Adobe After Effects Exchange:
www.adobe.com/go/learn_ae_cs3additionalanimationpresets.
You can also download animation presets from many After Effects commnuity websites, such as the AE Enhancers
forum: www.adobe.com/go/learn_ae_aeenhancershome.
You can add a single new animation preset or an entire folder of new animation presets to either of the Presets folders.
When After Effects starts, it searches both of the Presets folders and their subfolders for installed presets and adds
them to the Effects & Presets panel. After Effects ignores the contents of folders with names that begin and end in
parentheses; for example, the contents of the folder (archived_animation_presets) will not be loaded.
Note: Animation presets appear in the Effects & Presets panel only if they are located in one of the Presets folders or a
subfolder of one of the Presets folders. If you move a preset to a new folder, place a shortcut (Windows) or an alias
(Mac OS) of that folder in the Presets folder.
See also
“Apply an effect or animation preset” on page 351
“Save an animation preset” on page 353
“Use Adobe Bridge with After Effects” on page 28
AFTER EFFECTS CS3
User Guide
348
About effects
After Effects includes a variety of effects, which you apply to layers to add or modify video and audio characteristics.
For example, an effect can alter the exposure or color of a layer’s image, add new visual elements, manipulate sound,
distort images, remove grain, enhance lighting, animate text, or create a transition.
You browse and apply effects using the Effects & Presets panel. You modify effect properties using the Effect Controls
panel or Timeline panel or by moving effect control points in the Layer panel or Composition panel.
Youcanapplymultipleinstancesofthesameeffecttoalayer,renameeachinstance,andsetthepropertiesforeach
instance separately.
To see a video tutorial on applying and working with effects, visit the Adobe website at www.adobe.com/go/vid0228.
Note: Path operations on shape layers, such as Zig Zag and Pucker & Bloat—which you apply through the shape layer’s
Add menu—are called effects in Adobe Illustrator, but they function differently from other effects in After Effects.
Because effects are implemented as plug-ins, you can install and use additional effects that parties other than Adobe
provide. You can add a single new effect or an entire folder of new effects to the Plug-ins folder, which is located by
default in the Program Files\Adobe\Adobe After Effects CS3\Support Files (Windows) or Applications/Adobe After
Effects CS3 (Mac OS) folder. When After Effects starts, it searches the Plug-ins folder and its subfolders for all
installed effects and adds them to the Effect menu and to the Effects & Presets panel. After Effects ignores the
contents of folders with names that begin and end in parentheses; for example, the contents of the folder
(archived_effects) will not be loaded.
Adobe provides many third-party effect plug-ins with After Effects. Keylight, Color Finesse, and Cycore FX plug-ins
are installed by default with the After Effects application. The installers for some plug-ins install their documentation
in the same directory as the plug-ins themselves. Documentation for Cycore FX plug-ins is available on the Cycore
website: www.adobe.com/go/learn_ae_cycorefxdocumentation.
For more information on the various categories of After Effects effects, see “Effect reference” on page 355.
Animating effects
You animate effect properties in the same way that you animate any other properties—by adding keyframes or
expressions to them. In most cases, even effects that rely on animation for their normal use require that you set some
keyframes or expressions. For example, animate the Transition Completion property of a Transition effect or the
Evolution setting of the Fractal Noise effect to turn a static effect into a dynamic effect.
Color depth
Manyeffectssupportprocessingofimagecolorandalphachanneldataatadepthof16or32bitsperchannel(bpc).
Using an 8-bpc effect in a 16-bpc or 32-bpc project can result in a loss of color detail. If an effect supports only 8 bpc,
andyourprojectissetto16or32bpc,theEffectControlspaneldisplaysawarningicon nexttotheeffectname.
YoucansettheEffects&Presetspaneltolistonlytheeffectsthatsupportthecolordepthofthecurrentproject.(See
“Set the color depth” on page 234.)
Render order
The order in which After Effects renders masks, effects, layer styles, and transform properties—called the rendering
order—may affect the final result of an applied effect. By default, effects appear in the Timeline panel and Effect
Controls panel in the order in which they were applied. Effects are rendered in order from top to bottom in this list.
To change the order in which effects are rendered, drag the effect name to a new position in the list. (See “Render
order and collapsing transformations” on page 115.)
AFTER EFFECTS CS3
User Guide
349
An effect applied to an adjustment layer affects all layers below it in the layer stacking order in the Timeline panel.
(See “Create an adjustment layer” on page 136.)
Expression Controls effects
Expression Controls effects do not modify existing layer properties; rather, these effects add layer properties that
expressions can refer to. (See “Using Expression Controls effects” on page 555.)
Preventing edge clipping with the Grow Bounds effect
Because an effect is applied to a layer, the results of some effects are constrained to the layer’s bounds, which can
make the effect appear to end abruptly. You can apply the Grow Bounds effect to a layer to temporarily extend the
layer for the purpose of calculating the results of other effects. This process is not necessary for newer effects, which
tend to be 32-bpc effects.
Managing effects and effect properties with scripts
Paul Tuersley provides a script with which you can search compositions for effects and turn them on or off:
www.adobe.com/go/learn_ae_pauleffecttoggle.
Paul Tuersley also provides a script that makes synchronizing changes to effect properties on multiple layers easier:
www.adobe.com/go/learn_ae_pauleffectmultiplelayers.
See also
“About plug-ins” on page 44
“Layer switches and columns in the Timeline panel” on page 147
About compound effects and control layers
Several effects rely on a control layer as input. These compound effects use the pixel values of the control layer to
determinehowtoaffectthepixelsofthelayerthattheeffectisappliedto.Forexample,theDisplacementMapeffect
uses the color values of a control layer to determine how far to shift pixels of the underlying layer, and in which
direction. The compound effect ignores effects, masks, and transformations of a control layer, unless the layer has
been precomposed. It is common to use a control layer that is not itself visible—that is, its Video switch is off.
Most compound effects include a Stretch Map To Fit option (or a similarly named option), which temporarily
stretches or shrinks a control layer to the effect layer’s dimensions. This provides a pixel in the control layer corre-
sponding to each pixel in the effect layer. If you deselect this option, the compound effect’s calculations are
performed as if the control layer is centered on the effect layer at its original size.
For many compound effects, neutral gray pixels in the control layer correspond to null operations. This makes a
neutral gray solid layer a good starting point for creating a control layer. Apply the Fractal Noise effect to a layer and
precompose it to create a good control layer for turbulent or atmospheric results.
Effects with a Comp Camera attribute
Some effects can use a composition’s camera and lights. These effects include Card Dance, Card Wipe, and Shatter.
Some of these effects always use the composition camera, whereas others include light and camera options in the
Effect Controls panel.
AFTER EFFECTS CS3
User Guide
350
When you apply an effect with a Comp Camera attribute to a 2D layer, the effect can track the composition’s camera
and light positions and render a 3D image on the 2D layer that it is applied to. The effect’s results appear 3D; however,
the layer with the Comp Camera attribute applied remains a 2D layer and consequently has the following character-
istics:
•3DlayersaboveandbelowitintheTimelinepanelcannotintersectwitheachotherorcastshadowsoneachother.
•It cannot intersect with 3D layers or cast or accept shadows.
Note: The image is rendered on the layer, not the composition, so make sure that you apply these effects to layers that
are the same size as the composition and are exactly centered in the composition.
Working with effects and animation presets
Work with effects in the Effect Controls panel
When you apply an effect to a layer, the Effect Controls panel opens, listing the effect you just applied and controls
to change the property values for the effect. You can also work with effects and change most effect property values
in the Timeline panel. However, the Effect Controls panel has more convenient controls for many kinds of properties,
such as sliders, effect control point buttons, and histograms.
The Effect Controls panel is a viewer, which means that you can have Effect Controls panels for multiple layers open
at once and can use the viewer menu in the panel’s tab to select layers.
•To open or close the Effect Controls panel for the selected layer, press F3.
•To reset all of an effect’s properties to their default values, click Reset at the top of the effect’s entry.
•To duplicate selected effects, choose Edit > Duplicate, or press Ctrl+D (Windows) or Command+D (Mac OS).
•To move an effect to a different place in the rendering order, drag the effect up or down in the effect stack.
•To set an effect’s properties to the properties used in an animation preset, choose from the Animation Presets
menu at the top of the effect’s entry in the Effect Controls panel.
•To hide the Animation Presets menu in the Effect Controls panel, deselect Show Animation Presets in the panel menu.
See also
“Work with viewers” on page 19
Effects & Presets panel overview
Browse and apply effects and animation presets with the Effects & Presets panel. Each item in the panel is identified
by type with an icon:
32-bpc effect
16-bpc effect
8-bpc effect
audio effect
animation preset
AFTER EFFECTS CS3
User Guide
351
You can scroll through the list of effects and animation presets, or you can search for effects and animation presets
by typing any part of the name in the Contains box.
The options that you choose in the Effects & Presets panel menu determine which items are shown:
Show Effects For All Color Depths Shows effects that work with any color depth, not just the effects that work with
the depth of the current project.
Show Effects Shows all available effects.
Show Animation Presets Shows all animation presets, including those saved by you in the Presets folder.
The panel organizes effects and animation presets according to the option that you select from the panel menu:
Categories, Explorer Folders (Windows) or Finder Folders (Mac OS), or Alphabetical.
Use the following commands in the panel menu to manage your effects and animation presets:
Reveal In Explorer (Windows) or Reveal In Finder (Mac OS) Opens the folder that contains the effect or animation
preset selected in the Effects & Presets panel.
Refresh List Updates the list of effects and animation presets.
See also
“Set the color depth” on page 234
Apply an effect or animation preset
•To apply an effect or animation preset to a single layer, drag the effect or animation preset from the Effects &
Presets panel to a layer in the Timeline, Composition, or Effect Controls panel.
Note: When you’re dragging an effect or animation preset onto a layer in the Composition panel, the name of the layer
under the pointer is shown in the Info panel. If you release the mouse button when the pointer is not over a layer, a new
layer is created to hold the effect or animation preset.
•Toapplyaneffectoranimationpresettooneormorelayers,selectthelayers,andthendouble-clicktheeffector
animation preset in the Effects & Presets panel.
•To apply an effect to one or more layers, select the layers, and then choose Effect > [category] >[effect].
•To apply a recently used or saved animation preset to one or more layers, select the layers, choose Animation >
Recent Animation Presets, and then choose the animation preset from the list.
•To apply the most recently applied animation preset to one or more layers, select the layers, and then press
Ctrl+Alt+Shift+F (Windows) or Command+Option+Shift+F (Mac OS).
•To apply the most recently applied effect to one or more layers, select the layers, and then press Ctrl+Alt+Shift+E
(Windows) or Command+Option+Shift+E (Mac OS).
•To apply an animation preset to one or more layers using Adobe Bridge, select the layers, choose Animation >
Browse Presets, navigate to the animation preset, and then double-click it.
•To apply the effect settings from an animation preset to the current instance of an effect, choose the animation
preset name from the Animation Presets menu for the effect in the Effect Controls panel.
•To copy a layer’s effects to one or more layers, select the effects in the Timeline panel or Effect Controls panel,
choose Edit > Copy, select the target layers, and choose Edit > Paste.
Note: Applying an effect or animation preset to a layer selects the layer.
AFTER EFFECTS CS3
User Guide
352
By default, when you apply an effect to a layer, the effect is active for the duration of the layer. However, you can make
an effect start and stop at specific times or make the effect more or less intense over time by using keyframes or
expressions or by applying the effect to an adjustment layer.
Animation presets are applied at the current time.
See also
“Create an adjustment layer” on page 136
Delete or disable effects and animation presets
After you’ve applied effects to a layer, you can temporarily disable one or all the effects on the layer to concentrate
on another aspect of your composition. Effects that are disabled do not appear in the Composition panel and
typically are not included when the layer is previewed or rendered. However, in the Render Queue panel, you can
specify that the composition is rendered for final output with all effects on, regardless of which effects are rendered
forpreviewsintheCompositionpanel.Disablinganeffectdoesnotdeletethekeyframescreatedforanyoftheeffect
properties; all keyframes remain until the effect is deleted from the layer.
You can’t disable an animation preset or delete it from a layer as a unit. You can, of course, individually delete or
disable the effects, keyframes, and expressions that it comprises.
•To delete one effect from a layer, select the effect name in the Effect Controls panel or Timeline panel, and press
Delete.
•To delete all effects from one or more layers, select the layers in the Timeline or Composition panel and choose
Effect > Remove All or press Ctrl+Shift+E (Windows) or Command+Shift+E (Mac OS).
Note: This command eliminates all keyframes for the deleted effects. If you choose Remove All accidentally, immediately
choose Edit > Undo Delete Effect to restore the effects and keyframes.
•Totemporarilydisableoneeffect,selectthelayerintheEffectControlsorTimelinepanel,andthenclicktheEffect
switch to the left of the effect name.
•To temporarily disable all effects on a layer, click the Effect switch in the Switches column for the layer in the
Timeline panel.
Effect switch in the Effect Controls panel and Effect switch in the Timeline panel
A. The Effect switch in the Effect Controls panel turns a specific effect on or off. B. TheEffectswitchintheTimelinepanelalsoturnsaspecific
effect on or off. C. The Effect switch in the Switches column of the Timeline panel turns all effects on a layer on or off.
Remove an effect or animation preset
You can remove an effect or animation preset from the folder in which After Effects searches for these items,
preventing it from being loaded and from being shown in the Effects & Presets panel or Effect menu.
1Select the effect or animation preset in the Effects & Presets panel.
2Choose Reveal In Explorer (Windows) or Reveal In Finder (Mac OS) from the panel menu.
3Move the effect (.aex) or animation preset (.ffx) file out of the Plug-ins or Presets folder.
ABC
AFTER EFFECTS CS3
User Guide
353
4Choose Refresh List from the Effects & Presets panel menu to update the list of animation presets in the panel.
The list of effects is only updated when the application starts.
Rather than removing effects or animation presets entirely, consider creating a subfolder in the Plug-ins or Presets
folder for effects or animation presets that you seldom use. After Effects ignores the contents of folders with names
that begin and end with parentheses, such as (archive_folder).
Save an animation preset
You can save any combination of properties and their keyframes and expressions as an animation preset. This
includes effects and their properties. For example, if you created an explosion using several effects with complex
property settings, keyframes, and expressions, you can save all of those settings as a single animation preset. You can
then apply that animation preset to any other layer.
Animation presets appear in the Animation Presets category in the Effects & Presets panel.
1Select any combination of properties (e.g., Position and Scale) and property groups (e.g., Paint and Transform). If
you are selecting only effects, you can select them in the Effect Controls panel.
2Choose Save Animation Preset from the Animation menu or from the Effects & Presets panel menu.
3Specify a filename and location, and then click Save.
For the animation preset to appear in the Effects & Presets panel, it must be saved in the Presets folder.
Note: If the animation preset does not appear in the Effects & Presets panel, choose Refresh List from the Effects & Presets
panel menu.
Work with effect control points
Some effects have effect control points, which determine how the effect is applied to the layer. For example, the
Advanced Lightning effect has two effect control points—Origin and Direction—which specify where the lightning
begins and in which direction it points.
The coordinates for effect control points are in the layer’s coordinate space (layer space), not in the composition’s
coordinate space (composition space). The coordinates shown in the Info panel are in layer space when the Layer
panel is active.
View an effect control point
•To view an effect control point in the Layer panel, choose the effect name from the Layer panel’s View menu.
•To view an effect control point in the Composition panel, select the effect name in the Timeline panel or Effect
Controls panel.
Note: To view effect control points in the Composition panel, you must have Show Layer Controls selected in the View
menu and Effect Controls selected in View Options (View > View Options).
Move an effect control point
•In the Composition panel or Layer panel, drag the effect control point .
•In the Effect Controls panel, click the effect control point button ; then, in the Composition or Layer panel,
click where you want the effect control point.
•In the Timeline or Effect Controls panel, drag or enter values for the x and y coordinates for the effect control point
as you would to modify any other property.
AFTER EFFECTS CS3
User Guide
354
About randomness and random seeds
Because true randomness is not repeatable, many effects simulate randomness by using a calculation that generates
seemingly random results for each value of a Random Seed property. Multiple instances of the same effect will give
the same results if all of their settings—including the Random Seed property values—are the same. This allows you
to get predictable, deterministic results, while still achieving the appearance of randomness.
ChangingtheRandomSeedvaluedoesn’tmakethingsmoreorlessrandom;itonlymakesthemseemrandomina
different way.
You can add randomness to any property with the expressions in the Random Numbers category.
See also
“Random Numbers methods” on page 563
355
Chapter 15: Effect reference
Adobe provides many third-party effect plug-ins with After Effects. Keylight, Color Finesse, and Cycore FX plug-ins
are installed by default with the After Effects application. The installers for some plug-ins install their documentation
in the same directory as the plug-ins themselves. Documentation for Cycore FX plug-ins is available on the Cycore
website: www.adobe.com/go/learn_ae_cycorefxdocumentation.
Galleries of effects
3D Channel effects gallery
Blur & Sharpen effects gallery
No effect applied
“3D Channel Extract effect” on page 368 “Depth Matte effect” on page 368 “Depth Of Field effect” on page 369
“Fog 3D effect” on page 370 “ID Matte effect” on page 371
No effect applied
AFTER EFFECTS CS3
User Guide
356
Channel effects gallery
“Box Blur effect” on page 376 “Channel Blur effect” on page 376 “Compound Blur effect” on page 376
“Directional Blur effect” on page 377 “Fast Blur effect” on page 377 “Gaussian Blur effect” on page 378
“Lens Blur effect” on page 378 “Radial Blur effect” on page 379 “Sharpen effect” on page 380
“Smart Blur effect” on page 380 “Unsharp Mask effect” on page 380
No effect applied
“Alpha Levels effect” on page 381 “Arithmetic effect” on page 381 “Blend effect” on page 382
AFTER EFFECTS CS3
User Guide
357
Color Correction effects gallery
“Calculations effect” on page 383 “Channel Combiner effect” on page 383 “Compound Arithmetic effect” on
page 384
“Invert effect” on page 384 “Minimax effect” on page 385 “Remove Color Matting effect” on
page 385
“Set Channels effect” on page 386 “Set Matte effect” on page 386 “Shift Channels effect” on page 387
“Solid Composite effect” on page 387
No effect applied
“Auto Color and Auto Contrast effects”
on page 388
“Auto Levels effect” on page 389 “Brightness & Contrast effect” on
page 389
AFTER EFFECTS CS3
User Guide
358
“Broadcast Colors effect” on page 390 “Change Color effect” on page 390 “Change To Color effect” on page 391
“Channel Mixer effect” on page 392 “Color Balance effect” on page 392 “Color Balance (HLS) effect” on
page 392
“Color Link effect” on page 392 “Color Stabilizer effect” on page 393 “Colorama effect” on page 393
“Curves effect” on page 396 “Equalize effect” on page 396 “Exposure effect” on page 397
“Gamma/Pedestal/Gain effect” on
page 397
“Hue/Saturation effect” on page 398 “Leave Color effect” on page 399
“Levels effect” on page 399 “Levels (Individual Controls) effect” on
page 400
“Photo Filter effect” on page 400
AFTER EFFECTS CS3
User Guide
359
Distort effects gallery
“PS Arbitrary Map effect” on page 401 “Shadow/Highlight effect” on page 402 “Tint effect” on page 403
“Tritone effect” on page 403
No effect applied
“Bezier Warp effect” on page 404 “Bulge effect” on page 404 “Corner Pin effect” on page 405
“Displacement Map effect” on page 406 “Liquify effect” on page 406 “Magnify effect” on page 408
“Mesh Warp effect” on page 409 “Mirror effect” on page 410 “Offset effect” on page 410
AFTER EFFECTS CS3
User Guide
360
Generate effects gallery
“Optics Compensation effect” on
page 410
“Polar Coordinates effect” on page 411 “Reshape effect” on page 412
“Ripple effect” on page 414 “Smear effect” on page 415 “Spherize effect” on page 416
“Transform effect” on page 417 “Turbulent Displace effect” on page 417 “Twirl effect” on page 418
“Warp effect” on page 418 “Wave Warp effect” on page 419 “Puppet effect” on page 412
No effect applied
“4-Color Gradient effect” on page 419 “Advanced Lightning effect” on page 420 “Audio Spectrum effect” on page 421
AFTER EFFECTS CS3
User Guide
361
“Audio Waveform effect” on page 423 “Beam effect” on page 423 “Cell Pattern effect” on page 424
“Checkerboard effect” on page 425 “Circle effect” on page 426 “Ellipse effect” on page 426
“Eyedropper Fill effect” on page 426 “Fill effect” on page 427 “Fractal effect” on page 427
“Grid effect” on page 429 “Lens Flare effect” on page 429 “Lightning effect” on page 430
“Paint Bucket effect” on page 431 “Radio Waves effect” on page 432 “Ramp effect” on page 435
“Scribble effect” on page 435 “Stroke effect” on page 437 “Vegas effect” on page 438
“Write-on effect” on page 439
AFTER EFFECTS CS3
User Guide
362
Keying effects gallery
Matte effects gallery
Noise & Grain effects gallery
“Color Difference Key effect” on
page 440
“Color Key effect” on page 442 “Color Range effect” on page 442
“Difference Matte effect” on page 443 “Extract effect” on page 445 “Inner/Outer Key effect” on page 446
“Linear Color Key effect” on page 447 “Luma Key effect” on page 448 “Spill Suppressor effect” on page 449
“Matte Choker effect” on page 450 “Simple Choker effect” on page 451
No effect applied
AFTER EFFECTS CS3
User Guide
363
Paint effects gallery
Perspective effects gallery
“Add Grain effect” on page 459 “Dust & Scratches effect” on page 460 “Fractal Noise effect” on page 461
“Match Grain effect” on page 464 “Median effect” on page 466 “Noise effect” on page 466
“Noise Alpha effect” on page 466 “Noise HLS effect and Noise HLS Auto
effect” on page 467
“Remove Grain effect” on page 468
“Paint effect” on page 471 “Vector Paint effect” on page 471
No effect applied
“3D Glasses effect” on page 481 “Basic 3D effect” on page 483 “Bevel Alpha effect” on page 484
AFTER EFFECTS CS3
User Guide
364
Simulation effects gallery
Stylize effects gallery
“Bevel Edges effect” on page 484 “Drop Shadow effect” on page 484 “Radial Shadow effect” on page 485
“Card Dance effect” on page 487 “Caustics effect” on page 489 “Foam effect” on page 491
“Particle Playground effect” on page 495 “Shatter effect” on page 508 “Wave World effect” on page 514
No effect applied
“Brush Strokes effect” on page 517 “Color Emboss effect” on page 518 “Emboss effect” on page 518
“Find Edges effect” on page 519 “Glow effect” on page 519 “Mosaic effect” on page 520
AFTER EFFECTS CS3
User Guide
365
Text effects gallery
“Motion Tile effect” on page 520 “Posterize effect” on page 521 “Roughen Edges effect” on page 521
“Scatter effect” on page 522 “Strobe Light effect” on page 523 “Texturize effect” on page 523
“Threshold effect” on page 524
No effect applied
“Basic Text effect” on page 524 “Numbers effect” on page 525 “Path Text effect” on page 526
“Timecode effect” on page 530
AFTER EFFECTS CS3
User Guide
366
Time effects gallery
Transition effects gallery
“Echo effect” on page 531 “Posterize Time effect” on page 532 “Time Difference effect” on page 532
“Time Displacement effect” on page 533 “Timewarp effect” on page 535
No effect applied
“Block Dissolve effect” on page 537 “Card Wipe effect” on page 537 “Gradient Wipe effect” on page 539
“Iris Wipe effect” on page 540 “Linear Wipe effect” on page 541 “Radial Wipe effect” on page 541
“Venetian Blinds effect” on page 542
AFTER EFFECTS CS3
User Guide
367
Utility effects gallery
3D Channel effects
About 3D Channel effects
The 3D Channel effects work on 2D layers—specifically, 2D layers with 3D information in auxiliary channels. The
sources of these 2D layers are 3D scenes that have been rendered out of a 3D application.
Use 3D Channel effects to integrate 3D scenes into 2D composites and to make changes to those 3D scenes. You can
import 3D image files saved in RLA, RPF, Softimage PIC/ZPIC, and Electric Image EI/EIZ formats. For PIC and EI
files, the 3D channel information is in the ZPIC and EIZ files, respectively. You don’t actually import ZPIC and EIZ
files, but as long as they’re in the same folder with the PIC and EI files, you have access to their 3D channels using
the 3D Channel effects. The 3D Channel effects don’t affect other types of files.
3D Channel effects read and manipulate the additional channels of information, including z-depth, surface normals,
object ID, texture coordinates, background color, unclamped RGB, and material ID. You can layer 3D elements along
the z axis, insert other elements in a 3D scene, blur areas in a 3D scene, isolate 3D elements, apply a foggy effect with
depth, and extract 3D channel information for use as parameters in other effects.
If you convert a layer to 3D and view it from anywhere but the front and center, it doesn’t appear as expected.
To display a pixel’s depth and other channel values in the Info panel, apply a 3D Channel effect, and then—with the
effect selected—click the pixel in the Composition panel or Layer panel using the Selection tool.
See also
“About 3D layers” on page 171
“Cineon Converter effect” on page 542 “Color Profile Converter effect” on
page 543
“Grow Bounds effect” on page 544
“HDR Compander effect” on page 545 “HDR Highlight Compression effect” on
page 546
AFTER EFFECTS CS3
User Guide
368
3D Channel Extract effect
The 3D Channel Extract effect makes auxiliary channels visible as either grayscale or multichannel color images. You
can then use the resulting layer as a control layer for other effects. For example, extract the depth information in a
3D channel image file and then use it as an influence map in the Particle Playground effect, or extract values from
the unclamped RGB channel to produce a matte that generates glowing highlights.
To display a pixel’s 3D channel values in the Info panel, apply the 3D Channel Extract effect, select the channel in the
Effect Controls panel, and then click the pixel in the Composition panel or Layer panel using the Selection tool.
This effect works with 8-bpc color.
Original (left), with 3D Channel Extract applied using Texture UV (right)
3D Channel The channel to extract from the 3D image.
White Point, Black Point The value that is mapped to white or black.
See also
“About 3D layers” on page 171
Depth Matte effect
The Depth Matte effect reads the depth information in a 3D image and slices the image anywhere along the z axis.
For example, you can remove a background in a 3D scene, or you can insert objects into a 3D scene.
To insert a layer into a 3D scene, apply the Depth Matte effect to the layer containing the 3D scene, set the Depth
property to the depth at which you want to insert the new layer, duplicate the 3D scene layer, select Invert for the 3D
scene layer on top, and place the new layer between the two 3D scene layers in the layer stacking order in the Timeline
panel.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
369
Original (top left), with effect applied (bottom left), and with effect applied and Invert Alpha selected (bottom right)
Depth
The z axis value at which to slice the image. Everything with a depth value less than this Depth value is matted out.
To determine the depth of an object, click it in the Composition panel or Layer panel using the Selection tool while
the effect is selected.
Feather The amount of feather along the matte’s edges.
Invert Select to matte out everything with a depth greater than the Depth value. Deselect to matte out everything
with a depth less than the Depth value.
See also
“About 3D layers” on page 171
Depth Of Field effect
The Depth Of Field effect simulates a camera that’s focusing at one depth (focal plane) in a 3D scene, blurring objects
at other depths. This effect uses the depth information from the auxiliary channel of an imported file representing a
3D scene. To use the depth information that After Effects calculates for a camera layer, see “Create a camera layer
and change camera settings” on page 176.
This effect works with 8-bpc color.
Original (top left), and with Depth Of Field applied using different Focal Plane values (bottom left and bottom right)
Focal Plane The distance along the z axis of the focal plane from the camera.
AFTER EFFECTS CS3
User Guide
370
To show the depth of an object in the Info panel, click the object in the Composition panel or Layer panel using the
Selection tool while the effect is selected.
Maximum Radius How much blur is applied to objects outside the focal plane.
Focal Plane Thickness Determines what depths are in focus on either side of the focal plane.
Focal Bias The higher the value, the more quickly elements drop out of focus with increasing distance from the focal
plane.
See also
“About 3D layers” on page 171
Fog 3D effect
The Fog 3D effect simulates fog by behaving as though there is a scattering medium in the air that makes objects look
more diffuse as they get more distant along the z axis.
This effect works with 8-bpc color.
Original (top left), Gradient Layer (bottom left), and with Fog 3D applied (bottom right)
Fog Start Depth Where along the z axis the diffuse scattering begins.
To determine the depth of an object, click it in the Composition panel or Layer panel using the Selection tool while
the effect is selected.
Fog End Depth Where along the z axis the diffusion reaches its maximum.
Scattering Density Determines how quickly the scattering occurs. The higher the value, the more dense the fog
appears from its starting point.
Foggy Background Creates a foggy background (default). Deselect to create transparency at the back of the 3D scene
for compositing on top of another layer.
Gradient Layer (Optional) A grayscale layer to use as a control layer, the luminance values of which apply to fog
density. For example, use the Fractal Noise effect to create a swirling control layer for atmospheric fog. Make sure
that the dimensions of the gradient layer are at least as great as the dimensions of the 3D scene layer.
Layer Contribution How much the gradient layer affects the fog density.
AFTER EFFECTS CS3
User Guide
371
See also
“About 3D layers” on page 171
ID Matte effect
Many 3D programs tag each element in a scene with a unique Object ID. The ID Matte effect uses this information
to create a matte that excludes everything in the scene except the element you want.
Original (top left), with ID Matte applied using the near alien as the ID Selection (bottom left), and composited over a new background (bottom
right)
Aux. Channel Isolate elements based on Object ID or Material ID.
ID Selection The ID value for an object.
To determine the ID of an object, select the ID type from the Aux. Channel menu in the Effect Controls panel, and
click the object in the Composition panel or Layer panel using the Selection tool while the effect is selected. If Object
ID is selected for Aux. Channel, ID Selection automatically updates to the Object ID for the object you click.
Feather The amount of feather along the matte’s edges.
Invert Invertstheselection.SelecttomatteouttheobjectspecifiedbyIDSelection.Deselecttomatteouteverything
but the object (default).
Use Coverage Creates a cleaner matte by removing the colors stored behind the object from the pixels along the edge
of the matte. This option works only if the 3D image contains a coverage channel that stores information about the
colors behind objects.
See also
“About 3D layers” on page 171
Audio effects
Backwards effect
TheBackwardseffectreversesalayer’saudiobyplayingitfromthelastframetothefirstframe.Theframesremain
in their original order in the Timeline panel. Select Swap Channels to swap left and right channels.
AFTER EFFECTS CS3
User Guide
372
See also
“Preview video and audio” on page 120
Bass & Treble effect
The Bass & Treble effect boosts (increases) or cuts (decreases) the low frequencies (bass) or the high frequencies
(treble) of the audio. For greater control, use the Parametric EQ effect.
See also
“Preview video and audio” on page 120
Delay effect
The Delay effect repeats audio after a specified amount of time. This effect simulates sound bouncing off a surface,
such as a wall.
To simulate the acoustic ambience of a room, use the Reverb effect.
Delay Time Time between the original sound and its echo, in milliseconds.
Delay Amount Volume of the first delayed audio, as a fraction of the original.
Feedback Amount of the echo that is fed back into the delay line to create subsequent echoes.
Dry Out, Wet Out The amounts of the original (dry) sound and delayed (wet) sound in the final output. Values of
50% are commonly used.
See also
“Preview video and audio” on page 120
Flange & Chorus effect
Flange is an audio effect caused by mixing the original audio with a copy that is delayed by a varying amount that
cycles over time. The frequency of the copy is also offset by an amount related to the delay. Chorus uses a larger delay,
to make one voice or instrument sound like many.
The default settings for the Flange & Chorus effect are for flange. To create a chorus result, use values something like
the following: 40 for Voice Separation Time (or higher for a greater chorus result), 4 for Voices, 0.1 for Modulation
Rate, 50% for Modulation Depth, and 90 for Voice Phase Change, with Stereo Voices selected.
Voice Separation Time The time in milliseconds that separates each voice. Each voice is a delayed version of the
original sound. Use values of 6 or lower for flange, and higher values for chorus.
Voices The number of voices in the processed (wet) audio.
Modulation Rate The rate in Hz at which the modulation cycles.
Modulation Depth The amount of modulation.
Voice Phase Change The modulation phase difference in degrees between each subsequent voice. Divide 360 by the
number of voices to find the optimum value.
Invert Phase Inverts the phase of the processed (wet) audio, emphasizing more of the high frequencies; not inverting
the phase emphasizes more of the low frequencies.
AFTER EFFECTS CS3
User Guide
373
Stereo Voices Alternates assignment of voices to one of the two channels so that the first voice appears in the left
channel, the second in the right channel, the third in the left, and so on. To hear stereo voices, you must preview or
render in stereo.
Dry Out, Wet Out The amounts of the original (dry) sound and delayed (wet) sound in the final output. Values of
50% are commonly used.
See also
“Preview video and audio” on page 120
High-Low Pass effect
The High-Low Pass effect sets a limit above or below which frequencies can pass. High Pass allows frequencies above
the limit and blocks frequencies below. Conversely, Low Pass allows frequencies below the limit and blocks
frequencies above. Use High-Low Pass to do the following:
•Enhance or attenuate (reduce) a sound. For example, using High Pass can reduce traffic noise, which often is
concentrated at low frequencies, while minimally affecting a voice recording. Using Low Pass can remove high-
frequency sounds, such as static and buzzing.
•Changethefocusfromonesoundtoanotherovertime.Forexample,inaudiothatcontainsbothmusicandvoice,
you can fade out the music while gradually bringing in the voice.
•Protect equipment from potentially damaging frequencies.
•Direct certain frequencies to specific equipment. For example, use Low Pass to isolate sounds intended for a
subwoofer.
To check the frequencies that you filter out, switch to the opposite Filter Options value and preview audio.
Cutoff Frequency All frequencies below (High Pass) or above (Low Pass) are removed. If the unwanted sound
changes over time, animate this property.
To identify the frequencies of unwanted sound, use the Audio Spectrum effect.
Dry Out, Wet Out The amounts of the original (dry) sound and delayed (wet) sound in the final output. Common
values for removing frequencies are 0% for Dry Out and 100% for Wet Out.
See also
“Audio Spectrum effect” on page 421
“Preview video and audio” on page 120
Modulator effect
The Modulator effect adds both vibrato and tremolo to audio by modulating (varying) the frequency and amplitude.
Modulation Type The type of waveform to use. Sine produces smoother modulation. Triangle produces more abrupt
modulation.
Modulation Rate The rate in Hz of the modulation.
Modulation Depth The amount of frequency modulation.
AFTER EFFECTS CS3
User Guide
374
Amplitude Modulation The amount of amplitude modulation.
See also
“Preview video and audio” on page 120
Parametric EQ effect
The Parametric EQ effect emphasizes or attenuates specific frequency ranges. Parametric EQ is useful for enhancing
music, such as boosting low frequencies to bring up bass.
If you have audio with an unwanted sound (such as a beep from a forklift in the background), you can isolate and
cut the frequency range of the beep to attenuate the sound.
Using this effect, you can enhance up to three different bands of audio. As you adjust controls, a frequency-response
graph indicates the combined equalization curve you create; band 1 is red, band 2 is green, and band 3 is blue. You
may find it easier to specify controls if you determine in advance the frequency-response curve you want.
To identify the frequencies of unwanted sound, use the Audio Spectrum effect.
Band Enabled Activates an equalization band and its controls.
Frequency The center of the frequency band to modify.
Bandwidth The width of the frequency band to modify.
Boost/Cut The amount by which to boost (increase) or cut (decrease) the amplitude of the frequencies inside the
specified band. Positive values boost; negative values cut.
See also
“Audio Spectrum effect” on page 421
“Preview video and audio” on page 120
Reverb effect
The Reverb effect simulates a spacious or acoustically live interior by simulating random reflections of a sound off a
surface.
Reverb Time The average time, in milliseconds, between the original audio and the reverberated audio.
Diffusion Specifies how much the effect scatters the original audio. More diffusion can make the audio sound farther
from the microphone.
Decay Specifies the amount of time it takes for the effect to subside. A higher value simulates a larger space.
Brightness Specifies the amount of detail preserved from the original audio. High brightness simulates a room with
live (highly reflective) acoustics.
Dry Out, Wet Out The amounts of the original (dry) sound and delayed (wet) sound in the final output. Values of
50% are commonly used.
See also
“Preview video and audio” on page 120
AFTER EFFECTS CS3
User Guide
375
Stereo Mixer effect
The Stereo Mixer effect mixes the left and right channels of audio and pans the entire signal from one channel to the
other.
Invert Phase Inverts the phase of both channels of the stereo signal. Use this control to prevent two sounds at the
same frequency from canceling each other out.
See also
“Preview video and audio” on page 120
Tone effect
The Tone effect synthesizes simple audio tones to create sounds, such as the low rumble of a submarine, a telephone
ringing in the background, sirens, or a laser blast. You can have up to five tones for each instance of the Tone effect,
to create a chord. When you apply this effect to a layer with audio, the dry (original, unprocessed) audio is ignored,
and only the tone plays.
You can also apply the Tone effect to a layer that has no audio, such as a solid layer, to synthesize audio.
Note: The Tone effect doesn’t generate audio on a placeholder layer; for the effect to generate audio, you must replace the
placeholder with a footage item.
Waveform Options Specifies the type of waveform to use. Sine waves produce the purest tones. Square waves
produce the most distorted tones. Triangle waves have elements of both sine waves and square waves but are closer
to sine waves. Saw waves have elements of both sine waves and square waves but are closer to square waves.
Frequency Frequency in Hz. To turn off a tone, set its frequency to 0.0.
Level Changes the amplitude of all tones in this instance of the effect. To avoid clipping and popping, use a Level
value that is no greater than 100 divided by the number of frequencies you use. For example, if you use all five
frequencies, specify 20%.
Note: To avoid clicks at the end of a tone, set a keyframe for the desired Level value at the frame just before the end of
thetone,andthensetakeyframeforaLevelvalueof0.0attheendofthetone.Thistechniqueworkswellforanyaudio
that you end abruptly.
See also
“Preview video and audio” on page 120
“Set keyframes” on page 187
Blur & Sharpen effects
About Blur & Sharpen effects
In general, blur effects sample the area around a pixel and assign to the pixel a new value that is the average of the
sampled values. Increased blurriness is the result of increasing the size of the sample, whether this is expressed as a
radius or a length.
AFTER EFFECTS CS3
User Guide
376
Some blur effects have a Repeat Edge Pixels option. Select this option to make the blur algorithm operate as if the
pixel values beyond the edge of the layer are the same as those of the edge pixels. This option keeps edges sharp,
preventing them from darkening and becoming more transparent—the result of being averaged with a lot of zeroes.
Deselect this option to make the blur algorithm operate as if the pixel values beyond the edge of the layer are zero.
Note: Film grain and noise are removed from an image when you blur it. To make the image look more realistic, you
may want to add noise back to the image so that it doesn’t look retouched. (See “Noise & Grain effects” on page 452.)
Box Blur effect
Box Blur is similar to Fast Blur and Gaussian Blur, but Box Blur has the added advantage of an Iterations property,
which allows you to control the quality of the blur.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Iterations How many times the blur is sequentially applied to the image. A value around 3 gives a blur similar in
qualitytoFastBlur.Ahighernumberofiterationscreatessmoothertransitionsbetweencolorsandincreasestheblur,
but it also increases the render time. The default value creates boxy results.
Channel Blur effect
The Channel Blur effect blurs a layer’s red, green, blue, or alpha channels individually.
Note: If you have noise or artifacts primarily in one color channel—such as MPEG compression artifacts in the blue
channel of DV footage—use Channel Blur to clean up the noise in that channel, leaving the other channels sharp.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Compound Blur effect
The Compound Blur effect blurs pixels in the effect layer based on the luminance values of a control layer, also
knownasablur layer or blurring map. By default, bright values in the blur layer correspond to more blurring of the
effect layer, while dark values correspond to less blurring; select Invert Blur for light values to correspond to less
blurring.
This effect is useful for simulating smudges and fingerprints, or changes in visibility caused by atmospheric condi-
tions such as smoke or heat, especially with animated blur layers such as those generated with the Fractal Noise
effect.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
AFTER EFFECTS CS3
User Guide
377
Original (top left), blur layer (bottom left), and result (bottom right)
Maximum Blur The maximum amount, in pixels, that any part of the affected layer can be blurred.
Stretch Map To Fit Stretches the control layer to the dimensions of the layer to which it is applied; otherwise, the
control layer is centered on the effect layer.
See also
“About compound effects and control layers” on page 349
Directional Blur effect
The Directional Blur effect gives a layer the illusion of motion.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with effect applied (right)
Direction The direction of the blur. The blur is applied equally on either side of a pixel’s center; therefore, a setting
of 180˚ and a setting of 0˚ produce the same results.
Fast Blur effect
When layer quality is set to Best, Fast Blur is a close approximation of Gaussian Blur, but Fast Blur blurs large areas
more quickly.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
AFTER EFFECTS CS3
User Guide
378
Original (left), and with effect applied (right)
Gaussian Blur effect
The Gaussian Blur effect blurs and softens the image and eliminates noise. The layer’s quality setting doesn’t affect
Gaussian Blur.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with effect applied (right)
Lens Blur effect
The Lens Blur effect simulates the blurring of objects not in the focal plane of a camera. The appearance of the blur
depends on the control layer used as a depth map and the iris settings for the simulated camera aperture.
This effect works with 8-bpc and 16-bpc color.
Original (top left), Depth Map layer (bottom left), and result (bottom right)
Depth Map Layer The control layer from which the depth map is taken.
Depth Map Channel The channel of the control layer to use as the depth map. Pixels with low values correspond to
low depth (near the camera); pixels with high values correspond to high depth (far from the camera). Select Invert
Depth Map to invert this relationship.
Blur Focal Distance Depth of the focal plane, where pixels are in focus.
Iris Shape The polygon to use as the iris shape.
AFTER EFFECTS CS3
User Guide
379
Iris Blade Curvature The roundness of the edges of the iris.
Iris Rotation The rotation of the iris.
Iris Radius The size of the iris. Increase this value for greater blur.
Specular Threshold All pixels with a brightness value greater than Specular Threshold are treated as specular
highlights.
Specular Brightness Brightness of specular highlights.
Noise controls Film grain and noise are removed when you blur an image. To make the image look more realistic,
you may want to add noise back to the image so that it doesn’t look retouched. To add noise, set Noise Amount, and
choose a noise type from the Noise Distribution menu. To add noise without affecting the color in your image,
choose Monochromatic Noise.
Stretch Map To Fit Stretches the control layer to the dimensions of the layer to which it is applied; otherwise, the
control layer is centered on the affected layer.
Radial Blur effect
The Radial Blur effect creates blurs around a point, simulating the result of a zooming or rotating camera.
You can specify the level of anti-aliasing applied at Best quality; no anti-aliasing is applied at Draft quality. At Draft
quality, the blur appears somewhat grainy. You may prefer the draft results for special effects, but the grain may
flicker on interlaced displays.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with effect applied (right)
Type Spin blurs in arcs around the Center point, as if the camera were rotating; Amount specifies degrees of rotation.
Zoom blurs radially outward from the center point; Amount specifies the length of the blur.
Reduce Interlace Flicker effect
The Reduce Interlace Flicker effect reduces high vertical frequencies to make images more suitable for use in an
interlaced medium (such as NTSC video). For example, images with very thin horizontal lines can flicker when
broadcast. Reduce Interlace Flicker softens horizontal edges to reduce the flickering.
This effect works with 8-bpc color.
Note: Flicker may result from fields that haven’t been separated.
See also
“Separate video fields” on page 71
AFTER EFFECTS CS3
User Guide
380
Sharpen effect
The Sharpen effect increases the contrast where color changes occur. The layer’s quality setting doesn’t affect
Sharpen.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Smart Blur effect
The Smart Blur effect blurs an image while preserving lines and edges within the image. For example, you can use
the Smart Blur effect to smoothly blur shaded areas while retaining crisp outlines of text and vector graphics.
Original (left), and with effect applied (right)
This effect works with 8-bpc and 16-bpc color.
Radius How far the filter searches for dissimilar pixels to blur.
Threshold How different the pixels’ values should be before they are eliminated.
Mode What parts of the image receive the blur. Normal specifies that the blur be applied to the entire selection,
whereas Edge Only and Overlay Edge specify that the blur be applied only to the edges of color transitions. Where
significant contrast occurs, Edge Only applies black-and-white edges, and Overlay Edge applies white.
Unsharp Mask effect
The Unsharp Mask effect increases the contrast between colors that define an edge.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Radius The distance from the edge at which pixels are adjusted for contrast. If you specify a low value, only pixels
near the edge are adjusted.
AFTER EFFECTS CS3
User Guide
381
Threshold The greatest difference between adjacent pixels for which contrast isn’t adjusted. A lower value produces
agreaterresult.Avaluethatistoolowcausescontrastfortheentireimagetobeadjustedandcangeneratenoiseor
cause unexpected results.
Channel effects
Alpha Levels effect
Use Alpha Levels to convert completely opaque or completely transparent areas of a matte to be semitransparent, or
to convert semitransparent areas to be completely opaque or completely transparent. Because transparency is based
on the monochrome alpha channel, the controls for this effect refer to complete transparency as black and complete
opacityaswhite.ThiseffectisverysimilartotheLevelseffect,whichperformsthesameoperationsoncolorchannels
instead of the alpha channel.
•UseOutputBlackLevelof0andInputBlackLevelgreaterthan0toconvertarangeofsemitransparentareastobe
completely transparent.
•Use Output White Level of 1.0 and Input White Level less than 1.0 to convert a range of semitransparent areas to
be completely opaque.
•Use Output Black Level greater than 0 to convert a range of completely transparent areas to be semitransparent.
• Use Output White Level less than 1.0 to convert a range of completely opaque areas to be semitransparent.
This effect works with 8-bpc and 16-bpc color.
Input Black Level Alpha channel values at this level or lower are mapped to the Output Black Level (maximum trans-
parency).
Input White Level Alpha channel values at this level or higher are mapped to the Output White Level (maximum
opacity).
Gamma Determines the distribution of intermediate (gray, semitransparent) values. A Gamma value of 1 produces
a linear distribution of gray values. Gamma less than 1 biases the distribution toward darker gray values (more trans-
parency). Gamma greater than 1 biases the distribution toward lighter gray values (less transparency).
See also
“Levels effect” on page 399
Arithmetic effect
The Arithmetic effect performs various simple mathematical operations on an image’s red, green, and blue channels.
This effect works with 8-bpc color.
Operator The operation to perform between the value you specify for each channel and the existing value of that
channel for each pixel in the image:
•And, Or, and Xor Apply bitwise logical operations.
•Add, Subtract, Multiply, and Difference Apply basic math functions.
•Max Set the pixel’s channel value to the greater of the specified value and the pixel’s original value.
•Min Set the pixel’s channel value to the lesser of the specified value and the pixel’s original value.
AFTER EFFECTS CS3
User Guide
382
•Block Above Set the pixel’s channel value to zero if the pixel’s original value is greater than the value specified;
otherwise, leave the original value.
•Block Below Set the pixel’s channel value to zero if the pixel’s original value is less than the value specified;
otherwise, leave the original value.
•Slice Set the pixel’s channel value to 1.0 if the pixel’s original value is above the specified value; otherwise, set the
value to zero. In both cases, the values for the other color channels are set to 1.0.
Clip Result Values Prevents all functions from creating color values that exceed the valid range. If this option isn’t
selected, some color values may wrap around.
Blend effect
The Blend effect blends two layers using one of five modes.
You can blend layers more easily and quickly using blending modes, but you can’t animate blending modes. The
advantage of using the Blend effect is that you can animate it. (See “Blending modes” on page 163.)
This effect works with 8-bpc and 16-bpc color.
Original (top left), matte created with Fractal Noise effect on a solid layer (bottom left), and result of Blend effect with Mode set to Crossfade
(bottom right)
Blend With Layer The layer to blend with (the secondary or control layer).
Note: TousealayerasacontrollayerfortheBlendeffectbutnotshowthelayerintherestofthecomposition,deselect
the control layer’s Video switch . (See “Layer switches and columns in the Timeline panel” on page 147.)
Mode Blending mode:
•Color Only colorizes each pixel in the original image based on the color of each corresponding pixel in the
secondary image.
•Tint Only is similar to Color Only but tints pixels in the original image only if they’re already colored.
•Darken Only darkens each pixel in the original image that is lighter than the corresponding pixel in the secondary
image.
•Lighten Only lightens each pixel in the original image that is darker than the corresponding pixel in the secondary
image.
•Crossfade causes the original image to fade out while the secondary image fades in.
AFTER EFFECTS CS3
User Guide
383
Note: You can create a crossfade without applying an effect by animating the Opacity property of one layer on top of
another. However, this technique doesn’t work if the frontmost layer has any transparent portions (which allow the other
layer to show through, even when at full opacity). The Crossfade mode creates a proper crossfade between two layers,
even if both have transparent regions.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
If Layer Sizes Differ Specifies how to position the control layer. The layer’s quality setting affects Blend only if Stretch
To Fit is selected and if the layers are of different sizes. Stretching at Best quality is much smoother.
Calculations effect
The Calculations effect combines channels of one layer with the channels of a second layer.
This effect works with 8-bpc and 16-bpc color.
Input Channel The channel to extract and use as input to the blending operation. RGBA displays all channels
normally. Gray converts all color channel values for a pixel to the luminance value of the original pixel. Red, Green,
or Blue converts all color channel values for a pixel to the value of the selected color channel for the original pixel.
Alpha converts all channels to the value of the alpha channel for the original pixel.
Invert Input Inverts the layer (subtracts each channel value from 1.0) before the effect extracts the specified channel
information.
Second Layer The control layer with which Calculations blends the original layer.
Second Layer Channel The channel to be blended with the input channels.
Second Layer Opacity The opacity of the second layer. Use a setting of 0% for the second layer to have no influence
on the output.
Invert Second Layer Inverts the second layer (subtracts each channel value from 1.0) before the effect extracts the
specified channel information.
Stretch Second Layer To Fit Stretches the second layer to the dimensions of the original layer before blending.
Deselect to center the second layer on the original layer.
Preserve Transparency Ensures that the original layer’s alpha channel isn’t modified.
See also
“Blending modes” on page 163
Channel Combiner effect
The Channel Combiner effect extracts, displays, and adjusts channel values for a layer.
Note: YoucanusethiseffecttoviewanychannelasagrayscaleimagebychoosingthechannelfromtheFrommenuand
choosing Lightness Only from the To menu.
This effect works with 8-bpc color.
Use 2nd Layer Retrieve values from Source Layer, which can be any layer in the composition.
AFTER EFFECTS CS3
User Guide
384
From Which values to use as input; the first several items in the menu are actually multichannel combinations of
input and output options, so they don’t require you to set a To value.
•Saturation Multiplied uses the saturation value multiplied by the lightness value, where lightness is the minimum
distance to black or white. For example, a dark or light blue pixel has a lower value than a bright or pure blue pixel.
This option represents the most common view of a pixel’s saturation value.
•Min RGB uses the lowest value among the red, green, and blue channel values.
•Max RGB uses the highest value among the red, green, and blue channel values.
To The channels to which to apply the values. Choose Red Only, Green Only, and Blue Only to apply the value to
onechannelonlyandsettheothercolorchannelstozero.ChooseAlphaOnlytoapplythevaluetothealphachannel
and set the color channels to 1.0. When you select Hue Only, the applied hue value is combined with 50% lightness
and 100% saturation. When you select Lightness Only, the applied lightness value is combined with 0% saturation,
which then gives the hue no influence. When you select Saturation Only, the applied saturation values are combined
with 0% hue and 50% lightness.
Invert Inverts (subtracts from 1.0) the output channel values.
Solid Alpha Makes the alpha channel value 1.0 (complete opacity) throughout the layer.
Compound Arithmetic effect
The Compound Arithmetic effect mathematically combines the layer to which it is applied with a control layer. The
Compound Arithmetic effect is intended only to provide compatibility with projects created in earlier versions of
After Effects that use the Compound Arithmetic effect. Using blending modes is usually more effective than using
the Compound Arithmetic effect.
This effect works with 8-bpc color.
Second Source Layer The layer to use with the current layer in the given operation.
Operator The operation to perform between the two layers.
Operate On Channels The channels to which the effect is applied.
Overflow Behavior How the effect remaps values that fall outside the grayscale range of 0-255.
•Clip Values above 255 are mapped to 255. Values below 0 are mapped to 0.
•Wrap Values above 255 and below 0 are wrapped back around into the 0-255 range. For example, a value of 258
wraps around to 2, a value of 256 wraps around to 0, and a value of -3 wraps around to 253.
•Scale The maximum and minimum values are remapped to 255 and 0, and intermediate values are stretched or
compressed to fit within this range.
Stretch Second Source To Fit Scales the second layer to match the size (width and height) of the current layer. If this
option is deselected, the second layer is placed at its source’s current size, aligned with the upper left corner of the
source layer.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
Invert effect
The Invert effect inverts the color information of an image.
AFTER EFFECTS CS3
User Guide
385
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Channel Which channel or channels to invert. Each group of items operates in a particular color space, inverting
either the entire image in that color space or just a single channel.
•RGB/Red/Green/Blue RGB inverts all three of the additive color channels. Red, Green, and Blue each invert an
individual color channel.
•HLS/Hue/Lightness/Saturation HLS inverts all three of the calculated color channels. Hue, Lightness, and
Saturation each invert an individual color channel.
•YIQ/Luminance/In Phase Chrominance/Quadrature Chrominance YIQ inverts all three NTSC luminance and
chrominance channels. Y (luminance), I (in-phase chrominance), and Q (quadrature chrominance) each invert an
individual channel.
•Alpha Inverts the alpha channel of the image. The alpha channel isn’t a color channel; it specifies transparency.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
Minimax effect
The Minimax effect assigns each channel of a pixel the minimum or maximum value for that channel found within
a specified radius.
This effect can be used to enlarge or reduce a matte. For example, a white solid area surrounded by black shrinks one
pixel on each side using Minimum and a radius of 1.
The layer’s quality setting doesn’t affect Minimax.
This effect works with 8-bpc and 16-bpc color.
Operation Minimum assigns each channel of a pixel the minimum value for the specified channel within the
specified radius. Maximum assigns each channel of a pixel the maximum value. Minimum Then Maximum
performs the Minimum operation and then the Maximum operation. Maximum Then Minimum performs the
Maximum operation and then the Minimum operation.
Direction The axis along which to scan for values. Horizontal & Vertical scans all directions.
Remove Color Matting effect
The Remove Color Matting effect removes color fringes (halos) from layers with premultiplied color channels. Halos
often occur when an area of partial transparency retains the color of the original background and is composited into
a context with a different background color. Use this effect in conjunction with effects that create transparency—
such as keying effects—to achieve more control over the appearance of areas of partial transparency.
AFTER EFFECTS CS3
User Guide
386
Use Background Color to specify the new background color. To allow this effect to generate color values outside of
the range 0.0-1.0 when working in 32-bpc color, deselect Clip HDR Values.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with Remove Color Matting effect applied (right)
Set Channels effect
The Set Channels effect copies channels from control layers (source layers) to the red, green, blue, and alpha channels
of the effect layer. For example, you can take the luminance values of a control layer’s pixels and use them as the blue
values for the effect layer’s pixels.
This effect works with 8-bpc and 16-bpc color.
Set Matte effect
The Set Matte effect replaces the alpha channel (matte) of a layer with a channel from another layer above it for the
creation of traveling matte results. The Set Matte effect is intended only to provide compatibility with projects created
in earlier versions of After Effects that use the Set Matte effect.
This effect works with 8-bpc and 16-bpc color.
Original (top left), matte layer (bottom left), and result (bottom right)
Although you can use Set Matte for a traveling matte, it’s easier and faster to create traveling mattes by using a track
matte. (See “About track mattes and traveling mattes” on page 263.)
Take Matte From Layer The layer to use as the replacement matte.
Use For Matte The channel to use for the matte.
Invert Matte Inverts the transparency values of the matte.
Stretch Matte To Fit Scales the selected layer to match the size of the current layer. If Stretch Matte To Fit is
deselected, the layer designated as the matte is centered in the first layer.
AFTER EFFECTS CS3
User Guide
387
Composite Matte With Original Composites the new matte with the current layer, rather than replacing it. The
resultingmatteallowstheimagetoshowthroughonlywherethecurrentmatteandthenewmattebothhavesome
opacity.
Premultiply Matte Layer Premultiplies the new matte layer with the current layer.
Shift Channels effect
The Shift Channels effect replaces red, green, blue, and alpha channels in the image with other channels.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Take Channel From The channel to use as a source.
Solid Composite effect
TheSolidCompositeeffectoffersaquickwaytocreateacompositeofanewcolorsolidbehindtheoriginalsource
layer.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Source Opacity The opacity of the source layer.
Color The color of the solid.
Opacity The opacity of the solid.
Blending Mode The blending mode used to combine the layer and the solid color.
Color Correction effects
The Rebel CC animation preset is a simple, telecine-style color-correction tool for coloring or grading a movie. This
animation preset uses expressions to control the Levels (Individual Controls) effect. To learn more and download
the animation preset, see Stu Maschwitz's blog: www.adobe.com/go/learn_ae_sturebelcc.
JohnDickinsonprovidesvisualaidsonhiswebsitethatillustratehowtousetheCurvesandLevelseffectsforcolor
adjustments: www.adobe.com/go/learn_ae_jdcurves and www.adobe.com/go/learn_ae_jdlevels.
Using histograms to adjust color
Ahistogram is a representation of the number of pixels at each luminance value in an image. A histogram that has
nonzero values for each luminance value indicates an image that takes advantage of the full tonal range. A histogram
that doesn’t use the full tonal range corresponds to a dull image that lacks contrast.
A common color-correction task is adjusting an image to spread out the pixel values more evenly from left to right
on the histogram, instead of having them bunched up at one end or the other. Applying the Levels effect and
adjusting its Input White and Input Black properties in the histogram is an easy and effective way to accomplish this
task for many images.
AFTER EFFECTS CS3
User Guide
388
Histogram for image that does not use full tonal range
Input sliders moved so that output uses full tonal range
Histogram showing highlight clipping
Histogram showing shadow clipping
Auto Color and Auto Contrast effects
The Auto Color effect adjusts the contrast and color of an image after analyzing the shadows, midtones, and
highlights of the image. The Auto Contrast effect adjusts the overall contrast and mixture of colors. Each effect maps
the lightest and darkest pixels in the image to white and black, and then redistributes the intermediate pixels. The
result is that highlights appear lighter and shadows appear darker.
Because Auto Contrast and Auto Color don’t adjust channels individually, they don’t introduce or remove color casts.
AFTER EFFECTS CS3
User Guide
389
The Auto Levels effect uses many of the same controls as the Auto Color and Auto Contrast effects.
These effects work with 8-bpc and 16-bpc color.
Temporal Smoothing The range of adjacent frames, in seconds, analyzed to determine the amount of correction
needed for each frame, relative to its surrounding frames. If Temporal Smoothing is 0, each frame is analyzed
independently, without regard for surrounding frames. Temporal Smoothing can result in smoother looking correc-
tions over time.
Scene Detect If selected, frames beyond a scene change are ignored when surrounding frames are analyzed for
temporal smoothing.
Black Clip, White Clip How much of the shadows and highlights are clipped to the new extreme shadow and
highlight colors in the image. Note that setting the clipping values too high reduces detail in the shadows or
highlights. A value between 0.0% and 1% is recommended. By default, shadow and highlight pixels are clipped by
0.1%—that is, the first 0.1% of either extreme is ignored when the darkest and lightest pixels in the image are
identified; these are then mapped to output black and output white. This method ensures that input black and input
white values are based on representative rather than extreme pixel values.
Snap Neutral Midtones (Auto Color only) Identifies an average nearly neutral color in the frame and then adjusts the
gamma values to make the color neutral.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
Auto Levels effect
The Auto Levels effect maps the lightest and darkest values in each color channel in the image to white and black,
and then redistributes the intermediate values. As a result, highlights appear lighter and shadows appear darker.
Because Auto Levels adjusts each color channel individually, it may remove or introduce color casts.
See “Auto Color and Auto Contrast effects” on page 388 for explanations of this effect’s controls.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Brightness & Contrast effect
The Brightness & Contrast effect adjusts the brightness and contrast of an entire layer (not individual channels). The
default value of 0.0 indicates that no change is made. Using the Brightness & Contrast effect is the easiest way to make
simple adjustments to the tonal range of the image. It adjusts all pixel values in the image at once—highlights,
shadows, and midtones.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
AFTER EFFECTS CS3
User Guide
390
Broadcast Colors effect
Note: The Color Finesse plug-in included with After Effects includes excellent tools that can help you keep your colors
within the broadcast-safe range. For more information, see the Color Finesse documentation in the following folder:
Adobe After Effects CS3/Additional Documentation/Color Finesse 2.
The Broadcast Colors effect alters pixel color values to keep signal amplitudes within the range allowed for broadcast
television.
UsetheKeyOutUnsafeandKeyOutSafesettingsforHowToMakeColorSafetodeterminewhichportionsofthe
image will be affected by the Broadcast Colors effect at the current settings.
Note: Amorereliablewaytokeepcolorswithinthebroadcast-saferangeforyouroutputtypeistousecolormanagement
features to set the output color profile accordingly, such as to SDTV (Rec. 601 NTSC). This ensures that color values
between 0.0 and 1.0 in your working color space are converted to broadcast-safe values. (See “Broadcast-safe colors” on
page 250.)
This effect works with 8-bpc color.
Broadcast Locale The broadcast standard for your intended output. NTSC (National Television Standards
Committee) is the North American standard and is also used in Japan. PAL (Phase Alternating Line) is used in most
of Western Europe and South America.
How To Make Color Safe How to reduce signal amplitude:
•Reduce Luminance Reduces a pixel’s brightness by moving it toward black. This setting is the default.
•Reduce Saturation Moves the pixel’s color toward a gray of similar brightness, making the pixel less colorful. For
the same IRE level, reducing saturation alters the image more noticeably than does reducing luminance.
Maximum Signal The maximum amplitude of the signal in IRE units. A pixel with a magnitude above this value is
altered. The default is 110. Lower values affect the image more noticeably; higher values are more risky.
Change Color effect
The Change Color effect adjusts the hue, lightness, and saturation of a range of colors.
This effect works with 8-bpc and 16-bpc color.
View Corrected Layer shows the results of the Change Color effect. Color Correction Mask shows a grayscale matte
that indicates the areas of the layer that will be changed. White areas in the color correction mask are changed the
most, and dark areas are changed the least.
Hue Transform The amount, in degrees, to adjust hue.
Lightness Transform Positive values brighten the matched pixels; negative values darken them.
Saturation Transform Positive values increase saturation of matched pixels (moving toward pure color); negative
values decrease saturation of matched pixels (moving toward gray).
Color To Change The central color in the range to be changed.
Matching Tolerance How much colors can differ from Color To Change and still be matched.
Matching Softness Theamountthatunmatchedpixelsareaffectedbytheeffect,inproportiontotheirsimilarityto
Color To Change.
Match Colors Determinesthecolorspaceinwhichtocomparecolorstodeterminesimilarity.RGBcomparescolors
in an RGB color space. Hue compares the hues of colors, ignoring saturation and brightness—so bright red and light
AFTER EFFECTS CS3
User Guide
391
pink match, for example. Chroma uses the two chrominance components to determine similarity, ignoring
luminance (lightness).
Invert Color Correction Mask Inverts the mask that determines which colors to affect.
Change To Color effect
The Change To Color effect (formerly Change Color HLS effect) changes a color you select in an image to another
color using hue, lightness, and saturation (HLS) values, leaving other colors unaffected.
Change To Color offers flexibility and options unavailable in the Change Color effect. These options include
tolerance sliders for hue, lightness, and saturation for exact color matching, and the ability to select the exact RGB
values of the target color that you wish to change to.
This effect works with 8-bpc and 16-bpc color.
Original image (top left), with saturation removed in the planet (bottom left), and with light green changed to yellow in the planet (bottom
right)
From The center of the color range to change.
To The color to change matched pixels to.
To animate a color change, set keyframes or expressions for the To color.
Change Which channels are affected.
Change By How to change colors. Setting To Color performs a direct change of affected pixels to the target color.
Transforming To Color transforms affected pixel values toward the target color, using HLS interpolation; the amount
of change for each pixel depends on how close the pixel’s color is to the From color.
Tolerance How much colors can differ from the From color and still be matched. Expand this control to reveal
separate sliders for Hue, Lightness, and Saturation values.
Note: Use the View Correction Matte option to better identify which pixels are matched and affected.
Softness The amount of feather to use for the edges of the correction matte. Higher values create smoother transi-
tions between areas affected by the color change and those unaffected.
View Correction Matte Shows a grayscale matte that indicates the amount to which the effect affects each pixel.
White areas are changed the most, and dark areas are changed the least.
AFTER EFFECTS CS3
User Guide
392
Channel Mixer effect
TheChannelMixereffectmodifiesacolorchannelusingamixofthecurrentcolorchannels.Usethiseffecttomake
creative color adjustments not easily done with the other color adjustment tools: Create high-quality grayscale
images by choosing the percentage contribution from each color channel, create high-quality sepia-tone or other
tinted images, and swap or duplicate channels.
[output channel]-[input channel] The percentage of the input channel value to add to the output channel value. For
example, a Red-Green setting of 10 increases the value of the red channel for each pixel by 10% of the value of the
green channel for that pixel. A Blue-Green setting of 100 and a Blue-Blue setting of 0 replaces the blue channel values
with the green channel values.
[output channel]-Const Theconstantvalue(asapercentage)toaddtotheoutputchannelvalue.Forexample,aRed-
Const setting of 100 saturates the red channel for every pixel by adding 100% red.
Monochrome Uses the value of the red output channel for the red, green, and blue output channels, creating a
grayscale image.
This effect works with 8-bpc and 16-bpc color.
Color Balance effect
The Color Balance effect changes the amount of red, green, and blue in the shadows, midtones, and highlights of an
image.
Preserve Luminosity preserves the average brightness of the image while changing the color. This control maintains
the tonal balance in the image.
This effect works with 8-bpc and 16-bpc color.
Color Balance (HLS) effect
The Color Balance (HLS) effect alters an image’s levels of hue, lightness, and saturation. It’s intended only to provide
compatibility with projects created in earlier versions of After Effects that use the Color Balance (HLS) effect. For
new projects, use the Hue/Saturation effect, which operates the same as the Hue/Saturation command in Adobe
Photoshop. You can convert a movie to grayscale by setting the Saturation to –100.
This effect works with 8-bpc and 16-bpc color.
See also
“Hue/Saturation effect” on page 398
Color Link effect
The Color Link effect colorizes one layer with the average pixel values of another layer. This effect is useful for
quickly finding a color that matches the color of a background layer.
This effect works with 8-bpc color.
Source Layer The layer from which to sample colors. If you choose None, the layer to which the effect is applied is
usedasthesourcelayer,takingintoaccountanymasksandothereffectsappliedtothelayer.Ifyouchoosethelayer’s
name from the menu, the source layer without masks and effects is used.
Sample Specifies what values are sampled and what operation is performed on them.
AFTER EFFECTS CS3
User Guide
393
Clip The percentage of pixels to ignore at the extreme channel values. This clipping is useful for reducing the
influence of noise or other nonrepresentative pixels.
Stencil Original Alpha The effect places a stencil of the layer’s original alpha channel over the new value.
Opacity The effect’s opacity. The result of the effect is blended with the original image, with the effect result
composited on top. The lower you set this value, the less the effect affects the layer. For example, if you set this value
to 0%, the effect has no visible result on the layer; if you set this value to 100%, the original image doesn’t show
through.
Blending Mode The blending mode to use to combine the effect result with the original layer. These blending modes
aren’t available when averaging alpha channel values in the layer.
Color Stabilizer effect
The Color Stabilizer effect samples the color values of a single reference frame, or pivot frame, at one, two, or three
points; it then adjusts the colors of other frames so that the color values of those points remain constant throughout
the layer’s duration. This effect is useful for removing flicker from footage and equalizing the exposure of footage
with color shifts caused by varying lighting situations.
Use this effect to remove the flicker common to time-lapse photography and stop-frame animation.
You can animate the effect control points that define the sample areas to track objects for which you want to stabilize
colors. The greater the difference in color values between the sample points, the better the effect works.
This effect works with 8-bpc and 16-bpc color.
Set Frame Sets the pivot frame. Display the frame that has the area of brightness or color that you want to match,
and click Set Frame.
Stabilize What to stabilize:
•Brightness Brightness is stabilized using one sample point (Black Point).
•Levels Color is stabilized using two sample points (Black Point and White Point).
•Curves Color is stabilized using all three sample points (Black Point, White Point, and Mid Point).
Black Point Place this point on a dark area to stabilize.
Mid Point Place this point on a midtone area to stabilize.
White Point Place this point on a bright area to stabilize.
Sample Size Radius, in pixels, of sampled areas.
Colorama effect
The Colorama effect is a very versatile and powerful effect for converting and animating colors in an image. Using
the Colorama effect, you can subtly tint an image or radically change its color palette.
Colorama works by first converting a specified color attribute to grayscale and then remapping the grayscale values
to one or more cycles of the specified output color palette. One cycle of the output color palette appears on the
Output Cycle wheel. Black pixels are mapped to the color at the top of the wheel; increasingly lighter grays are
mapped to successive colors going clockwise around the wheel. For example, with the default Hue Cycle palette,
pixels corresponding to black become red, while pixels corresponding to 50% gray become cyan.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
394
Guy Chen provides an example of using the Fractal Noise effect to generate the base noise (in this case for the
turbulent surface of the Sun) and then colorizing the noise with the Colorama effect:
www.adobe.com/go/learn_ae_guyfractalsun.
Input Phase controls
Get Phase From The color attribute to use as input. Choose Zero to use a color attribute from another layer.
Add Phase The second layer to use as input. To use only this layer as input, select Zero for Get Phase From;
otherwise,boththeAddPhaselayerandthelayertowhichtheeffectisappliedareused.Youcanchoosethelayerto
which the effect is applied to add a second input attribute from the same layer.
Add Phase From The color attribute from the second layer to use as input.
Add Mode How input values are combined:
•Wrap Adds the values of the two attributes for each pixel. Values above 100% are wrapped around the cycle again.
For example, a sum of 125% wraps around to 25%.
•Clamp Adds the values of the two attributes for each pixel. Values above 100% are clipped to 100%.
•Average Averagesthevaluesofthetwoattributesforeachpixel.Becausetheaverageoftwovaluesthatareeach
in the range 0% to 100% is never over 100%, wrapping and clamping by this operation are never necessary. Average
is therefore the safest option for predictable output.
•Screen Screens the second layer over the original layer; the brighter areas in the second layer brighten the first
layer, and the darker areas in the second layer are discarded. Screen mode is especially useful for compositing fire,
lens flares, and other lighting effects.
Phase Shift ThepointontheOutputCyclewheelatwhichthemappingoftheinputcolorsbegins.Apositivevalue
moves the starting point clockwise around the Output Cycle wheel.
Animate Phase Shift to cycle colors around the wheel.
Output Cycle controls
Use Preset Palette Presets for the Output Cycle. The top palettes are designed for quick color correction and
adjustment tasks. The bottom choices offer a variety of built-in color palettes for creative results.
Output Cycle Customize the output color palette by altering the colors and locations of the triangles on the Output
Cycle wheel. The triangles specify the location on the color wheel where a specific color occurs. The color between
triangles is smoothly interpolated, unless Interpolate Palette is deselected. Each Output Cycle can have 1-64
triangles.
•To change a triangle’s location, drag the triangle. Shift-drag to snap the triangle to 45-degree increments. At the
top of the wheel, the triangle snaps to either the start position or end position depending on whether you drag
from the left or right.
•To add a triangle, click in or near the wheel, and select a color from the color picker. Click slightly to the left of the
top arrows for the end color, and slightly to the right for the start color.
•To duplicate a triangle, Ctrl-drag (Windows) or Command-drag (Mac OS) the triangle.
•To delete a triangle, drag it away from the wheel.
•To change the opacity, select a triangle on the color wheel and then drag the attached triangle above the opacity
slider. Make sure that Modify Alpha is selected if you want the opacity information to affect your output.
AFTER EFFECTS CS3
User Guide
395
Note: When you animate the Output Cycle, a triangle’s position and color are interpolated between keyframes. For best
results, make sure that all keyframes have the same number of Output Cycle triangles.
Cycle Repetitions HowmanyiterationsoftheOutputCycletheinputcolorrangeismappedto.Thedefaultvalueof
1mapstheinputrangetooneiterationoftheOutputCycle,frominputblackatthetopoftheOutputCyclewheel,
clockwisetoinputwhiteatthetopoftheOutputCyclewheel.Avalueof2mapstheinputrangetotwoiterationsof
the Output Cycle. Use this option to create a simple palette and repeat it many times throughout a gradient.
Interpolate Palette Colors between triangles are interpolated smoothly. When this option is deselected, output
colors are posterized.
Modify controls
Modify controls specify which color attributes are modified by the Colorama effect. For subtle refinement of images,
choose the same color attribute for Input Phase and Modify. For example, choose Hue from both menus to simply
adjust Hue.
Modify The color attribute to modify.
Modify Alpha Modifies alpha channel values.
Note: If you apply Colorama to a layer with an alpha channel, and the Output Cycle doesn’t contain alpha information,
the anti-aliased edges of the layer may appear pixelated. To smooth the edges, deselect Modify Alpha. If Modify Alpha is
selected and the Output Cycle contains alpha information, the output is affected even if you’ve selected None from the
Modify menu. Using this method, you can adjust the levels of just the alpha channel without also changing the RGB
information.
Change Empty Pixels The Colorama effect’s influence extends to transparent pixels. (This setting works only if
Modify Alpha is selected.)
Pixel Selection, Masking, and other controls
These controls determine which pixels are affected. For the Matching controls for Pixel Selection to work, Matching
Mode must be set to anything other than Off.
Matching Color The center of the range of colors of pixels to be affected by the Colorama effect. To select a specific
color in the image using the eyedropper, turn off the Colorama effect temporarily by clicking its Effect switch in
the Effect Controls panel.
Matching Tolerance How far a color can be from Matching Color and still be affected by the Colorama effect. When
MatchingToleranceis0,onlytheexactcolorselectedforMatchingColorisaffectedbyColorama.WhenMatching
Tolerance is 1, all colors are matched; this value essentially turns Matching Mode off.
Matching Softness How smoothly the matched pixels blend into the rest of the image. For example, if you have an
image of a man wearing a red shirt and blue pants, and you want to change the color of the pants from blue to red,
subtly adjust Matching Softness to spread the matching from the blue in the pants into the shadows of the pants folds.
Ifyouadjustittoohigh,thematchingspreadstotheblueofthesky;ifyouadjustitevenhigher,thematchingspreads
to his red shirt.
Matching Mode What color attributes are compared to determine matching. In general, use RGB for high-contrast
graphics and Chroma for photographic images.
Mask Layer The layer to use as a matte. Masking Mode specifies what attribute of the Mask Layer is used to define
the matte.
Composite Over Layer Showsmodifiedpixelscompositedontopoftheoriginallayer.Deselectthisoptiontoshow
only modified pixels.
AFTER EFFECTS CS3
User Guide
396
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
Curves effect
TheCurveseffectadjuststhetonalrangeofanimage.YoucanalsousetheLevelseffect,buttheCurveseffectgives
you more control. With the Levels effect you make the adjustments using just three controls (highlights, shadows,
and midtones), but with the Curves effect you can arbitrarily map input values to output values using a curve defined
by 256 points.
You can load and save arbitrary maps and curves to use with the Curves effect.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
When you apply the Curves effect, After Effects displays a graph in the Effect Controls panel that you use to specify
a curve. The horizontal axis of the graph represents the original brightness values of the pixels (input levels); the
vertical axis represents the new brightness values (output levels). In the default diagonal line, all pixels have identical
input and output values. Curves displays brightness values from 0 to 255 (8 bit) or 32768 (16 bit), with shadows (0)
on the left.
JohnDickinsonprovidesvisualaidsonhiswebsitethatillustratehowtousetheCurveseffectforcoloradjustments:
www.adobe.com/go/learn_ae_jdcurves.
Use the Curves effect
1Choose Effect > Color Correction > Curves.
2If the image has more than one color channel, choose the channel you want to adjust from the Channel menu.
RGB alters all channels using a single curve.
3Use the Bezier tool and the Pencil tool to modify or draw a curve. (To activate a tool, click the Bezier button
or the Pencil button .)
To smooth the curve, click the Smooth button. To reset the curve to a line, click the Line button.
The curve type is determined by the last tool used to modify it. You can save arbitrary map curves modified by the
Pencil tool as .amp (Photoshop lookup) files. You can save curves modified by the Bezier tool as .acv (Photoshop
spline) files.
Equalize effect
TheEqualizeeffectaltersanimage’spixelvaluestoproduceamoreconsistentbrightnessorcolorcomponentdistri-
bution. The effect works similarly to the Equalize command in Adobe Photoshop. Pixels with 0 alpha (completely
transparent) values aren’t considered, so masked layers are equalized based on the mask area.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
397
Original (left), and with effect applied (right)
Equalize RGB equalizes the image based on red, green, and blue components. Brightness equalizes the image based
on the brightness of each pixel. Photoshop Style equalizes by redistributing the brightness values of the pixels in an
image so that they more evenly represent the entire range of brightness levels.
Amount To Equalize How much to redistribute the brightness values. At 100%, the pixel values are spread as evenly
as possible; lower percentages redistribute fewer pixel values.
Exposure effect
Use the Exposure effect to make tonal adjustments to footage, either one channel at a time or all channels at once.
The Exposure effect simulates the result of modifying the exposure setting (in f-stops) of the camera that captured
the image. The Exposure effect works by performing calculations in a linear color space, rather than in the image’s
current color space. The Exposure effect is designed for making tonal adjustments to high–dynamic range (HDR)
images with 32-bpc color, but you can use the effect on 8-bpc and 16-bpc images.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Master Adjust all channels simultaneously.
Individual Channels Adjust channels individually.
Exposure Simulates the exposure setting on the camera that captures the image, multiplying all light intensity values
by a constant. The units for Exposure are f-stops.
Offset Darkens or brightens the shadows and midtones with minimal change to the highlights.
Gamma Correction The amount of gamma correction to use for adding an additional power-curve adjustment to the
image. Higher values make the image lighter; lower values make the image darker. Negative values are mirrored
around zero (that is, they remain negative but still get adjusted as if they were positive). The default value is 1.0, which
corresponds to no additional adjustment.
Note: In previous versions of After Effects, the Gamma Correction property was the Gamma property, and its behavior
was reversed.
Bypass Linear Light Conversion Select to apply the Exposure effect to the raw pixel values. This option can be useful
if you manage color manually using the Color Profile Converter effect.
See also
“Adjust exposure for previews” on page 129
“High dynamic range color” on page 235
Gamma/Pedestal/Gain effect
The Gamma/Pedestal/Gain effect adjusts the response curve independently for each channel. For pedestal and gain,
a value of 0.0 is completely off, and a value of 1.0 is completely on.
AFTER EFFECTS CS3
User Guide
398
The Black Stretch control remaps the low pixel values of all channels. Large Black Stretch values brighten dark areas.
Gamma specifies an exponent describing the shape of the intermediate curve. The Pedestal and Gain controls specify
the lowest and highest attainable output value for a channel.
This effect works with 8-bpc color.
Hue/Saturation effect
The Hue/Saturation effect adjusts the hue, saturation, and lightness of individual color components in an image. This
effect is based on the color wheel. Adjusting the hue, or color, represents a move around the color wheel. Adjusting
the saturation, or purity of the color, represents a move across its radius. Use the Colorize control to add color to a
grayscale image converted to RGB, or to add color to an RGB image.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Channel Control The color channel you want to adjust. Choose Master to adjust all colors at once.
Channel Range The definition of the color channel chosen from the Channel Control menu. Two color bars
represent the colors in their order on the color wheel. The upper color bar shows the color before the adjustment;
thelowerbarshowshowtheadjustmentaffectsallofthehuesatfullsaturation.Usetheadjustmentslidertoeditany
range of hues.
Master Hue Specifies the overall hue of the channel chosen from the Channel Control menu. Use the dial, which
represents the color wheel, to change the overall hue. The underlined value displayed above the dial reflects the
numberofdegreesofrotationaroundthewheelfromthepixel’soriginalcolor.Apositivevalueindicatesclockwise
rotation; a negative value indicates counterclockwise rotation. Values range from –180 to +180.
Master Saturation, Master Lightness Specify the overall saturation and lightness of the channel chosen from the
Channel Control menu. Values range from –100 to +100.
Colorize Adds color to a grayscale image converted to RGB, or adds color to an RGB image—for example, to make
it look like a duotone image by reducing its color values to one hue.
Colorize Hue, Colorize Saturation, Colorize Lightness Specify the hue, saturation, and lightness of the color range
chosen from the Channel Control menu. After Effects displays only the sliders for the Channel Control menu choice.
Adjust colors with the Hue/Saturation effect
1Choose Effect > Color Correction > Hue/Saturation.
2From the Channel Control menu, choose which colors to adjust:
•Choose Master to adjust all colors at once.
•Choose a preset color range for the color you want to adjust, and then use the sliders for that color range.
3For Hue, type a value or drag the dial.
4For Saturation, type a value or drag the slider. The color shifts away from or toward the center of the color wheel,
relative to the beginning color values of the selected pixels.
5For Lightness, type a value or drag the slider.
Colorize an image or create a monotone result
1Choose Effect > Color Correction > Hue/Saturation.
2Select Colorize. The image is converted to the hue of the current foreground color. The lightness value of each
pixel doesn’t change.
AFTER EFFECTS CS3
User Guide
399
3Drag the Colorize Hue dial to select a new color if desired.
4Drag the Colorize Saturation and Colorize Lightness sliders.
Modify the range of Hue/Saturation effect adjustments
1From the Channel Control menu, choose an individual color. (By default, the range of color selected when you
choose a color component is 30˚ wide, with 30˚ of fall-off on either side. Setting the fall-off too low can produce
dithering in the image.)
2Do any of the following:
•Drag one or both of the white triangles to adjust the amount of feather without affecting the range.
•Drag one or both of the vertical white bars to adjust the range. Increasing the range decreases the fall-off, and vice
versa.
Leave Color effect
The Leave Color effect removes all colors from a layer except those similar to the Color To Leave. For example, a
movie of a basketball game could be decolored except for the orange of the ball itself.
This effect works with 8-bpc color.
Amount To Decolor How much color to remove. 100% causes areas of the image dissimilar to the selected color to
appear as shades of gray.
Tolerance The flexibility of the color-matching operation. 0% decolors all pixels except those that exactly match
Color To Leave. 100% causes no color change.
Edge Softness The softness of the color boundaries. High values smooth the transition from color to gray.
Match Colors Determines whether colors’ RGB values or HSB values are compared. Choose Using RGB to perform
more strict matching that usually decolors more of the image. For example, to leave dark blue, light blue, and
medium blue, choose Using HSB and choose any shade of blue as Color To Leave.
Levels effect
The Levels effect remaps the range of input color levels onto a new range of output color levels, with a distribution
of color values determined by the gamma value. This effect functions much the same as the Levels adjustment in
Photoshop.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with effect applied (right)
John Dickinson provides visual aids on his website that illustrate how to use the Levels effect for color adjustments:
www.adobe.com/go/learn_ae_jdlevels.
Channel The color channels to be modified.
Histogram Shows number of pixels with each luminance value in an image.
AFTER EFFECTS CS3
User Guide
400
Input Black and Output Black Pixels in the input image with a luminance value equal to the Input Black value are
given the Output Black value as their new luminance value. The Input Black value is represented by the upper left
triangle below the histogram. The Output Black value is represented by the lower left triangle below the histogram.
Input White and Output White PixelsintheinputimagewithaluminancevalueequaltotheInputWhitevalueare
giventheOutputWhitevalueastheirnewluminancevalue.TheInputWhitevalueisrepresentedbytheupperright
trianglebelowthehistogram.TheOutputWhitevalueisrepresentedbythelowerrighttrianglebelowthehistogram.
Gamma The exponent of the power curve that determines the distribution of luminance values in the output image.
The Gamma value is represented by the middle triangle below the histogram.
Clip To Output Black and Clip To Output White These controls determine the results for pixels with luminance values
that are less than the Input Black value or greater than the Input White value. If clipping is on, pixels with luminance
values less than the Input Black value are mapped to the Output Black value; pixels with luminance values above the
InputWhitevaluearemappedtotheOutputWhitevalue.Ifclippingisoff,theresultingpixelvaluescanbelessthan
the Output Black value or greater than the Output White value and are affected by the Gamma value.
Levels (Individual Controls) effect
The Levels (Individual Controls) effect functions like the Levels effect but allows you to adjust the individual color
values for each channel. As a result, you can add expressions to individual properties or animate one property
independently of the others. To see each control individually, click the arrow next to the channel color to expand it.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with effect applied (right)
See also
“Levels effect” on page 399
Photo Filter effect
ThePhotoFiltereffectmimicsthetechniqueofputtingacoloredfilterinfrontofthecameralenstoadjustthecolor
balance and color temperature of the light transmitted through the lens and exposing the film. You can choose a
color preset to apply a hue adjustment to an image, or you can specify a custom color using the Adobe Color Picker
or the eyedropper.
You can use the Photo Filter effect controls to do the following:
•To use a color preset for the filter color, choose an option from the Filter pop-up menu.
•To select a custom color for the filter color, click the Color control’s color swatch to select a color using the Adobe
Color Picker, or click the eyedropper and click a color anywhere on the computer screen.
•To set the amount of color applied to the image, adjust Density.
•To ensure that the image isn’t darkened by the effect, select Preserve Luminosity.
AFTER EFFECTS CS3
User Guide
401
To retain Photo Filter adjustment layers created in Photoshop, import the Photoshop file into your After Effects
project as a composition rather than as footage. If you changed your default Photoshop color settings, After Effects
may not be able to exactly match the color of the Photo Filter.
This effect works with 8-bpc and 16-bpc color.
Warming Filter (85) and Cooling Filter (80) Color conversion filters that tune the white balance in an image. If an
image was photographed with a lower color temperature of light (yellowish), the Cooling Filter (80) makes the image
colors bluer to compensate for the lower color temperature of the ambient light. Conversely, if the photo was taken
with a higher color temperature of light (bluish), the Warming Filter (85) makes the image colors warmer to
compensate for the higher color temperature of the ambient light.
Warming Filter (81) and Cooling Filter (82) Light balancing filters for minor adjustments in the color quality of an
image. The Warming Filter (81) makes the image warmer (yellower), and the Cooling Filter (82) makes the image
cooler (bluer).
Individual Colors Apply a hue adjustment to the image depending on the color preset you choose. Your choice of
color depends on how you use the Photo Filter command. If a photo has a color cast, you can choose a complement
color to neutralize the color cast. You can also apply colors for special color effects or enhancements. For example,
the Underwater color simulates the greenish-blue color cast common to underwater photography.
PS Arbitrary Map effect
The PS Arbitrary Map effect is intended only to provide compatibility with projects created in earlier versions of
After Effects that use the Arbitrary Map effect. For new work, use the Curves effect.
The PS Arbitrary Map effect applies a Photoshop arbitrary map file to a layer. An arbitrary map adjusts the brightness
levels of an image, remapping a specified brightness range to darker or brighter tones. In the Curves window in
Photoshop, you can create an arbitrary map file for the entire image or for individual channels.
This effect works with 8-bpc and 16-bpc color.
You can import and apply an arbitrary map file with Options in the Effect Controls panel. When loaded into After
Effects, the specified arbitrary map is applied to the layer or to one or more channels of the layer, depending on how
it was created. If you don’t select an arbitrary map, After Effects applies the default map (linear distribution of
brightness) to the layer. Although you can’t import .acv or Photoshop spline files into the After Effects PS Arbitrary
Map effect, you can convert these files in Photoshop to create files that are compatible with the After Effects Curves
effect.
To convert .acv and Photoshop spline files, load the .acv file (Windows) or the Photoshop spline file (Mac OS) in the
Curves dialog box, click the Pencil tool, and then save the file as an .amp file (Windows) or Photoshop lookup file
(Mac OS).
Phase Cycles through the arbitrary map. Increasing the phase shifts the arbitrary map to the right (as viewed in the
Curves dialog box); decreasing the phase shifts the map to the left.
Apply Phase Map To Alpha Applies the specified map and phase to the layer’s alpha channel. If the specified map
doesn’t include an alpha channel, After Effects uses the default map (linear distribution of brightness) for the alpha
channel.
See also
“Curves effect” on page 396
AFTER EFFECTS CS3
User Guide
402
Shadow/Highlight effect
The Shadow/Highlight effect brightens shadowed subjects in an image and reduces the highlights in an image. This
effect doesn’t darken or lighten an entire image; it adjusts the shadows and highlights independently, based on the
surrounding pixels. You can also adjust the overall contrast of an image. The default settings are for fixing images
with backlighting problems.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Auto Amounts If this option is selected, the Shadow Amount and Highlight Amount values are ignored, and
amounts are used that are automatically determined to be appropriate for lightening and restoring detail to the
shadows. Selecting this option also activates the Temporal Smoothing control.
Shadow Amount The amount to lighten shadows in the image. This control is active only if you deselect Auto
Amounts.
Highlight Amount The amount to darken highlights in the image. This control is active only if you deselect Auto
Amounts.
Temporal Smoothing The range of adjacent frames, in seconds, analyzed to determine the amount of correction
needed for each frame, relative to its surrounding frames. If Temporal Smoothing is 0, each frame is analyzed
independently, without regard for surrounding frames. Temporal Smoothing can result in smoother-looking correc-
tions over time.
Scene Detect If this option is selected, frames beyond a scene change are ignored when surrounding frames are
analyzed for temporal smoothing.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the clip. For example, if you
set this value to 100%, the effect has no visible result on the clip; if you set this value to 0%, the original image doesn’t
show through.
Expand the More Options category to reveal the following controls:
Shadow Tonal Width and Highlight Tonal Width The range of adjustable tones in the shadows and highlights. Lower
values restrict the adjustable range to only the darkest and lightest regions, respectively. Higher values expand the
adjustable range. These controls are useful for isolating regions to adjust. For example, to lighten a dark area without
affecting the midtones, set a low Shadow Tonal Width value so that when you adjust the Shadow Amount, you’re
lightening only the darkest areas of an image. Specifying a value that is too large for a given image might introduce
halos around strong dark to light edges. The default settings attempt to reduce these artifacts. These halos may occur
if the Shadow or Highlight Amount value is too large; they can also be reduced by decreasing these values.
Shadow Radius and Highlight Radius The radius (in pixels) of the area around a pixel that the effect uses to
determine whether the pixel resides in a shadow or a highlight. Generally, this value should roughly equal the size of
the subject of interest in the image.
Color Correction The amount of color correction that the effect applies to the adjusted shadows and highlights. For
example, if you increase the Shadow Amount value, you bring out colors that were dark in the original image; you
AFTER EFFECTS CS3
User Guide
403
may want these colors to be more vivid. The higher the Color Correction value, the more saturated these colors
become. The more significant the correction that you make to the shadows and highlights, the greater the range of
color correction available.
Note: If you want to change the color over the whole image, use the Hue/Saturation effect after applying the
Shadow/Highlight effect.
Midtone Contrast Theamountofcontrastthattheeffectappliestothemidtones.Highervaluesincreasethecontrast
in the midtones alone, while concurrently darkening the shadows and lightening the highlights. A negative value
reduces contrast.
Black Clip, White Clip How much of the shadows and highlights are clipped to the new extreme shadow and
highlight colors in the image. Note that setting the clipping values too high reduces detail in the shadows or
highlights. A value between 0.0% and 1% is recommended. By default, shadow and highlight pixels are clipped by
0.1%—that is, the first 0.1% of either extreme is ignored when identifying the darkest and lightest pixels in the image,
which are then mapped to output black and output white. This method ensures that input black and input white
values are based on representative rather than extreme pixel values.
Tint effect
The Tint effect tints a layer by replacing each pixel’s color values with a value between the colors specified by Map
Black To and Map White To. Pixels with luminance values between black and white are assigned intermediate values.
Amount To Tint specifies the intensity of the effect.
For more complex tinting, use the Colorama effect.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with effect applied (right)
See also
“Colorama effect” on page 393
Tritone effect
The Tritone effect alters a layer’s color information by mapping bright, dark, and midtone pixels to colors you select.
It’s like the Tint effect, except with midtone control.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
AFTER EFFECTS CS3
User Guide
404
Distort effects
Zaxwerks provides a set of 3D Warps effect plug-ins, which can be used to distort layers in 3D space:
www.adobe.com/go/learn_ae_zax3dwarps.
Bezier Warp effect
TheBezierWarpeffectshapesanimageusingaclosedBeziercurvealongtheboundaryofalayer.Thecurveconsists
of four segments. Each segment has three points (a vertex and two tangents).
This effect works with 8-bpc and 16-bpc color.
Original (top left) and with variations of Bezier Warp applied (bottom left and right)
Thepositionsoftheverticesandtangentsdeterminethesizeandshapeofacurvedsegment.Draggingthesepoints
reshapes the curves that form the edge, thus distorting the image. For example, you can use Bezier Warp to reshape
one image to fit another, as in wrapping a label around a jar. Bezier Warp is also useful for correcting lens aberrations,
such as the fisheye effect (barrel distortion) that can occur with a wide-angle lens; using Bezier Warp, you can bend
the image back to achieve an undistorted look. By animating the effect and choosing a high quality setting, you can
create fluid visual effects, such as a jiggling gelatin dessert or a fluttering flag.
Bulge effect
The Bulge effect distorts an image around a specified point, making the image appear to bulge toward or away from
the viewer, depending on the options you select.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
405
Original (top left), and with variations of Bulge applied (bottom left and right)
Horizontal Radius and Vertical Radius The width and height of the distorted area, in pixels. You can also set the
radius values by dragging the selection handles in the layer.
Bulge Height Theapparentdepthofthebulge.Positivevaluespushthebulgetowardtheviewer.Negativevaluespull
the bulge away from the viewer.
Taper Radius The shallowness of the sides of the bulge. A taper radius of 0 produces a steep, pronounced bulge.
Antialiasing The amount of edge smoothing (blending of colors) at the boundaries of the bulge. Anti-aliasing is
applied only when the layer quality is set to Best.
Pin All Edges Prevents the edges of the layer from bulging.
Corner Pin effect
The Corner Pin effect distorts an image by repositioning each of its four corners. Use it to stretch, shrink, skew, or
twistanimageortosimulateperspectiveormovementthatpivotsfromtheedgeofalayer,suchasadooropening.
You can also use it to attach a layer to a moving rectangular region tracked by the motion tracker. You can move the
corner pins in the Composition panel, the Timeline panel, or the Effect Controls panel.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original image (top left), corner moved (bottom left), and final image (bottom right)
This post on the AE Enhancers forum describes and links to an animation preset from Donat van Bellinghen for
scaling a set of Corner Pin effect points: www.adobe.com/go/learn_ae_donatscalecornerpin.
AFTER EFFECTS CS3
User Guide
406
Displacement Map effect
The Displacement Map effect distorts a layer by displacing pixels horizontally and vertically based on the color
values of pixels in the control layer specified by the Displacement Map Layer property. The type of distortion created
by the Displacement Map effect can vary greatly, depending on the control layer and options you select.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (top left), displacement map (bottom left), and displaced image (bottom right)
The displacement is determined from the color values of the displacement map. The color values range from 0 to
255. Each value is converted into a scale ranging from -1 to 1. The displacement amount is calculated by multiplying
the converted value by the maximum displacement amount you specify. A color value of 0 produces maximum
negative displacement (–1 * maximum displacement). A color value of 255 produces maximum positive
displacement. A color value of 128 produces no displacement.
The effect uses the control layer specified by Displacement Map Layer, without considering any effects or masks. If
youwanttousethecontrollayerwithitseffects,precomposeit.Ifthecontrollayerisn’tthesamesizeasthelayerto
which the effect is applied, it is centered, stretched, or tiled depending on the setting for Displacement Map Behavior.
Select Expand Output to allow the results of the effect to extend beyond the original boundaries of the layer to which
it’s applied. Select Wrap Pixels Around to copy pixels displaced outside of the original layer boundaries to the
opposite side of the layer; that is, pixels pushed off the right side appear on the left side, and so on.
Rick Gerard provides additional explanation and an example project for the Displacement Map effect on his website:
www.adobe.com/go/learn_ae_rickdisplacementmap.
Liquify effect
The Liquify effect lets you push, pull, rotate, enlarge and shrink areas in a layer. Several Liquify tools distort the brush
area when you hold down the mouse button or drag. The distortion is concentrated at the center of the brush area,
and the effect intensifies as you hold down the mouse button or repeatedly drag over an area.
You can limit the area of a layer you distort by using Freeze Area Mask. Use the Reconstruction mode to lessen or
undo distortions you’ve created.
The Liquify effect can extend beyond the boundaries of the target layer. This extension is useful when the target layer
is smaller than the composition.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
407
Original (top left), and with variations of Liquify applied (bottom left and right)
Mask properties
Freeze Area Mask Determinestheareaoftheimageinwhichthedistortionisaffectedbymaskopacityandfeather
settings. Areas outside the mask are distorted; areas within the mask are distorted according to Mask Opacity and
Mask Feather settings.
Mask Opacity Determines how the area within the mask is affected by the distortion. If Mask Opacity is set to 100%,
the area within the mask isn’t affected by the distortion; if it’s set to 50%, the area within the mask is somewhat
affected. If you set Mask Opacity to 100%, make sure to feather the mask to prevent jagged edges on the mask.
Mask Feather The width of the feather used to blend pixels between the masked area and the nonmasked area.
Tools
Warp Pushes pixels forward as you drag.
Turbulence Smoothly scrambles pixels. This setting is useful for creating fire, clouds, waves, and similar effects.
Twirl Clockwise Rotates pixels clockwise as you hold down the mouse button or drag.
Twirl Counterclockwise Rotates pixels counterclockwise as you hold down the mouse button or drag.
Pucker Moves pixels toward the center of the brush area as you hold down the mouse button or drag.
Bloat Moves pixels away from the center of the brush area as you hold down the mouse button or drag.
Shift Pixels Moves pixels perpendicular to the stroke direction.
Reflection Copies pixels to the brush area.
Clone Copies the distortions from around a source location to the current mouse location. Set the source
location by Alt-clicking (Windows) or Option-clicking (Mac OS) the source point.
Reconstruction Reverses distortions or applies them in different ways.
Distort an image with the Liquify effect
1Select the layer, and choose Effect > Distort > Liquify.
2In the Layer panel, create a mask to freeze areas of the image, and then set mask properties.
3In the Effect Controls panel do the following:
•Choose the mask you created from the Freeze Area Mask pop-up menu.
AFTER EFFECTS CS3
User Guide
408
•Specify a brush size and brush pressure. A low brush pressure makes changes occur more slowly, so it’s easier to
stop them at exactly the right moment.
•Specify a turbulent jitter to control how tightly the Turbulence tool scrambles pixels.
•Select View Mesh under the View Options control.
•Set a distortion mesh offset if desired.
•Drag the Distortion Percentage slider to specify the amount of distortion.
4Use the tools to distort the preview of the image.
5Use the Reconstruction tool to fully or partially reverse the distortions or to change the image in new ways.
Undo distortions with the Liquify effect
Use the Reconstruction tool and its modes to reverse distortions or redo them in new ways.
1Select the Reconstruction tool, and then choose a mode from the Reconstruction Mode pop-up menu:
Revert Changes unfrozen areas back to their predistorted state.
Displace Reconstructs unfrozen areas to match the displacement at the starting point for the reconstruction. You
can use Displace to move all or part of the preview image to a different location.
Amplitwist Reconstructs unfrozen areas to match the displacement, rotation, and overall scaling that exist at the
starting point.
Affine Reconstructs unfrozen areas to match all local distortions that exist at the starting point, including
displacement, rotation, horizontal and vertical scaling, and skew.
2Drag the area to restore. The restoration occurs more quickly at the brush center.
Magnify effect
TheMagnifyeffectenlargesallorpartofanimage.Thiseffectcanactlikeamagnifyingglassplacedoveranareaof
the image, or you can use it to scale the entire image far beyond 100% while maintaining resolution.
This effect works with 8-bpc color.
Original (top left), and with variations of Magnify applied (bottom left and right)
Shape The shape of the magnified area.
Center The center point of the magnified area.
AFTER EFFECTS CS3
User Guide
409
Magnification Percentage by which to scale the magnified area.
Link How the size and edge feathering of the magnified area are affected by the Magnification setting. Setting Link
to any value other than None disables the Resize Layer option.
•None The size and edge feathering of the magnified area don’t depend on the Magnification setting.
•Size To Magnification The radius of the magnified area is equal to the Magnification value (a percentage) times
the Size value.
•Size & Feather To Magnification The radius of the magnified area is equal to the Magnification value (a
percentage) times the Size value. The thickness of the edge feather is equal to the Magnification value times the
Feather value.
Size The radius of the magnified area, in pixels.
Feather The amount of edge feather, in pixels.
Opacity The opacity of the magnified area, as a percentage of the opacity of the original layer.
Scaling The type of scaling used to magnify the image:
•Standard This method maintains sharpness in the image but produces pixelated edges at higher values.
•Soft Uses spline algorithms. If you scale the image beyond 100%, Soft reduces edge pixelation and maintains
image quality. Soft works well at large magnification amounts.
•Scatter Creates scatter or noise in the image as the image enlarges.
Blending Mode The blending mode used to combine the magnified area with the original layer. The None option
displays transparent pixels around the magnified area.
Resize Layer If Resize Layer is selected, the magnified area can extend beyond the original layer’s boundaries.
Mesh Warp effect
The Mesh Warp effect applies a grid of Bezier patches over a layer, which you can manipulate to distort areas of an
image. Each corner of a patch includes a vertex and two to four tangents (points that control the curvature of the line
segment that makes up the edge of the patch). The number of tangents depends on whether the vertex is in a corner,
on an edge, or inside the grid. By moving the vertices and tangents, you can manipulate the shape of the curved line
segment. The finer the grid, the tighter the adjustments you can make to the area of the image inside the patch.
This effect works with 8-bpc and 16-bpc color.
Original (top left), with distortion mesh (bottom left), and with Mesh Warp applied (bottom right)
AFTER EFFECTS CS3
User Guide
410
To select multiple vertices, Shift-click the vertices.
Rows, Columns Specify up to 31 patches vertically (Rows) or horizontally (Columns). For broader distortion, use
fewerpatches.Forfinercontrol,usemore.Dragtheverticesandtangentstochangethegridshape.Theimagefollows
the grid shape according to the elasticity setting and the boundary created by the adjacent patch.
Quality Specifies how closely the image follows the shape defined by the curve. The higher the quality value, the
more closely the image follows the shape. Higher quality settings require more rendering time.
Distortion Mesh Click the stopwatch to animate the distortion over time.
Note: Each patch becomes a boundary for the distortion. For example, when you stretch a patch, the area of the image
in the patch stretches, squishing the area of the image in the adjacent patch. The boundary of the adjacent patch protects
the image inside it from being squished to zero. In other words, you can’t push an image out of its patch.
Mirror effect
The Mirror effect splits the image along a line and reflects one side onto the other.
Reflection Center The position of the line about which the reflection occurs.
Reflection Angle The angle of the line about which the reflection occurs. An angle of 0˚ reflects the left side onto the
right. An angle of 90˚ reflects the top onto the bottom.
This effect works with 8-bpc and 16-bpc color.
Offset effect
TheOffseteffectpanstheimagewithinalayer.Visualinformationpushedoffonesideoftheimageappearsonthe
opposite side. One use of the Offset effect is to create a looping background from a layer. At Best quality, the offset
is performed with subpixel precision.
Lloyd Alvarez provides a simple expression for the Offset effect to simulate a poorly timed film projector:
www.adobe.com/go/learn_ae_lloydoffsetprojector.
Shift Center To The new position of the original image’s center point.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
This effect works with 8-bpc and 16-bpc color.
Optics Compensation effect
Use the Optics Compensation effect to add or remove camera lens distortion. Elements composited with
mismatched lens distortion cause anomalies in the animation. For example, tracked objects in a distorted scene don’t
match the scene area because linear objects don’t follow the distortion of the scene.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Field Of View (FOV) The field of view (FOV)ofthedistortedfootage.TheFOVisrelativetothesizeofthesourcelayer
and the selected FOV Orientation. The distortion amount is relative to FOV. There is no general rule as to what FOV
value applies to different lenses. Zooming in reduces the FOV, and zooming out increases it. Consequently, if footage
includes different zoom values, you’ll need to animate the FOV value.
AFTER EFFECTS CS3
User Guide
411
Reverse Lens Distortion Reverses the lens distortion. For example, to remove wide-angle lens distortion, set Field Of
View to 40.0 and select Reverse Lens Distortion. Selecting Reverse Lens Distortion enables the Resize control.
FOV Orientation The axis on which the Field Of View value is based. This setting is useful when matching computer-
generated elements to the rendered view angle.
View Center Specifies an alternate center point of view. This setting is useful when using custom lenses that aren’t
centered. However, in most cases, this control should be left untouched.
Optimal Pixels Maintains as much pixel information as possible through the distortion. When selected, FOV values
are no longer reversible.
Resize Resizes the layer when the applied distortion stretches the layer beyond its boundaries. To use this control,
firstselectReverseLensDistortion,andthenchooseanoption.Offdoesn’tresizethelayer.Max2Xresizesthelayer
to a maximum of twice the original width and height. Max 4X resizes the layer to a maximum of four times the
original width and height. Unlimited resizes the layer as far as it is stretched. This option may require a large amount
of memory.
Add and match lens distortion with Optics Compensation
To match FOV values, layers must be the same size. However, if you select Resize, you can apply Optics Compen-
sation again and reverse the distortion using the same value (reversed). You can then apply another effect between
the two instances of Optics Compensation.
If you resize a layer using Optics Compensation and then precompose it into a larger composition, you cannot
reverse the distortion using the same value until you enlarge the precomposed layer to accommodate the expanded
layer.
1Select the layer with the distortion, and choose Effect > Distort > Optics Compensation.
2In the Effect Controls panel, adjust the FOV until a distorted edge or line appears straight. Note the FOV value.
3Select the computer graphic layer you want to distort, and apply Optics Compensation to it using the FOV value
from step 2.
4Select Reverse Lens Distortion.
5Remove Optics Compensation from the footage layer.
Polar Coordinates effect
The Polar Coordinates effect distorts a layer by transposing each pixel in the layer’s (x,y) coordinate system to the
corresponding position in the polar coordinate system, or the reverse. This effect produces unusual and surprising
distortions that can vary greatly depending on the image and the controls you select. The standard coordinate system
specifies points by measuring the horizontal distance (x axis) and the vertical distance (y axis) from the origin. Each
point is specified as (x,y). The polar coordinate system specifies points by measuring the length of a radius from the
origin (r) and its angle from the x axis ( ). Each point is specified as (r, ).
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
AFTER EFFECTS CS3
User Guide
412
Original (top left), and with variations of Polar Coordinates applied (bottom left and right)
StuMaschwitzprovidesanexampleprojectthatusestheFractalNoiseeffecttocreatethecoronaoftheSunandthen
uses the Polar Coordinates effect to wrap the line of noise around into a circle:
www.adobe.com/go/learn_ae_stucorona.
Interpolation Specifies the amount of distortion. At 0%, no distortion occurs.
Type of Conversion The conversion process to use:
•Rect To Polar Moves pixels by using (x,y) coordinates from each pixel as (r, ) coordinates. For example, an (x,y)
coordinate of (2,3) becomes a polar coordinate with a radius of 2 and a degree of 3. Horizontal lines distort into
circles, and vertical lines into radial lines.
•Polar To Rect Moves pixels by using the (r, ) coordinates from each pixel as the (x,y) coordinates. For example,
polar coordinates of radius 10 and 45˚ become (x,y) coordinates of (10,45).
Puppet effect
Use the Puppet effect to animate distortions of images to produce natural, lifelike motion.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
See also
“Animating with Puppet tools” on page 226
Reshape effect
The Reshape effect transforms one shape into another shape on the same layer, dragging the underlying image with
it. The image is distorted to fit the shape of the new area. You create or import up to three masks to define the area
you want to distort: the source mask, the destination mask, and the boundary mask (optional).
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
413
Original including three masks (top left), and with variations of Reshape applied (bottom left and right)
By default, After Effects assigns the masks a function (source, destination, or boundary) based on the order in which
you create or import them. You can also specify different masks. Use a closed path for each mask. All three masks
must be on the layer to which you apply the Reshape effect, although you can copy masks from another layer.
Source Mask The mask that contains the image area you want to reshape. If not specified, After Effects uses the
second mask created as the Source mask. In the Composition and Layer panels, a red outline defines the source mask.
Destination Mask
The mask that determines the shape of the final image. If not specified, After Effects uses the third
mask created as the Destination mask. In the Composition and Layer panels, a yellow outline defines the destination mask.
Boundary Mask Specifies what part of the image is reshaped. Anything outside the boundary isn’t altered. If not
specified, After Effects uses the first mask created as the Boundary mask. In the Composition and Layer panels, a
blue outline defines the boundary mask.
Percent The amount of reshaping. This value is useful for creating partial distortions that increase over time.
Elasticity Specifies how closely the image follows the shape defined by the curve. Stiff acts like cold rubber, allowing
the image to distort the least amount. Super Fluid acts like hot rubber, allowing the image to distort in a fluid fashion.
The other settings fall between. The more fluid elasticity settings require more rendering time. If the final image
doesn’t follow the curve as expected, use the following elasticity guidelines:
•In general, use the stiffest setting possible that doesn’t create a polygonal image. Use a higher elasticity setting if
the final image looks polygonal but the curves are smooth.
•Use Stiff, Less Stiff, or Below Normal if the source and destination masks are similar in shape and have low
curvature (few curved segments that change direction radically).
•Use Normal, Absolutely Normal, or Above Average if the source and destination masks are dissimilar and have
mild curvature.
•Use Loose, Liquid, or Super Fluid if the masks are very dissimilar and have extreme curvature.
Correspondence Points Specifies the number of points on the source mask that are associated with, or mapped to,
points on the destination mask. These points appear in the Composition panel and control the interpolation of the
distortion through space. To control the precision of the effect, you can add, delete, or move the points on either
mask. A mask can have an unlimited number of points, but the more points it has, the longer the effect takes to
render. If the distortion appears twisted, try adding more correspondence points at distinguishing points along the
masks. (If the arc lengths of the curves between correspondence points are too different, twisting may result.)
AFTER EFFECTS CS3
User Guide
414
Interpolation Method Specifies how After Effects determines the distortion of each video or animation frame in the
interval between keyframes or if no keyframes exist.
•Discrete Requires no keyframes because it calculates the distortion at each frame. Discrete produces the most
accurate results but requires more rendering time.
•Linear (Default) Requires two or more keyframes and performs a straight-line interpolation between the
keyframes. Linear produces steady changes between keyframes and sharp changes at keyframes.
•Smooth Requires three or more keyframes and approximates the distortion using cubic curves, producing distor-
tions with graceful motion.
Use the Reshape effect
1Open the layer in a Layer panel.
2Create or import the source, destination, and boundary masks into the layer.
Name each mask so that you can easily recognize it in the Mask menu in the Effect Controls panel.
3In the Timeline panel, choose None from the Mode pop-up menu for each mask.
4Position the boundary mask to specify the area of the image that will remain unaltered. Areas within the boundary
mask will be distorted; areas outside the mask will remain unaltered. Keep the boundary mask as far as possible from
the source and destination masks to avoid foldovers.
5Scale and position the source mask over the image.
6Scaleandpositionthedestinationmasktoindicatethefinalshape.Distortionsworkbestifthesourceanddesti-
nation masks are in approximately the same location.
7Make the Composition or Timeline panel active, select the layer, and then choose Effect > Distort > Reshape.
8From the Mask menus, choose the source, destination, and boundary masks.
9Adjust the Percent control, and choose an option for Elasticity.
10 In the Composition panel, add, delete, or move correspondence points on the masks to control the distortion:
•To add a point, Alt-click (Windows) or Option-click (Mac OS) the mask.
•To delete a point, Alt-click or Option-click the point.
•To move a point, drag it to a new location.
•To change the interpolation of a pair of points, Shift-click a point. Smooth interpolation works best with round
masks, while linear interpolation works best with angular masks. You can combine smooth and linear interpo-
lation in the same composition.
11 Choose an interpolation method, and preview the distortion. If Linear or Smooth produces undesired results,
add more keyframes. If Discrete produces undesired results, choose another method.
Ripple effect
The Ripple effect creates the appearance of ripples in a specified layer, moving away from a center point in concentric
circles. The effect is similar to dropping a stone in a pond. You can also specify that ripples move toward the center
point.
Animate ripples at a constant speed using the Wave Speed control. This control doesn’t require keyframes for
animation. Animate ripples at varying speeds by creating keyframes for the Ripple Phase control.
AFTER EFFECTS CS3
User Guide
415
This effect works with 8-bpc and 16-bpc color.
Radius Controls the distance the ripples travel from the center point. The Radius value is a percentage of the image
size. If the center of the ripple is the center of the layer and the radius is set to 100, the ripples travel to the edge of
the image. A value of 0 produces no ripples. Like ripples in water, ripples in the layer become smaller as they travel
farther from the center.
To create a single-wave ripple, set Radius to 100, Wave Width between 90 and 100, and Wave Height as desired.
Center Of Ripple Specifies the center of the effect.
Type Of Conversion Specifies how the ripples are created. Asymmetric produces more realistic-looking ripples;
asymmetric ripples include lateral motion and produce more distortion. Symmetric produces motion that travels
only outward from the center point; symmetric ripples produce less distortion.
Wave Speed Sets the speed at which the ripples travel outward from the center point. When you specify a wave
speed, the ripples are automatically animated at a constant speed (without keyframes) across the time range. A
negative value makes the ripples move toward the center, and a value of 0 produces no movement. To vary wave
speed over time, set this control to 0, and then create a keyframe for the Ripple Phase property of the layer.
Wave Width Specifies the distance, in pixels, between wave peaks. Higher values produce long, undulating ripples,
and low values produce many small ripples.
Wave Height Specifies the height of the ripple wave. Taller waves produce greater distortion.
Ripple Phase Specifiesthepointalongthewaveformatwhichawavecyclebegins.Thedefaultvalueof0˚startsthe
wave at the midpoint of its downward slope; 90˚ starts it at the lowest point in the trough; 180˚ starts it at the
midpoint of the upward slope, and so on.
Smear effect
UsingtheSmeareffect,youdefineanareawithinanimageandthenmovethatareatoanewlocation,stretching,or
smearing, the surrounding part of the image with it. Use masks to define the area you want to distort.
This effect works with 8-bpc and 16-bpc color.
To use Smear, first create or import two masks: the source mask and the boundary mask. You can create masks on
the layer in After Effects or use masks created in Adobe Illustrator. To use a mask created in Illustrator, copy the mask
and paste it into a layer in After Effects. Masks must be closed to work with Smear; if a mask is an open trace, After
Effectsclosesitwhenyouselectit.BothmasksmustbeonthesamelayerasthefootagetowhichyouapplytheSmear
effect, although you can copy masks from another layer.
When you move the source mask within the image, Smear stretches the portion of the image inside the boundary
mask to follow the edges of the source mask. The boundary mask tries to protect the image outside it from being
stretched. Both the original position of the source mask (set in the Layer panel) and the offset position of the source
maskaredisplayedintheCompositionpanel.Thefirstpositionofthesourcemaskisindicatedbyalightredoutline,
and the new position is indicated by a dark outline.
You can animate the position, size, and rotation of the source mask as it moves to its offset position. You can also
animate the original position of the source mask in the Layer panel.
Processing can take up to several minutes with certain settings. Computation time increases as the source mask gets
closer to the boundary mask. Processing is interrupted when you click a control.
Source Mask Specifies a mask as the source mask. By default, After Effects selects the second mask you create or
import for the layer as the source mask.
AFTER EFFECTS CS3
User Guide
416
Note: You must specify both a boundary mask and a source mask to create a distortion.
Boundary Mask Specifies a mask as the boundary mask. By default, After Effects selects the first mask you create or
import as the boundary mask.
Mask Offset Specifies a destination position for the source mask. The offset is a position specified by x and y coordi-
nates, which appear to the right of the Offset button. To set an offset location, click the Offset button, and then click
the image in the desired location. To set the offset position numerically, type a new value for each axis. When you
don’t need the precision provided by Mask Offset, you can simply drag the source mask offset in the Composition
panel.
Note: Unwanted undulations may occur if the source mask is close to the boundary mask during animation.
Mask Rotation Rotates the source mask around its center point, between 0˚ and 360˚.
Mask Scale Scales the source mask (at its offset position) larger or smaller, in relation to its original position.
Percent Specifies what percentage of the smear is actually performed. For example, when Percent is set to 50%,
Smear performs half of the smear you have specified by moving, scaling, and rotating the source mask. This value
doesn’taffectthelocationoftheoriginalandoffsetpositionsofthesourcemask;itaffectsonlythepercentageofthe
effect that is performed.
Elasticity Specifies how closely the image follows the shape defined by the curve. Stiff distorts the least, while Super
Fluid distorts the most. In general, use the stiffest setting possible that doesn’t create polygonal images.
Interpolation Method Specifies a method for the interpolation that Smear performs between keyframes. Linear
requires two or more keyframes and performs a straight-line interpolation between the keyframes. Discrete
produces animations in which the distortions change at keyframes. Smooth requires three or more keyframes and
approximates the distortion using cubic curves, producing distortions with graceful motion. If you need further
precision in the animation between keyframes, add more keyframes. For example, a distortion representing a 90-
degree rotation between two keyframes appears as a folding of the image. To make this distortion more fluid, add a
keyframe for every 10˚.
Use the Smear effect
1Open the layer in a Layer panel.
2Create or paste the masks to use as the boundary mask and the source mask.
3Position the boundary mask to specify the area of the layer you don’t want Smear to affect.
4Scale and position the source mask over the area you want to move.
5Make the Composition panel active, and choose Effect > Distort > Smear.
6Enter a Percent value to specify the amount of smear applied.
7In the Composition panel, move the source mask to its destination position by dragging it or by using the Mask
Offset value.
8Use the Mask Rotation control to rotate the source mask, and use the Mask Scale control to scale it.
9Drag the Percent slider as needed, and choose a setting for Elasticity.
Spherize effect
The Spherize effect distorts a layer by wrapping a region of the image onto a sphere. The layer’s quality setting influ-
ences the Spherize effect. Best quality samples the displaced pixels to subpixel precision; Draft quality samples to the
nearest whole pixel.
AFTER EFFECTS CS3
User Guide
417
This effect works with 8-bpc and 16-bpc color.
Transform effect
The Transform effect applies two-dimensional geometric transformations to a layer. This effect supplements the
transform properties available for each layer in the Timeline panel. Anchor Point, Position, Rotation, Scale, and
Opacity properties function much the same as the layer transform properties in the Timeline panel.
You can specify the shutter angle for motion blur for this layer independently of the composition’s shutter angle.
(Motion blur must be enabled for the layer and for the composition for this to be relevant.)
Note: This effect is relative to the input layer. Therefore, to make a layer rotate around the upper left corner, open the
layer in the Layer panel, choose Transform from the Layer panel menu, and then move the anchor point and the position
to the upper left corner.
This effect works with 8-bpc and 16-bpc color.
Skew Skew amount.
Skew Axis The axis about which skew occurs.
See also
“Use motion blur” on page 200
Turbulent Displace effect
The Turbulent Displace effect uses fractal noise to create turbulent distortions in an image. For example, use it to
create flowing water, funhouse mirrors, and waving flags.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Displacement The type of turbulence used. Turbulent Smoother, Bulge Smoother, and Twist Smoother each
perform the same operations as Turbulent, Bulge, and Twist, except that the Smoother options create smoother
warps and take longer to render. Vertical Displacement warps the image vertically only. Horizontal Displacement
warps the image horizontally only. Cross Displacement warps the image both vertically and horizontally.
Amount Higher values cause more distortion.
Size Higher values cause larger areas of distortion.
Offset (Turbulence) Determines the portion of the fractal shape that is used to create the distortion.
Complexity Determines the level of detail in the turbulence. Lower values cause smoother distortions.
Evolution Animating this setting results in changes of the turbulence over time.
Note: Although the Evolution value is set in units called revolutions, it’s important to realize that these revolutions are
progressive. The Evolution state continues to progress infinitely at each new value. Use the Cycle Evolution option to
return the Evolution setting to its original state at each revolution.
Evolution Options EvolutionOptionsprovidecontrolsthatrendertheeffectforoneshortcycleandthenloopitfor
the duration of the layer. Use these controls to prerender turbulence elements into loops, and thus speed up
rendering time.
•Cycle Evolution Creates a loop that forces the Evolution state to return to its starting point.
•Cycle The number of revolutions of the Evolution setting that the fractal cycles through before it repeats. The
timing of the Evolution cycles is determined by the amount of time between Evolution keyframes.
AFTER EFFECTS CS3
User Guide
418
Note: The Cycle control affects only the state of the fractal, not geometrics or other controls, so you can get different
results with different Size or Offset settings.
•Random Seed Specifies a value from which to generate the fractal noise. Animating this property results in
flashing from one set of fractal shapes to another within the same fractal type. For smooth transition of the fractal
noise, use the Evolution control.
Note: Create new turbulence animations by reusing previously created Evolution cycles and changing only the Random
Seed value. Using a new Random Seed value alters the noise pattern without disturbing the Evolution animation.
Pinning Specifies which edges to pin so that the pixels along those edges aren’t displaced.
Resize Layer Enables the distorted image to expand past the layer’s original bounds.
Create a seamless loop using Turbulent Displace
1Set two keyframes for the Evolution control, using full revolutions only.
2Adjust the time between keyframes, and the number of Evolution revolutions until you’re satisfied with the
appearance of the displacement.
3Select Cycle Evolution.
4Set a value for Cycle that’s evenly divisible by the number of revolutions that you set for Evolution.
5In the Timeline panel, move the current-time indicator to the time where the cycle completes. For example, if the
Cycle value is 2, find the frame where the Evolution value is 2 revolutions.
6Move the current-time indicator back one frame, to prevent a duplicate frame in the seamless loop.
7Press the right bracket key (])to trim the layer Out point to the current time.
8Prerender this layer, and import it into the project.
9Set this prerendered footage item to loop. (See “Loop a footage item” on page 63.)
Note: If you set keyframes for any of the other controls, you must return them to their initial settings at the point on the
Timeline panel where the cycle begins to repeat. Otherwise, these properties don’t loop.
Twirl effect
The Twirl effect distorts an image by rotating a layer around its center. The image is distorted more sharply in its
center than at the edges, causing a whirlpool result at extreme settings. Because distortion in this effect is significant,
After Effects uses special anti-aliasing techniques to produce the highest-quality image. As a result, the Twirl effect
can be particularly slow to render.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Angle How far to twirl the image. Positive angles twirl the image clockwise; negative angles twirl it counterclockwise.
For a whirlpool result, animate the angle.
Twirl Radius How far the twirl extends from the twirl center. This value is a percentage of width or height of the layer,
whichever is greater. A value of 50, for example, produces a twirl that extends to the edges of the layer.
Warp effect
Use Warp to distort or deform layers. The warp styles work much like the Warp effects in Adobe Illustrator and Warp
Text in Adobe Photoshop.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
419
Warping a layer
Wave Warp effect
The Wave Warp effect produces the appearance of a wave traveling across an image. You can produce a variety of
different wave shapes, including square, circular, and sine waves. The Wave Warp effect is automatically animated at
a constant speed across the time range (without keyframes or expressions). To vary speeds, you need to set keyframes
or expressions.
This effect works with 8-bpc and 16-bpc color.
Wave Type The shape of the wave.
Wave Height The distance, in pixels, between wave peaks.
Wave Width The size of the wave in pixels.
Direction The direction the wave travels across the image. For example, a value of 225˚ makes the waves travel diago-
nally from upper right to lower left.
Wave Speed The speed (in cycles per second) at which the waves travel. A negative value reverses the wave direction,
andavalueof0producesnomovement.Tovarywavespeedovertime,setthiscontrolto0,andthensetkeyframes
or expressions for the Phase property.
Pinning Which edges to pin so that the pixels along those edges aren’t displaced.
Phase The point along the waveform at which a wave cycle begins. For example, 0˚ starts the wave at the midpoint
of its downward slope, and 90˚ starts it at the lowest point in the trough.
Antialiasing Sets the amount of anti-aliasing, or edge smoothing, to perform on the image. In many cases, lower
settings produce satisfactory results; a high setting can significantly increase rendering time. Anti-aliasing is
performed only if the layer quality setting is Best.
Generate effects
4-Color Gradient effect
The 4-Color Gradient effect produces a four-color gradient. The gradient is defined by four effect points, the
positions and colors of which can be animated using the Positions & Colors controls. The gradient is actually
composed of four solid-color circles blended together, each with an effect point as its center.
AFTER EFFECTS CS3
User Guide
420
This effect works with 8-bpc and 16-bpc color.
Blend Higher values create more gradual transitions between colors.
Jitter Theamountofjitter (noise) in the gradient. The jitter, which reduces banding, affects only those areas where
banding could occur.
Opacity The opacity of the gradient, as a fraction of the layer’s Opacity value.
Blending Mode The blending mode to use in combining the gradient with the layer.
Advanced Lightning effect
The Advanced Lightning effect creates simulations of electrical discharges. Unlike the Lightning effect, Advanced
Lightning doesn't self-animate. Animate the Conductivity State or other properties to animate the lightning.
The Advanced Lighting effect includes the Alpha Obstacle feature, with which you can make the lightning go around
designated objects.
This effect works with 8-bpc color.
Lightning Type Specifies the characteristics of the lightning.
Note: The type determines the nature of the Direction/Outer Radius contextual control. In the Breaking type, the
branches are focused toward the Direction point as the distance between Origin and Direction increases.
Origin Specifies the point of origin for the lightning.
Direction, Outer Radius This control changes depending on the Lightning Type:
•Not In Use The Direction or Outer Radius control is not available if Lightning Type is Vertical.
•Outer Radius Specifies the distance that the lightning travels from its origin. This control is enabled if Omni or
Anywhere is selected as the lightning type. Use it to terminate the lightning at a defined distance from the origin.
•Direction Specifies the direction that the lightning will travel. This control is enabled if any of the following
lightning types are selected: Direction, Strike, Breaking, Bouncy, and Two-Way Strike.
Conductivity State Changes the path of the lightning.
Core Settings These controls adjust various characteristics of the lightning’s core.
Glow Settings These controls adjust the lightning’s glow.
Note: To disable the glow, set Glow Opacity to 0. This setting can speed up rendering time significantly.
Alpha Obstacle Specifies the influence of the original layer’s alpha channel on the path of the lightning. The
lightning attempts to wrap itself around opaque areas of the layer’s alpha channel, seeing them as an obstacle.
Note: If Alpha Obstacles is set to a value other than 0, it's not always possible to preview the correct result in less than
full resolution; full resolution may reveal new obstacles. Be sure to check the result in full resolution before final
rendering.
Turbulence Specifies the amount of turbulence in the lightning path. Higher values result in a more complex strike
containing more branches and forks, and lower values produce simpler strikes with fewer branches.
Forking Specifies what percentage of a branch is forked. Its value is influenced by Turbulence and Alpha Obstacle
settings.
Decay Specifies the amount of continuous decay or dissipation of the lightning strength and influences where the
opacity of the forks begins to fade.
AFTER EFFECTS CS3
User Guide
421
Decay Main Core Decays the main core along with its forks.
Composite On Original Composites the lightning with the original layer using the Add blending mode. When
deselected, only the lightning is visible.
Complexity Specifies the complexity of the turbulence in the lightning.
Min. Fork Distance Specifies the minimum pixel distance between new forks. Lower values create more forks in the
lightning. Higher values result in fewer forks.
Termination Threshold Specifies the level at which a path terminates, based on resistance in the atmosphere and
possible alpha collision. At lower values, the path terminates more easily when encountering resistance or alpha
obstacles. At higher values, the path more persistently moves around alpha obstacles.
Note: Increasing Turbulence or Complexity values causes resistance to increase in some areas. These areas change as
conductivity changes. Increasing the Alpha Obstacle value causes resistance to increase at alpha edges.
Main Core Collision Only Calculates collisions only on the main core. The forks aren’t affected. This control is
relevant only if you select Alpha Obstacle.
Fractal Type Specifies the type of fractal turbulence used to create the lightning.
Core Drain Specifies the percentage by which the core strength is drained when creating a new fork. Increasing this
value reduces the opacity of the core where new forks appear. Because forks draw their strength from the main core,
decreasing this value reduces the opacity of the forks as well.
Fork Strength Specifies the opacity of the new fork. This amount is measured as a percentage of the Core Drain
value.
Fork Variation Specifies the amount of variation in the opacity of the fork and determines how much the fork opacity
deviates from the amount set for Fork Strength.
Audio Spectrum effect
ApplytheAudioSpectrumeffecttoavideolayertodisplaytheaudiospectrumofanaudiolayer.Theeffectdisplays
the magnitude of frequencies in the range you define using Start Frequency and End Frequency. This effect can
display the audio spectrum in a number of different ways, including along a Bezier path of a layer. Apply the effect
to a layer that contains a solid or an image, and that may contain audio.
Note: Audio Spectrum uses the audio source footage without time-remapping, effects, stretch, or levels. To display the
spectrum with such effects, precompose the audio layer before applying the Audio Spectrum effect.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
AFTER EFFECTS CS3
User Guide
422
Original (top left), and with effect applied (bottom left and right)
Audio Layer The audio layer you want to use as input.
Start Point, End Point Specifies the position at which the spectrum starts or ends if Path is set to None.
Path The audio spectrum is displayed along the path of the layer, unless None is chosen.
Use Polar Path The path starts from a single point and appears as a radial graph.
Start Frequency, End Frequency The lowest and highest frequencies, in hertz, to display.
Frequency Bands The number of frequency bands into which to divide displayed frequencies.
Maximum Height Maximum height, in pixels, of a displayed frequency.
Audio Duration Duration of audio, in milliseconds, used to calculate the spectrum.
Audio Offset Time offset in milliseconds used to retrieve the audio.
Thickness Thickness of the bands.
Softness How feathered or blurry the bands appear.
Inside Color, Outside Color Inside and outside colors of the bands.
Blend Overlapping Colors Specifies that overlapping spectrums are blended.
Hue Interpolation If the value is greater than 0, the frequencies displayed rotate through the hue color space.
Dynamic Hue Phase If selected, and the Hue Interpolation is greater than 0, the Start color shifts to the maximum
frequency in the range of displayed frequencies. This setting allows the hue to follow the fundamental frequency of
the spectrum displayed as it changes.
Color Symmetry If selected, and the Hue Interpolation is greater than 0, the start and end colors are the same. This
setting allows color continuity on closed paths.
Display Options Specifies whether to display frequency as Digital, Analog Lines, or Analog Dots.
Side Options Specifies whether to display the spectrum above the path (Side A), below the path (Side B), or both
(Side A & B).
Duration Averaging Specifies that audio frequencies are averaged to reduce randomness.
Composite On Original If selected, displays the original layer with the effect.
AFTER EFFECTS CS3
User Guide
423
Audio Waveform effect
Apply the Audio Waveform effect to a video layer to display the audio waveform amplitude of an audio layer. You
can display the audio waveform in a number of different ways, including along an open or closed mask path.
Note: Audio Waveform uses the audio source footage without time-remapping, effects, stretch, or levels. To display the
spectrum with such effects, precompose the audio layer before applying the Audio Waveform effect.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (top left), and with effect applied (bottom left and right)
Audio Layer The audio layer you want to display as a waveform.
Start Point, End Point The position at which the waveform starts and ends, if Path is set to None.
Path If set to None, the audio waveform is displayed along the path of the layer.
Displayed Samples Number of samples to display in the waveform.
Maximum Height Maximum height, in pixels, of a displayed frequency.
Audio Duration Duration of audio, in milliseconds, used to calculate the waveform.
Audio Offset Time offset, in milliseconds, used to retrieve the audio.
Thickness The thickness of the waveform.
Softness How feathered or blurry the waveform appears.
Inside Color, Outside Color The inside and outside colors of the waveform.
Waveform Options
Mono combines the left and right channels of the audio layer. Nonstereo audio layers play as Mono.
Display Options Digital displays each sample as a single vertical line connecting the minimum and maximum
source sample. This option simulates the display used on digital equipment. Analog Lines displays each sample as a
line connecting the previous and next sample from either the minimum or maximum audio source sample. This
optionsimulatestheretraceseeninthedisplayofananalogoscilloscope.AnalogDotsdisplayseachsampleasadot
representing either the minimum or maximum audio source sample.
Beam effect
The Beam effect simulates the movement of a beam, such as a laser beam. You can make the beam shoot, or you can
create a wandlike beam with stationary start and end points. The beam looks best when motion blur is enabled and
the shutter angle is set to 360.
AFTER EFFECTS CS3
User Guide
424
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with a simulated beam (right)
The Length control specifies the length of the beam based on a percentage of the Time specified. For example, a
setting of 100% means that the visible beam length is at its maximum when the Time control is 50%. Time specifies
thetimeofthebeam’stravelfromstarttoendasapercentage.The3DPerspectivecontroluses3Dperspectivebased
on start and end thickness if Time is animated.
Cell Pattern effect
The Cell Pattern effect generates cellular patterns based on cellular noise. Use it to create static or moving
background textures and patterns. The patterns can be used in turn as textured mattes, as transition maps, or as a
source for displacement maps.
This effect works with 8-bpc color.
Original image (left); the Cell Pattern effect creates a displacement map (center), which is used as a displacement map for the Displacement
Map effect (right).
Cell Pattern The cell pattern to use. HQ denotes high-quality patterns that render with more definition than their
unmarked counterparts. Mixed Crystals is available only as a high-quality option.
Note: The Static Plates option is identical in appearance to the Plates option. However, when evolving, the static plates
retain a uniform lightness value, whereas the plates shift the lightness of the cell pattern.
Invert Inverts the cell pattern. Black areas become white, and white areas become black.
Contrast/Sharpness Specifies the contrast of the cell pattern when you use the Bubbles, Crystals, Pillow, Mixed
Crystals, or Tubular cell pattern. The control specifies sharpness for any of the Plate or Crystallize options.
Note: The contrast is affected by the option chosen from the Overflow menu.
Overflow How the effect remaps values that fall outside the grayscale range of 0-255. Overflow isn’t available if
sharpness-based cell patterns are chosen.
•Clip Values above 255 are mapped to 255. Values below 0 are mapped to 0. Contrast amount controls how much
of the image falls outside the range 0-255; higher contrast amounts result in a mostly black or white image, with less
gray. Therefore, less subtle cellular detail appears at higher contrast settings.
•Soft Clamp Remaps grayscale values to fall inside the 0–255 range. Contrast appears reduced; cells are mostly
gray with very few areas of pure black or white.
AFTER EFFECTS CS3
User Guide
425
•Wrap Back Values above 255 or below 0 are reflected back into the 0-255 range. For example, a value of 258
(255+3) is reflected to 252 (255-3), and a value of -3 is reflected to 3. With this setting, Contrast values above 100
increase complexity and detail.
Disperse How randomly the pattern is drawn. Lower values cause more uniform or gridlike cell patterns.
Note: If you set the Disperse value above 1.0, set the layer to Best quality to avoid artifacts.
Size The size of the cells. The default size is 60.
Offset Determines the portion of the fractal shape used to create the pattern.
Tiling Options Choose Enable Tiling to create a pattern built of repeating tiles. Cells Horizontal and Cells Vertical
determine how many cells wide and how many cells high each tile is.
Evolution Animating this setting results in changes of the pattern over time.
Note: Although the Evolution value is set in units called revolutions, it’s important to realize that these revolutions are
progressive. The Evolution state continues to progress infinitely at each new value. Use the Cycle Evolution option to
return the Evolution setting to its original state at each revolution.
Evolution Options EvolutionOptionsprovidecontrolsthatrendertheeffectforoneshortcycleandthenloopitfor
the duration of your clip. Use these controls to prerender cell pattern elements into loops, and thus speed up
rendering time.
•Cycle Evolution Creates a loop that forces the Evolution state to return to its starting point.
•Cycle The number of revolutions of the Evolution setting that the cell pattern cycles through before it repeats. The
timing of the Evolution cycles is determined by the amount of time between Evolution keyframes.
Note: The Cycle control affects only the state of the cell pattern, not geometrics or other controls, so you can get different
results with different Size or Offset settings.
•Random Seed Specifies a value from which to generate the cell pattern. Animating this property results in flashing
from one cell pattern to another within the same cell pattern type. For smooth transition of the cell pattern, use the
Evolution control.
Note: Create new cell pattern animations by reusing previously created Evolution cycles and changing only the Random
Seed value. Using a new Random Seed value alters the cell pattern without disturbing the Evolution animation.
Checkerboard effect
The Checkerboard effect creates a checkerboard pattern of rectangles, half of which are transparent.
This effect works with 8-bpc color.
Anchor The point of origin of the checkerboard pattern. Moving this point offsets the pattern.
Size From How the dimensions of the rectangles are determined:
•Corner Point Each rectangle’s dimensions are those of the rectangle with opposite corners defined by the Anchor
and Corner points.
•Width Slider A rectangle’s height and width are equal to the Width value, meaning that the rectangles are squares.
•Width & Height Sliders A rectangle’s height is equal to the Height value. A rectangle’s width is equal to the Width
value.
Feather Thickness of the edge feather within the checkerboard pattern.
Color The color of the nontransparent rectangles.
AFTER EFFECTS CS3
User Guide
426
Opacity The opacity of the colored rectangles.
Blending Mode Theblendingmodetousetocompositethecheckerboardpatternontopoftheoriginallayer.These
blending modes work identically to the ones in the Timeline panel, except for the default None mode, which renders
the checkerboard pattern only.
Circle effect
The Circle effect creates a customizable solid disk or ring.
This effect works with 8-bpc color.
Edge None creates a solid disk. The other options all create rings. Each option corresponds to a different set of
properties that determine the shape and edge treatment of the ring:
•Edge Radius
ThedifferencebetweentheEdgeRadiuspropertyandtheRadiuspropertyisthethicknessofthering.
•Thickness The Thickness property sets the ring’s thickness.
•Thickness * Radius The product of the Thickness property and the Radius property is the ring’s thickness.
•Thickness & Feather * Radius The product of the Thickness property and the Radius property is the ring’s
thickness. The product of the Feather property and the Radius property is the ring’s feather.
Feather The thickness of the feather.
Invert Circle Inverts the matte.
Blending Mode The blending mode used to combine the shape and the original layer. These blending modes behave
like those in the Timeline panel, except for None, which displays only the shape, without the original layer.
Ellipse effect
The Ellipse effect draws an ellipse.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Eyedropper Fill effect
The Eyedropper Fill effect (formerly the Color Picker effect) applies a sampled color to the source layer. This effect
is useful for quickly picking a solid color from a sample point on the original layer or picking a color value from one
layer and using blending modes to apply this color to a second layer.
This effect works with 8-bpc color.
Sample Point The center of the sampled area.
Sample Radius The radius of the sampled area.
Average Pixel Color Which color values are sampled:
•Skip Empty Samples the average RGB color values, excluding those of transparent pixels.
•All Samples the average of all RGB color values, including those of transparent pixels.
•All Premultiplied Samples the average of all RGB color values, premultiplied with the alpha channel.
•Including Alpha Samples the average of all RGB color and alpha channel values. This setting results in the sampled
color also containing the average transparency of the sampled pixels.
AFTER EFFECTS CS3
User Guide
427
Maintain Original Alpha Maintains the original layer’s alpha channel. If you choose Including Alpha in the Average
Pixel Color menu, the original alpha is stenciled over the sampled color.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
Fill effect
The Fill effect fills specified masks with a specified color. If you want to add both a stroke and a fill to a closed path,
theorderinwhichyouapplythestrokeandfilldeterminesthevisiblewidthofthestroke:Ifthefillisappliedbefore
thestroke,thefullstrokebrushsizeisvisible;ifthestrokeisappliedbeforethefill,thefillappearsontopofthestroke,
obscuring the half of the stroke that falls inside the path.
This effect works with 8-bpc color.
See also
“Stroke effect” on page 437
Fractal effect
The Fractal effect renders the Mandelbrot or Julia set, creating colorful textures. When you first apply the effect, the
picture you see is the classic sample of the Mandelbrot set; the set is the area that is colored black. Any pixel outside
the set is colorized, depending on how close it is to the set.
This effect works with 8-bpc and 16-bpc color.
Spaceship layer (top left) composited over layer with Mandelbrot fractal with Lightness Gradient palette (bottom left) and Julia fractal (bottom
right)
Set Choice Specifies the set used. Mandelbrot is the typical Mandelbrot set. Mandelbrot Inverse is the Mandelbrot
set mathematically inverted. Julia always changes depending on the center point from the Mandelbrot set and can
produce the set of all possible Julia sets. Julia Inverse is the inverse of the Julia set. To see a Julia set, you may want to
set the magnification to a negative value, because these sets tend to fill up the complex plane outside the normal
boundary.MandelbrotOverJuliaisthesameasMandelbrot,exceptthatitdoeschangewhentheJuliacenterpoint
changes.MandelbrotInverseoverJuliaisthesameasMandelbrotInverse,exceptthatitdoeschangewhentheJulia
center point changes.
AFTER EFFECTS CS3
User Guide
428
Mandelbrot, Julia Specify the settings for the specified set. X (Real) and Y (Imaginary) specify the pixels at the center
of the image for either the Mandelbrot or Julia set. Magnification specifies the magnification of the effect. Escape
Limit specifies how many times the calculation looks for a color for a given pixel before it assigns the color black. It
also sets the maximum number of line segments the Selection tool can use when tracing the path of a point. Higher
numbers require longer render times.
Color Specifies the color of the effect:
•Overlay Displaysaghostedversionoftheoppositeset.Forexample,whenviewingtheJuliaset,usethiscontrol
to display a ghosted version of the Mandelbrot set. When you select Overlay, a white cross hair with a black drop
shadowappearssoyoucanseetheexactpointatthecenteroftheoppositeset.ThiscontrolisusefulbecausetheJulia
set depends on the center point of the Mandelbrot set.
•Transparency Specifies whether black pixels are transparent. If you choose Solid Color from the Palette menu,
this control specifies whether everything inside or outside the set is transparent.
•Palette Specifies the palette to use when drawing the set. Lightness Gradient creates a gradient that ranges from
black to white, passing through the hue specified by the Hue control. Then it applies the same gradient eight more
times, each time using the hue 45˚ away on the color wheel. The number of colors in the gradient is specified by the
Cycle Steps control. Hue Wheel uses all the color from the Hue color wheel, with maximum brightness and
saturation. Black And White uses alternating bands of black and white. Solid Color turns everything transparent
excepttheinsideoftheset,whichusesthecolorspecifiedbytheHuecontrol.SelectTransparenttogettheopposite
result.
•Hue Specifies the hue for solid colors and the starting hue for color gradients. This control works well for creating
smooth color changes or for cycling through the palette. Cycle Steps specifies the number of bands of different color
that appear before the cycle starts over. Cycle Offset specifies where, other than the beginning, a cycle starts.
•Edge Highlight Highlights the edges between color bands. This control requires low-quality mode. If you want
to use high-quality edge highlighting, use the Find Edges effect instead.
High Quality Settings Specify the oversampling settings for the effect:
•Oversample Method Specifies the method used to oversample the effect: Edge Detect-Fast-May Miss Pixels
performs a simple edge detection and oversamples only those pixels. This option is the fastest, especially in areas with
a lot of solid color, such as black, and it generally produces results indistinguishable from Brute Force. Brute Force-
Slow-Every Pixel oversamples every pixel in the image. It is slow but precise.
•Oversample Factor Specifies the amount of oversampling to perform. For example, a value of 4 specifies that each
pixel is sampled 16 times (4x4=16) and that the average color is used. Higher values produce better quality output
but require longer render times.
Use tools with the Fractal effect
When the Fractal effect is selected in the Effect Controls panel, you can use After Effects tools in the following way.
(If you don’t want the Fractal tools active, deselect the effect before using tools.)
•Drag the Selection tool to see if a point’s path lies within the set. If the path leads out of the bounded rectangle (-
2, -2, 2, 2), it has gone into infinity; in such a case, the starting-point color is based on how many line segments it
takes to reach infinity. If the path ends within the rectangle, it’s colored black.
•Use the Zoom tool to zoom in or out on a particular point, or hold down Ctrl (Windows) or Command (Mac OS),
click and hold the Magnifying tool over the center of the image, and navigate from the center. For example, to
zoom straight in, stay in the center; to move up, drag up just a little and then quickly move back to the center.
AFTER EFFECTS CS3
User Guide
429
•Use the Hand tool to pan the image. Press Ctrl (Windows) or Command (Mac OS) to pan the opposite fractal. For
example, when viewing the Julia set, press Ctrl (Windows) or Command (Mac OS) to pan the Mandelbrot set and
see how the Julia set depends on the center point of the Mandelbrot set.
•Usethearrowkeystopanthecenterpointby1pixel.PressShiftasyoupressanarrowkeytoadjustthepointby
10 pixels. Press Ctrl (Windows) or Command (Mac OS) as you press an arrow key to adjust the center point of the
opposite set.
Grid effect
Use the Grid effect to create a customizable grid. Render this grid in a solid color or as a mask in the alpha channel
of the source layer. This effect is good for generating design elements and mattes within which other effects can be
applied.
This effect works with 8-bpc color.
Use Grid with the Advanced Lightning effect to create lightning forks that follow a grid pattern.
Anchor The point of origin of the grid pattern. Moving this point offsets the pattern.
Size From How the dimensions of the rectangles are determined:
•Corner Point Each rectangle’s dimensions are those of the rectangle with opposite corners defined by the Anchor
and Corner points.
•Width Slider A rectangle’s height and width are equal to the Width value, meaning that the rectangles are squares.
•Width & Height Sliders A rectangle’s height is equal to the Height value. A rectangle’s width is equal to the Width
value.
Border The thickness of the grid lines. A value of 0 causes the grid to disappear.
Note: The anti-aliasing of the grid borders may cause the visible thickness to vary.
Feather The softness of the grid.
Invert Grid Inverts the transparent and opaque areas of the grid.
Color The color of the grid.
Opacity The opacity of the grid.
Blending Mode The blending mode to use to composite the grid on top of the original layer. These blending modes
work identically to the ones in the Timeline panel, except for the default None mode, which renders the grid only.
Lens Flare effect
The Lens Flare effect simulates the refraction caused by shining a bright light into the camera lens. Specify a location
for the center of the flare by clicking anywhere inside the image thumbnail or by dragging its cross hair.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
430
Single lens flare (bottom left) and multiple lens flares (bottom right)
Lightning effect
The Lightning effect creates lightning bolts and other electrical visuals, including a Jacob’s Ladder result (as seen in
oldhorrormovies)betweentwospecifiedpointsinalayer.Thiseffectisautomaticallyanimatedwithoutkeyframes
or expressions.
This effect works with 8-bpc color.
Variations in thickness, color, and number of branches (bottom left and right)
Start Point, End Point Where the lightning begins and ends.
Segments The number of segments that form the main lightning bolt. Higher values produce more detail but reduce
the smoothness of motion.
Amplitude The size of undulations in the lightning bolt as a percentage of the layer width.
Detail Level, Detail Amplitude How much detail is added to the lightning bolt and any branches. For Detail Level,
typical values are between 2 and 3. For Detail Amplitude, a typical value is 0.3. Higher values for either control are
best for still images but tend to obscure animation.
Branching The amount of branching (forking) that appears at the ends of bolt segments. A value of 0 produces no
branching; a value of 1.0 produces branching at every segment.
Rebranching The amount of branching from branches. Higher values produce treelike lightning bolts.
Branch Angle The angle between a branch and the main lightning bolt.
AFTER EFFECTS CS3
User Guide
431
Branch Seg. Length The length of each branch segment as a fraction of the average length of the segments in the
lightning bolt.
Branch Segments The maximum number of segments for each branch. To produce long branches, specify higher
values for both Branch Seg. Length and Branch Segments.
Branch Width The average width of each branch as a fraction of the width of the lightning bolt.
Speed How fast the lightning bolt undulates.
Stability How closely the lightning follows the line defined by the start and end points. Lower values keep the
lightning bolt close to the line; higher values create significant bouncing. Use Stability with Pull Force to simulate a
Jacob’sLaddereffectandcausethelightningbolttosnapbacktoapositionalongthestartlineafterithasbeenpulled
in the Pull Force direction. A Stability value that is too low doesn’t allow the lightning to be stretched into an arc
before it snaps back; a value that is too high lets the lightning bolt bounce around.
Fixed Endpoint Determines whether the end point of the lightning bolt remains fixed in place. If this control isn’t
selected, the end of the bolt undulates around the end point.
Width, Width Variation The width of the main lightning bolt and how much the width of different segments can
vary. Width changes are randomized. A value of 0 produces no width changes; a value of 1 produces the maximum
width changes.
Core Width The width of the inner glow, as specified by the Inside Color value. Core Width is relative to the total
width of the lightning bolt.
Outside Color, Inside Color The colors used for the lightning bolt’s outer and inner glows. Because the Lightning
effect adds these colors on top of existing colors in the composition, primary colors often produce the best results.
Bright colors often become much lighter, sometimes becoming white, depending on the brightness of colors beneath.
Pull Force, Pull Direction The strength and direction of a force that pulls the lightning bolt. Use the Pull Force value
with the Stability value to create a Jacob’s Ladder appearance.
Random Seed AninputvaluefortherandomnoisegeneratorthatisthebasisoftheLightningeffect.Iftherandom
movement of the lightning interferes with another image or layer, enter a new value for Random Seed until you find
one that works for you.
Blending Mode The blending mode to use to composite the lightning on top of the original layer. These blending
modes work identically to the ones in the Timeline panel.
Rerun At Each Frame Regenerates the lightning at each frame. To make the lightning behave the same way at the
same frame every time you run it, don’t select this option. Selecting this option increases rendering time.
Paint Bucket effect
The Paint Bucket effect (formerly Basic Fill effect) is a nondestructive paint effect that fills an area with a solid color.
It works much like the Paint Bucket tool in Adobe Photoshop. Use the Paint Bucket effect for colorizing cartoon-type
outlined drawings or replacing areas of color in an image.
This effect works with 8-bpc color.
Fill Point The effect fills an area that contains the Fill Point. The area is determined by analyzing pixels that neighbor
the Fill Point and expanding the fill area by adding matching pixels. How far the fill color spreads depends upon the
Tolerance setting, as well as the option you choose from the Fill Selector menu.
Fill Selector Which values to operate on:
•Color & Alpha Specifies that the effect fills the fill point’s RGB and alpha channels with the new color.
AFTER EFFECTS CS3
User Guide
432
•Straight Color Specifies that the effect fills only the fill point area’s RGB channel with the new color.
•Transparency Specifies that the effect fills only the transparent areas near the fill point. You must set a fill point
in a transparent area for this option to work.
•Opacity Specifies that the effect fills only the opaque areas near the fill point. You must set a fill point in an opaque
area for this option to work.
•Alpha Channel Specifies that the effect fills either the opaque or transparent areas in the whole image, depending
upon the alpha channel value at the point you set the fill point.
Tolerance How far a pixel’s color values can be from the Fill Point color values and still match. Higher values expand
the range of pixels that the effect fills.
View Threshold Shows what pixels match—that is, which pixels are within the Tolerance value of the color values of
the Fill Point pixel. This option is especially useful in tracking leaks. If there is a small gap, the color can flow over
and fill areas not intended to be filled.
Stroke How the effect treats the edges of the filled area:
•Antialias Anti-aliases the edges of the filled area.
•Feather Creates a feathered edge for the filled area. Feather Softness values create a more gradually disappearing
edge.
•Spread Expands the area of the fill color. The Spread Radius value indicates the number of pixels the fill color
extends beyond the edge of the fill area.
•Choke Contracts the area of the fill color. The Spread Radius value indicates the number of pixels the fill color
shrinks from the edge of the fill area.
•Stroke Confines the fill to just the border of the selected area. The Stroke Width value indicates the width of the
stroke, in pixels.
Color The fill color.
Opacity Opacity of the filled area.
Blending Mode The blending mode to use to composite the result of effect on top of the original layer. All of these
blending modes operate like those in the Timeline panel, except for Fill Only. Use Fill Only to show only the fill.
Note: If you apply multiple instances of Paint Bucket to a layer, be sure not to set more than one to use the Fill Only
blending mode. If you set more than one instance to use this blending mode, only the first application of the effect is
shown.
Radio Waves effect
The Radio Waves effect creates radiating waves from a stationary or animated effect control point. You can use this
effect to generate pond ripples, sound waves, or intricate geometric patterns. Use the Reflection control to make the
shapes bounce off the sides of the layer. You can also use Radio Waves to create realistic wave displacement maps that
work well with the Caustics effect.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
433
Polygon wave type with square stroke profile (bottom left), and Image Contour wave type with Sine stroke profile (bottom right)
Producer Point The point from which the waves appear.
Parameters Are Set At Specifies whether parameters can be animated for individual waves. Birth specifies that each
wave maintains the same parameter settings over time. Each Frame specifies that the waves change as the parameters
change. For example, if you create a star wave with an animated rotation property, select Birth to offset each star from
the previous one to create a twisting tunnel, or select Each Frame to make all the stars rotate in unison as the rotation
property changes.
Render Quality
Controls the quality of the output. Radio Waves creates smooth, anti-aliased shapes by rendering high-
resolution versions of the shapes and then scaling them down by oversampling. For example, to create a 100x100-pixel
image, it may first generate a 400x400-pixel image and then scale it down using 4x oversampling. Oversampling
provides high-quality results but results in long render times. This option works only with Best quality mode.
Wave Type What to base the wave shape on.
Polygon
What kind of polygon to use for the wave shape. These controls are available if Polygon is chosen for Wave Type.
•Sides Three sides create a triangle, four create a square, and so on. Size values above 64 result in a smooth circle.
You can also approximate a circle by setting Sides to 3, Curve Size to 1, and Curvyness to about 0.62.
•Curve Size Specifies how much of each side is curved at each point.
•Curvyness Specifies how extreme the curve is at each point of the wave.
•Star Specifies that the polygon is shaped like a star. To change the number of points on the star, change the
number of sides.
•Star Depth Specifies the star’s angles by controlling the distance between inner points and the star’s center.
Mask Specifiesthemaskusedtocreateawave.ThiscontrolisavailableifyouchooseMaskfromtheWaveTypepop-
up menu.
Image Contour controls
You can base the wave shape on the contours of an image by choosing Image Contours for Wave Type.
Source Layer The layer to use as input for the creation of the image contours. Select an animated layer to emit
moving shapes. A well-defined outline, high-contrast grayscale layer, or alpha channel works well as a source. The
Radio Waves effect detects edges and converts sources into outlines.
AFTER EFFECTS CS3
User Guide
434
Source Center Specifies the center point of the shape, relative to the source layer. For example, if you isolate a shape
thatispositionedinthelefthalfoftheframe,theshaperadiatestotheleftbydefault;youcanmovethesourcecenter
anywhere on the layer.
Value Channel The color attributes of the source layer used to define the image contours.
Invert Input Inverts the chosen value channel option.
Value Threshold Specifies the threshold for the chosen value channel. It determines the percentage value at which
everythingbelowitoraboveitismappedtoeitherwhiteorblack.Thiscontrolcanmakeabigdifferenceintheshape
of the wave.
Pre-Blur Smooths out the value channel before the value threshold is sampled. If you have a high-contrast image,
such as white on black, and you want the wave to follow the edges very closely, set this option to 0.
Tolerance Defines how tightly the wave conforms to the layer. A very high setting results in sharp corners; a very
low value can make the wave shape more sensitive to noise.
Contour Specifies the shape in the source layer that you want to use as the emitted wave. Contour numbers the
shapes by their order in the frame from top to bottom, left to right. The shape in the top left corner is number 1.
Wave Motion controls
Wave Motion controls specify how the wave emits from the center point.
Frequency Specifies the number of waves per second flowing out of the producer point.
Expansion Specifiesthespeedatwhichthewavetravelsfromtheproducerpointonceitisborn.Thisoptiondoesn’t
affect the number of waves per second.
Orientation Specifies the rotation of the shape at birth around its center point. To animate the rotation, use the Spin
control.
Direction Specifies the wave’s initial direction if Velocity is greater than 0. By default, particles are emitted from the
producer point in an expanding radial pattern.
Velocity Specifies the speed at which the wave moves in the specified direction.
Spin Controls the continued rotation of a shape after it is born.
Lifespan (sec) Specifies the time, in seconds (including the fade-in and fade-out times), that the wave exists.
To prevent waves from abruptly disappearing when their lifetime ends, use the Fade Out Time control.
Reflection Specifies whether the waves bounce off the edges of the layer and back into the scene. This option is
effective for generating displacement maps for use as water ripples.
Stroke controls
Stroke controls specify the appearance of the wave’s stroke.
Profile Controlstheappearanceofthestrokethatdefinestheshape.Theoutlineoftheshapeisanimatedinthewave
that emanates from the effect point. The quality of the stroke is defined as a 3D wave type.
Color Specifies the color of the stroke.
Opacity Specifies the maximum possible opacity of the stroke. The actual opacity of the stroke takes into account
this setting in conjunction with the Fade-in Time and Fade-out Time controls.
AFTER EFFECTS CS3
User Guide
435
Fade-in Time Specifies the amount of time it takes the wave to fade into view. Fade-in Time is measured in seconds
and begins with 0 opacity at birth. For example, if the Lifespan is 3 seconds and Fade-in Time is 1 second, the stroke
is completely transparent at birth and fades smoothly to full opacity at 1 second.
Fade-out Time Specifies the amount of time it takes the wave to fade out of view. Fade-out Time is measured
backward in time from the end of the Lifespan. If the Lifespan is 3 seconds and Fade-out Time is 1 second, the wave
begins to fade out at 2 seconds. If the sum of Fade-in Time and Fade-out Time is greater than the Lifespan value, the
intersection point of the two fades is calculated so that the wave doesn’t reach full transparency. If either Fade-in
Time or Fade-out Time is longer than the Lifespan, that amount is truncated to equal the Lifespan.
Start Width Specifies the width of the shape at its birth. End Width specifies the width of the shape at the end of its
lifespan.
Ramp effect
The Ramp effect creates a color gradient. You can create linear or radial ramps, and vary the position and colors of
therampovertime.UsetheStartOfRampandEndOfRamppropertiestospecifythestartandendpositions.Use
the Ramp Scatter control to disperse the ramp colors and eliminate banding.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Note: Ramps often don’t broadcast well; serious banding occurs because the broadcast chrominance signal doesn’t
contain sufficient resolution to reproduce the ramp smoothly. The Ramp Scatter control dithers the ramp colors, elimi-
nating the banding apparent to the human eye.
Scribble effect
The Scribble effect creates the appearance of hand-drawn artwork by filling or stroking a closed mask.
For example, the Scribble effect can simulate fills that look like marker, cross-hatching, or textiles. It fills a mask with
a single zigzagging line that crisscrosses the path. Some paths, because of their geometry, cannot be filled with a
single line. The Scribble effect breaks these paths into several simpler paths, each of which it then fills with a
zigzagged stroke.
Aharon Rabinowitz provides a tutorial that shows how to use Auto-trace with the Scribble effect to create a stylized
animated fill from video footage or from Illustrator graphics: www.adobe.com/go/learn_ae_aharonscribble.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
436
Masks (top left), Scribble applied to outside edges (bottom left), and Scribble applied to inside edges with Composite on Original (bottom right)
Scribble Single Mask scribbles a specified mask on the layer; All Masks scribbles all masks on the layer; All Masks
Using Modes combines the masks using their modes and then scribbles the resulting shape.
Mask The mask to use if Scribble is set to Single Mask.
Fill Type Controls whether the fill is drawn inside the path or creates a scribble along the path. Left Edge draws the
fill along the path’s left edge; Right Edge draws the fill along the path’s right edge. The left and right edges of a path
are determined by the direction in which the path is drawn. When using the Left Edge or Right Edge fill types on
masks that have tight curves, you get best results by making the Edge Width less than the radius of the curve.
Edge Options Options for the edge of the scribble if Fill Type is set to an edge.
•Edge Width Controls the width of the edge.
•End Cap Controls the ends of scribble lines. Use Round for stroked lines with semicircular ends; use Butt for
stroked lines with squared ends; and use Projecting for stroked lines with squared ends that extend half the line width
beyond the end of the line, making the weight of the line extend equally in all directions around the line. This option
is enabled only if Fill Type is set to Centered Edge.
•Join Specifies how the corners of a scribble line appear. Use Round for stroked lines with rounded corners; use
Bevel for stroked lines with squared corners; and use Miter for stroked lines with pointed corners.
•Miter Limit Controls when the effect switches from a miter (pointed) join to a bevel (squared-off) join. Specify a
value between 1 and 500. For example, if the value is set to the default of 4, the effect switches from a miter to a bevel
join when the length of the point reaches four times the stroke weight. A miter value of 1 results in a bevel join. It’s
enabled if Join is set to the Miter option.
•Start/End Apply To Specifies how changes to the effect’s Start and End options in the Timeline panel are applied;
Scribble Result affects the scribble in the order in which it is drawn, and Mask Path follows the path of the mask to
create more continuous drawing in or out of the scribble.
Angle Specifies the angle of the scribbled stroke.
Stroke Width Specifies the width of the stroke. Specify a value from 0.1 to 50.
Stroke Options Specify the curviness, spacing, and overlap of the scribbled line.
•Curviness Controls the amount of curve at the end of each scribbled stroke. Specify a value between 0˚ and 100˚.
•Curviness Variation Determines the amount of variance the curviness values can have at each end point. Specify
a value between 0% and 100%. A value of 0 gives the scribble sharp corners, while a value of 100 makes the scribble
loopy.
AFTER EFFECTS CS3
User Guide
437
•Spacing and Spacing Variation The number of pixels between lines and zigzags. Setting a value equal to the stroke
width value makes the lines fall next to each other.
•Path Overlap Determines whether the scribble ends at the path, inside the path, or outside the path. Specify 0 to
makeitendatthepath,negativevaluestomakeitendinside,andpositivevaluestomakeitendoutside.PathOverlap
Variation determines how much each stroke can vary from the value specified for Path Overlap.
Start, End Where the drawn stroke starts and ends, as a percentage of the distance from the beginning of the total
stroke.
Fill Paths Sequentially Enabled if Scribble is set to All Masks. If this control is selected, the start and end values apply
to the combined length of the scribbles for all masks. If it isn’t selected, the start and end values apply independently
to the scribble for each mask.
Wiggle Type Specifies an animation style: Static keeps the scribble constant over time; Jumpy changes from one
scribble to the next abruptly; and Smooth changes from one scribble to the next smoothly.
Wiggles/Second Controls how frequently a new scribble is generated when the Wiggle Type control is set to Smooth
or Jumpy.
Composite On Transparent replaces the original image with the scribble. On Original Image composites the scribble
on the original image. Reveal Original Image shows the original image through the scribble.
Stroke effect
TheStrokeeffectcreatesastrokeorborderaroundamaskoralongaBezierpath.Youcanalsospecifystrokecolor,
opacity, and spacing, as well as brush characteristics. Specify whether the stroke appears on top of the image, on a
transparent image, or if it reveals the original alpha channel. To use a path created in Illustrator, copy the path and
paste it into a layer in After Effects.
This effect works with 8-bpc color.
Original (top left), with mask (bottom left), and with effect applied (bottom right)
Brush Hardness Specifies the edge quality of the stroke, between hard and soft.
Spacing Specifies the spacing between stroke segments.
Paint Style Specifies whether the stroke is applied to the original layer or to a transparent layer.
See also
“Fill effect” on page 427
AFTER EFFECTS CS3
User Guide
438
Vegas effect
The Vegas effect generates running lights and other path-based pulse animations around an object. You can outline
just about anything, surround it with a number of lights or longer pulses, and then animate it to create the appearance
of lights chasing around the object.
This effect works with 8-bpc color.
Stroke What to base the stroke on: Image Contours or Mask/Path.
Image Contours If Image Contours is chosen from the Stroke menu, you specify what layer to take the image
contours from and how to interpret the input layer.
•Input Layer The layer whose image contours are used. High-contrast, grayscale layers, and alpha channels work
well and are easy to work with.
•Invert Input Inverts the input layer prior to creating the stroke.
•If Layer Sizes Differ Determines how to adjust the layers if the size of the input layer differs from that of the layer
to which Vegas is applied. Center centers the input layer in the composition at its original size. Stretch To Fit scales
the input layer to match the layer to which Vegas is applied.
•Channel The color attribute of the input layer used to define the contours.
•Threshold The percentage value at which everything below or above is mapped to either white or black. This
property is important in determining the location of the edges that the effect strokes.
•Pre-Blur Smooths out the input layer before the threshold is sampled. Set this option to 0 if you have a high-
contrast image and want the stroke to follow the edges very closely.
•Tolerance Defines how tightly the stroke conforms to the input layer. A very high value results in sharp corners,
while very low values can make the stroking sensitive to noise.
•Render Specifies whether to apply the effect to a selected contour or to all contours in the layer.
•Selected Contour Specifies the contour to use when Selected Contour is selected from the Render menu.
Contours are numbered from left top to bottom right; the contour with the highest point is number 1, the second
highest point is number 2, and so on.
•Shorter Contours Have Specifies whether shorter contours have fewer segments. By default, the effect breaks each
contour into the same number of segments. For example, if you apply the effect to the letter R, the outside contour
may look fine with 32 segments, but the inside contour may be almost solid. To resolve this issue, select Fewer
Segments.
Mask/Path The mask or path to use for the stroke. You can use either closed or open masks.
Segments Specifies the number of segments used to create each stroked contour. For example, if the effect is applied
to the word Vegas and Segments is set to 10, the outline of each of the letters, plus the inner contours of e,g, and a,
are broken into 10 segments.
Length Determines the length of a segment’s stroke in relation to its maximum possible length. For example, if
Segments is set to 1, the maximum length of a stroke is one complete trip around the object outline. If Segments is
set to 3, the maximum length of a segment is 1/3 of the total outline, and so on.
Segment Distribution Determines the spacing of the segments. Bunched puts the segments together like boxcars in
a train: The shorter the segment length, the shorter the overall length of the train. Even spaces the segments evenly
around the contour.
AFTER EFFECTS CS3
User Guide
439
Rotation Animates the segments around the contour. For example, to create the appearance of running lights, start
with a large number of segments set to 50% of their length, and then animate Rotation to move the lights around the
shapes.
Random Phase Specifies that the stroke starting point is different for each contour. By default, the effect strokes a
contour beginning at its highest point on the screen. In the event of a tie, it starts at the leftmost highest point.
Blend Mode Determines how the stroke is applied to the layer. Transparent creates the effect on a transparent
background. Over places the stroke over the existing layer. Under places the stroke behind the existing layer. Stencil
uses the stroke as an alpha channel mask, filling the stroke with the pixels of the original layer.
Color Specifies the color of the stroke, unless Stencil is chosen for Blending Mode.
Width Specifies the width of the stroke in pixels. Fractional values are supported.
Hardness Determines how sharp or blurry the edges of the stroke are. A value of 1 creates a slight blur; a value of 0.0
blurs the line so that few solid areas of color remain.
Start, End Opacity Specify the opacity at the beginning or end of the stroke.
Mid-point Opacity Specifies the opacity of the midpoint of the stroke. This control works in terms of relative opacity,
not absolute opacity. Setting it to 0 makes the change in opacity smooth from the start point to the end point, as if
there were no midpoint at all.
Mid-point Position Specifies the location of the midpoint within a segment: Lower values move the midpoint closer
tothebeginning;highervaluesmovethemidpointclosertotheend.Usethiscontroltomovethemidpointopacity
from the center of the stroke.
See also
“About randomness and random seeds” on page 354
Write-on effect
The Write-on effect animates strokes on a layer. For example, you can simulate the action of hand-writing of cursive
text or signatures.
Note: A convenient way to animate Brush Position is to use Motion Sketch to create Position keyframes on a new solid
layerandthenuseanexpressionontheBrushPositionpropertytolinkittothePositionpropertyonthenewsolidlayer.
(See “Sketch a motion path with Motion Sketch” on page 199 and “Add, edit, and remove expressions” on page 549.)
This effect works with 8-bpc color.
Other methods of animating paint strokes and text are also available. For example, you can animate text by using the
type tools and text animators, and you can animate a paint stroke applied with a paint tool. Paint strokes can have a
Write-on Duration setting, which you can use to create similar results as with the Write-on effect. You can also
animate shape paths for a similar result with the Trim Paths operation. (See “Animating text” on page 285, “Animate
paint strokes” on page 310, and “Managing and editing shapes” on page 325.)
Brush Position The position of the brush. Animate this property to create a stroke.
Stroke Length (secs) The duration, in seconds, of each brush mark. If this value is 0, the brush mark has unlimited
duration. Use a single, constant, nonzero value to create a snakelike movement of the stroke. Animate this value to
make the stroke expand and contract.
Brush Spacing (secs) The time interval, in seconds, between brush marks. Smaller values produce smoother paint
strokes but take more time to render.
AFTER EFFECTS CS3
User Guide
440
Paint Time Properties and Brush Time Properties Specifies whether paint properties and brush properties are
applied to each brush mark or to the entire stroke. Choose None to apply values at each time to all brush marks in
the stroke. Choose a property name for each brush mark to retain the value for that property at the time that the
brush mark was drawn. For example, if you choose Color, then each brush mark keeps the color specified by the
Color value at the time that the mark was drawn.
Paint Style How the paint stroke interacts with the original image:
•On Original Image Paint stroke appears over original image.
•On Transparent Paint stroke appears over transparency; the original image doesn’t appear.
•Reveal Original Image The original image is revealed by the paint stroke.
Keying effects
After Effects includes several built-in keying effects, as well as the Academy Award winning Keylight effect, which
excels at professional-quality color keying. For information on the Keylight effect, see its documentation in this
folder: Adobe After Effects CS3/Additional Documentation/Keylight.
To see a video tutorial on keying with Keylight, visit the Adobe website at www.adobe.com/go/vid0229.
Adobe Creative Suite Production Premium Edition also includes Adobe Ultra, which can quickly key out a poorly
lit background shot with a low-quality webcam.
See also
“Keying overview and tips” on page 268
Color Difference Key effect
The Color Difference Key effect creates transparency from opposite starting points by dividing an image into two
mattes, Matte Partial A and Matte Partial B. Matte Partial B bases the transparency on the specified key color, and
Matte Partial A bases transparency on areas of the image that don’t contain a second, different color. By combining
the two mattes into a third matte, called the alpha matte, the Color Difference Key creates well-defined trans-
parency values.
The Color Difference Key produces high-quality keying for all well-lit footage items shot against a bluescreen or
greenscreen and works especially well with images that contain transparent or semitransparent areas, such as smoke,
shadows, or glass.
This effect works with 8-bpc and 16-bpc color.
See also
“Keying overview and tips” on page 268
“Matte Choker effect” on page 450
“Simple Choker effect” on page 451
Use the Color Difference Key effect
1Select the layer you want to make transparent, and then choose Effect > Keying > Color Difference Key.
AFTER EFFECTS CS3
User Guide
441
Note: To use any of the eyedroppers in the Layer panel, choose Color Difference Key from the View menu in the Layer
panel.
2In the Effect Controls panel, choose Matte Corrected from the View menu. To view and compare the source
image, both partial mattes, and the final matte at the same time, choose [A, B, Matte] Corrected, Final from the View
menu. Other views available in the View menu are described in step 10.
3Selecttheappropriatekeycolor:Tokeyoutabluescreen,usethedefaultbluecolor.Tokeyoutanonbluescreen,
select a key color in one of the following ways:
•Thumbnail eyedropper: Select and then click in the Composition panel or the original thumbnail image on an
appropriate area.
•Key Color eyedropper: Select and then click in the Composition or Layer panel on an appropriate area.
•Key Color swatch: Click to select a color from the specified color space.
Note: The eyedropper tools move the sliders accordingly. Use the sliders in step 9 to fine-tune the keying results.
4Click the matte button to display the final combined matte in the matte thumbnail.
5Select the Black eyedropper, and then click inside the matte thumbnail on the lightest area of black to specify
transparent regions. The transparency values in the thumbnail and Composition panel are adjusted.
6Select the White eyedropper, and then click inside the matte thumbnail on the darkest area of white to specify
opaque regions. The opaque values in the thumbnail and the Composition panel are adjusted.
To produce the best possible key, make the black and white areas as different as you can so that the image retains as
many shades of gray as possible.
7Select a matching accuracy from the Color Matching Accuracy menu. Choose Faster unless you use a screen that
isn’t a primary color (red, blue, or yellow). For those screens, choose More Accurate, which increases rendering time
but produces better results.
8If you need to further adjust transparency values, repeat steps 5 and 6 for one or both of the partial mattes. Click
the Partial Matte B button or the Partial Matte A button to select a partial matte, and then repeat the steps.
9Adjust transparency values for each partial matte and for the final matte by dragging one or more of the following
sliders in the Matte Controls section:
•Black sliders adjust the transparency levels of each matte. You can adjust the same levels using the Black
eyedropper.
•White sliders adjust the opaque levels of each matte. You can adjust the same levels using the White eyedropper.
•Gamma sliders control how closely the transparency values follow a linear progression. At a value of 1 (the
default), the progression is linear. Other values produce nonlinear progressions for particular adjustments or
visual effects.
10 Whenadjustingindividualmattes,choosefromtheViewmenutocomparethematteswithandwithoutadjust-
ments:
•Choose Uncorrected to view a matte without adjustments.
•Choose Corrected to view a matte with all adjustments.
11 Before closing the Effect Controls panel, select Final Output from the View menu. Final Output must be selected
for After Effects to render the transparency.
To remove traces of reflected key color from the image, apply Spill Suppressor using Better For Color Accuracy. If the
image still has a lot of color, apply the Simple Choker or Matte Choker effect.
AFTER EFFECTS CS3
User Guide
442
Color Key effect
The Color Key effect keys out all image pixels that are similar to a specified key color. This effect modifies only the
alpha channel of a layer.
This effect works with 8-bpc and 16-bpc color.
See also
“Keying overview and tips” on page 268
“Matte Choker effect” on page 450
“Simple Choker effect” on page 451
Key out a single color with the Color Key effect
1Select the layer.
2Choose Effect > Keying > Color Key.
3In the Effect Controls panel, specify a key color in one of two ways:
•Click the Key Color swatch to open the Color dialog box and specify a color.
•Click the eyedropper, and then click a color on the screen.
4Drag the Color Tolerance slider to specify the range of color to key out. Lower values key out a smaller range of
colors near the key color. Higher values key out a wider range of color.
5Drag the Edge Thin slider to adjust the width of the keyed area’s border. Positive values enlarge the mask,
increasing the transparent area. Negative values shrink the mask, decreasing the transparent area.
6Drag the Edge Feather slider to specify the softness of the edge. Higher values create a softer edge but take longer
to render.
Color Range effect
The Color Range effect creates transparency by keying out a specified range of colors in either the Lab, YUV, or RGB
color space. You can use this key on screens that consist of more than one color or on bluescreens or greenscreens
that have been unevenly lit and contain different shades of the same color.
This effect works with 8-bpc color.
Poorly lit greenscreen (top left) and background layer (bottom left) are combined using Color Range Key (bottom right).
AFTER EFFECTS CS3
User Guide
443
See also
“Keying overview and tips” on page 268
“Matte Choker effect” on page 450
“Simple Choker effect” on page 451
Use the Color Range effect
1Select the layer you want to make transparent, and then choose Effect > Keying > Color Range.
2Choose Lab, YUV, or RGB from the Color Space menu. If you have trouble isolating the subject using one color
space, try using a different one.
3Select the Key Color eyedropper, and then click in the matte thumbnail to select the area that corresponds to a
color in the Composition panel you want to make transparent. Typically, this first color is the one that covers the
largest area of the image.
Note: To use the eyedroppers in the Layer panel, choose Color Range from the View menu in the Layer panel.
4Select the Plus eyedropper, and then click other areas in the matte thumbnail to add other colors or shades to the
range of colors keyed out for transparency.
5Select the Minus eyedropper, and then click areas in the matte thumbnail to subtract other colors or shades from
the range of colors keyed out.
6Drag the Fuzziness slider to soften the edges between transparent and opaque regions.
7Use the sliders in the Min/Max controls to fine-tune the color range you selected with the Plus and Minus
eyedroppers. The L, Y, R sliders control the first component of the specified color space; the a, U, G sliders control
the second component; and the b, V, B sliders control the third component. Drag the Min sliders to fine-tune the
beginning of the color range. Drag the Max sliders to fine-tune the end of the color range.
Difference Matte effect
The Difference Matte effect creates transparency by comparing a source layer with a difference layer, and then keying
outpixelsinthesourcelayerthatmatchboththepositionandcolorinthedifferencelayer.Typically,it’susedtokey
out a static background behind a moving object, which is then placed on a different background. Often the difference
layer is simply a frame of background footage (before the moving object has entered the scene). For this reason, the
Difference Matte effect is best used for scenes that have been shot with a stationary camera and an unmoving
background.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
444
Difference Matte Key effect
A. Original image B. Background image C. New background image D. Final composite image
See also
“Keying overview and tips” on page 268
“Matte Choker effect” on page 450
“Simple Choker effect” on page 451
Use the Difference Matte effect
1Select a motion footage layer as the source layer.
2Inthesourcelayer,findaframethatconsistsonlyofbackground,andsavethebackgroundframeasanimagefile.
(See “Export a single frame of a composition” on page 607.)
3Import the image file into After Effects, and add it to the composition.
Theimportedimagebecomesthedifferencelayer.Makesurethatitsdurationisatleastaslongasthatofthesource
layer.
Note: If the shot doesn’t contain a full background frame, you may be able to assemble the full background by combining
partsofseveralframesinAfterEffectsorPhotoshop.Forexample,youcanusetheCloneStamptooltotakeasampleof
the background in one frame, and then paint the sample over part of the background in another frame.
4Turn off the display of the difference layer by clicking the Video switch in the Timeline panel.
5Make sure that the original source layer is selected, and then choose Effect > Keying > Difference Matte.
6IntheEffectControlspanel,chooseFinalOutputorMatteOnlyfromtheViewmenu.(UsetheMatteOnlyview
to check for holes in the transparency. To fill undesired holes after you complete the keying process, see “Close a hole
in a matte” on page 271.)
7Select the background file from the Difference Layer menu.
8Ifthedifferencelayerisn’tthesamesizeasthesourcelayer,chooseoneofthefollowingcontrolsfromtheIfLayer
Sizes Differ menu:
Center Places the difference layer in the center of the source layer. If the difference layer is smaller than the source
layer, the rest of the layer fills with black.
Stretch To Fit Stretches or shrinks the difference layer to the size of the source layer. Background images may become
distorted.
AB
C D
AFTER EFFECTS CS3
User Guide
445
9Adjust the Matching Tolerance slider to specify the amount of transparency based on how closely colors must
match between the layers. Lower values produce less transparency; higher values produce more transparency.
10 Adjust the Matching Softness slider to soften the edges between transparent and opaque areas. Higher values
make matched pixels more transparent but don’t increase the number of matching pixels.
11 If the matte still contains extraneous pixels, adjust the Blur Before Difference slider. This slider suppresses noise
by slightly blurring both layers before the comparison is made. Note that the blurring occurs only for the comparison
and doesn’t blur final output.
12 Before closing the Effect Controls panel, make sure to select Final Output from the View menu to ensure that
After Effects renders the transparency.
Extract effect
The Extract effect creates transparency by keying out a specified brightness range, based on a histogram of a
specified channel. It’s best used to create transparency in an image shot against a black or white background or
against a background that is very dark or bright but consists of more than one color.
Note: The controls for this effect are similar to those of the Extract effect in Adobe Premiere Pro, but the purpose and
results of the effect are different.
This effect works with 8-bpc and 16-bpc color.
See also
“Keying overview and tips” on page 268
“Matte Choker effect” on page 450
“Simple Choker effect” on page 451
Use the Extract effect
In the Effect Controls panel, the Extract effect displays a histogram for a channel specified in the Channel menu. The
histogram displays a representation of the brightness levels in the layer, showing the relative number of pixels at each
level. From left to right, the histogram extends from the darkest (a value of 0) to the lightest (a value of 255).
Using the transparency control bar beneath the histogram, you can adjust the range of pixels that are made trans-
parent. The position and shape of the bar in relation to the histogram determine transparency. Pixels corresponding
to the area covered by the bar remain opaque; pixels corresponding to the areas not covered by the bar are made
transparent.
1Select the layer you want to make transparent, and then choose Effect > Keying > Extract.
2If you are keying out bright or dark areas, choose Luminance from the Channel menu. To create visual effects,
choose Red, Green, Blue, or Alpha.
3Adjust the amount of transparency by dragging the transparency control bar in the following ways:
•Drag the upper right or upper left selection handles to adjust the length of the bar and to shorten or lengthen the
transparency range. You can also adjust the length by moving the White Point and Black Point sliders. Values
above the white point and below the black point are made transparent.
•Dragthelowerrightorlowerleftselectionhandlestotaperthebar.Taperingthebarontheleftaffectsthesoftness
of transparency in the darker areas of the image; tapering it on the right affects the softness in the lighter areas.
You can also adjust the softness levels by adjusting White Softness (lighter areas) and Black Softness (darker areas).
AFTER EFFECTS CS3
User Guide
446
Note: To taper the edges of the transparency control bar, you must first shorten the transparency bar.
•Drag the entire bar left or right to position it under the histogram.
Inner/Outer Key effect
The Inner/Outer Key effect isolates a foreground object from its background.
This effect works with 8-bpc and 16-bpc color.
See also
“Keying overview and tips” on page 268
Use the Inner/Outer Key effect
To use the Inner/Outer key, create a mask to define the inside and outside edge of the object you want to isolate. The
mask can be fairly rough—it doesn’t need to fit exactly around the edges of the object.
In addition to masking a soft-edged object from its background, Inner/Outer Key modifies the colors around the
border to remove contaminating background colors. This color decontamination process determines the
background's contribution to the color in each border pixel, and then removes that contribution—thus removing the
halo that can appear if a soft-edged object is matted against a new background.
1Select the border of the object that you want to extract by doing one of the following:
•Draw a single closed mask near the object's border; then select the mask from the Foreground menu and leave the
Background menu set to None. Adjust the Single Mask Highlight Radius to control the size of the border around
this mask. (This method works well only on objects with simple edges.)
•Drawtwoclosedmasks:aninnermaskjustinsidetheobject,andanoutermaskjustoutsidetheobject.Makesure
that any fuzzy or uncertain areas of the object lie within these two masks. Select the inner mask from the
Foreground menu and the outer mask from the Background menu.
Note: Make sure that the mask mode for all masks is set to None.
2If you want, move the masks around to find the location that provides the best results.
3Toextractmorethanoneobject,ortocreateaholeinanobject,drawadditionalmasksandthenselectthemfrom
the Additional Foreground and Additional Background menus. For example, to key out a woman’s hair blowing in
the wind against a blue sky, draw the inner mask inside her head, draw the outer mask around the outside edge of
her hair, and then draw an additional mask around the gap in her hair where you can see sky. Select the additional
mask from the Additional Foreground menu to extract the gap and remove the background image.
4Create additional open or closed masks to clean up other areas of the image, and then select them from the
Cleanup Foreground or Cleanup Background menu. Cleanup Foreground masks increase the opacity along the
mask; Cleanup Background masks decrease the opacity along the mask. Use the Brush Radius and Brush Pressure
options to control the size and density of each stroke.
Note: You can select the Background (outer) mask as a Cleanup Background mask to clean up noise from the
background portions of the image.
5Set Edge Thin to specify how much of the matte’s border is affected by the key. A positive value moves the edge
away from the transparent region, increasing the transparent area; a negative value moves the edge toward the trans-
parent region and increases the size of the foreground area.
6Increase the Edge Feather values to soften edges of the keyed area. High Edge Feather values take longer to render.
AFTER EFFECTS CS3
User Guide
447
7Specify the Edge Threshold, which is a soft cutoff for removing low-opacity pixels that can cause unwanted noise
in the image background.
8Select Invert Extraction to reverse the foreground and background regions.
9Set Blend With Original to specify the degree to which the resulting extracted image blends with the original
image.
Linear Color Key effect
Linear keys create a range of transparency across an image. A linear key compares each pixel in the image to the key
color you specify. If the color of a pixel closely matches the key color, it becomes completely transparent. Pixels that
don’t match as well are made less transparent, and pixels that don’t match at all remain opaque. The range of trans-
parency values, therefore, forms a linear progression.
The Linear Color Key effect uses RGB, hue, or chroma information to create transparency from a specified key color.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
See also
“Keying overview and tips” on page 268
“Matte Choker effect” on page 450
“Simple Choker effect” on page 451
Apply the Linear Color Key effect
In the Effect Controls panel, the Linear Color Key effect displays two thumbnail images; the left thumbnail image repre-
sentstheunalteredsourceimage,andtherightthumbnailimagerepresentstheviewyou’veselectedintheViewmenu.
You can adjust the key color, the matching tolerance, and the matching softness. The matching tolerance specifies
how closely pixels must match the key color before they start becoming transparent. The matching softness controls
the softness of edges between the image and the key color.
You can also reapply this key to preserve a color that was made transparent by the first application of the key. For
example, if you key out a medium-blue screen, you might lose some or all of a light-blue piece of clothing your
subjectiswearing.Youcanbringbackthelight-bluecolorbyapplyinganotherinstanceoftheLinearColorKeyand
choosing Keep This Color from the Key Operation menu.
1Select a layer as the source layer, and then choose Effect > Keying > Linear Color Key.
2In the Effect Controls panel, choose Key Colors from the Key Operation menu.
3ChooseacolorspacefromtheMatchColorsmenu.Inmostcases,usethedefaultRGBsetting.Ifyouhavetrouble
isolating the subject using one color space, try using a different color space.
4IntheEffectControlspanel,chooseFinalOutputfromtheViewmenu.Theviewyouchooseappearsintheright
thumbnail and in the Composition panel. If you need to see other results, work in one of the other views:
Source Only Shows the original image without the key applied.
Matte Only Shows the alpha channel matte. Use this view to check for holes in the transparency. To fill undesired
holes after you complete the keying process, see “Close a hole in a matte” on page 271.
AFTER EFFECTS CS3
User Guide
448
5Select a key color in one of the following ways:
•Select the Thumbnail eyedropper, and then click an appropriate area in the Composition panel or the original
thumbnail image.
•Select the Key Color eyedropper, and then click an appropriate area in the Composition or Layer panel.
•To preview transparency for different colors, select the Key Color eyedropper, hold down the Alt key (Windows)
or Option key (Mac OS), and move the cursor to different areas in the Composition panel or the original
thumbnail image. The transparency of the image in the Composition panel changes as you move the cursor over
different colors or shades. Click to select the color.
•Click the Key Color swatch to select a color from the specified color space. The selected color becomes trans-
parent.
Note: The eyedropper tools move the sliders accordingly. Use the sliders in steps 6 and 7 to fine-tune the keying results.
To use eyedroppers in the Layer panel, choose Linear Color Key from the View menu in the Layer panel.
6Adjust matching tolerance in one of the following ways:
•Select the Plus (+) or the Minus (-) eyedropper, and then click a color in the left thumbnail image. The Plus
eyedropper adds the specified color to the key color range, increasing the matching tolerance and the level of
transparency. The Minus eyedropper subtracts the specified color from the key color range, decreasing the
matching tolerance and the level of transparency.
•Drag the matching tolerance slider. A value of 0 makes the entire image opaque; a value of 100 makes the entire
image transparent.
7Drag the Matching Softness slider to soften the matching tolerance by tapering the tolerance value. Typically,
values under 20% produce the best results.
8Before closing the Effect Controls panel, make sure to select Final Output from the View menu to ensure that After
Effects renders the transparency.
Preserve a color after applying Linear Color Key
1In the Effect Controls panel or Timeline panel, turn off any current instances of keys or matte effects by
deselecting the Effect option to the left of the key name or tool name. Deselecting the option causes the original
image to appear in the Composition panel so that you can select a color to preserve.
2Choose Effect > Keying > Linear Color Key. A second set of Linear Color Key controls appears in the Effect
Controls panel below the first set.
3In the Effect Controls panel, choose Keep Colors from the Key Operation menu.
4Select the color you want to keep.
5In the first application of the Linear Color Key effect, choose Final Output from the View menu in the Effect
Controls panel, and then turn other instances of the Linear Color Key effect back on to examine the transparency.
You may need to adjust colors or reapply the key a third time to get the results you need.
Luma Key effect
The Luma Key effect keys out all the regions of a layer with a specified luminance or brightness. The layer’s quality
setting doesn’t influence the Luma Key effect.
Use this effect if the object from which you want to create a matte has a greatly different luminance value than its
background. For example, if you want to create a matte for musical notes on a white background, you can key out
the brighter values; the dark musical notes become the only opaque areas.
AFTER EFFECTS CS3
User Guide
449
This effect works with 8-bpc and 16-bpc color.
White background of original (top left and bottom left) is removed using Luma Key and composited over underlying layer (bottom right).
See also
“Keying overview and tips” on page 268
“Matte Choker effect” on page 450
“Simple Choker effect” on page 451
Key out a luminance value with the Luma Key effect
1Select the layer, and choose Effect > Keying > Luma Key.
2Select a Key Type to specify the range to be keyed out.
3
DragtheThresholdsliderintheEffectControlspaneltosettheluminancevalueyouwantthemattetobebasedon.
4Drag the Tolerance slider to specify the range of values to be keyed out. Lower values key out a smaller range of
values near the threshold. Higher values key out a wider range of values.
5Drag the Edge Thin slider to adjust the width of the keyed area’s border. Positive values make the mask grow,
increasing the transparent area. Negative values shrink the mask.
6Drag the Edge Feather slider to specify the softness of the edge. Higher values create a softer edge but take longer
to render.
Spill Suppressor effect
The Spill Suppressor effect removes traces of the key color from an image with a screen that’s already been keyed out.
Typically, the Spill Suppressor is used to remove key color spills from the edges of an image. Spills are caused by light
reflecting off the screen and onto the subject.
If you’re not satisfied with the results from using the Spill Suppressor, try applying the Hue/Saturation effect to a layer
after keying, and then decrease the saturation value to de-emphasize the key color. (See “Hue/Saturation effect” on
page 398.)
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
450
Original greenscreen (top left) leaves green glow when keyed out (bottom left). Spill Suppressor removes glow (bottom right).
See also
“Keying overview and tips” on page 268
“Matte Choker effect” on page 450
“Simple Choker effect” on page 451
Use the Spill Suppressor effect
1Select the layer and choose Effect > Keying > Spill Suppressor.
2Choose the color you want to suppress in one of the following ways:
•If you already keyed out the color with a key in the Effect Controls panel, click the Color To Suppress eyedropper,
and then click the screen color in the key’s Key Color swatch.
•In Spill Suppressor, click the Key Color swatch and choose a color from the color wheel.
Note: To use the eyedropper in the Layer panel, choose Spill Suppressor from the View menu in the Layer panel.
3From the Color Accuracy menu, choose Faster to suppress blue, green, or red. Choose Better to suppress other
colors, because After Effects may need to analyze the colors more carefully to produce accurate transparency. The
Better option may increase rendering time.
4Drag the Suppression slider until the color is adequately suppressed.
Matte effects
Matte Choker effect
The Matte Choker effect repeats a sequence of choking and spreading the matte to fill undesired holes (transparent
areas) in opaque regions. The repetition is necessary because the entire matte must be choked and spread; the
spreading fills the hole, but the edges of the matte must be choked back to preserve the matte shape.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
451
Original (top left) shows areas of unwanted transparency after using Color Key (bottom left) that are removed with Matte Choker (bottom
right).
See also
“Keying overview and tips” on page 268
“Close a hole in a matte” on page 271
Simple Choker effect
The Simple Choker effect shrinks or expands the edges of a matte in small increments to create a cleaner matte. The
Final Output view displays the image with the effect applied, and the Matte view provides a black-and-white view of
the image with black areas indicating transparency and white areas indicating opacity. Choke Matte sets the amount
of choke. Negative values spread the matte; positive values choke it.
This effect works with 8-bpc and 16-bpc color.
Original (top left) contains unwanted edges after keying (bottom left) that are removed with Simple Choker (bottom right).
See also
“Keying overview and tips” on page 268
AFTER EFFECTS CS3
User Guide
452
Noise & Grain effects
Work with Grain effects
Almost every digital image captured from the real world contains grain or visual noise caused by the recording,
encoding, scanning, or reproduction processes and by the equipment used to create the image. Examples include the
faint static of analog video, compression artifacts from digital cameras, halftone patterns from scanned prints, CCD
noise from digital image sensors, and the characteristic speckle pattern of chemical photography, known as film
grain.
Noise isn’t necessarily bad; it’s often added to images to create a mood or tie elements together, such as adding film
grain to a computer-generated object to integrate it into a photographed scene. However, noise can be unwanted for
aesthetic reasons. Archival footage or high-speed photography may appear unpleasantly grainy; digital compression
artifactsorhalftonepatternsmaymaranimage;ornoisemayinterferewithtechnicalprocessessuchasbluescreen
compositing.
There are also technical reasons to reduce noise. For example, compression algorithms usually achieve smaller file
sizes if the input material is less noisy, so noise reduction is a valuable preprocessing step for work such as DVD
creation and video streaming.
The Add Grain, Match Grain, and Remove Grain effects allow you to manipulate grain that appears more or less
evenly over an entire image. Grain effects can’t correct image problems that affect only a few pixels, such as dust, salt
and pepper noise, or analog video dropouts.
The Add Grain effect generates new grain from nothing; it doesn’t take samples from existing grain. Instead, a
number of parameters and presets for different types of film can be used to synthesize different types of grain.
The Remove Grain and Match Grain effects use a two-step process to manipulate grain without affecting the edges,
sharpness, or highlights of an image. First, the grain is sampled, either automatically or manually; second, the grain
is analyzed and portrayed by a mathematical model, which the effect uses to add, remove, or match the grain.
Three types of grain effects: matching (top left), adding (bottom left), and removing (bottom right)
RE:Vision Effects provides the DE:Noise plug-in for removing noise and grain from images:
www.adobe.com/go/learn_ae_revisionfxdenoise.
Neat Video provides the Reduce Noise plug-in for removing noise from digital video:
www.adobe.com/go/learn_ae_neatvideoreducenoise.
AFTER EFFECTS CS3
User Guide
453
Apply a grain effect
Each grain effect is applied with default settings and is displayed in Preview viewing mode, which has a preview
region framed by a white border and centered on the image. The preview region displays the results of the grain effect
on just a portion of your image, for speed and comparison purposes. The grain effects are almost fully automatic but
also offer many controls to achieve precise results. You can also selectively apply the grain effects to portions of your
image using the extensive Blend With Original features provided with each effect.
1Select the layer you want to affect.
2Choose Effect > Noise & Grain > [effect].
3Choose a viewing method from the Viewing Mode control in the Effect Controls panel:
Preview Displays the current settings of the applied effect in a 200x200-pixel area.
Blending Matte Shows the current color matte or mask, or the combination of both, which results from the current
settings of the Blend With Original controls group.
Final Output Renders the full active frame, using the current settings of the effect.
4Adjust the effect’s controls in the Effect Controls panel.
The preview region in the Composition panel reflects any changes you make.
5Choose Final Output from the Viewing Mode control.
Apply a grain effect to a selected area
The Blend With Original controls group lets you precisely apply a grain effect to a particular area of an image or
sequence by masking and matting the desired area. You can choose between two selection techniques or use a combi-
nation of both:
Color Matching Excludes any area of the image that matches a selected color. By inverting the matte, you can also
selectively process such an area.
Masking Layer Uses any layer in the current composition as a mask to selectively process or exclude an area of the
current layer or track.
When any grain effect is first applied, the Amount value of the Blend With Original controls group is set to 0%; this
value determines the percentage of blending between the original image and the processed version. At 0%, no
blending occurs and the selected effect is applied to the entire image at full strength; at 100%, white areas of the
blending matte are unchanged from the original image.
Any mask or matte works in a similar way: The white pixels in it exclude that area of the original image from
processing by the grain effect; the black pixels process normally. At 100% Amount, the white areas fully blend with
the original so that they are completely excluded from the processing. This behavior remains true when the match
is inverted. Regardless of the Amount value, the black areas of the matte or mask are always processed. The Amount
slider affects only the areas under the white pixels in the matte or mask. It affects only how the white areas of the
matte or mask are treated by each grain effect.
1Apply a grain effect to the image.
2Do any of the following in the Effect Controls panel:
•Tocreateamattearoundtheareatowhichyouwanttoapplyorexcludethegraineffect,usetheColorMatching
controls in the Blend With Original controls group.
•To mask the current layer with another layer or track, use the Masking Layer controls.
AFTER EFFECTS CS3
User Guide
454
3Adjust the Blur Matte value to soften the matte and to produce a softer transition between the affected and
unaffected areas of the image.
4If you’re using both a color matte and a layer mask, choose one of the following from the Combine Match And
Mask Using menu:
Screen Makes the matte white wherever either the mask or the color match is white.
Multiply Makes the matte white where both of the inputs are white.
5Reduce the Amount value to let more of the original image show through the grain.
6Choose Final Output from the Viewing Mode control.
Generate a color-matching matte
When a grain effect is first applied, a neutral gray color is used to generate a default color-matching matte, so that in
most images a visible matte appears. The Color Matching group of controls uses color matching to precisely define
amatte.Thematteisolatesportionsoftheimagewherethelayerthatusesthegraineffectisblendedwiththeinput.
1Apply a grain effect to the image.
2To select a color to exclude from or restrict to the effect, do one of the following adjacent to the Matching Color
control in the Blend With Original and Color Matching controls groups:
•Click the color swatch and select a color in the Color Picker dialog box.
•Click the eyedropper and click a color anywhere on-screen.
3Do one of the following:
•To prevent the grain effect from affecting the selected color, make sure that the Invert Match control is deselected.
•To restrict the grain effect to the selected color, leaving the rest of the image unaffected, select Invert Match.
4Ifyouwanttoexcludecolorsthataresimilartothematchingcolor,increasetheMatchingTolerancevalue,which
sets a threshold for color matching. As the value increases, the matte includes pixels with colors increasingly different
from the matching color.
5Choose an option from the Match Color Using control if you want to change the default criterion (RGB) used to
determine that a color is similar to the matching color.
6Adjust the Matching Softness controls to determine the width of the transition band between completely matched
and completely unmatched pixels or how smoothly the affected areas blend with the original image.
7Select Invert Match if you want to invert the matte so that the white areas become black and the black areas
becomewhite.(Thematchingcolorwillbeblackinthematteandwillbeprocessedbythegraineffectregardlessof
the Amount setting. The inversion doesn’t affect any other settings.)
8If you’re using both a color matte and a layer mask, choose one of the following from the Combine Match And
Mask Using menu:
Screen Makes the matte white wherever either the mask or the color match is white.
Multiply Makes the matte white where both of the inputs are white.
9Choose Final Output from the Viewing Mode control.
AFTER EFFECTS CS3
User Guide
455
Generate a layer matte
In some cases, you may want to use a different layer or track as a mask for the layer that uses a grain effect. This type
of mask allows unlimited control over exactly which parts of an image are modified and by how much.
1Apply a grain effect to the image.
2In the Effect Controls panel, choose the layer that you want to use as a mask from the Mask Layer control in the
Blend With Original and Masking Layer controls groups.
3Choose a masking mode from one of the standard track matte mode options.
4If the masking layer is a different size than the current layer, choose one of the following from the If Mask Size
Differs pop-up menu in the Masking Layer controls:
Center Centers the masking layer over the current layer.
Stretch To Fit Resizes the masking layer to match the dimensions of the current layer.
5If you’re using both a color matte and a layer mask, choose one of the following from the Combine Match And
Mask Using menu:
Screen Makes the matte white wherever either the mask or the color match is white.
Multiply Makes the matte white where both of the inputs are white.
6Choose Final Output from the Viewing Mode control.
Change the preview region
You can use the Preview Region controls group to change the position or the size of a grain effect’s preview region.
Because adding or removing grain can affect sharpness of detail, you may want to preview an area of fine detail, such
as a human face or some text. When you remove grain with the Remove Grain effect, a best practice is to preview an
area where the grain is most clearly visible or most objectionable, such as a large expanse of solid color.
You’ll achieve the best results by experimenting, applying small increments to each of several controls in the Effect
Controls panel, and viewing the results in the Composition panel after every adjustment.
1After applying a grain effect, click the Center button in the Preview Region group of controls in the Effect
Controls panel.
A cross hair is centered in the Composition panel.
2In the image, click the desired center of the preview region.
The preview region redraws, centered in the new position.
3Tochangethedimensionsofthepreviewregion,changetheWidthandHeightvaluesintheEffectControlspanel
to the desired size, in pixels. (Larger preview regions can result in slower rendering.)
4Select Show Box if you want to outline the preview region in color. If you want to change the outline color, next
to Box Color do one of the following:
•Click the color swatch and select a color in the Color Picker dialog box.
•Click the eyedropper button, and click a color anywhere on-screen.
5View the results:
•To view the fine detail of the noise structure, zoom into the preview region.
•To examine the noise in each channel independently, click the corresponding color channel icon in the Compo-
sition panel.
AFTER EFFECTS CS3
User Guide
456
•To increase the effect’s interaction speed and RAM preview duration, use the Region Of Interest feature in the
Composition panel to reduce the area that’s processed. (See “Work with the region of interest” on page 111.)
•To retain an image of the current frame in its current state, click Take Snapshot in the Composition panel. You
can subsequently click and hold down Show Last Snapshot to view the most recent snapshot instead of the
active composition, and to toggle between the current and previous states of the preview region. This technique
is extremely useful for evaluating subtle adjustments. (See “Work with snapshots” on page 125.)
•Tocomparethepreviewregionwithandwithoutthegraineffect,clicktheEffectswitch(smallficon) next to the
grain effect’s name in the Effect Controls panel to temporarily disable the effect. Click Take Snapshot in the
Composition panel, click the Effect switch again to re-enable the effect, and then click and hold down Show Last
Snapshot to display the snapshot of the image without the effect.
Work with noise samples in Grain effects
Noise sampling is the first and most important step in removing noise from an image or in matching the noise of one
image in another image. Normally, this process is entirely automatic. For very fine control, you can switch to Manual
mode and adjust the samples using the Sampling controls group in the Effect Controls panel.
A noise sample should be a solid block of uniform color that clearly displays the noise pattern present in the image.
The objective is to extract samples of pure noise, without any image features that the algorithm could misconstrue
as grain. For instance, extract samples from a piece of sky, a background wall, or an area of fleshtone. All samples
should be selected from the normal range of the film, DV, or video stock. Avoid underexposed or overexposed areas
lacking in information, especially areas where pixel values have been clipped to pure black or white. Within this
normal exposure range, it’s best to select samples with various RGB values and colors—for example, one sample from
a bright area, one from a dark area, and one from an area with midtones.
The number of samples in automatic mode is high to ensure that the algorithm has enough good noise data, even if
finding good samples in a particular image is difficult. In addition, automatic mode may override the number of
samples you’ve set if the effect can’t find enough good samples. You can vary the size of the samples in either
automatic or manual mode; however, increasing sample size doesn’t guarantee better results, especially if the
resulting samples include more substantial variations in RGB values. Sample size should be reduced if a particular
image doesn’t contain sufficiently large areas of constant color values. Conversely, increasing the sample size may
give better results if the image contains large featureless areas.
Manually reposition noise samples
Automatic grain or sample selection generally gives acceptable results for the Match Grain or Remove Grain effect,
butyoucanchoosetomanuallypositionandresizeeachsampleorchangethesamplenumber.Forexample,youmay
want to reposition samples if the automatic sampling selected a uniform area that is underexposed or overexposed
and that lacks information about grain structure.
Noise samples for the Match Grain and Remove Grain effects are always extracted from the source layer without
regarding any effects or masks already applied to the layer; this method results in more accurate sampling. If you
want the samples to include the existing effects, you must precompose or prerender the source layer with the effects
and then apply the grain effect to the resulting source layer.
Avoid sample areas with the following characteristics: sharp edges, color gradients, highlights, textures such as grass
or water ripples, fine detail such as hair or tree leaves, and overexposed or underexposed areas lacking in infor-
mation.
1In the Effect Controls panel, choose Noise Samples from the Viewing Mode menu.
The samples appear as small white squares (24 x 24 pixels) overlaid on the source image.
AFTER EFFECTS CS3
User Guide
457
2Choose Manual from the Sample Selection pop-up menu in the Sampling controls group.
3To remove the least desirable samples from the image, try reducing the Number Of Samples value.
4To move a noise sample, do one of the following:
•Click the point parameter for the noise sample in the Noise Sample Points controls group. A cross hair
appears in the composition, centered on that sample. Click the desired location in the Composition panel to place
the sample.
•Using the Selection tool , drag the sample point in the Composition panel to the desired location.
•Enter the desired horizontal and vertical coordinates in the Effect Controls panel.
Note: The number of sample points that are enabled corresponds to the current value of the Number Of Samples.
5Repeat for each sample point you want to move.
Change the sampling source frame
By default, the Remove Grain and Match Grain effects take noise samples from the first frame of the sequence, but
you can choose to sample the noise from a different frame. Changing the frame might be useful if large lighting or
exposure variations occur between frames within the sequence.
1Decide which frame you want to sample; make sure that the project settings Display Style is set to Frames,
numbering from zero. The number of the current frame then appears in blue in the top left corner of the Timeline
panel. Enter that frame number as the Source Frame value in the Sampling controls group.
2Choose Noise Samples from the Viewing Mode menu.
The selected frame appears in the Composition panel, and its automatic samples appear on the image.
Change the noise sample box color
You can set the Remove Grain or Match Grain effect’s viewing mode to Noise Samples to see the areas sampled by
the effect. Sampled areas are automatically framed with a white outline. If you prefer, you can change the color of
these noise sample boxes.
❖Next to the Sample Box Color control in the Sampling controls group, do one of the following:
•Click the color swatch, and select a color in the Color Picker.
•Click the eyedropper, and click a color anywhere in the application window.
Working with added or matched grain
The Add Grain effect creates new grain or noise in an image by building the grain from nothing or by basing the
grain’s properties on presets. The Match Grain effect also creates new grain in an image but by matching the grain in
a different image. Both effects share several controls in the Effect Controls panel that let you control the new grain’s
color, tonal range, blending mode, and animation properties.
Adjusting the tones of added or matched grain
The precise grain pattern present in any frame of film isn’t uniform throughout the frame but may depend on the
tonal values of the content at each pixel. For example, in chemical film grain, the sizes of the silver halide crystals
actually vary with the exposure level.
AFTER EFFECTS CS3
User Guide
458
The Add Grain and Match Grain effects let you reproduce these subtle changes in grain patterns across areas of an
image or a sequence by using the Shadows, Midtones, Highlights, and Midpoint controls in the Application controls
group. These controls let you define how much grain is added to each tonal area and also to each channel in the
image. For example, you can add more grain to overexposed areas of the blue channel to give an image of sky a
grainier look.
You can use the Application controls group for the Add Grain or Match Grain effect to do the following:
•To define how much grain is added to each tonal area in an image, adjust the Shadows, Midtones, and Highlights
values.
•To define the midpoint of the image’s tonal range for grain application purposes, adjust the Midpoint slider. By
default, this slider is centered at 0.5, which represents the middle of the range of pixel values—127 for 8-bpc images
and 16384 for 16-bpc images.
•For even finer control, use the Channel Balance controls to adjust the grain in the shadow, midtone, and highlight
areas independently for each channel.
Animating added or matched grain
By default, the grain or noise generated by the Add Grain and Match Grain effects moves at the same speed as the
source material to accurately simulate realistic noise. Slowing down the noise processes may be useful for aesthetic
effect or to keep the added noise from buzzing and drawing attention to itself. These effects have an internal
randomizer that changes the positions of the noise pixels between frames. But you can also change the appearance
of the noise between layers on the same frame while keeping every other parameter constant.
You can use the Animation controls group for the Add Grain or Match Grain effect to do the following:
•To determine the frame rate of the added grain, as a multiple of the destination frame rate, adjust the Animation
SpeedvalueintheAnimationcontrolsgroupintheEffectControlspanel.Atthedefault1,thenoisemovesatthe
same rate as the frames. At zero, the noise is stationary over time.
•To use interpolation to create smooth transitions between the generated noise frames, select Animate Smoothly.
This control matters only if Animation Speed is less than 1.
•To change the appearance of the noise between layers on the same frame, adjust the Random Seed value. Each
Random Seed value represents one of 100 possible variations in the appearance; changing the value doesn’t make
the results more or less random.
Blending and adjusting the color of added or matched grain
You can adjust the color, saturation, and blending behavior of the grain generated by the Add Grain or Match Grain
effect.
Several factors can affect the apparent color of the grain that these effects generate, including the following:
•The color value of the underlying pixel in the source image.
•The Saturation value of the noise.
•The Tint Color and Tint Amount values, if you have modified these from the defaults.
•The Blending Mode value in the Application controls group.
•The amount of noise applied, if any, to each channel individually using the Channel Intensities controls group.
AFTER EFFECTS CS3
User Guide
459
Using the Color controls group in the Effect Controls panel, you can adjust any of the following:
Monochromatic Givestheaddednoiseasingletint.Bydefault,thetonesareblackandwhite,butyoucanchangethe
Tint Color to make it a gradient of any color. (The Saturation and Channel Intensities controls aren’t available if
Monochromatic is selected.)
Tint Amount Controls the depth and intensity of the color shift.
Tint Color Controls the color the added noise shifts toward.
Saturation Controls the amount and vividness of the color.
The Blending Mode in the Application controls determines how the color value of the generated noise combines with
the color value of the underlying source layer at each pixel:
Film Makes the generated grain appear embedded in the image. This mode affects darker colors more than lighter
ones, just as the grain in a film negative appears.
Multiply Multiplies the color values of the noise and the source. However, the result may be either lighter or darker
than the original, because the noise may have either a positive or negative value.
Add Combines the color values of the pixel in the source with the noise. However, the result isn’t always lighter than
the original because the noise created by grain effects can have either a positive or negative value.
Screen Multiplies the inverse brightness values of the noise and the source. The effect is like printing from a multiple
exposure on a negative. The result is always brighter than the original.
Overlay Combines the behavior of Film and Multiply: Both shadows and highlights get less grain, while midtones
get a full application of grain.
Add Grain effect
The Add Grain effect generates new noise from nothing and does not take samples from existing noise. Instead, a
number of parameters and presets for different types of film can be used to synthesize many different types of noise
or grain. You can modify virtually every characteristic of this noise, control its color, apply it to the image in several
ways, even animate it or apply it selectively to only a part of your image.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
The distribution of the added noise over the color channels does affect the overall color of the resulting image. With
a dark background, the noise tends to add to the image visually, so a red tint or more noise in the red channel gives
a reddish hue to the image. With a bright background, the noise tends to subtract from the image visually, so a red
tint or more noise in the red channel gives a cyan color. The result also depends on the Blending Mode control in the
Application controls group.
Note: The actual grain of your image may vary from the film presets, because of factors such as exposure and scanning
resolution.
AFTER EFFECTS CS3
User Guide
460
You can use the Add Grain effect’s controls to do the following:
•To reproduce the grain of a particular film or photographic stock, choose the film type from the Add Grain effect’s
Preset menu in the Effect Controls panel.
•To adjust the intensity and size of the applied grain and introduce a blur, adjust the Tweaking controls group for
the Add Grain effect in the Effect Controls panel.
•To modify the color of the added noise, adjust the Color controls.
•To define how the color value of the generated noise combines with the color value of the underlying destination
layer at each pixel, choose a Blending Mode in the Application controls group.
•To define how much grain is added to each tonal area in your image and the midpoint, adjust the Shadows,
Midtones, Highlights and Midpoint values in the Application controls group.
•To animate the added grain, adjust the properties in the Animation controls group.
•To apply the effect to the entire image, choose Final Output from the Viewing Mode menu.
Tweaking controls for Grain effects
The Match Grain and Add Grain effects share a group of Tweaking controls. You can use these controls to modify
the intensity and size of the noise and to introduce a blur, all of which can be done across the three channels or
individually for each channel. You can also change the aspect ratio of the applied grain.
Note: ThevaluesoftheTweakingcontrolsarerelativetothenoisesampledinthesourcelayer:avalueof1.0leavesthat
property of the source noise unchanged, while higher and lower values alter the applied noise.
Adjust any of the following controls in the Tweaking controls group:
Intensity Controls the amount of variation in brightness and color strength between pixels in the generated noise,
which determines the visibility of the noise. Increasing the value does not change the position or size of each grain
but makes the grain appear to pop more; lower values give a more subtle muted appearance.
Channel Intensities Controls the contrast between pixels in the generated noise separately for each channel. For
example, you may want to add more grain to the blue channel to emulate film.
Size Adjusts the size of the generated grain in pixels.
Channel Size Adjusts the size of the generated grain in pixels independently for each channel.
Softness Sets the amount of softness in the grain.
Aspect Ratio Controls the ratio of the width of the generated grain over a constant height of 1; this is useful for
emulating the effect of anamorphic lenses or for aesthetic effects. A value higher than 1 stretches the grain horizon-
tally; values smaller than 1 squash it horizontally.
See also
“Working with added or matched grain” on page 457
Dust & Scratches effect
The Dust & Scratches effect reduces noise and defects by changing dissimilar pixels within a specified radius to be
more like their neighboring pixels. To achieve a balance between sharpness of the image and hiding defects, try
various combinations of Radius and Threshold settings.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
461
Original image with scratches (top left), enlarged view of scratches (bottom left), and scratches removed with loss of clarity (bottom right)
Radius How far the effect searches for differences among pixels. High values make the image blurry. Use the smallest
value that eliminates the defects.
Threshold How different pixels can be from their neighbors without being changed by the effect. Use the highest
value that eliminates the defects.
Fractal Noise effect
TheFractalNoiseeffectusesPerlinnoisetocreategrayscalenoisethatyoucanusefororganic-lookingbackgrounds,
displacement maps, and textures, or to simulate things like clouds, lava, or vapor.
The Evolution controls create subtle changes in the shape of the fractal noise. Animating these controls results in
smooth changes of the noise over time, creating an effect such as passing clouds or flowing water.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Stu Maschwitz provides an example project that uses the Fractal Noise effect to create the corona of the Sun:
www.adobe.com/go/learn_ae_stucorona.
Guy Chen provides an example of using the Fractal Noise effect to generate the base noise (in this case for the
turbulent surface of the Sun) and then colorizing the noise with the Colorama effect:
www.adobe.com/go/learn_ae_guyfractalsun.
Harry Frank provides an animation preset that uses Fractal Noise to create a star field:
www.adobe.com/go/learn_ae_harryfractalstars.
Controls
Fractal Type The noise is created by generating a grid of random numbers for each noise layer (where the number
of noise layers is specified by Complexity). The Fractal Type setting determines the characteristics of this grid.
Noise Type The type of interpolation to use between the random values in the noise layer’s grid.
Invert Inverts the noise. Black areas become white, and white areas become black.
Contrast The default value is 100. Higher values create larger, more sharply defined areas of black and white in the
noise, generally revealing less subtle detail. Lower values result in more areas of gray, softening or muting the noise.
Overflow Remaps color values that fall outside of the range of 0–1.0, using one of the following options:
•Clip Remaps values so that any value above 1.0 is displayed as pure white, and any value below 0 is displayed as
pure black. The Contrast value influences how much of the image falls outside of this range. Higher values result in
AFTER EFFECTS CS3
User Guide
462
a mostly black and/or white image with less gray area. Therefore, higher contrast settings display less subtle detail.
When used as a luma matte, the layer has sharper, better-defined areas of transparency.
•Soft Clamp Remaps values on an infinite curve so that all values stay in the range. This option reduces contrast
and makes noise appear gray with few areas of pure black or pure white. When used as a luma matte, the layer
contains subtle areas of transparency.
•Wrap Back Remaps triangularly, so that values above 1.0 or below 0 fall back into the range. This option reveals
subtle detail when Contrast is set above 100. When used as a luma matte, the layer reveals more detailed textured
areas of transparency.
•Allow HDR Results No remapping is performed. Values outside the range of 0-1.0 are preserved.
Transform Settings to rotate, scale, and position the noise layers. The layers appear as if they are at different depths
if you select Perspective Offset.
Complexity The number of noise layers that are combined (according to the Sub Settings) to create the fractal noise.
Increasing this number increases the apparent depth and amount of detail in the noise.
Note: Increasing Complexity results in longer rendering times. If appropriate, try reducing the Size rather than increasing
Complexity to achieve similar results and avoid longer rendering. A trick to increase apparent complexity without
increasing rendering time is to use a negative or very high Contrast or Brightness setting and choose Wrap Back for
Overflow.
Sub Settings The fractal noise is generated by combining layers of noise. The Sub Settings control how this combi-
nationoccursandhowthenoiselayers’propertiesareoffsetfromoneanother.Scalingsuccessivelayersdowncreates
finer details.
•Sub Influence How much influence each successive layer has on the combined noise. At 100%, all iterations have
the same amount of influence. At 50%, each iteration has half as much influence as the previous iteration. A value of
0% makes the effect appear exactly as if Complexity is 1.
•Sub Scaling, Rotation, and Offset The scale percentage, angle, and position of a noise layer relative to the previous
noise layer.
•Center Subscale Calculates each noise layer from the same point as the previous layer. This setting can result in
the appearance of duplicated noise layers stacked on top of each other.
Evolution Uses progressive revolutions that continue to change the image with each added revolution. This method
is unlike typical revolutions that refer to a setting on the dial control for which the result is the same for every
multiple of 360˚. For Evolution, the appearance at 0˚ is different from that at 1 revolution, which is different from
that at 2 revolutions, and so on. To return the Evolution setting to its original state (for example, to create a seamless
loop), use the Cycle Evolution option.
You can specify how much the noise evolves over a period of time by animating Evolution. The more revolutions
withinagivenamountoftime,themorerapidlythenoisechanges.LargechangesintheEvolutionvalueoverashort
period of time may result in flashing.
To create a seamless loop, use Cycle Evolution, and set Evolution keyframes at full revolutions with no degrees—
partially completed revolutions may interrupt the loop.
Evolution Options Options for Evolution.
•Cycle Evolution Creates a cycle of Evolution that loops over the set amount of time. This option forces the
Evolution state to return to its starting point, creating a smooth progressive cycle, a nonrepeating cycle, or a loop
segment.
AFTER EFFECTS CS3
User Guide
463
To ensure that a cycle completes full revolutions, choose a Cycle value that either matches or is evenly divisible by
the number of revolutions set for Evolution.
•Cycle (in Revolutions) Specifies the number of revolutions that the noise cycles through before it repeats. The
speed of these Evolution cycles is determined by the amount of time between Evolution keyframes. This option
affects only the evolution of the noise, not Transform or other controls. For example, if you view two identical states
of noise with different Size or Offset settings, they don’t appear the same.
Note: Cycle is available only if Cycle Evolution is selected.
•Random Seed Sets a unique random value from which to generate the noise. Animating the Random Seed results
in flashing from one set of noise to another (within that fractal type). For smooth transition of the noise, use the
Evolution option.
You can easily create new fractal noise animations by reusing previously created Evolution cycles and changing only
the Random Seed value. Using a new Random Seed value alters the noise pattern without disturbing the Evolution
animation.
Instead of animating Evolution over the entire composition, save rendering time by prerendering and looping one
short Evolution cycle for the duration you want.
Opacity Specifies the opacity of the noise.
Blending Mode Specifies an operation between the fractal noise and the original image. These blending modes are
identical to the ones in the Modes column in the Timeline panel, with the following three exceptions:
•None Renders the fractal noise only and does not composite on the original layer.
•Hue Rendersthefractalnoiseashuevaluesinsteadofgrayscale.TheSaturationandLightnessoftheoriginallayer
are maintained. If the original layer is grayscale, nothing happens.
•Saturation Renders the fractal noise as saturation values instead of grayscale. The Hue and Lightness of the
original layer are maintained. If the original layer is grayscale, nothing happens.
Create a seamless loop using Fractal Noise
1Select a layer in the Timeline panel, and choose Effect > Noise & Grain > Fractal Noise.
2Set two keyframes for Evolution.
3Adjust the time between keyframes and the number of Evolution revolutions until you are satisfied with the
animation of the noise.
4Select Cycle Evolution.
5Set a value for Cycle.
The evolution completes the number of revolutions you specify for Cycle in the amount of time determined by the
distance between Evolution keyframes. Determine the Cycle value by considering how much of this cycle you need
to render before it repeats. Choose the shortest length appropriate for your project to save rendering time.
Initially,thelastframeofacycleisidenticaltothefirstframe.Tocreateaseamlessloop,skipthelastframebysetting
the Out point of the layer one frame before the last frame of the cycle:
6Move the current-time indicator to the time where the cycle completes. For example, if the Cycle is set to 2, locate
the frame when the Evolution value is 2.
Note: If you set keyframes for other Fractal Noise controls, return them to their initial settings where the cycle begins to
repeat in the timeline, or the controls don’t loop.
7Move the current-time indicator back one frame.
AFTER EFFECTS CS3
User Guide
464
8Trim the layer’s Out point at this frame.
9Prerender this layer, and import the pre-rendered movie into your project.
10 Select the imported footage item in the Project panel, and choose File > Interpret Footage. Then set Loop to the
number of loops required for the duration of the layer in the project.
Match Grain effect
The Match Grain effect matches the noise between two images. This is especially useful for compositing and in
bluescreen/greenscreen work. The Match Grain effect only adds noise and can’t remove it, so if the destination is
already noisier than the source, an exact match is not possible. In this case, you can first use the Remove Grain effect
to clean up the destination and then apply the Match Grain effect to the result to get a perfect match.
The Match Grain effect uses noise sampling as its starting point. Basically, entire frames of new noise are synthesized
to match the noise samples. You can modify the noise in many ways before the effect is applied to the new image,
such as duplicating the noise from an image but making the noise larger and redder before applying the noise to
another image.
The Match Grain effect shares some controls with the Add Grain effect. (See “Add Grain effect” on page 459.)
Note: The Match Grain effect samples the noise on the frame in the source layer that corresponds to the first frame in
the destination layer. If the source layer is not present at that frame, or if the noise samples contain transparent areas,
no noise is sampled or applied.
This effect works with 8-bpc and 16-bpc color.
Original images (left), and with effect applied (right)
See also
“Working with added or matched grain” on page 457
Match noise or grain between images
1Make sure that the source and the destination layers are in the same composition.
2Select the destination layer to which you want to add grain.
3Choose Effect > Noise & Grain > Match Grain.
4Choose a layer from the Noise Source Layer control in the Effect Controls panel to specify the source layer from
which you want to sample the grain. (The Noise Source Layer control lists only layers that are in the Timeline panel.)
AFTER EFFECTS CS3
User Guide
465
The grain is automatically sampled and applied to the preview region on the destination layer. If you need an
automatic match, you can skip the remaining steps.
5Iftherealreadyissignificantnoiseinthedestinationlayerbeforechoosinganoisesourcelayerandthiscausesa
grain mismatch, adjust the Compensate For Existing Noise slider to avoid grain build-up.
6Do any of the following:
•To adjust the intensity and size of the applied grain and to introduce a blur, adjust the Tweaking controls.
•To modify the color of the added noise, adjust the Color controls.
•To determine how the color value of the generated noise combines with the color value of the underlying desti-
nation layer at each pixel, choose a Blending Mode in the Application controls group.
•To define how much grain is added to each tonal area in your image and the midpoint, adjust the Shadows,
Midtones, Highlights, and Midpoint values in the Application controls group.
7If you want to change the effect view, choose any of the following from the Viewing Mode menu in the Effect
Controls panel:
Noise Samples Showstheareasthathavebeensampledtoextractthecurrentnoisemodel.Selectingthesourcelayer
causes it to appear in the Composition panel, with its noise sample squares displayed.
Compensation Samples Shows the noise samples that have been automatically extracted from the destination image.
Preview Displays the current settings of the applied effect in a 200x200 pixel area.
Blending Matte Shows the current color matte or mask, or the combination of both, which results from the current
settings of the Blend With Original controls group.
Final Output Renders the full active frame, using the current settings of the effect.
8Animate the added grain, if desired.
9Choose Final Output from the Viewing Mode control.
Compensate for existing noise when matching noise
If you’re trying to match the grain between images with the Match Grain effect, and your destination layer already
has its own visible grain, a grain mismatch or grain build-up may occur. To prevent these problems, the Compensate
For Existing Noise control extracts a noise model from both the source and the destination and then modifies the
noisefromthesourcetoaccountforthenoisealreadypresentinthedestination,beforeapplyingittothedestination.
To use this control automatically, simply set the Compensate For Existing Noise slider to 100%. You can then view
the noise samples in the destination layer by choosing Compensation Samples in the Viewing Mode menu. You can
also reposition the samples in the destination image by setting Sampling Mode to Manual. This makes the Compen-
sation Sample Points available for manual repositioning.
1Apply the Match Grain effect to the destination layer.
2In the Effect Controls panel, adjust the Compensate For Existing Noise value under the Match Grain effect as
needed. The noise in the source layer and the noise in the destination layer are sampled, and their difference is calcu-
lated, so that only enough noise to match the destination layer to the source layer is applied to the destination.
3To modify the noise samples, choose Noise Samples from the Viewing Mode menu, change the Sampling >
Sample Selection control to Manual, and then expand the Compensation Sample Points. The current value of
Number Of Samples determines how many points are available.
4To reposition each sample point, do any of the following:
•Drag each sample point in the Composition panel to a new location.
AFTER EFFECTS CS3
User Guide
466
•Enter new x and y coordinates adjacent to the sample point under the Compensation Sample Points controls in
the Effect Controls panel.
•Click a Compensation Sample Point’s point parameter in the Effect Controls panel, and then click where you
want to move the point in the Composition panel.
5Choose Final Output from the Viewing Mode control.
Median effect
The Median effect replaces each pixel with a pixel that has the median color value of neighboring pixels with the
specified Radius. At low Radius values, this effect is useful for reducing some types of noise. At higher Radius values,
this effect gives an image a painterly appearance.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Noise effect
The Noise effect randomly changes pixel values throughout the image.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with effect applied (right)
Amount Of Noise The amount of noise to add.
Noise Type Use Color Noise adds random values to the red, green, and blue channels individually. Otherwise, the
same random value is added to all channels for each pixel.
Clipping Clips color channel values. Deselecting this option causes more apparent noise. This control does not work
in a 32-bpc project.
Noise Alpha effect
The Noise Alpha effect adds noise to the alpha channel.
This effect works with 8-bpc color.
Noise The type of noise. Unique Random creates equal amounts of black and white noise. Squared Random creates
high-contrast noise. Uniform Animation creates animated noise, and Squared Animation creates animated high-
contrast noise.
AFTER EFFECTS CS3
User Guide
467
Amount The magnitude of the noise.
Original Alpha How to apply the noise to the alpha channel:
•Add Produces equal amounts of noise in the transparent and opaque areas of the clip.
•Clamp Produces noise in the opaque areas only.
•Scale Increases the amount of noise proportionate to the level of opacity and produces no noise in 100% trans-
parent areas.
•Edges Produces noise only in partially transparent areas, such as the edge of the alpha channel.
Overflow How the effect remaps values that fall outside the grayscale range of 0-255:
•Clip Values above 255 are mapped to 255. Values below 0 are mapped to 0.
•Wrap Back Values above 255 or below 0 are reflected back into the 0-255 range. For example, a value of 258
(255+3) is reflected to 252 (255-3), and a value of -3 is reflected to 3.
•Wrap Values above 255 and below 0 are wrapped back around into the 0-255 range. For example, a value of 258
wraps around to 2, a value of 256 wraps around to 0, and a value of -3 wraps around to 253.
Random Seed An input value to the random number generator for the noise. This control is active only if you choose
Uniform Random or Squared Random.
To produce flashing noise, animate the Random Seed control. To create smoothly animated noise, animate the Noise
Phase value.
Noise Phase Specifies the placement of noise. This control is active only if you choose Uniform Animation or
Squared Animation.
Noise Options (Animation) How noise is animated.
•Cycle Noise Produces a cycle of noise that plays through once in the specified amount of time.
•Cycle Specifies the numbers of revolutions of the Noise Phase that the noise cycles through before it repeats
(available only when Cycle Noise is selected).
Alter the timing of the Noise Phase keyframes to adjust the speed of the Noise Phase cycles.
To save time animating the Noise Phase value, use the Cycle Noise option to create a seamless noise loop. Then,
render the layer, and reimport it as a new source footage item.
Noise HLS effect and Noise HLS Auto effect
The Noise HLS and Noise HLS Auto effects add noise to the hue, lightness, and saturation components of an image.
The noise generated by the Noise HLS Auto effect is automatically animated noise; you choose the speed of the
animation. To animate the Noise HLS effect, you must use keyframes or expressions. Controls for these effects are
the same except for the Noise Phase or Noise Animation Speed control, which controls noise animation.
These effects work with 8-bpc color.
AFTER EFFECTS CS3
User Guide
468
Original (left), and with effect applied (right)
Noise The type of noise. Uniform produces uniform noise. Squared creates high-contrast noise. Grain produces
grainlike noise similar to film grain.
Hue The amount of noise added to hue values.
Lightness The amount of noise added to lightness values.
Saturation The amount of noise added to saturation values.
Grain Size This control is active only for the Grain type of noise.
Noise Phase (Noise HLS only) An input value to the random number generator for the noise. When you set
keyframes for Noise Phase, the effect cycles through the phases to create animated noise. Greater value differences
between keyframes increase the speed of the noise animation.
Noise Animation Speed (Noise HLS Auto only) The speed of the noise animation. To accelerate or decelerate the
noise animation, animate this property.
Remove Grain effect
To remove grain or visual noise, use the Remove Grain effect. This effect uses sophisticated signal processing and
statistical estimation techniques in an attempt to restore the image to how it would look without the grain or noise.
While many techniques, such as applying a mild Gaussian Blur effect or the Median effect, reduce the visibility of
noise in an image, the tradeoff is an unavoidable loss of sharpness and highlights. The Remove Grain effect, in
contrast, differentiates fine image detail from grain and noise and preserves the image detail as much as possible.
The Remove Grain effect provides several options to precisely balance the reduction in noise and the amount of
sharpness retained in the image. Additionally, the Remove Grain effect can analyze the differences between frames
to further improve noise reduction and sharpness; since this process operates over time, it is called temporal filtering.
Note: Good degraining depends on good noise sampling. The results of the automatic sampling depend on the image
content and noise type. You can also change the number, size, and position of the samples to get the best results for a
particular image.
The Temporal Filtering controls of the Remove Grain effect use a statistical algorithm to blend the current frame
with previous and next frames. These controls are particularly effective in removing compression artifacts from DV
or video footage. Because temporal filtering works on the basis of differences between frames, it is useful only for
sequences.
To properly evaluate the results of this filter, the sequence must be viewed in real time, either with a RAM preview
or by viewing a movie rendered to a file.
To increase the speed of the Remove Grain effect preview, adjust the Remove Grain controls in order in the Effect
Controls panel. Specifically, the most efficient workflow is to find effective degraining settings first and to adjust the
last three controls last.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
469
Original (left), and with effect applied (right)
Remove noise or grain from an image
1Select the layer you want to affect.
2Choose Effect > Noise & Grain > Remove Grain.
3Adjust any of the following using the Noise Reduction Settings controls group:
•To adjust the overall amount of noise in the image, adjust the Noise Reduction value.
•To adjust the amount of noise on each channel individually, adjust the Red, Green, and Blue Noise Reduction
values in the Channel Noise Reduction controls.
The blue channel often has the most pronounced grain in a chemical film-based image. Try reducing the noise in
only the blue channel to retain all image detail in the other two channels.
4Adjust the Passes value to control the maximum noise radius that can be detected:
•If your grain is large and chunky, try increasing the Passes value. A higher number of passes reduces larger-sized
noise.
•If your render time is longer than desired because your file size is large, try lowering the number of passes to
reduce the memory usage and render time.
Note: Once the optimum number of passes is applied, additional passes have no effect.
5Choose one of the following from the Mode pop-up menu:
Multichannel Degrains all channels of a color image together, which generally produces the best results on color
images. This mode takes advantage of correlations between channels to improve the accuracy of the denoising
process.
Single Channel Degrains each channel independently. Use this mode for a monochromatic image or if Multichannel
causes objectionable color artifacts.
6Adjust any of the following in the Fine Tuning controls group to improve the balance between noise reduction and
retained sharpness:
Chroma Suppression Suppresses some of the chroma from the noise to clean up the image. If the noise is very
colorful, increasing this control can help remove it. Setting the amount too high may strip some chroma from the
image itself. (Chroma Suppression has no effect on grayscale images and isn’t available if the Noise Reduction
Settings Mode is Single Channel.)
Texture Controls the amount of low-level noise that passes through to the output. This is especially useful to reduce
objectionable artifacts or to retain finely textured areas such as wood grain, brick, or the like. Lower values result in
a smoother, possibly artificial-looking result. Higher values may leave the output unchanged from the input.
Noise Size Bias Controls how the noise reduction process responds to variations in noise size within the same image.
The default value of zero treats all sizes equally. Negative values leave larger residual noise and more aggressively
remove smaller-sized grain; this leaves larger residual noise after degraining. Positive values leave smaller noise and
more aggressively remove noise of larger size.
AFTER EFFECTS CS3
User Guide
470
Clean Solid Areas Controls the extent to which adjacent pixels with low variations in value are smoothed out by the
noise reduction process. This is helpful for large areas of solid color that need to be as clean as possible. Settings that
are too high can smooth out nearly solid areas of the image, resulting in an artificial appearance.
7AdjusttheUnsharpMaskcontrolstoenhancesubtleedgedetailthatmayhavebeensuppressedbythedegraining.
8If you are applying the effect to a sequence of frames, use the Temporal Filtering controls to perform interframe
noise reduction.
9To change the effect view, choose any of the following from the Viewing Mode pop-up menu:
Noise Samples Shows the areas that have been sampled to extract the current noise model.
Preview Displays the current settings of the applied effect in a 200x200 pixel area.
Blending Matte Shows the current color matte or mask, or the combination of both, which results from the current
settings of the Blend With Original controls group.
10 Choose Final Output from the Viewing Mode control.
Add temporal filtering to a sequence
1Apply the Remove Grain effect to your image.
2PlacetheRemoveGrainpreviewregionovertheareaoftheimagethathasthemostsubtlechangesfromframeto
frame or that has the most moving image detail.
3Select Enable in the Temporal Filtering controls.
4Adjust the Amount value to 100%.
5Create a RAM preview of the sequence or render it.
6If you see unwanted streaking or blurs around moving objects, reduce the Motion Sensitivity value, and then
preview or render it again.
7Try the following techniques if you want to improve the results:
•To quickly reduce the noise of a sequence that has a lot of buzzing noise, set the Noise Reduction value to zero and
the Temporal Filtering Amount to 100%, and render the sequence.
•To speed up previews, apply temporal filtering to your sequence after all the settings for a single frame have been
adjusted.
•To retain a layer’s effects and also apply temporal filtering to it, precompose the selected layer (choose Layer >
Precompose), and then apply the Remove Grain effect to that layer.
Sharpen an image with Unsharp Mask controls
The Remove Grain effect contains Unsharp Mask controls, which increase the contrast of edges and fine details to
help restore some of the sharpness that may have been lost during the grain reduction process.
❖Do any of the following:
•Increase the Unsharp Mask controls Amount value to obtain acceptable sharpening without generating
undesirable artifacts or bringing back too much grain.
•Increase the Threshold value to remove any unwanted artifacts that resulted from the sharpening.
•Adjust the Radius to change the area over which Unsharp Mask finds details.
•AdjusttheNoiseReductionvalueuntiltheimagejustbeginstolosesharpness;thendecreasethevaluealittle,and
then apply the Unsharp Mask controls to sharpen the image.
AFTER EFFECTS CS3
User Guide
471
Paint effects
Paint effect
Apply the Paint effect using the paint tools.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
See also
“Work with paint tools and paint strokes” on page 302
Vector Paint effect
For most drawing and painting tasks, use shape tools and paint tools, not the Vector Paint effect.
For more information, see “Work with paint tools and paint strokes” on page 302 and “Shape layers overview” on
page 312.
This effect works with 8-bpc and 16-bpc color.
Original (top left), brushstroke with selection spline (bottom left), and second stroke created with Wiggle control (bottom right)
Vector Paint strokes are made up of many tiny points that create the stroke path. You cannot isolate or adjust these
individual points, but you can affect them using Vector Paint features such as smoothing and wiggling. The wiggling
of a stroke is created by manipulating and displacing these points along the stroke path.
Vector Paint strokes are nondestructive, so painting and erasing actions affect only the appearances on a layer; they
don’t alter the original source file of any image on the layer. All paint strokes are recorded and stored as they are
drawn, so you can make the strokes appear in various sequences, such as animated over time or all at once.
For animated strokes, the exact timing (real time) you used to draw the strokes can be played back and rendered. You
can adjust the playback speed to fit the timing you want. You can also create new strokes by blending existing strokes,
both in space and in time.
Vector Paint supports the Wacom and Creation Station tablets’ pressure-stylus and erase functions.
Note: The Vector Paint options menu contains some unique commands and settings that are otherwise unavailable.
Open this menu by clicking the Vector Paint toolbar options button when a Vector Paint painting tool is selected.
AFTER EFFECTS CS3
User Guide
472
When you use Vector Paint on a layer, you can start over at any time by deleting all strokes or the Vector Paint effect
itself. To delete the effect, select Vector Paint in the Effect Controls panel and press Delete or Backspace.
Paint with the Vector Paint effect
1Select the Selection tool in the Tools panel.
2In either the Composition or Timeline panel, select the layer on which you want to paint.
3Choose Effect > Paint > Vector Paint. The Vector Paint effect appears and is selected in the Effect Controls panel,
and the Vector Paint toolbar appears on the left side of the Composition panel.
Note: This toolbar appears only if Vector Paint is selected (highlighted) in the Effect Controls panel. If the rulers in the
Composition panel interfere with your view of the Vector Paint toolbar, deselect View > Show Rulers.
4Select the Vector Paint painting tool you want to use from the Vector Paint toolbar.
5In the Effect Controls panel, select the options you want for Brush Settings and Composite Paint.
6In the Timeline panel, move the current-time indicator to the appropriate point in time.
7In the Composition panel, drag to draw strokes on the layer.
To quickly set your brush Radius and Feather amounts as you paint, press Ctrl (Windows) or Command (Mac OS)
and click anywhere in the Composition panel; then drag in or out to resize the brush. When you release the Ctrl or
Command key, you can then drag in or out to resize the feather.
Vector Paint tools
Vector Paint tools in Composition panel
You can use three tools in the Vector Paint toolbar to work with Vector Paint:
Selection tool Select a stroke by clicking or dragging across it. You can drag across several strokes to select them
simultaneously. You select strokes to edit or delete them.
Paint tool Paint directly on the layer, using settings defined in the Effect Controls panel. When you use the Paint
tool, the pointer appears as a circle (or square) in the actual size of the brush.
Eraser tool Erase areas of the layer, using Brush Type settings defined in the Effect Controls panel. The Eraser
pointer appears as a circle with an X through it. If you use an installed tablet with stylus eraser support, Vector Paint
automatically switches to eraser mode when you use the stylus eraser.
Clicking the active tool (Selection, Paint, or Brush) in the Vector Paint toolbar deactivates painting and hides the
other buttons in the toolbar. You can then drag and scale the layer. To reactivate the toolbar, reselect one of the three
Vector Paint tool buttons.
AFTER EFFECTS CS3
User Guide
473
Work with Vector Paint brushes
Vector Paint includes three brush types: Paint, Air, and Square. These brush types define the shapes and performance
of both the Paintbrush tool and the Eraser tool. All brush types but the Air brush include a Feather setting.
❖Do one of the following:
•In the Vector Paint toolbar, click the Paint , Air , or Square button.
•In the Effect Controls panel, click the current Brush Type setting (Paint, Air, or Square) repeatedly to cycle
through the brushes until the one you want is selected.
With increased Feather and reduced Opacity settings, Paint brushstrokes may resemble Air brushstrokes. However,
when you paint a single stroke that crosses itself, the two brush types produce different results. Air brushstrokes build
up opacity as the stroke crosses itself. Paint brushstrokes don’t build up opacity within the same stroke, whether they
cross themselves or not. To increase opacity with Paint brushstrokes, create multiple strokes over the area (like
multiple coats of paint).
Note: Each brush type is also available for the Eraser tool. When the Eraser tool is selected in the Vector Paint toolbar,
the name appears with “-E” after it in the Effect Controls panel. Also, if a tablet is installed and the stylus has eraser
support, Vector Paint automatically switches to eraser mode when you use the stylus eraser.
Brush Settings controls
Radius Controls the size of the brush or eraser.
If you press Alt (Windows) or Option (Mac OS) when clicking the question mark representing the Radius value, a
Set Value dialog box appears. You can then type a Relative Radius, reducing the radius of each stroke by that
percentage. The default value is 100%, which produces no change in the stroke radii.
Feather Controls the softness of brush or eraser edges (but doesn’t affect the airbrush).
When you drag to change Radius, Feather, or Opacity values, hold down Ctrl (Windows) or Command (Mac OS) to
reduce the size of the increments. To change the value by larger increments, hold down Shift as you drag.
Opacity Controls the transparency of the paint or erasures.
Brush Type Shows the brush type you selected in the Vector Paint toolbar in the Composition panel.
Color Representsthepaintcolorusedtodrawstrokes.SelectanewcolorbyclickingtheColorswatchandthenusing
the Color Picker, or by using the eyedropper to sample a color from the desktop.
When one or more strokes of the same color are selected, this swatch displays the color of those strokes. You can
change the color of the selected strokes.
Color Clone When Color Clone is turned on, the brush behaves like a combination eyedropper and brush. The color
of the stroke is determined by the pixels at the position where the stroke begins. The Color swatch in the Effect
Controls panel’s Brush Settings displays the new sampled color. When you begin another stroke, a new group of
pixels is sampled and used to color that stroke.
The Color Clone affects strokes only while you draw; it has no effect on an already completed stroke. This brush
setting is the only one you can’t apply after drawing. Clicking either the eyedropper or Color swatch turns off the
Color Clone feature.
Stylus TheRadiusoptionaffectsstylussensitivity.Whenyouselectthisoption,thepressureofthepenonthetablet
changes the weight of the stroke as it is drawn. Lighter pressure decreases the radius (creating a thinner stroke), and
increased pressure increases the radius (creating a wider one). The Radius value setting indicates the maximum
radius amount. Use the tablet settings to adjust the pressure-width sensitivity for the pen.
Note: You can choose Stylus Radius even if no tablet is installed. This option affects strokes when wiggling is enabled.
AFTER EFFECTS CS3
User Guide
474
The pressure variation of the pen on the tablet alters the opacity of the stroke as you draw. Light pressure results in
lower opacity values, while increased pressure creates more opaque strokes. The Opacity value defines the maximum
of the Opacity range.
Selecting and editing Vector Paint strokes
WhenyouselectasinglestrokeorstrokeswiththesameBrushSettings,youcanedittheenabledBrushSettingsinthe
EffectControlspanel.YourchangestothestrokesimmediatelyappearintheCompositionpanelasyoucompletethem.
When you select multiple strokes that have different Brush Settings, a question mark [-?-] appears next to that Brush
Setting in the Effect Controls panel. If you edit that value, all of the selected strokes are reset to the new value.
To edit a specific paint stroke, select it using the Selection tool on the Vector Paint toolbar and click or drag, or
choose Select from the Vector Paint options menu. You can select and then move, revise attributes, or delete either a
paint stroke or erasure stroke.
Use the following commands from the Select option in the Vector Paint toolbar option menu to select and edit paint
strokes:
Note: Some options are tied to the current position of the current-time indicator in the Timeline panel.
All Selects all strokes on a layer.
None Deselects all strokes on a layer (available only if some strokes are selected).
Visible Selects all strokes visible at the current frame.
Current Time Selects all strokes that were drawn at the current time position. (Playback Speed doesn’t affect the
original start time of strokes.)
Last Painted Selects the last-painted brush stroke (or erase stroke). If you painted several strokes with the Shift key
held down, this command selects that group of strokes.
Similar With one or more strokes selected, this command selects additional strokes with similar Brush Settings
properties. If strokes with dissimilar properties are initially selected, this command selects a broader range of strokes.
Inverse Toggles to a selection of all unselected strokes, leaving the previously selected strokes unselected.
After you select one or more strokes, you can transform them, such as by rotating, scaling (vertically, horizontally,
or both), or nudging (repositioning one pixel at a time).
Tools for editing paint work with Vector Paint
Use the following tools in the Vector Paint toolbar in the Composition panel to revise your paint work:
Undo button Click the Undo button to cancel your most recent single painting action, if it can be undone. If the
action cannot be undone, this tool is dimmed (not available). You can also undo paint actions by using the Undo
command on the Vector Paint options menu or by pressing Ctrl+Z (Windows) or Command+Z (Mac OS).
Note: Don’t use the Undo command on the Edit menu to undo Vector Paint actions.
Eyedropper Use the eyedropper to select a color to paint with from a sampling anywhere on the desktop. Press
the Escape key to cancel the eyedropper.
Note: By default, the eyedropper samples a single pixel. Hold down Ctrl (Windows) or Command (Mac OS) and click
the eyedropper to sample a 3-x-3-pixel average. Hold down Shift and drag to sample a range of multiple pixels.
Color swatch Displays the current selection as a solid color. When clicked, it opens the Color Picker dialog
box. If the Opacity setting is less than 100%, the Color Swatch icon appears checkered, not solid.
AFTER EFFECTS CS3
User Guide
475
If Color Clone is enabled in the Effect Controls panel, this swatch represents the sampled color. Shift-click the Color
Swatch to open the Set Value dialog box for Opacity without turning off Color Clone.
Smoothing a Vector Paint stroke
The Smoother command in the Vector Paint options menu removes points from a selected stroke or strokes. This
action simplifies stroke paths, smoothing out the curves. By eliminating unneeded points, the Smoother command
can also dramatically reduce the size of the project file if you have complex drawings composed of many strokes.
When you select a path and choose Smoother, a dialog box appears in which you can type a Max Error value. This
value sets the tolerance for the smoothing. Higher values remove more points on the path, resulting in a smoother
stroke. Values can range from 0–100. The default value, 1.0, removes only redundant points, maintaining details in
the stroke.
After you click OK in the dialog box, the stroke paths immediately reflect the smoothing in the Composition panel.
Smoothing cannot be undone. Removing these points may alter the shape of the path. If you want to preview the
results, create a duplicate of the layer and apply Smoothing to test the result. If the results are satisfactory, then apply
the command to the original layer.
Configure a stylus for Vector Paint (Windows only)
You can specify preferences for a Wacom or Creation Station tablet in several areas of the After Effects interface.
Note: Using a tablet with the Vector Paint effect isn’t supported in Mac OS. You can, however, use a tablet with the
standard paint tools and the Paint effect.
❖In the Vector Paint Preferences dialog box, click Options in the Effects Control panel, and select the following
preferences:
Stylus Vendor Tablets aren’t supported in Vector Paint on Mac OS. “Unknown” appears.
Use High Res. Coordinates If this option is selected, data is recorded at high resolution (if supported by the stylus).
This setting overrides normal mouse coordinates to use the higher resolution of the tablet, recording strokes with
greater precision and subpixel precision.
Note: Wacom tablets don’t support the High Res. Coordinates option if Proportional mode is selected in the Wacom
control panel.
If you experience offset coordinates with the pen, try the following:
•Check that screen resolution and monitor settings haven’t changed.
•If using a Wacom tablet, make sure that the tablet-mapping aspect isn't set to Proportional. Select To Fit mode or
One To One mode instead.
•Restart the computer.
•If all else fails, deselect Use High Res. Coordinates. Subpixel precision will be lost, but Pressure and Eraser modes
will still be available.
Play back your painting with Vector Paint
Use the Playback Mode pop-up menu in the Effect Controls panel to specify when and how quickly your strokes
appear in a composition. When you draw strokes, Vector Paint records information for the stroke start time and the
drawing time of each stroke (in real time). The playback mode you select determines when a stroke starts and for
how long it appears. You can set the speed at which the strokes play back using Playback Speed.
AFTER EFFECTS CS3
User Guide
476
Play back your strokes using standard (spacebar) preview or RAM preview, or by viewing the results of a rendered
composition.
Note: Regardless of how you record your strokes and which Playback mode you select when recording, you can always
switch to another Playback Mode at any time.
While the playback mode chosen affects what you see during playback, it also determines what you see while you are
drawing strokes. Onion Skin mode, for example, is used primarily while drawing strokes, and then another mode is
selected before rendering.
Note: Note the position of the current-time indicator when you begin drawing strokes. This position affects the
appearance of strokes in all modes except All Strokes.
Adjust the following controls to affect the way that strokes appear in the composition:
All Strokes Displays all strokes for the full duration of the layer, regardless of the position of the current-time
indicator when you drew them.
Past Strokes Displays strokes from the time at which they were recorded until the end of the layer (the Out point).
Hold Strokes Displays strokes from the frame on which they were drawn and holds them only until the point at
which the next stroke was drawn. This mode treats strokes like Hold keyframes; as a stroke appears, it replaces the
next, as in a slide show.
Animate Strokes Begins drawing the stroke at the current time (that is, at the frame where the current-time indicator
is when you draw the stroke). The stroke animates in the same way as it was drawn.
Current Frame The default Draw Strokes setting. This mode displays the stroke only at the frame at which it was
painted.
Onion Skin Displays strokes drawn on the current frame plus strokes drawn on the surrounding few frames. These
additional strokes appear color-coded and at reduced opacity, to distinguish them from the strokes on the current
frame. Those strokes actually exist only on the frames in which they are drawn. Onion-skinning is very useful for
drawing frame-by-frame animations because it gives you reference points for the stroke positions.
Use the Onion Skinning options in the Vector Paint Preferences dialog box to specify how previous and forward
strokes appear when Onion Skin is the active playback mode. (To open Vector Paint Preferences, use the Vector Paint
options menu and choose Options.) These options include the following:
•Frames Backward/Frames Forward Sets the number of frames backward or forward that are displayed. Both
backward and forward frames are displayed unless one or both of these values is set to 0.
•Color Backward/Color Forward Sets the color of the display of backward and forward strokes.
•Skin Opacity Sets the percentage of opacity for onion skin strokes.
Adjust the playback speed for the Vector Paint effect
The Playback Speed value in the Effect Controls panel can change the timing at which painted strokes appear in
previews and rendered compositions. Playback Speed affects the Vector Paint strokes only if you set Playback Mode
to Past Strokes, Hold Strokes, or Animate Strokes.
When you create strokes on a layer, the stroke is tied to the location of the current-time indicator in the Timeline
panel when you start drawing. Vector Paint also records the amount of time you take to draw the stroke. For example,
you might start painting a stroke with the current-time indicator set to 0:00 and use 1.5 seconds to draw the stroke.
Then, you might move the current-time indicator to 2:00 and draw a second stroke (leaving 0.5 seconds between the
completion of the first stroke and the beginning of the second one). For this example, let’s say you use 1.0 second to
draw the second stroke. The entire process covers 3.0 seconds on the timeline.
AFTER EFFECTS CS3
User Guide
477
Bychangingtheplaybackspeed,youcanchangethetimingforstrokeappearancesinpreviewsandrenderedcompo-
sitions.
1In the Effect Controls panel under Vector Paint, make sure that Playback Mode is set to Past Strokes, Hold Strokes,
or Animate Strokes.
2In the Effect Controls panel, click the underlined Playback Speed value and type a new value, using a number
between 0 and 100.
You can also change the playback speed by dragging the value itself or the slider below it: drag left to decrease the
speed; drag right to increase it.
For animations, always begin painting strokes at the layer In point, especially when adjusting Playback Speed. This
workflow locks the In point (first stroke’s start time) to the In point of the layer, making it easier to locate the
beginning of the animation. Then, simply place the layer’s In point where you want the animation to begin in the compo-
sition.
The results that your changes produce depend on the Playback Mode setting:
Animate Strokes With the Playback Speed at 1.0, each stroke appears as if drawn by an unseen hand, taking the same
amountoftimeasyouusedtocreateit.WhenyouincreasethePlaybackSpeedvalue,youreducethetimeittakesto
draw each stroke and the gaps between strokes. If you decrease Playback Speed, both the time taken to draw the
strokes and the length of the gaps between strokes increase. Using the example above, if you increase the Playback
Speed value to 2.0 (double the speed), the first stroke would be drawn in 0.75 seconds, the gap between the two
strokes would be shortened to 0.25 seconds, and the second stroke would be drawn in 0.5 seconds. The entire
animation would be complete after 1.5 seconds of playback.
Past Strokes With the Playback Speed at 1.0, each stroke appears in completed form at the frame in which you
started drawing and remains visible for the duration of the layer playtime. When you increase Playback Speed, each
stroke appears at an earlier point in time. If you decrease Playback Speed, strokes occur at later points in time.
Hold Strokes Like Past Strokes mode, each stroke appears in completed form at the frame in which it was drawn.
However, in Hold Strokes mode, each stroke disappears when the next stroke appears (without any gap between
them). Otherwise, the results of changing Playback Speed are similar to those in Past Strokes mode.
Change playback time with the Vector Paint Re-timer
The results from using the Re-timer or changing the Playback Speed value are similar but have important differences:
•You apply the Re-timer to individual strokes you select before choosing the Re-timer option. In comparison,
changes in Playback Speed apply to all paint strokes on the layer.
•The Re-timer affects only playbacks that use Animate Strokes mode. Playback Speed changes can also influence
Hold Strokes and Past Strokes modes.
•The Re-timer does not affect the start times of strokes. Changing the Re-timer value shortens or lengthens the
amount of time previews and rendered versions take to draw the stroke. The strokes begin to appear at the same
points in time as before, but they are drawn more quickly or more slowly.
•The values for Re-timer are percentages of the original time required to draw the stroke. The default value is 100%.
A higher value causes the drawing time to increase, so that a setting of 200% uses twice the time to draw the
selected strokes. A lower value draws the selected strokes more quickly.
1Using the Vector Paint Selection tool , click or drag to select the strokes.
2From the Vector Paint options menu, choose Re-timer.
3In the Set Value dialog box, type a value for Relative Duration (%), and click OK.
AFTER EFFECTS CS3
User Guide
478
Note: You cannot use the Undo command to reverse the Re-timer after you apply it. However, you can apply the Re-
timer again, using the inverse of the value you typed previously to revert to the original value. For example, if you
changed the Re-timer value to 200% and then wanted to go back to the earlier setting, choose Re-timer again and type
a value of 50%.
Paint using QuickPaint mode in Vector Paint
Ordinarily, when you draw strokes with Vector Paint, those strokes are associated with the position of the current-
time indicator. After you draw a stroke, you can draw more strokes at the same time setting or at different time
settings. The results you see when you preview or render the composition depend on your Playback Mode setting.
The Shift-Paint Records controls change the way that strokes associate with time settings, called QuickPaint mode.
Oneoftheadvantagesofthisfeatureisthatyoucancreatefastcontinuousrecordingsofasequenceofstrokeswithout
redraw delays after each one.
1From the Vector Paint options menu, choose Shift-Paint Records, and then choose a Shift-Paint Records option:
Note: You cannot apply a Shift-Paint Records option to strokes you’ve already created.
To Current Frame Specifies that all strokes start at the current frame (the current-time indicator position when you
draw the strokes). The result is similar to ordinary painting mode except that Shift-Paint Records has no redraw
delays.
To Sequential Frames Specifies that all stroke start times are offset by one frame. The next frame is calculated
according to the composition frame rate at the time of drawing. For example, if the current-time indicator is at 0:00
when you draw three strokes, then the start point is 0:00 for the first stroke, 00:01 for the second stroke, and 00:02
for the third stroke.
In Realtime Specifies that stroke start times are determined by how they are drawn. The strokes are recorded and
played back in real time even if you lift the brush while drawing. Strokes play back exactly as they were recorded,
includinganytimethatelapsed(gaps)betweenthecreationofthestrokes(providedthatyoucontinuedtoholddown
Shift during the time gap).
Continuously Specifies that stroke start times follow one another, without any gaps. When one stroke is finished
drawing, the next one begins immediately. Otherwise, the result is similar to the In Realtime option.
2Press Shift as you paint.
When you paint, the Info panel displays the name of the selected Shift-Paint Records option.
Wiggle controls for the Vector Paint effect
Enable Wiggling Ifselected,allstrokesonthelayeraresettowiggleusingtheWiggleControlvaluessetintheEffect
Controls panel.
Wiggles/sec Determines the number of wiggles per second of composition time. Wiggling is spline-based morphing
of paint strokes. Wiggles/sec controls the speed at which the morph completely shifts shape. For example, in a 30-
fps composition, setting the Wiggles/sec value to 30 creates one wiggle per frame. Lower values result in a smooth
animation of morphing strokes. Higher values create more rapid wiggling.
Displacement Variation Determines how far the stroke moves from its original position while wiggling. The greater
the value, the greater the deviation in shape.
Displacement Detail Determines how much the original shape of the path is altered while wiggling. Greater values
increase the detail of displacement (or change in shape) in the stroke. Lower values produce less displacement,
leaving the path closer to its original shape.
AFTER EFFECTS CS3
User Guide
479
When Displacement Detail values are set very high, the stroke may not resemble its original shape at all. This
approach is useful in creating randomly animated strokes.
Set the Displacement Detail value by using the slider in the Effect Controls panel (preset to values between 0 and
100) or by clicking the underlined Displacement Detail value and typing a number between 0 and 1000.
Pressure Variation Determines how much the Radius and Opacity values of the stroke vary while wiggling. For
strokesthathaveStylusRadiusenabled,theRadiuswiggles.ForstrokesthathaveStylusOpacityenabled,theOpacity
wiggles. The amount of variation in either the Radius or Opacity value while wiggling depends on the value specified
for Pressure Variation. The Radius and Opacity settings in the Brush Settings act as maximum amounts, not to be
exceeded while wiggling.
Note: Strokes that don’t have either Stylus Radius or Stylus Opacity options selected aren’t affected by the Wiggle Pressure
Settings. However, these options can be enabled even if a tablet isn’t installed.
In the Effect Controls panel, set the Pressure Variation value by clicking the underlined Pressure Variation value and
typing a number between -30,000 and 30,000, or by dragging the Pressure Variation slider.
Pressure Detail Determines how tight the pressure variation appears along the stroke. Higher values create more
dense variations.
Individual Stroke Seeds If selected, this option creates a different random wiggle seed for each stroke on a layer.
Because the wiggle controls apply to all strokes on a layer, the wiggle parameters are always the same. To randomize
the wiggling of the individual strokes, select the Individual Stroke Seeds option.
If Individual Stroke Seeds isn’t selected, all strokes use the same wiggle seed, so they all have the same spatial wiggle
values. For example, two strokes exactly on top of each other will wiggle equally. By setting individual seeds for each
stroke, you avoid identical strokes wiggling in the same way.
Composite Paint options
Various options control the way Vector Paint composites strokes on a layer. Select the option you want in the Effect
Controls panel for a layer, from the Composite Paint pop-up menu under Vector Paint. These options control two
things: what you see in the Composition panel as you work, and what aspects of the layer the strokes affect, including
what happens when you preview and render the composition.
As you paint and erase, you can either hide or display the footage image. You have similar viewing options when you
paint using matte and alpha-channel options.
As you work, painting and erasing can block pixels in an original image, such as a footage file or solid. You can also
paint on a virtual layer above or below that image (although the virtual layer doesn’t appear as a separate layer in the
Timeline panel). You can paint and erase to adjust mattes and alpha channels for the original image. You can restrict
Vector Paint strokes to the areas inside or outside the original alpha channel.
Each Composite Paint option specifies a unique combination of work view, layer type (image, matte, or alpha
channel), and placement of strokes relative to the original image. You can select strokes later and change the
Composite Paint option, but it’s a good idea to understand what results each option produces before you start
painting.
The following illustrations use the same basic example of an imported image. A paint stroke has been applied,
followed by an erasure stroke. The original image is the green layer, including an alpha channel that reveals the
background layer.
AFTER EFFECTS CS3
User Guide
480
Composite Paint options
A. In Original (default setting), before painting The imported image is visible.
B. In Original, with paint stroke The paint strokes appear above the original image.
C. In Original, with paint stroke and erasure stroke Anerasurestrokeremovesunderlyingportionsofboththepaint
stroke and the original image.
D. Only Theoriginalimageonthelayerdoesn’tappearintheworkingview;onlypaintstrokesareshown.Erasures
remove only paint, not the original image.
E. Over Original The original image is visible in the working view, similar to the In Original option. Painting and
erasing occur as with the Only option: Erasing removes pixels from underlying paint strokes but doesn’t alter the
original image.
F. Under Original The layer image is visible in the working view. Painting doesn’t alter the original image; it affects
only areas of the layer that are outside the original image. Erasures remove only paint pixels, not the original image.
G. Track Original Matte Theoriginalimageisn’tvisibleintheworkingview.Paintstrokesarevisible.Paintingaffects
only the area within the original image alpha channel (that is, paint applied within the original circle area). Erasures
remove only existing paint pixels.
H. Track Original Matte Visible The original image is visible in the working view. Otherwise, Vector Paint strokes
behave exactly as with Track Original Matte, so erasures don’t affect the original image.
I. As Matte Before you paint, nothing is visible in working view. Paint strokes affect only the matte, revealing the
underlying original image. Erasures add back areas of opacity, so that they appear to erase the underlying image
again. Both types of strokes are restricted to the area of the original alpha channel.
ABC
DEF
GH I
JK L
AFTER EFFECTS CS3
User Guide
481
J. As Inverse Matte Before you paint, the original image is visible in the working view. Painting affects only areas
within the original image alpha channel. Paint strokes block (rather than reveal) the original image, appearing to
erase the original image. Erasures remove only painting strokes; that is, they re-reveal the underlying image within
the alpha channel.
K. In Original Alpha Only The original image appears within its alpha channel in working view. Strokes affect the
alpha channel itself. Painting adds areas of opacity. Erasures add areas of transparency.
Note: You don’t need to switch colors when you paint in the alpha channel, even if you paint with gray. The changes to
the opacity of the painted area are determined by the values shown for Opacity and Feather under Brush Settings in the
Effect Controls panel, not by the color of paint.
L. Under Original Alpha Only The original image appears within its alpha channel in working view. Strokes don’t
affect the original image alpha channel, only areas outside of it. Painting adds areas of opacity; erasing restores trans-
parency to painted areas only.
Note: The difference between using Under Original and Under Original Alpha Only is that in the latter, strokes affect
only the alpha channel; RGB is unchanged.
Select Vector Paint preferences
UsetheVectorPaintPreferencesdialogboxtocustomizethewayyouviewyourworkinVectorPaint.Unlikemost
other effects, the options you select as Vector Paint preferences apply to all your Vector Paint work, both on the
current layer and on other layers. Your current preferences are also used for subsequent sessions of Vector Paint.
1Select Vector Paint in the Effect Controls panel and open the Vector Paint Preferences dialog box in any of the
following ways:
•Click the menu button in the Vector Paint toolbar in the Composition panel, and choose Options.
•Right-click (Windows) or Control-click (Mac OS) anywhere in the Composition panel, and choose Options.
•In the Effect Controls panel, click Options to Vector Paint.
2Choose the appropriate options.
Note: Better Preview While Drawing is temporarily disabled in low-memory situations, and Draft quality is used
instead. Also, if the preview doesn’t draw correctly, you may have an incompatible graphics card.
Perspective effects
3D Glasses effect
The3DGlasseseffectcreatesasingle3Dimagebycombiningaleftandright3Dview.Youcanuseimagesfrom3D
programs or stereoscopic cameras as sources for each view.
The method you use to create the combined images dictates how you view them. For example, you can use 3D
Glasses to create an anaglyphic image, which is an image containing two slightly different perspectives of the same
subject that are tinted contrasting colors and superimposed on each other. To create an anaglyphic image, first
combine views and tint each one a different color. Then, use 3D glasses that have either red and green lenses or red
and blue lenses to view the resulting image stereoscopically.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
482
Original (left), and with effect applied (right)
To avoid problems with flipped views, keep in mind the following guidelines:
•Use the same vertical dimensions for the composition and source images. A one-pixel difference produces the
same result as moving the position one pixel vertically.
•Make sure that the layer’s Position values are whole numbers (such as 240 instead of 239.7).
•Iftheleftandrightviewimagesareinterlaced,deinterlacethembeforeusing3DGlassestoavoidfieldmismatch.
•Because 3D Glasses creates interlaced frames, don’t select an interlace option in the Render Settings dialog box.
Ghost effects occur if the luminance values of one color exceed those of another color to such an extent that you can
see the first color through the wrong lens of anaglyph glasses. For example, an excessive red luminance value
becomes visible through the blue lens. If you adjust the Balance value, test the results on the final output media. If
you set the Balance value too high, a reversed shadow may appear.
Whenyouworkwithredandblueimages,thebluecoloringlasseswithredandbluelensesisactuallycyan,notblue.
Red and cyan are complementary colors, producing the best separation because they filter each other out more
efficiently. When you work with red and green images, it may appear that the green isn’t as bright as the red. However,
viewing the images with red and green lenses produces an even result because green has a higher luminance value
than red.
Left View, Right View The layer to use as the left or right view. You need to apply 3D Glasses to only one layer in a
composition.Ifyouuseasecondlayer,makesurethatthetwolayersarethesamesize.Thesecondlayerdoesn’tneed
to be visible in the composition.
Convergence Offset Theamountthatthetwoviewsareoffset.Usethiscontroltorealignuncalibratedcameraviews
of rendered material. Photos or images rendered from 3D programs are generally misaligned and require a negative
Convergence Offset value. If the original footage was shot with correct convergence, changing this value isn’t
necessary. Keyframing this value may result in erratic animation.
Swap Left-Right Swaps the left and right views.
3D View How the views are combined.
•Stereo Pair Scales both layers to fit side by side within the effect layer’s bounding box. Select Swap Left-Right to
create cross-eyed vision. Selecting Stereo Pair disables Convergence Offset.
•Interlace Upper L Lower R Takestheupper(first)fieldfromtheLeftViewlayer,andthelower(second)fieldfrom
the Right View layer, and combines them into a sequence of interlaced frames. Use this option if you want to view
the results with polarized or LCD shutter glasses. Select Swap Left-Right to switch fields.
•Red Green LR Tints the Right View layer red, and the Left View layer green using the luminance values of each
layer.
•Red Blue LR TintstheRightViewlayerredandtheLeftViewlayerblue(cyan)usingtheluminancevaluesofeach
layer.
AFTER EFFECTS CS3
User Guide
483
•Balanced Red Green LR Performs the same operation as Red Green LR but also balances the colors to reduce
shadows or ghosting effects caused by one view showing through the other. Setting a high value reduces the overall
contrast.
•Balanced Red Blue LR PerformsthesameoperationasRedBlueLRbutalsobalancesthecolorstoreduceshadows
or ghosting effects.
•Balanced Colored Red Blue Convertsthelayerintoa3Dviewusingtheoriginallayer’sRGBchannels.Thisoption
maintains the layer’s original colors but may produce shadows and ghosting effects. To reduce these effects, adjust
the balance or desaturate the image, and then apply 3D Glasses. If you use CG images, raise the black level of both
views before applying the effect.
Balance Specifies the level of balance in a balanced 3D view option. Use this control to reduce shadows and ghost
effects.Thedefaultbalancethat3DGlassessetswhenyouselecttheBalancedColoredRedBlueoptionistheideal
value: If you set Balance to 0.0, 3D Glasses creates no 3D depth, and if you set Balance too high, 3D Glasses produces
a highly saturated output.
Basic 3D effect
IfyouareworkingonaprojectthatwascreatedinanolderversionofAfterEffectsandtheBasic3Deffectisapplied
to one or more layers, you can continue to use the Basic 3D effect; otherwise, use the 3D layer switch instead.
This effect works with 8-bpc color.
Basic 3D effect: Swivel (top left); Swivel and Tilt (bottom left); and Swivel, Tilt, and Distance (bottom right)
TheBasic3Deffectmanipulatesalayerin3Dspace.Youcanrotateanimagearoundhorizontalandverticalaxesand
move it toward or away from you. With Basic 3D, you can also create a specular highlight to give the appearance of
light reflecting off a rotated surface. The light source for the specular highlight is always above, behind, and to the
left of the viewer. Because the light comes from above, the image must be tilted backward to see this reflection.
Specular highlights can enhance the realism of the 3D appearance. The specular highlight can be viewed only at Best
quality.
The layer’s quality setting affects Basic 3D. Draft quality calculates pixel location to the nearest integer value; Best
quality calculates pixel location to the subpixel level.
Swivel Controls horizontal rotation (rotation around a vertical axis). You can rotate past 90˚ to see the back side of
the image, which is the mirror image of the front.
Tilt Controls vertical rotation (rotation around a horizontal axis).
Distance To Image Specifies the image’s distance from the viewer. As the distance gets larger, the image recedes.
AFTER EFFECTS CS3
User Guide
484
Specular Highlight Adds a glint of light that reflects off the surface of the layer, as if an overhead light were shining
on the surface. When Draw Preview Wireframe is selected, the specular highlight is indicated by a red plus sign (+)
if it isn’t visible on the layer (that is, if the center of the highlight doesn’t intersect the layer) and a green plus sign (+)
if the highlight is visible.
Preview Draws a wireframe outline of the 3D image. The wireframe outline renders quickly. To see the final results,
deselect Draw Preview Wireframe when you finish manipulating the wireframe image. The preview wireframe is
drawn only at Draft quality; when you switch to Best quality, the image content is drawn. This way, you won’t
accidentally render a Best quality movie in Preview mode.
Bevel Alpha effect
The Bevel Alpha effect gives a chiseled and lighted appearance to the alpha boundaries of an image, often giving 2D
elements a 3D appearance. If the layer is completely opaque, then the effect is applied to the bounding box of the
layer. The edge created by this effect is somewhat softer than that created by the Bevel Edges effect. This effect works
especially well for elements with text in the alpha channel.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Bevel Edges effect
The Bevel Edges effect gives a chiseled and lighted 3D appearance to the edges of an image. Edge locations are deter-
mined by the alpha channel of the source image. Unlike Bevel Alpha, the edges created with this effect are always
rectangular, so images with nonrectangular alpha channels don’t produce the proper appearance. All edges have the
same thickness. At Best quality, edge thickness is interpolated for smooth visual results.
This effect works with 8-bpc color.
Original (left), and with effect applied (right)
Drop Shadow effect
TheDropShadoweffectaddsashadowthatappearsbehindthelayer.Theshapeoftheshadowisdeterminedbythe
layer’s alpha channel.
When you add a drop shadow to a layer, a soft-edged outline of the layer’s alpha channel appears behind it, as if a
shadow is cast on the background or underlying objects.
Drop Shadow can create a shadow outside the bounds of the layer. The layer’s quality setting affects the subpixel
positioning of the shadow and the smoothness of the shadow’s soft edges.
AFTER EFFECTS CS3
User Guide
485
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
To render the shadow without the image, select Shadow Only.
Note: To apply a drop shadow to a layer that rotates, rotate the layer using the Transform effect and then apply the Drop
Shadow effect. You can also use nesting, precomposing, or an adjustment layer to achieve this result. If you don’t use one
of these methods, the shadow rotates with the layer.
Radial Shadow effect
The Radial Shadow effect creates a shadow from a point light source over the layer it’s applied to, rather than from
an infinite light source (as with the Drop Shadow effect). The shadow is cast from the alpha channel of the source
layer, allowing the color of that layer to influence the color of the shadow as light passes through semitransparent
areas. You can use this effect to make a 3D layer appear to cast a shadow onto a 2D layer.
This effect works with 8-bpc color.
Original (left), and with effect applied (right)
Shadow Color The color of the shadow.
Note: The colors of the layer may override this option if you choose Glass Edges from the Render control menu. See the
Render and Color Influence controls for more information.
Opacity The opacity of the shadow.
Light Source The location of the point light source.
Copy and paste position keyframes or expressions from another effect’s control point (for example, Lens Flare) to
quickly create a shadow that matches another effect’s light source.
Projection Distance Thedistancefromthelayertothesurfaceonwhichtheshadowfalls.Theshadowappearslarger
as this value increases.
Softness The softness of the shadow’s edges.
Render The type of shadow:
•Regular Creates a shadow based on the Shadow Color and Opacity values, regardless of semitransparent pixels in
the layer. (If Regular is chosen, the Color Influence control is disabled.)
AFTER EFFECTS CS3
User Guide
486
•Glass Edge Creates a colored shadow based on the color and opacity of the layer. If the layer contains semitrans-
parent pixels, the shadow uses both the color and transparency of the layer. This option creates the appearance, for
example, of sun shining through stained glass.
The more transparent the pixels in the layer are, the closer the shadow color matches the colors of the layer. If the
layer contains no semitransparent pixels, Glass Edge has little result.
Note: Anti-aliased edges produce colors in a shadow edge when you choose Glass Edge, even if the layer is fully opaque.
The layer’s colors shine through these anti-aliased edges, and the Shadow Color fills the center of the shadow.
Color Influence The fraction of the layer’s color values that appear in the shadow. At 100%, the shadow takes on the
color of any semitransparent pixels in the layer. If the layer contains no semitransparent pixels, Color Influence has
little result, and the Shadow Color value determines the shadow’s color. Decreasing the Color Influence value blends
the colors of the layer in the shadow with the Shadow Color. Increasing Color Influence reduces the influence of the
Shadow Color.
Shadow Only Select to render only the shadow.
Resize Layer Select to allow the shadow to extend beyond the layer’s original boundaries.
Simulation effects
Common Lighting controls and Material controls
Several of the Simulation effects have some common controls. The Card Wipe effect also shares many controls with
the Card Dance effect.
Lighting controls
Light Type Specifies which type of light you want to use. Distant Source simulates sunlight and casts shadows in one
direction, where all the light rays strike the object from virtually the same angle. Point Source is similar to a light
bulb and casts shadows in all directions. First Comp Light uses the composition’s first light layer, which can use a
variety of settings.
Light Intensity Specifies the power of the light. The higher the value, the brighter the layer. Other lighting settings
affect the overall light intensity as well.
Light Color Specifies the color of light.
Light Position Specifies the position of the light in x,y space. To position the light interactively, Alt-drag (Windows)
or Option-drag (Mac OS) the light’s effect point.
Light Depth Specifies the position of the light in z space. Negative numbers move the light behind the layer.
Ambient Light Distributes light over the layer. Increasing this value adds an even illumination to all objects and
prevents shadows from being totally black. Setting Ambient Light to pure white and setting all other light controls
to 0 makes the object fully lit and eliminates any 3D shading from the scene.
Material controls
The Material controls specify reflection values.
Diffuse Reflection Gives objects form-defining shading. Shading depends on the angle at which the light strikes the
surface and is independent of the viewer’s position.
AFTER EFFECTS CS3
User Guide
487
Specular Reflection Takes into account the position of the viewer. It models the reflection of the light source back to
the viewer. It can create the illusion of shininess. For realistic effects, you can animate this control by using higher
and higher values to mask the transition from filtered to nonfiltered versions of the layer.
Highlight Sharpness Controls shininess. Very shiny surfaces produce small, tight reflections, while duller surfaces
spread the highlight out into a larger region. Specular highlights are the color of the incoming light. Because light is
typically white or off-white, broad highlights can desaturate an image by adding white to the surface color.
In general, use the following process to adjust lighting: Set Light Position and Diffuse Reflection to control the overall
light level and shading in a scene. Then adjust Specular Reflection and Highlight Sharpness to control the strength
and spread of highlights. Finally, adjust Ambient Light to fill in the shadows.
Card Dance effect
This effect creates the appearance of card choreography by dividing layers into numerous cards and then controlling
all geometric aspects of the cards by using a second layer. For example, Card Dance can simulate an extruded pin
sculpture, a crowd doing the wave, or letters floating on the surface of a pond.
This effect works with 8-bpc color.
Original (top left), and with rotation adjusted using Camera Position controls (bottom left) and Corner Pin controls (bottom right)
Original (left), gradient layer (center), and with Card Dance applied (right)
Apply Card Dance to the layer to use for the front of the cards. To set the view, use the rotation or perspective
controls, or match the perspective of the effect in any scene by corner-pinning.
AFTER EFFECTS CS3
User Guide
488
For example, select a vertical grayscale gradient layer (black on top, white on bottom) from the Gradient Layer 1
menu, and then select Intensity 1 from the X Rotation Source menu. Card Dance uses the intensity of the gradient
to animate the x-axis rotation of the cards. It assigns a numeric value to the center pixel of each card on the gradient
layer, based on the pixel’s intensity. Pure white equals 1, pure black equals –1, and 50% gray equals 0. Card Dance
then multiplies that value by the X Rotation Multiplier value and rotates each card that amount. If X Rotation Multi-
plier is set to 90, the cards in the top row rotate almost 90˚ backward, the cards in the bottom row rotate almost 90˚
forward, and cards in middle rows rotate by lesser amounts. Cards in the 50% gray area don’t rotate at all.
Ifyouwanthalfofthecardsinalayertocomeinfromtheright,andtheotherhalftocomeinfromtheleft,createa
gradient layer that is half black and half white. Set the gradient as the source for X Position, and set X Position Multi-
plier to 5, and animate it to 0. The cards in the black area initially appear at the left, and the cards in the white area
initially appear at the right.
See also
“Common Lighting controls and Material controls” on page 486
Rows, Columns, Layer, and Order controls
Rows & Columns Specifies the interaction of the numbers of rows and columns. Independent makes both the Rows
and Columns sliders active. Columns Follows Rows makes only the Rows slider active. If you choose this option, the
number of columns is always the same as the number of rows.
Rows The number of rows, up to 1000.
Columns The number of columns, up to 1000, unless Columns Follows Rows is selected.
Note: Rows and columns are always evenly distributed across a layer, so unusually shaped rectangular tiles don’t appear
along the edges of a layer—unless you use an alpha channel.
Back Layer The layer that appears in segments on the backs of the cards. You can use any layer in the composition;
its Video switch can even be turned off. If the layer has effects or masks, precompose the layer first.
Gradient Layer 1 The first control layer to use to make the cards dance. You can use any layer. Grayscale layers
produce the most predictable results. The gradient layer acts as a displacement map for animating the cards.
Gradient Layer 2 The second control layer.
Rotation Order The order in which the cards rotate around multiple axes when using more than one axis for
rotation.
Transformation Order The order in which the transformations (scale, rotation, and position) are performed.
Position, Rotation, and Scale controls
Position (X, Y, Z), Rotation (X, Y, Z), and Scale (X, Y) specify the transformation properties you want to adjust.
Because Card Dance is a 3D effect, you can control these properties separately for each axis of the cards. However,
because the cards themselves are still 2D, they have no inherent depth—hence the absence of z scaling.
Source Specifies the gradient layer channel you want to use to control the transformation. For example, select
Intensity 2 to use the intensity from Gradient Layer 2.
Multiplier The amount of transformation applied to the cards.
Offset The base value from which the transformation begins. It is added to the transformation value (a card’s center
pixel value times the Multiplier amount) so that you can start the transformation from some place other than 0.
AFTER EFFECTS CS3
User Guide
489
Camera System and Camera Position controls
Camera System Specifies whether to use the effect’s Camera Position properties, the effect’s Corner Pins properties,
or the default composition camera and light positions to render 3D images of the cards.
X Rotation, Y Rotation, Z Rotation Rotate the camera around the corresponding axis. Use these controls to look at
the cards from the top, side, back, or any other angle.
X, Y Position Where the camera is positioned along the x and y axes.
Z Position Where the camera is positioned along the z axis. Smaller numbers move the camera closer to the cards,
and larger numbers move the camera away from the cards.
Focal Length The zoom factor. Smaller numbers zoom in.
Transform Order The order in which the camera rotates around its three axes, and whether the camera rotates before
or after it is positioned using the other Camera Position controls.
Corner Pins controls
CornerPinningisanalternativecameracontrolsystem.Useitasanaidforcompositingtheresultoftheeffectinto
a scene on a flat surface that is tilted with respect to the frame.
Upper Left Corner, Upper Right Corner, Lower Left Corner, Lower Right Corner Where to attach each of the corners
of the layer.
Auto Focal Length Controls the perspective of the effect during the animation. When Auto Focal Length is
deselected, the focal length you specify is used to find a camera position and orientation that positions the corners
of the layer at the corner pins. If this isn’t possible, the layer is replaced by its outline, drawn between the pins. When
Auto Focal Length is selected, the focal length required to match the corner points is used, if possible. If not, it inter-
polates the correct value from nearby frames.
Focal Length Overrides the other settings if the results you’ve obtained aren’t what you need. If you set the Focal
Length to something that doesn’t correspond to what the focal length would be if the pins were actually in that
configuration, the image may look unusual (strangely sheared, for example). But if you know the focal length that
you are trying to match, this is the easiest way to get correct results.
Caustics effect
This effect simulates caustics—reflections of light at the bottom of a body of water, created by light refracting through
the water’s surface. The Caustics effect generates this reflection and creates realistic water surfaces when used with
Wave World and Radio Waves.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
490
Original (top left), and with Bottom set to the text layer (bottom left) and Water Surface set to the whirl layer with Surface Opacity set to 0%
(bottom right)
To get the most realistic results from Caustics, render the Bottom layer separately, with Render Caustics enabled and
Surface Opacity at 0. Then precompose, and use the resulting layer as the Bottom layer for another Caustics effect
with Render Caustics off. With this process you can offset, scale, or otherwise manipulate the Bottom layer in the precom-
posed composition, and thus simulate lighting that doesn’t come from straight overhead.
See also
“Common Lighting controls and Material controls” on page 486
Bottom controls
The Bottom controls specify the appearance of the bottom of the body of water:
Bottom Specifies the layer at the bottom of the body of water. This layer is the image that is distorted by the effect,
unless Surface Opacity is 100%.
Scaling Makesthebottomlayerlargerorsmaller.Iftheedgesofthebottomlayershow,becauseoftherefractionof
the light through the waves, scale up the bottom layer. Scaling down is useful for tiling a layer to make a complex
pattern.
Repeat Mode Specifies how a scaled-down bottom layer is tiled. Once uses only one tile, basically turning tiling off.
Tilesusesthetraditionaltilingmethodofabuttingtherightedgeofonebottomlayertiletotheleftedgeofanother
bottom layer tile. This option works well if the bottom layer contains a repeating pattern, like a logo, that needs to
read a certain way. Reflected abuts each edge of a bottom layer tile to a mirrored copy of the tile. This option can
eliminate a hard edge where the two tiles meet.
If Layer Size Differs Specifies how to handle the bottom layer when it is smaller than the composition.
Blur Specifies the amount of blur applied to the bottom layer. To make the bottom totally sharp, set this control to
0. Higher values make the bottom appear increasingly blurry, especially where the water is deeper.
Water controls
Water Surface Specifies the layer to use as the water’s surface. Caustics uses the luminance of this layer as a height
map for generating a 3D water surface. Light pixels are high, and dark pixels are low. You can use a layer created by
using the Wave World or Radio Waves effect; precompose the layer before using it with Caustics.
Wave Height Adjusts the relative height of the waves. Higher values make the waves steeper and the surface
displacement more dramatic. Lower values smooth the Caustics surface.
AFTER EFFECTS CS3
User Guide
491
Smoothing Specifies the roundness of the waves by blurring the water surface layer. Very high values eliminate
detail. Very low values show imperfections in the water surface layer.
Water Depth Specifies depth. A small disturbance in shallow water moderately distorts the view of the bottom, but
the same disturbance in deep water distorts the view significantly.
Refractive Index Affects the way the light bends as it passes through the liquid. A value of 1 does not distort the
bottom. The default value of 1.2 accurately simulates water. To add distortion, increase the value.
Surface Color Specifies the color of the water.
Surface Opacity Controls how much of the bottom layer is visible through the water. If you want a milky effect,
increase the Surface Opacity and Light Intensity values; a value of 0 results in a clear liquid.
Set Surface Opacity to 1.0 to perfectly reflect a sky later. With a suitable texture map, you can use this technique to
create the effect of liquid mercury.
Caustics Strength Displays the caustics, the concentrations of light on the bottom surface, caused by the lensing
effect of the water waves. This control changes the way everything looks: The waves’ dark spots get much darker, and
the light spots get much lighter. If you don’t set a value for this control, the effect distorts the bottom layer when the
waves pass over it, but it doesn’t render the lighting effect.
Sky controls
Sky Specifies the layer above the water. Scaling makes the sky layer larger or smaller. If the edges of the sky layer
show, scale the layer up. Scaling down is useful for tiling a layer to make a complex pattern.
Repeat Mode Specifies how a scaled-down sky layer is tiled. Once uses only one tile, basically turning tiling off. Tiles
uses the traditional tiling method of abutting the right edge of one layer tile to the left edge of another layer tile. This
optionworkswellifthelayercontainsarepeatingpattern,likealogo,thatneedstoreadacertainway.Reflectedabuts
each edge of a layer tile to a mirrored copy of the tile. This option can eliminate a hard edge where the two tiles meet.
If Layer Size Differs Specifies how to handle the layer when it is smaller than the composition. Intensity specifies the
opacity of the sky layer. Convergence specifies how close the sky and the bottom or water layer appear, controlling
the extent to which the waves distort the sky.
Foam effect
This effect generates bubbles that flow, cling, and pop. Use the effect’s controls to adjust attributes for the bubbles
such as stickiness, viscosity, life span, and bubble strength. You can control exactly how the foam particles interact
with each other and with their environment, and specify a separate layer to act as a map, controlling precisely where
the foam flows. For example, you can have particles flow around a logo or fill a logo with bubbles.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
492
Original (top left), with Foam applied (bottom left), and with a robot layer used as the Bubble Texture Layer (bottom right)
You can also substitute any image or movie for bubbles. For example, you can create swarms of ants, flocks of birds,
or crowds of people.
Note: On a frame-by-frame basis, Foam renders quickly, but the slightest adjustment in the initial settings is likely to
result in very different output a few seconds into the simulation. When making adjustments to Physics controls, the
farther into the simulation you are, the longer the adjustments take to render, because each adjustment results in the
simulation being recalculated all the way back to the beginning. Not every frame takes this long to calculate; once Foam
adjusts to the change, rendering speeds up again.
See also
“About randomness and random seeds” on page 354
View controls
Draft Displays the bubbles without fully rendering them. This is a fast way to preview the behavior of the bubbles.
Draft mode is the only way to preview the universe edges, the Flow Map alignment, and the Producer location, orien-
tation, and size. Bubbles are represented by blue ellipses. The Producer Point is represented by a red ellipse. The
bubble universe is represented by a red rectangle.
Draft + Flow Map DisplaystheDraftviewwireframesuperimposedoveragrayscalerepresentationoftheflowmap,
if selected.
Rendered Displays the final output of the animation.
Producer controls
The Producer controls specify the location where the bubbles originate, as well as the speed at which they are
generated:
Producer Point The center of the area from which the bubbles can be produced.
Producer X Size, Producer Y Size Adjust the width and height of the area from which the bubbles can be produced.
Producer Orientation Adjusts the rotation (orientation) of the area from which the bubbles can be produced.
Producer Orientation has no noticeable effect when Producer X Size and Producer Y Size are identical.
Zoom Producer Point Specifies whether the producer point and all of its associated keyframes remain relative to the
universe (selected) or to the screen (unselected) when you zoom in or out on it. For example, if you set a position for
ProducerPointintheupper-leftcornerofthelayerandthenzoomoutonthatlayer,theproducerpointstaysinthe
AFTER EFFECTS CS3
User Guide
493
upper-left corner of the screen if you don’t select Zoom Producer Point. If you select Zoom Producer Point, the point
moves with the universe as it is zoomed out, and the point ends up closer to the center of the screen.
Production Rate Determines the rate at which bubbles are generated. This control does not affect the number of
bubbles per frame. Rather, the rate is the average number of bubbles generated every 30th of a second. Higher
numbers yield more bubbles.
If a large number of bubbles appear in the same point at the same time, some may pop. If you want a lot of foam,
increase the values for Producer X Size and Producer Y Size so that the bubbles don’t immediately pop each other.
Bubbles controls
Size Specifiestheaveragesizeforadultbubbles.SizeVariance,BubbleGrowthSpeed,andRandomSeedalsoaffect
the size of a bubble in any particular frame.
Size Variance
Specifies the range of possible bubble sizes. This control uses the Size value as the average and creates
smaller-than-average and larger-than average-bubbles by using the range you specify here. For example, a default bubble
Size of 0.5 and default Size Variance of 0.5 generate bubble sizes ranging from 0 to 1 (0.5 –.5 = 0 and 0.5 + 0.5 = 1).
Lifespan Specifies the maximum life of a bubble. This value is not absolute; if it were, the bubbles would all pop after
the same lifespan, as if they were hitting a wall. Rather, this value is a target lifespan; some bubbles pop early, and
others may last until the end.
Bubble Growth Speed Specifies how fast a bubble reaches full size. When a bubble is released from the producer
point, it generally starts out rather small. If you set this value too high and you specify a small producer area, the
bubbles pop each other, and the effect generates fewer bubbles than expected.
Strength Influences how likely a bubble is to pop before it reaches its Lifespan limit. Lowering a bubble’s Strength
makes it more likely to pop early in its life, when forces like wind and flow maps act upon it. Lower values are good
for soap bubbles. The highest value is recommended for flocking animations.
Set this value low, and set Pop Velocity high to create chain reactions of popping bubbles.
Physics controls
The Physics controls specify the motion and behavior of the bubbles:
Initial Speed Sets the speed of the bubble as it is emitted by the producer point. This speed is affected by the other
Physics parameters.
Low Initial Speed values in conjunction with the default producer size don’t affect the results much because the
bubbles bounce off each other. For more control over initial speed, increase the values for Producer X Size and
Producer Y Size.
Initial Direction Sets the initial direction in which the bubble moves as it emerges from the producer point. This is
affected by other bubbles and other Physics controls.
Wind Speed Sets the speed of the wind that pushes the bubbles in the direction specified by Wind Direction.
Wind Direction Sets the direction in which the bubbles blow. Animate this control to create turbulent wind effects.
Bubbles are affected by wind as long as Wind Speed is greater than 0.
Turbulence Applies small random forces to the bubbles, making them behave chaotically.
Wobble Amount Randomly changes the shape of bubbles from perfectly round to a more natural elliptical shape.
AFTER EFFECTS CS3
User Guide
494
Repulsion Controls whether bubbles bounce off each other, stick to each other, or pass through each other. At a value
of 0, bubbles don’t collide; they pass through each other. The higher the Repulsion value, the more likely bubbles are
to interact with each other when they collide.
Pop Velocity Controls how popping bubbles affect each other. When a bubble pops, it affects other bubbles around
itbyleavingaholethatotherbubblescanfill,pushingotherbubblesaway,orpoppingotherbubbles.Thehigherthe
value, the more popping bubbles affect one another.
Viscosity Specifies the rate at which bubbles decelerate after being released from the producer point, and controls
the speed of the flow of the bubbles. A high Viscosity value creates resistance as the bubbles get farther away from
the producer point, causing them to slow down. If Viscosity is set high enough, the bubbles stop. The thicker the
substance, the higher the Viscosity. For example, if you want to create the effect of bubbles traveling through oil, set
Viscosity fairly high, so that the bubbles meet resistance as they travel. To create the effect of bubbles floating in air,
set Viscosity fairly low.
Stickiness Causes bubbles to clump together and makes them less vulnerable to other Physics controls like Wind
Direction. The higher the Stickiness, the more likely the bubbles are to form clusters and cling. Use Stickiness and
Viscosity to create a bubble cluster.
Zoom and Universe Size controls
Zoom Zooms in or out around the center of the bubble universe. To create really large bubbles, increase the Zoom
value instead of the Size value because large bubble sizes can be unstable.
Universe Size Sets the boundaries of the bubble universe. When bubbles completely leave the universe, they pop and
aregoneforever.Bydefault,theuniverseisthesizeofthelayer.Valuesgreaterthan1createauniversethatstretches
beyond the borders of the layer. Use higher values to make bubbles flow in from off-screen, or make it possible to
zoom out and bring them back into the picture. Using a value lower than 1 clips the bubbles before they reach the
edge of the layer. For example, when you want to confine bubbles to a specific area, such as inside a mask shape, set
Universe Size a little larger than the mask size to remove all the extra bubbles and speed up the rendering process.
Rendering controls
The Rendering controls specify the appearance of the bubbles, including their texture and reflection:
Blend Mode Specifies the relative transparency of bubbles as they intersect. Transparent blends the bubbles
smoothly together, allowing you to see the bubbles through each other. Solid Old On Top makes a younger bubble
appear to be underneath an older bubble and eliminates transparency. Use this setting to simulate bubbles flowing
toward you. Solid New On Top makes younger bubbles appear to be on top of older bubbles and also eliminates
transparency. Use this setting to make bubbles appear as if they are flowing downhill.
Bubble Texture Specifies the bubble texture. Use a preset texture, or create your own. To see the texture, make sure
that View is set to Rendered. To create your own texture, select User Defined, and from the Bubble Texture Layer
menu, choose the layer you want to use as the bubble.
Note: The preset bubble textures are prerendered 64 x 64 images. If you zoom in above 64 x 64, the bubble appears blurry.
To avoid this, use a higher-resolution custom bubble.
Bubble Texture Layer Specifies the layer you want to use as the bubble image. To use this control, choose User
Defined from the Bubble Texture menu. If you want the layer to appear only as a bubble, turn off the video switch
for the layer in the Timeline panel.
Note: You can use any file type that After Effects supports. If you plan on zooming in or using a large bubble size, make
surethattheresolutionofthelayerishighenoughtoavoidblurring.Remember,thisdoesn’thavetobeanormalbubble.
You can make blood cells, starfish, bugs, space aliens, or flying monkeys. If it’s a layer in your composition, it can be a
bubble.
AFTER EFFECTS CS3
User Guide
495
Bubble Orientation Determines the direction that the bubble rotates. Fixed releases the bubble from the producer
right side up and keeps it that way. Use this control if the bubble has built-in highlights and shading, as all of the
preset bubbles do. Physical Orientation buffets and spins bubbles around by the forces on them, creating a chaotic
scene. Bubble Velocity faces the bubble in the direction of its motion. This is the most useful setting for flocking-
style animations.
Environment Map Specifies the layer that is reflected in the bubbles. If you want to use this layer only for the
reflection, turn off the layer’s video switch.
Reflection Strength Controls how much of the selected Environment Map is reflected in the bubbles. The higher the
value, the more the reflection obscures the original bubble texture. Reflections appear only on opaque pixels, so
bubbles with high amounts of transparency, such as the Spit preset, don’t reflect much.
Reflection Convergence Controls how much your Environment Map is distorted as it is mapped onto the bubbles.
A value of 0 projects the map flat on top of all of the bubbles in the scene. As the value increases, the reflection
distorts to account for the spherical shape of each bubble.
Flow Map controls
The Flow Map controls specify the map that the flow of the foam follows:
Flow Map Specifies the layer used to control the direction and speed of the bubbles. Use a still image layer; if you
select a movie as the flow map layer, only the first frame is used. A flow map is a height map based on luminance:
White is high, and black is low. White is not infinitely high; if a bubble travels fast enough, it can travel past a white
obstacle. Make sure that the map is a little blurry; sharp edges can create unpredictable results. For example, to make
bubbles flow through a canyon, create a flow map with a white canyon rim, a black canyon, and blurry gray walls.
Use wind to blow the bubbles in the direction you want them to flow, and the walls of the canyon contain them. You
can also use a gentle gradient on the floor of the canyon to control the flow direction, but this is somewhat more
difficult to set up.
Note: If the bubbles don’t follow the map, use the Simulation Quality control. Also, try blurring the flow map a little to
make sure that it does not have excessively abrupt edges.
Flow Map Steepness Controls the difference between white and black as they are used to determine steepness. If the
bubbles are ricocheting randomly off the flow map, decrease this value.
Flow Map Fits Specifieswhethertheflowmapisrelativetothelayerortotheuniverse.Theflowmapresizesitselfto
fit whichever you specify. This control is useful when you want to enlarge the universe but the flow map is designed
for a particular layer, or when you want the bubbles to start off-screen and be affected by the flow map as they arrive
onscreen.
Simulation Quality Increases the precision, and therefore the realism, of the simulation. However, the higher the
value, the longer the composition takes to render. Normal generally produces good results and takes the least amount
of time to render. High returns better results but takes longer to render. Intense increases the rendering time but
produces more predictable bubble behavior. Use this option if the bubbles aren’t following the flow map. It often
solves problems of erratic behavior that can occur with small bubbles, high bubble speeds, and steep slopes.
Particle Playground effect
The Particle Playground effect lets you animate a large number of similar objects independently, such as a swarm of
bees or a snow storm. Use the Cannon to create a stream of particles from a specific point on the layer, or use the
Grid to generate a plane of particles. The Layer Exploder and Particle Exploder can create new particles from existing
layers or particles. You can use any combination of particle generators on the same layer.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
496
Particles shooting out of the spacecraft layer (top left), text characters used as particles shooting out of a ray gun (bottom left), and Layer
Exploder used on spacecraft layer (bottom right)
Start by creating a stream or plane of particles, or by exploding an existing layer into particles. Once you have a layer
of particles, you can control their properties, such as speed, size, and color. You can replace the default dot particles
with images from an existing layer to create, for example, an entire snowstorm from a single snowflake layer. You can
also use text characters as particles. For example, you can shoot words across the screen, or you can create a sea of
text in which a few letters change color, revealing a message.
Use Cannon, Grid, Layer Exploder, and Particle Exploder controls to generate particles. Use Layer Map control to
specify a layer in place of each default dot particle. Use Gravity, Repel, and Wall controls to influence overall particle
behavior. Use Property Mapper controls to influence particle properties. Use Options to set options, including those
for substituting text characters in place of dots.
Note: Because of the complexity of Particle Playground, you may experience long computation, preview, and render
times.
Use Particle Playground
1Select the layer on which you want particles to exist, or create a new solid layer.
2Choose Effect > Simulation > Particle Playground. The layer becomes an invisible layer in which only the particles
are visible. Animating the layer in the Timeline panel animates the entire layer of particles.
3Set up a particle generator to determine how particles are created. You can shoot a stream of particles from the
Cannon, generate a flat plane full of particles from the Grid, or use the Layer Exploder to create particles from an
existing layer. If you’ve already created particles, you can apply the Particle Exploder to explode them into more new
particles.
4Select your particles. By default, Particle Playground creates dot particles. You can replace the dots with a layer
already in the composition or with text characters you specify.
5Specify the overall behavior of some or all particles. Use Gravity to pull particles in a specified direction, Repel to
push particles apart from or toward one another, or Wall to contain or exclude particles from a certain area.
6Use an image to specify the behavior of individual particles. You can modify controls that change particle motion,
such as speed and force, and controls that change particle appearance, such as color, opacity, and size.
The Particle Playground effect renders with anti-aliasing when the layer to which it is applied is set to Best quality.
ItalsoappliesmotionblurtomovingparticleswhenboththeMotionBlurlayerswitchandtheEnableMotionBlur
composition switch are on.
AFTER EFFECTS CS3
User Guide
497
When you use another layer as a source for particles, Particle Playground ignores any changes you made to that layer
within that composition, such as changing the Position values. Instead it uses the layer in its original state. To keep
changes for a layer when you use it as a particle source, precompose the layer.
Particle content and particle generators
Particle Playground can generate three kinds of particles: dots, a layer, or text characters. You can specify only one
kind of particle per particle generator.
Create particles by using the Cannon, the Grid, the Layer Exploder, and the Particle Exploder. The Grid creates
particles in an organized grid format with straight rows and columns. The exploders create particles randomly, like
firecracker sparks.
Theparticlegeneratorssettheattributesofparticlesatthemomenttheyarecreated.Afterthat,particlebehavioris
influenced by the Gravity, Repel, Wall, Exploder, and Property Mapper controls. For example, if you want particles
to stick to grid intersections, you might use the Static Friction option in the Persistent Property Mapper to hold
particles in place. Otherwise, as soon as particles are created, they begin moving away from their original grid
positions.
Cannon controls
The Cannon is on by default; to use a different method to create particles, first turn the Cannon off by setting
Particles Per Second to zero. The Cannon creates particles in a continuous stream.
Position Specifies the (x,y) coordinates from which particles are created.
Barrel Radius Sets the size of the Cannon’s barrel radius. Negative values create a circular barrel, and positive values
create a square barrel. For a narrow source, such as a ray gun, specify a low value. For a wide source, such as a school
of fish, specify a high value.
Particles Per Second Specifies how often particles are created. A value of 0 creates no particles. A high value
increases the density of the particle stream. If you don’t want the Cannon to fire continuously, set keyframes for this
control so that the value is 0 at the times when you don’t want to create any particles.
Direction Sets the angle at which particles are fired.
Direction Random Spread Specifies how much each particle’s direction deviates randomly from the cannon
direction. For example, specifying a 10-degree spread sprays particles in random directions within +/–5˚ of the
cannon direction. For a highly focused stream, such as a ray gun, specify a low value. For a stream that widens
quickly, specify a high value. You can specify up to 360˚.
Velocity Specifies the initial speed of particles in pixels per second as they emanate from the Cannon.
Velocity Random Spread Specifies the amount of random velocity of particles. A higher value results in more
variation in the velocity of particles. For example, if you set Velocity to 20 and Velocity Random Spread to 10,
particles leave the Cannon at velocities ranging from 15 to 25 pixels per second.
Color Sets the color of dots or text characters. This control has no effect if you use a layer as the particle source.
Particle Radius Sets the radius of dots, in pixels, or the size of text characters in points. This control has no effect if
you use a layer as the particle source.
Grid controls
The Grid creates a continuous plane of particles from a set of grid intersections. The movement of Grid particles is
completely determined by the Gravity, Repel, Wall, and Property Mapper settings. By default, the Force control of
Gravity is on, so Grid particles fall toward the bottom of the frame.
AFTER EFFECTS CS3
User Guide
498
WiththeGrid,anewparticleappearsoneveryframeateachgridintersection.Youcan’tadjustthisfrequency,butif
you want to turn off the Grid or make the Grid stop generating particles at specific times, set the Particle Radius/Font
Sizecontrolto0,orusekeyframestoanimatethevalueoftheParticlesAcrossandParticlesDowncontrols.Tomake
more particles appear in each frame, increase the values for Particles Across and Particles Down.
Note: Bydefault,theCannonisonandtheGridisoff.IfyouareusingtheGridandwanttostoptheCannonfromgener-
ating particles, turn off the Cannon by setting its Particles Per Second value to 0.
Position Specifies the (x,y) coordinates of the grid center. When a grid particle is created, it is centered over its grid
intersection, regardless of whether it is a dot, a layer, or a text character. If you’re using text characters as particles,
the Use Grid option in the Edit Grid Text dialog box is on by default, placing each character on its own grid inter-
section, so normal character spacing, word spacing, and kerning do not apply. If you want text characters to appear
at the grid position with normal spacing, use a text alignment other than the Use Grid option.
Width, Height Specify the dimensions of the grid, in pixels.
Particles Across, Particles Down Specify the number of particles to distribute horizontally and vertically across the
grid area. Particles are generated only when the value is 1 or more.
Note: If the Width, Height, Particles Across, and Particles Down controls are not available, the Use Grid option has been
turned off in the Edit Grid Text dialog box.
Color Sets the color of dots or text characters. This control has no effect if you use a layer as the particle source.
Particle Radius/Font Size Sets the radius of dots in pixels or the size of text characters in points. This control has no
effect if you use a layer as the particle source.
Layer Exploder and Particle Exploder
The Layer Exploder explodes a layer into new particles, and the Particle Exploder explodes a particle into more new
particles. In addition to explosion effects, the exploders are also handy for simulating fireworks or for rapidly
increasing the number of particles.
The following guidelines can help you control particles resulting from an explosion:
•Alayerisexplodedonceforeachframe.Bydefault,thiscreatesacontinuousshowerofparticlesfortheduration
ofthecomposition.Ifyouwanttostartorstopalayerexplosion,animatetheRadiusofNewParticlescontrolby
using keyframes so that its value is zero at times when you don’t want particles to be created.
•Ifthesourceofthelayerisanestedcomposition,youcansetdifferentOpacityvaluesorInandOutpointsforthe
layers within the nested composition to make the exploding layer transparent at different points in time. The Layer
Exploder does not create particles where the source of the layer is transparent.
•To change the position of the exploding layer, precompose the layer with its new position (use the Move All
Attributes Into The New Composition option), and then use the precomposed layer as the exploding layer.
•When you explode particles, the new particles inherit the position, velocity, opacity, scale, and rotation of the
original particles.
•After you explode layers or particles, the movement of particles is influenced by the Gravity, Repel, Wall, and
Property Mapper controls.
Some Persistent Property Mapper and Ephemeral Property Mapper options can make explosions more realistic. For
example,changeOpacitytomaketheresultingparticlesfadeout,orchangetheRed,Green,andBluecolorchannels
to make resulting particles change color as they appear to cool.
Explode Layer (Layer Exploder only) Specifies the layer you want to explode. To make the video disappear the
moment the particles appear, either turn off the video for the layer or trim the layer’s Out point.
AFTER EFFECTS CS3
User Guide
499
Radius Of New Particles Specifies the radius of the particles resulting from the explosion. This value must be smaller
than the radius of the original layer or particle.
Velocity Dispersion Specifies, in pixels per second, the maximum speed of the range within which Particle
Playground varies the velocity of the resulting particles. High values create a more dispersed or cloudlike explosion.
Low values keep the new particles closer together and can make the exploded particles resemble a halo or shockwave.
Affects Specifies which particles are affected by the Layer Exploder and Particle Exploder.
Layer Map controls
By default, the Cannon, Grid, Layer Exploder, and Particle Exploder create dot particles. To replace the dots with a
layer in the composition, use the Layer Map. For example, if you use a movie of a single bird flapping its wings as a
particle source layer, After Effects replaces all dots with an instance of the bird movie, creating a flock of birds. A
particle source layer can be a still image, a solid, or a nested After Effects composition.
Amultiframe layer isanylayerwithasourcethatvariesovertime,suchasamovieoracomposition.Whenyoumap
new particles to a multiframe layer, use the Time Offset Type control to specify how you want to use the layer’s
frames. For example, use Absolute to map an unchanging image onto a particle, or use Relative to map an animating
sequence of frames onto a particle. You can randomize both Absolute and Relative across particles.
Note: When you choose a layer for Layer Map, Particle Playground ignores any changes that you made to that layer
within that composition. Instead, it uses the layer in its original state. To keep transformations, effects, masks, raster-
ization options, expressions, or keyframe changes for a layer when you use it as a particle source, precompose the layer.
Use Layer Specifies the layer you want to use as the particles.
Time Offset Type Specifies how you want to use a multiframe layer’s frames. For example, if you are using a layer of
a bird flapping its wings and you choose Relative for Time Offset Type with a Time Offset of 0, the flapping wings
for all the instances of the bird are synchronized. While this might be realistic for a marching band, it is not realistic
for a flock of birds. To make each bird start flapping its wings from a different frame in the layer, use Relative
Random.
•Relative Starts playing the layer at a frame based on the Time Offset you specify, relative to the effect layer’s
current time; then advances in step with the Particle Playground layer’s current time. If you specify a Time Offset of
0, all particles show the frame that corresponds to the effect layer's current time. If you choose a Time Offset of 0.1
(and your composition is set to 30 fps), each new particle displays the frame that is 0.1 seconds after the previous
particle’s frame. Regardless of the Time Offset you specify, the first particle always displays the frame of the source
layer that corresponds to the effect layer’s current time.
•Absolute Displays a frame from the layer based on the Time Offset you specify, regardless of the current time.
ChooseAbsolutewhenyouwantaparticletoshowthesameframeofamultiframesourcelayerforitsentirelifespan,
instead of cycling through different frames as the effect layer advances in time. For example, if you choose Absolute
and specify a Time Offset of 0, every particle shows the first frame of the source layer for its entire lifespan. If you
want to show a frame other than the first frame, move the layer earlier in time until the frame you want to show
corresponds to the In point of the Particle Playground layer. If you specify a Time Offset of 0.1, for example, each
new particle displays a frame that is 0.1 second after that of the previous particle (or every third frame of a 30-fps
animation).
•Relative Random Starts playing the layer from a frame chosen at random, within the range between the effect
layer’s current time and the Random Time Max you specify. For example, if you choose Relative Random and specify
a Random Time Max of 1, each particle starts playing from a layer frame chosen at random from between the current
time and 1 second after the current time. If, for another example, you specify a negative Random Time Max value of
- 1, the Random Time Max is before the current time, so that the range within which new particles start playing
AFTER EFFECTS CS3
User Guide
500
advances as the current time advances. However, the range is always between the current time and one second earlier
than the current time.
•Absolute Random Takesaframeatrandomfromthelayer,byusingatimebetween0andtheRandomTimeMax
you specify. Choose Absolute Random when you want each particle to represent a different single frame of a multi-
frame layer. For example, if you choose Absolute Random and specify a Random Time Max of 1, each particle shows
a layer frame from a random time between 0 and 1 second into the layer’s duration.
Time Offset Specifies the frame from which to start playing sequential frames from the layer.
Affects Specifies which particles are affected by the Layer Map controls.
Replace default Cannon particles with text
You can use text characters as particles. For example, you can type a message that the Cannon shoots across the
frame. You can also change the attributes of any three sets of characters. For example, you can make some of the
characters larger or brighter than others.
1In the Effect Controls panel, click Options.
2Click Edit Cannon Text.
3Type text in the text box, and then set the following options:
•For Font/Style, choose the font and style for Cannon characters.
•For Order, click to specify the sequence in which characters exit the Cannon. The sequence is relative to the
character order typed in the text box. For example, if the Cannon Direction is set to 90˚ (making it point to the
right), English text must exit the Cannon last letter first to be in readable order. Therefore, select Right to Left.
•For Loop Text, select to continuously generate the characters you typed. Deselect to generate only one instance of
the characters.
4Click OK to close the Edit Cannon Text dialog box, and then click OK to close the Particle Playground dialog box.
5Click the right-facing triangle next to Cannon so that it points downward.
6Click the Font Size value, type a value of 10 or greater, and press Enter (Windows) or Return (Mac OS).
If you want to stop replacing default particles with text, delete all text from the text box in the Edit Cannon Text
dialog box.
Replace default Grid particles with text
1In the Effect Controls panel, click Options, and then click Edit Grid Text.
2Set the following options:
•For Font/Style, choose the font and style for Grid characters.
•For Alignment, click Left, Center, or Right to position text in the text box at the Position specified in the Grid
control, or click Use Grid to position each letter in the text on consecutive grid intersections.
•For Loop Text, select to repeat the characters you typed until all the grid intersections contain one character. Grid
intersections are specified by the Particle Across and Particle Down controls. Deselect to generate only one
instance of the text. (This option is available only if you select Use Grid alignment.)
3Type text in the text box. If Use Grid alignment is selected and you want to skip a grid intersection, type a space.
To force the next character down to the next grid row, press Enter (Windows) or Return (Mac OS).
4Click OK to close Edit Grid Text, and then click OK to close the Particle Playground dialog box.
5Click the right-facing triangle next to Grid so that it points downward.
AFTER EFFECTS CS3
User Guide
501
6Click the Font Size value, type a value of 10 or greater, and press Enter (Windows) or Return (Mac OS).
If you want to stop replacing default particles with text, delete all text from the text box in the Edit Grid Text dialog box.
Changing a particle over its lifespan
Some controls affect the particle from birth: Cannon, Grid, Layer Exploder, and Particle Exploder. Others affect the
particle after birth and over the course of its lifespan: Gravity, Repel, Wall, Persistent Property Mapper, and
Ephemeral Property Mapper. To have full control over particle movement and appearance, you must balance these
controls.
For example, if you want to use the Cannon to shoot sparks that fade over time, it may seem that you need only
animate the Cannon’s Color control. However, using this method, you change only the color of each new particle as
it’s created. To control the color for the lifespan of particles, you must create a layer map and use one of the Property
Mappers to alter the particles’ color channels.
The following list covers common particle behavior and how you can influence it.
Speed At particle creation, particle velocity is set by the Cannon and the exploders; Grid particles have no initial
speed. After particle creation, use the Force control in the Gravity and Repel control groups. You can also influence
the speed of individual particles by using a layer map to set values for the Speed, Kinetic Friction, Force, and Mass
properties in the Property Mappers.
Direction At particle creation, the Cannon includes particle direction; the Layer Exploder and Particle Exploder
send new particles in all directions; and Grid particles have no initial direction. After particle creation, direction can
be influenced by the Direction control in the Gravity control group or by specifying a Boundary (mask) in the Wall
control group. You can also influence the direction of individual particles by using a layer map to set values for the
Gradient Force, X Speed, and Y Speed properties in the Property Mappers.
Area Use a Wall mask to contain particles to a different area or to remove all barriers. You can also restrict particles
to an area by using a layer map to set values for the Gradient Force property in the Property Mappers.
Appearance At particle creation, the Cannon, Grid, Layer Exploder, and Particle Exploder set particle size unless
you replace the default dots with a layer map. The Cannon and Grid set the initial color, while the Layer Exploder
and Particle Exploder take color from the exploded dot, layer, or character. The Options dialog box affects the initial
appearance of text. After particle creation, you can use the Property Mappers to set values for Red, Green, Blue, Scale,
Opacity, and Font Size.
Rotation At particle creation, the Cannon and Grid set no rotation; the Particle Exploder takes rotation from the
exploded dot, layer, or character. Use Auto-Orient Rotation to make particles rotate automatically along their
respective trajectories. For instance, a particle can point up as it climbs an arc, and point down as it descends.
Rotation isn’t easily visible for a dot particle. It is easier to observe only when you replace the dot particle with text
characters or a layer. After particle creation, use a layer map to set values for the Angle, Angular Velocity, and Torque
property in the Property Mappers.
Note: The appearance and rotation of a layer map particle changes in relation to the mapped layer’s original appearance
and rotation. For instance, if you replace the default dot particles with a movie of a spinning wheel, the spinning-wheel
particles appear to spin when no particle rotation is applied.
AFTER EFFECTS CS3
User Guide
502
Gravity controls
Use Gravity controls to pull existing particles in a direction you specify. Particles accelerate in the direction of gravity.
Apply in a vertical direction to create falling particles, such as rain or snow, or rising particles, such as champagne
bubbles. Apply in a horizontal direction to simulate wind.
Force Specifies the force of gravity. Positive values increase the force, pulling particles more strongly. Negative values
reduce the force.
Force Random Spread Specifies a range of randomness for the Force. At zero, all particles fall at the same rate. At a
higher value, particles fall at slightly different rates. Although pure gravity accelerates all objects equally, increasing
the Force Random Spread value can produce more realistic results with subjects such as leaves falling through air,
where there is enough air resistance to vary the leaves’ rates of descent.
Direction Specifies the angle along which gravity pulls. The default is 180˚, which simulates the real world by pulling
particles toward the bottom of the frame.
Affects Specifies a subset of the layer’s particles to which Gravity applies.
Repel controls
Repel controls specify how nearby particles repel or attract each other. This feature simulates adding a positive or
negative magnetic charge to each particle. You can specify which particles, layers, or characters are the repelling force
and which are repelled.
Note: If you want to repel an entire layer of particles away from a specific area, use the Property Mapper controls, Wall
or Gradient Force.
Force Specifies the repel force. Greater values repel particles with more force. Negative values result in particle
attraction.
Force Radius Specifies the radius (measured in pixels) within which particles are repelled. Another particle must be
within this radius to be repelled.
Repeller Specifies which particles act as the repellers or attractors to another subset you specify by using the Affects
control.
Affects Specifies a subset of the layer’s particles to which repulsion or attraction applies.
Wall controls
Wall controls contain particles, limiting the area within which particles can move. A wall is a closed mask that you
create by using a mask tool, such as the Pen tool. When a particle hits the wall, it bounces off at a velocity based on
the force with which it hit.
Boundary Specifies the mask to use as the wall. You can create a new mask by drawing one on the effect layer.
Affects controls
Many Particle Playground controls include Affects controls. Affects controls specify which particles are affected by
the encompassing control. For example, the Affects controls within the Particle Exploder controls specify which
particles the Particle Exploder affects.
Particles From Specifies the particle generator or combination of particle generators whose particles you want to
affect.
Selection Map Specifies the layer map that influences which particles are affected.
AFTER EFFECTS CS3
User Guide
503
Note: The simulation space is not bounded by the dimensions of the layer to which Particle Playground is applied. You
may need to use a selection map that is larger than the Particle Playground layer so that dots that are not visible are still
affected by Selection Map.
Characters Specifies the characters you want to affect. This control applies only if you are using text characters as
the particle type.
Older/Younger Than Specifies the age threshold, in seconds, above or below which you want to affect a particle.
Positive values affect older particles, and negative values affect younger particles. For example, a value of 10 means
that as soon as a particle reaches 10 seconds, it changes to the new value.
Age Feather Specifies the age range in seconds within which the Older/Younger Than value is feathered, or softened.
Feathering creates a gradual, rather than abrupt, change. For example, if you set Older/Younger Than to 10 and Age
Feather to 4, about 20% of particles start changing when they’re 8 seconds old, 50% change when they’re 10 seconds
old (the Older/Younger Than value), and the remainder change by the time they’re 12 seconds old.
Use Particle Playground Property Mapper controls
You can control specific properties of individual particles by using a layer map and either the Persistent Property
Mapper or the Ephemeral Property Mapper. You can’t alter a specific particle directly, but you can use a layer map to
specify what happens to any particle that passes over a specific pixel in the layer. Particle Playground interprets the
brightness of each layer map pixel as a specific value. The Property Mapper associates a specific layer map channel
(Red, Green, or Blue) with a specific property, so that as a particle passes over a certain pixel, the brightness value at
that pixel modifies the property.
A particle property can be modified in either a persistent or an ephemeral way:
•Apersistent change to a particle property retains the most recent value set by a layer map for the remaining lifespan
of the particle, unless the particle is modified by another control such as Repel, Gravity, or Wall. For example, if
you use a layer map to modify particle size and you animate the layer map so it exits the frame, the particles keep
the last size value set by the layer map after it exits the frame.
•An ephemeral change to a particle property causes the property to revert to its original value after each frame. For
example, if you use a layer map to modify particle size and you animate the layer map so that it exits the frame,
eachparticlereturnstoitsoriginalsizevalueassoonasnolayermappixelscorrespondtoit.Similarly,ifyouapply
an operator such as Add, each time a particle passes over a different layer map pixel, the value of the layer map
pixel is added to the original value of the particle.
In both the Persistent and Ephemeral Property Mappers, you can control up to three particle properties indepen-
dently by using a single RGB image as a layer map. Particle Playground achieves this by extracting brightness values
separately from the red, green, and blue channels in the image. You don’t have to use all three channels if you want
to modify just one property. To change just one property or change up to three properties using the same values, use
a grayscale image as the layer map because the RGB channels are identical.
In combination with keyframes or expressions, the Property Mappers provide complete control over individual
particle properties in space and time. Using layer maps, you can change particle properties at any location within a
frame. By applying keyframes or expressions to Property Mapper options and animating a layer map, you can control
how particle properties change.
1For Use Layer As Map, choose a layer map to use as the source for values that modify particle values. The layer
map must be part of the composition.
2To apply the effect to a subset of particles, specify the Affects controls as necessary.
AFTER EFFECTS CS3
User Guide
504
3Choose a property for each of the Map Red To, Map Green To, and Map Blue To controls. You don’t have to map
properties to all of the color channels. For example, if you want to change scale over an image map, you can map the
color red to scale without setting other properties.
4Specify the minimum and maximum values you want the layer map to produce for each Map To group. Min is the
value to which a black pixel is mapped, and Max is the value to which a white pixel is mapped. The complete tonal
distribution between Min and Max is then scaled proportionally.
5If using the Ephemeral Property Mapper, you can apply an operator to the value of a particle property and the
value of the corresponding layer map pixel.
Note: Because particle properties use many kinds of units, such as pixels, degrees, and seconds, you may want to
compress or expand the range of values from the layer map so that all the resulting values are usable in the measurement
system of a specific particle property. First, use the Min and Max controls, which define the range of values to use from
the layer map. If further adjustment is necessary and you’re using the Ephemeral Property Mapper, use the Operator
control and choose a mathematical operator to amplify, attenuate, or limit the effect of a layer map.
InboththePersistentandEphemeralPropertyMappers,youcanusealayermap’salphachanneltomakemoresubtle
changes to the value of a particle property. For example, particles over a layer-map pixel in which the alpha channel
value is 255 are fully affected, while lower values affect particles less. Layer-map pixels that are completely trans-
parent have no effect on particle properties.
Whenyouchooseanyofthefollowingproperties,ParticlePlaygroundcopiesthevaluefromthelayermap(thatis,
the layer selected in the Use Layer as a Map menu) and applies it to the particle.
None Modifies no particle property.
Red, Green, Blue Copy the value of the particle’s red, green, or blue channel within a range of 0.0–1.0.
Kinetic Friction Copies the amount of resisting force against a moving object, typically within a range of 0.0–1.0.
Increase this value to slow down or stop moving particles, as if braking.
Static Friction Copies the amount of inertia that holds a stationary particle in place, typically within a range of 0.0–
1.0. At zero, a particle moves when any other force, such as gravity, is present. If you increase this value, a stationary
particle requires more of another force to start moving.
Angle Copies the direction in which the particle points, in degrees relative to the particle’s original angle. The angle
is easily observable when a particle is a text character or a layer without radial symmetry.
Angular Velocity Copies the velocity of particle rotation in degrees per second. This determines how fast a particle
rotates around its own axis.
Torque Copies the force of particle rotation. The angular velocity of a particle is increased by a positive torque and
is increased more slowly for particles of greater mass. Brighter pixels affect angular velocity more forcefully; if
enough torque is applied against angular velocity, the particle starts spinning in the opposite direction.
Scale Copies the scale value of a particle along both the x and y axes. Use this to stretch a particle proportionally. A
value of 1.0 scales the particle to its full size; a value of 2.0 scales it 200%, and so on.
X Scale, Y Scale Copy the scale value of a particle along the x or y axis. Use these to stretch a particle horizontally or
vertically.
X, YCopy the position of a particle along the x or y axis in the frame, in pixels. A value of zero specifies a position
at the left of the frame (for X) or at the top of the frame (for Y).
Gradient Velocity Copies the velocity adjustment based on areas of a layer map on both the x and y planes of motion.
X Speed, Y Speed Copy the horizontal speed (x-axis velocity) or vertical speed (y-axis velocity) of a particle in pixels
per second.
AFTER EFFECTS CS3
User Guide
505
Gradient Force Copiestheforceadjustmentbasedonareasofalayermaponboththexandyplanesofmotion.The
pixel brightness values in the color channel define the resistance to particle force at each pixel, so the color channel
acts like a layer map of hills and valleys that decrease or increase particle force. In the layer map, areas of equal
brightness result in no adjustment, similar to flat land. Lower pixel values represent less resistance to a particle’s force,
similar to a downhill grade. Higher pixel values represent more resistance to a particle’s force, similar to an uphill
grade. For best results, use a soft-edged layer map image.
If you are using a layer map for Gradient Force where flat areas equal no adjustment, and you are using the Min and
Max controls (not the Min or Max operators) to set the range of values for Gradient Force, set them to positive and
negative values of the same number (for example, –30 and +30). This ensures that the middle of the range remains
centered at zero.
X Force Copies the coercion along the x axis of motion. Positive values push a particle to the right.
Y Force Copies the coercion along the y axis of motion. Positive values push a particle down.
Opacity Copies the transparency of a particle, where zero is invisible, and 1 is solid. Adjust this value to fade particles
in or out.
Mass Copies the particle mass, which interacts with all properties that adjust force, such as Gravity, Static Friction,
Kinetic Friction, Torque, and Angular Velocity. It takes greater force to move particles with a larger mass.
Lifespan Copies the elapsed length of time a particle exists, in seconds. At the end of its lifespan, the particle is
removed from the layer. The default lifespan is effectively immortal.
Character Copies the value that corresponds to an ASCII text character, making it replace the current particle.
Applies only if you’re using text characters as particles. You can specify which text characters appear by painting or
drawing shades of gray on the layer map that correspond to the ASCII characters you want. A value of zero produces
no character. For US English characters, use values between 32 and 127. The range of possible values can accom-
modate Japanese characters. For more information about the ASCII character values for a font you’re using, see the
documentation for the font, use a utility such as Character Map (Windows), or contact the font manufacturer.
Note: If you simply want to make certain characters spell a message, it’s much easier to type the text directly in the
Options dialog box. The Character property is more useful as a secret message effect in which you scramble text
characters.
Font Size Copies the point size of characters. Applies only if you’re using text characters as particles. Increase this
value to make characters larger.
Time Offset CopiestheTimeOffsetvalueusedbytheLayerMap.AppliesonlyifyouusedtheLayerMapcontrolto
specify a multiframe layer (such as a movie) as a particle source.
Scale Speed Copies the scale of a particle. Positive values expand the particle, and negative values shrink the particle.
Particles expand or shrink by a percentage per second.
Min and Max controls for Property Mappers
When the overall range of layer map brightness values is too wide or narrow, use Min and Max to stretch, compress,
or shift the range of values produced by the layer map. The following examples describe when you might want to
adjust Min and Max:
•You want to set the smallest font size for your text to 10 points and the largest size to 96 points. Set the Min value
to 10 and the Max value to 96.
•You set the initial color of a particle and then use a layer map to change particle colors. If you find that the color
changes aren’t dramatic enough, you can lower the Min value and raise the Max value to increase the contrast of
the color changes.
AFTER EFFECTS CS3
User Guide
506
•You set the initial velocity of a particle and then use a layer map to affect the X Speed value. However, you find
that the difference between the fastest and slowest particles is too great. By raising the Min value and lowering the
Max value for the layer map channel that is mapped to the X Speed value, you narrow the resulting range of
particle speeds.
•YouusealayermaptoaffecttheScalepropertyofparticlesandfindthatthesmallestparticlesaren’tsmallenough
while the largest resulting particles are too large. In this case, the entire output range needs to be shifted down;
lower both the Min and Max values.
•You have a layer map that modifies particles in the opposite direction from the one you want. Swap the Min and
Max values, which has the same result as inverting the layer map.
Note: The alpha channel of the layer map is used as the selection map for the Persistent and Ephemeral Property
Mappers.
Operator controls for the Ephemeral Property Mapper
When you use the Ephemeral Property Mapper controls, Particle Playground replaces the value of a particle’s
property with the value represented by the layer map pixel at the particle’s current location. You can also amplify,
attenuate, or limit the resulting values by specifying a mathematical operator and then using both the value of a
particle’s property and its corresponding layer map pixel value.
Set Replaces the value of a particle property by the value of the corresponding layer map pixel. For example, to
simply replace the value of a particle property with the brightness value of the corresponding pixel on the layer map,
use Set. This is the most predictable operator and is the default.
Add Uses the sum of the value of a particle property and the value of the corresponding layer map pixel.
Difference Uses the absolute value of the difference of the value of a particle property and the brightness value of the
corresponding pixel on the layer map. Because it takes the absolute value of the difference, the resulting value is
always positive. This operator is useful when you want to limit values to only positive values. If you’re trying to model
realistic behavior, the Difference operator may not be ideal.
Subtract Starts with the value of a particle property and subtracts the value of the brightness value of the corre-
sponding pixel on the layer map.
Multiply Multiplies the value of a particle property by the brightness value of the corresponding pixel on the layer
map and uses the result.
Min Compares the brightness value of the layer map to the value of the particle property and uses the lower value.
To limit a particle property so that it is less than or equal to a value, use the Min operator and set both the Min and
Max controls to that value. If you use a white solid as a layer map, you need only set the Max control to that value.
Max Comparesthebrightnessvalueofthelayermaptothevalueoftheparticlepropertyandusesthehighervalue.
To amplify existing values of properties, try applying the Add operator with positive values or the Multiply operator
with values above 1.0. To attenuate (tone down) property value changes, try applying the Multiply operator using
values between 0 and 1.0.
Layer maps for Particle Playground
Alayer map is an image in which each pixel’s brightness value is used by an effect in a calculation. Particle
Playground uses a layer map to exercise precise control of a particle property such as opacity. In this way, After
Effects doesn’t use a layer map as a picture but as a matrix of numbers. In many cases, you never see the actual layer
map in the final movie—you see only the result of an effect applying the layer map’s pixel values to the corresponding
pixels in a destination layer.
AFTER EFFECTS CS3
User Guide
507
Regardless of the color depth of the image that you use as a layer map, After Effects always uses its red, green, and
blue channels as if each were an 8-bpc grayscale image. If you create a layer map using colors, the Property Mappers
in Particle Playground can extract the brightness values from each RGB color channel separately.
A layer map is often used as a stationary layer of the same dimensions as its destination layer. The value of each pixel
in the layer map applies only to one specific pixel at the corresponding position in the destination layer. However,
when you animate a layer, the appearance of the pixels in the destination layer changes depending on which layer-
mappixelcorrespondstoitataparticularpointintime.Layermapsareoftenanimatedsothatthelayermapeffect
appears to sweep through the destination layer.
Layer maps are often created by painting in an image-editing program, such as Adobe Photoshop, although you can
use any program that can save an image compatible with After Effects. The key to creating a good layer map is to
remember that the brightness value of each pixel influences an effect property. Here are some hints and tips for
creating layer maps:
•Ifyouwantalayermaptomatchtheshapeofanimagethatalreadyexists,simplyusethatimage.Forbestresults,
create a layer map that has the same dimensions as the layer containing the image.
•You can create a layer map by precomposing a white solid layer, a black solid layer, and a mask on the top layer
thatdetermineswhichareasarewhiteandblack.Increasingthemask’sfeathersoftensthetransitionbetweenblack
and white values.
•In Photoshop, an easy way to create a layer map is to create a layer with a black or white background, draw a
selection, and fill the selection with the opposite color. Blurring the entire layer softens the transition between
black and white values.
•You can set layer map values more precisely by painting shades of gray within a range from 0 (black) to 255 (white).
This is the tonal range of an 8-bit channel. To simplify painting or drawing, see if your image-editing program
provides or allows you to create a palette of 256 gray shades.
Note: While images created for use as displacement maps (in other effects or programs) often map tones to values on a
scale from –127 to +127, Particle Playground interprets tones of gray as values on a scale from 0.0 (black) to 1.0 (white).
If you’re using images created as displacement maps, use the Min and Max controls to modify the range of tones produced
by the layer map.
•The alpha channel in a layer map modifies the value before it’s applied to the destination layer. Areas where the
alphachanneliscompletelyoff(transparentareasofalayermap)don’taffectonparticlevalues.Areaswherethe
alpha channel has a partial value (semitransparent areas of a layer map) partially affect the particle value. For
example, if a layer-map pixel has a value of 10 and the layer-map alpha channel has a value of 127 (50%), the layer-
map pixel is affected by 50%, and its true value is 5. When you use the Persistent and Ephemeral Property
Mappers, the actual value applied to a particle is also affected by the range set for the Min and Max controls.
•If you want to change any of the layer map’s layer properties (Masks, Effects, or Transform), change them,
precompose the layer, and then use the resulting composition as the layer map. Otherwise, Particle Playground
ignores any property settings.
•The contrast between adjacent pixel values determines how smoothly the values change across the surface of the
layer map. To create smooth changes, paint using a soft or anti-aliased brush, or apply gradients. To create abrupt
changes, avoid intermediate shades, using just a few widely spaced shades, such as 50% gray, black, and white.
•You can adjust overall edge contrast with blur or sharpen filters, if your painting or drawing program provides them.
Note: Ifyouwanttoeditindividualpixels,openthelayermapintheprogramyouusedtocreateitandmakethechange.
AFTER EFFECTS CS3
User Guide
508
Before you apply a layer map to a particle layer, they must be in the same composition, in a stacking order that
produces the results you want. If you want particles to be visible in front of the layer map, make sure that the layer
with Particle Playground applied is in front of the layer map. If you don’t want the layer map to be visible, hide it by
clicking the layer’s eye icon in the Timeline panel.
RGB layer maps
Particle Playground can extract brightness values separately from the red, green, and blue channels in an image. If
you want to create different layer maps for each channel, use a program that can edit individual color channels, such
as Adobe Photoshop, and then paint or paste each layer map into its own channel. Save the layer map as an RGB
image in a format After Effects can import. The image may look unusual when viewed in RGB mode because it’s
intended to be used as a single hidden layer containing three different layer maps, not as a visible color layer.
When you apply an effect that can use each color channel as a separate layer map, you can still use a grayscale image;
the RGB channels will be identical.
If you already have three separate images, you can combine them into a single RGB file by using the Set Channels
effect. Set Channels can load each image into its own channel in a combined file, making it suitable for use as an
RGB layer map.
Improving performance with Particle Playground
Keep the following in mind when working with the Particle Playground effect:
•
When you’re generating a Particle Playground effect, keep an eye on the Info panel to see how many particles are
being produced. If an effect contains more than 10,000 particles, it can significantly slow rendering. If you notice
performance problems, set Particles Per Second and/or Particles Down to relatively low values (between 1 and 100).
•The Grid and Layer Exploder generate particles on every frame, which may generate too many particles for the
effect you’re creating and slow down rendering. To avoid continuous particle generation, animate these controls
to decline to zero over time: Layer Exploder, Radius of New Particles, Grid Width and Height, Particle Radius, and
Font Size. Then Particle Playground generates new particles only at the start of a sequence.
•When you apply a Particle Playground effect to a layer, the particle positions aren’t limited to the bounds of that
layer.Tocontrolparticlesthatyoucan'tseeorthatappearneartheedgeoftheimage,useaSelectionorProperty
Map that’s larger than the area of the Particle Playground layer. Also, note that After Effects takes an image map’s
alpha channel into account. If you want transparent areas of your map to affect the particles, precompose the map
layer with a black solid behind it.
To specify field rendering with a Particle Playground effect, select Enable Field Rendering in the Particle Playground
options dialog box. Then Particle Playground calculates the simulation at double the frame rate of the current
composition, which is what field rendering requires.
Shatter effect
The Shatter effect explodes graphic images. Use the effect’s controls to set explosion points and adjust the strength
and radius. Anything outside the radius doesn’t explode, leaving portions of the layer unaltered. You can choose from
a variety of shapes for the shattered pieces and extrude the pieces to give them bulk and depth. You can even use a
gradient layer to precisely control the order of an explosion. For example, you can import a logo and use Shatter to
blow a logo-shaped hole in a layer.
Note: To reverse the temporal direction of the Shatter effect (i.e., have the pieces come together instead of fly apart), apply
the effect, precompose the layer, and then time-reverse the precomposition layer.
This effect works with 8-bpc color.
AFTER EFFECTS CS3
User Guide
509
Original (top left), and as Shatter is applied over time to reveal another layer (bottom left and right)
AharonRabinowitzprovidesavideotutorialthatshowshowmake3DextrudedtextinAfterEffectsusingtheShatter
effect: www.adobe.com/go/learn_ae_aharonextrusionhacks.
See also
“Common Lighting controls and Material controls” on page 486
“Precompose layers” on page 114
“Reverse a layer’s playback direction” on page 220
View controls
The View control specifies exactly how a scene appears in the Composition panel by using the following views:
Rendered Displays the pieces with textures and lighting—as they will look at final output. Use this view when
rendering the animation.
Wireframe Front View Displays the layer from a full-screen, straight-on camera angle with no perspective. Use this
view to adjust effect points and other parameters that are hard to see from an angle. In addition, the outlines of the
shatter map are visible so you can precisely position, rotate, and scale the shatter pattern. It’s handy to toggle between
this view and the perspective view you use for the scene.
Wireframe Displays the correct perspective of the scene, so you can quickly set up the camera the way you like it and
fine-tune the Extrusion Depth.
Wireframe Front View + Forces Displays the wireframe front-view representation of the layer, plus a blue represen-
tation of each force sphere.
Wireframe + Forces Displays the wireframe view, plus a blue representation of the force spheres. This view includes
camera controls, so you can position everything precisely in 3D space.
Render control
The Render control renders the whole scene (the default), the unshattered layer, or the shattered pieces indepen-
dently.Forexample,ifyouwanttoapplytheGloweffectonlytoshatteredpiecesandnottotheportionsofthelayer
that remain intact, create the explosion and duplicate the layer. Next, for the back layer, choose Layer from the
Render menu, and for the front layer, choose Pieces. Then apply the Glow effect to the front layer.
AFTER EFFECTS CS3
User Guide
510
Shape controls
Shape controls specify the shape and appearance of the shattered pieces.
Pattern Specifies the preset pattern to use for the exploded pieces.
Custom Shatter Map Specifies the layer you want to use as the shape of the exploded pieces.
White Tiles Fixed Prevents pure white tiles in a custom shatter map from being exploded. You can use this control to
force certain parts of a layer to remain intact.
Use this control when your shatter map uses images or letters such as O: Set the portion you don’t want to blow out,
such as the centers of the O and the background, to pure white and set the rest to another pure color.
Repetitions Specifies the scale of the tile pattern. This control works only in conjunction with the preset shatter
maps, which all seamlessly tile. Increasing this value increases the number of pieces on the screen by scaling down
the size of the shatter map. Consequently, the layer breaks into more and smaller pieces. Animating this control is
not recommended, as it can cause sudden jumps in the number and size of shatter pieces.
Direction Rotates the orientation of a preset shatter map, relative to the layer. As with Repetitions, animating this
control results in sudden jumps in the animation and is not recommended.
Origin Preciselypositionsapresetshattermaponthelayer.Thisisusefulifyouwanttolineupportionsofanimage
with specific shattered pieces. Animating this control results in sudden jumps in the animation and is not recom-
mended.
Extrusion Depth Adds a third dimension to the exploded pieces. The higher the value, the thicker the pieces. In
Rendered view, this effect isn’t visible until you start the shatter or rotate the camera. As you set this control higher,
the pieces may actually pass through each other. While this is generally not a problem in full-speed animations, it
may become visible when the pieces grow very thick and move slower.
Force 1 and Force 2 controls
Force 1 and Force 2 controls define the blast areas by using two different Forces.
Position Specifies the current center point of the blast in (x,y) space.
Depth Specifies the current center point in z space, or how far in front of or behind the layer the blast point is. Adjust
Depthtodeterminehowmuchoftheblastradiusisappliedtothelayer.Theblastradiusisasphere,andthelayeris
basicallyaplane;therefore,onlyacircularsliceofthesphereintersectstheplane.Thefartherawaythelayerisfrom
the center of the blast, the smaller the circular slice. When pieces explode, they fly away from the force center. Depth
determines which way the pieces fly: Positive values cause the pieces to explode forward, toward the camera
(assuming the default camera settings of 0, 0, 0); negative values cause pieces to blow backward, away from the
camera. To see the result of the Depth setting, use the Wireframe + Force Sphere view.
Radius Defines the size of the blast sphere. The radius is the distance from the center of a circle (or sphere) to the
edge. By adjusting this value, you can fine-tune exactly which pieces explode. Changing this value can vary the speed
and completeness of the explosion. Animating it from small to large generates an expanding, shockwave explosion.
Note: To begin the shattering at a time other than layer time zero, animate the Radius property, not the Strength
property. Pieces inside the force sphere defined by the Radius property are pulled off-screen by gravity even if Strength is
set to 0. Use Hold keyframes on the Radius property with the value 0 until the time when you want the shattering to start.
Strength Specifies the speed at which the exploded pieces travel—how hard they are blown away from or sucked
back into the blast point. A positive value blows the pieces away from the blast point; a negative value sucks the pieces
into the blast point. The greater the positive value, the faster and farther they fly away from the center point. The
greater the negative value, the faster the pieces launch themselves toward the center of the force sphere. Once the
pieces are launched, however, they are no longer affected by the force sphere; the Physics settings take over. A
AFTER EFFECTS CS3
User Guide
511
negative Strength value does not suck the pieces into a black hole; instead, the pieces fly through each other and back
out the other side of the sphere. Setting Strength very low causes the pieces to break up into shapes, creating cracks
inthelayer,butitdoesn’tactuallyblowthepiecesapart.Ifgravityissettoanythingotherthan0,thepiecesarepulled
in the direction of gravity after they break up.
Note: A shatter piece is made up of vertices (points or dots that define the corners of the shape), edges (lines that connect
the dots), and planes (walls of the shape). Shatter determines when a shape has come in contact with a force sphere based
on when a vertex comes in contact with the sphere.
Gradient controls
Gradient controls specify the gradient layer used to control the timing of an explosion and the pieces that are affected
by the blast.
Shatter Threshold Specifies which pieces in the force sphere shatter according to the corresponding luminance of
the specified gradient layer. If Shatter Threshold is set to 0%, no pieces in the force sphere shatter. If it is set to 1%,
onlythepiecesintheforcespherecorrespondingtowhite(orverynearlywhite)areasonthegradientlayershatter.
If it is set to 50%, all the pieces in the force sphere corresponding to white-to-50%-gray areas on the gradient layer
shatter. If it is set to 100%, all pieces in the force sphere shatter. Because there are 256 shades of gray (including black
and white), each percentage point represents approximately 2.5 shades of gray.
Animating Shatter Threshold influences the timing of the explosion. If you leave it set to 0%, the layer never
explodes. However, if you set a Shatter Threshold keyframe at 50%, the pieces of your layer in the force field that
correspond to areas of your gradient layer that range from white to 50% gray explode. If you then animate Shatter
Threshold up to 100%, the remaining pieces in the force sphere explode.
Gradient Layer Specifies the layer to use to determine when specific areas of the target layer shatter. White areas
shatter first; black areas shatter last. Shatter determines which pixels correspond to which pieces by subdividing the
layer into pieces, each with a center point or balance point. If you superimpose the shatter map over the gradient
layer, the gradient layer pixels that are precisely under each balance point control the explosion.
Note: Some shapes have a balance point that falls outside the actual area of the shape—for example, the letters C and
U. When designing a gradient layer in such a situation, avoid using grayscale versions of letters. Instead, use larger
shapes that cover the balance point of each character.
Invert Gradient Inverts the pixel values in the gradient. White becomes black, and black becomes white.
Physics controls
Physics controls specify the way the pieces move and fall through space.
Rotation Speed Specifies the speed at which pieces rotate around the axis set by the Tumble Axis control, allowing
you to simulate different rotation speeds for different materials. In nature, similarly shaped pieces spin at different
speeds based on their mass and air friction. For example, a brick spins faster than Styrofoam.
Tumble Axis Specifies the axis that the pieces spin around. Free spins the pieces in any direction. None eliminates all
rotation. X, Y, and Z spin the pieces only around the selected axis. XY, XZ, and YZ spin the pieces only around the
selected combination of axes.
Note: Any application of z-axis rotation appears only when a second force hits the layer. The pieces do not rotate from
the first blast if only z-axis rotation is selected.
Randomness Affects the initial velocities and spins generated by the force sphere. When this control is set to 0,
pieces fly directly away from the center point of a blast (assuming a positive force). Since real explosions are rarely
this orderly, Randomness allows you to vary things a little bit.
AFTER EFFECTS CS3
User Guide
512
Viscosity Specifies how fast pieces decelerate after being blown apart. The higher the Viscosity value, the more resis-
tance the pieces encounter as they move and spin. If Viscosity is set high enough, the pieces quickly come to a stop.
To replicate an explosion in water or sludge, set Viscosity to a high value. In air, set it to a medium value, and for an
explosion in space, set it very low, or to 0.
Mass Variance Specifies the theoretical weight of the pieces as they explode. For example, a large piece is heavier
than a small piece and therefore does not fly as far or as fast when it encounters the blast. Mass Variance’s default
setting of 30% gives a realistic approximation of this law of physics. Setting Mass Variance to 100% greatly
exaggerates the difference between the behavior of large versus small pieces. Setting it to 0% makes all pieces behave
the same, regardless of their size.
Gravity Determines what happens to the pieces after they break up and blow apart. The higher the gravity setting,
the faster the pieces are sucked in the direction set by Gravity Direction and Gravity Inclination.
Gravity Direction Defines the direction in (x,y) space that the pieces travel when affected by gravity. The direction
is relative to the layer. If Gravity Inclination is set to -90 or 90, Gravity Direction has no effect.
Gravity Inclination Determines the direction in z space that the pieces travel once they explode. A value of 90
explodes the pieces forward, relative to the layer. A value of -90 explodes them backward, relative to the layer.
Textures controls
Textures controls specify the texture of the pieces.
Color Specifies the color of the piece as defined by the Front Mode, Side Mode, and Back Mode menus. This color
may or may not be visible depending on the Mode settings: When a Mode setting is Color, Tinted Layer, Color +
Opacity, or Tinted Layer + Opacity, the selected color is factored into the appearance of the piece.
Opacity Controls the opacity of the corresponding Mode setting. A Mode setting must be Color + Opacity, Layer +
Opacity, or Tinted Layer + Opacity for the opacity to affect the appearance of the piece. You can use the Opacity
control in conjunction with texture maps to create the look of semitransparent materials.
Front Mode, Side Mode, Back Mode Determine the appearance of the front, sides, and back of the pieces. Color
appliestheselectedcolortotheapplicablesideofthepiece.LayertakesthelayerchoseninthecorrespondingLayer
menu and maps it to the applicable side of the piece. Tinted Layer blends the chosen layer with the selected color;
the effect is similar to viewing the layer through a colored filter. Color + Opacity combines the selected color and the
Opacity amount. With Opacity at 1, the applicable side is given the selected color. With Opacity at 0, the applicable
side is transparent. Layer + Opacity combines the chosen layer and the Opacity amount. With Opacity at 1, the
chosen layer is mapped to the applicable side. With Opacity at 0, the applicable side is transparent. Tinted Layer +
Opacity combines the tinted chosen layer and the Opacity amount. With Opacity at 1, the tinted chosen layer is
mapped to the applicable side. With Opacity at 0, the applicable side is transparent.
Note: If you apply Shatter to a layer containing an alpha channel that you want to use for transparency, use the same
texture (or at least another layer with an identical alpha channel) for the front, sides, and back of the pieces to make all
sides transparent.
Front Layer, Side Layer, Back Layer Specify the layer to be mapped onto the corresponding side of the piece. Front
Layermapsthechosenlayertothefrontofthepiece.BackLayermapsthechosenlayerbackwardtothelayer.IfLayer
ischosenforbothFrontModeandBackMode,andthesamelayerisspecifiedforeach,eachshatteredpiecehasthe
same pixel information on both sides. Side Layer maps an extrusion of the chosen layer to the extruded sides of the
piece, as if the chosen layer is also mapped to the front and back, and the layer has been sliced through.
Note: If you choose a layer with an effect applied, the effect does not show up in the texture unless you precompose the
layer. However, if you select None, the layer to which you have applied Shatter, along with any effects that occur before
Shatter, is used as the texture map, with no precomposing required.
AFTER EFFECTS CS3
User Guide
513
Camera System and Camera Position controls
Camera System Whether to use the effect’s Camera Position properties, the effect’s Corner Pins properties, or the
default composition camera and light positions to render 3D images.
X Rotation, Y Rotation, Z Rotation Rotate the camera around the corresponding axis. Use these controls to look at
the cards from the top, side, back, or any other angle.
X, Y Position Where the camera is positioned in (x,y) space.
Z Position Where the camera is positioned along the z axis. Smaller numbers move the camera closer to the cards,
and larger numbers move the camera away from the cards.
Focal Length The zoom factor. Smaller numbers zoom in.
Transform Order The order in which the camera rotates around its three axes, and whether the camera rotates before
or after it is positioned using the other Camera Position controls.
Corner Pins controls
Corner pinning is an alternative camera control system. Use it as an aid for compositing the result of the effect into
a scene on a flat surface that is tilted with respect to the frame.
Upper Left Corner, Upper Right Corner, Lower Left Corner, Lower Right Corner Where to attach each of the corners
of the layer.
Auto Focal Length Controls the perspective of the effect during the animation. If this option is deselected, the focal
length you specify is used to find a camera position and orientation that positions the corners of the layer at the
corner pins, if possible. If not, the layer is replaced by its outline, drawn between the pins. If this option is selected,
the focal length required to match the corner points is used, if possible. If not, the correct value is interpolated from
nearby frames.
Focal Length Overrides the other settings if the results you’ve obtained aren’t what you need. If you set the Focal
Length to something that doesn’t correspond to what the focal length would be if the pins were actually in that
configuration, the image may look unusual (strangely sheared, for example). But if you know the focal length that
you are trying to match, this option is the easiest way to get correct results.
Creating a custom shatter map
All layers in After Effects are represented as an RGBA image, including black-and-white images. The Shatter effect
calculates the luminance threshold of each channel to create a custom shatter map. Shatter calculates the 50%
luminance threshold of each channel, creating an image composed of only eight colors: red, green, blue, yellow,
magenta, cyan, white, and black. These eight colors become possible combinations of the channels set either all the
way on (255) or all the way off (0). The shatter layer splits along the edges of these different colored sections.
Whendesigningcustomshattermaps,youcanfinditusefultomanuallysetathresholdforeachchanneloftheimage
at 50% (you can use the Curves effect to do so). When you set the threshold, you can see how the image will be broken
into pieces. Alternatively, you can create custom shatter maps by drawing an image using only the eight colors listed
above, with no intermediate shades or anti-aliasing.
Note: Use the Colorama effect to posterize the colors of an image to these eight colors. Turn off Interpolate Palette in the
Colorama effect controls. See “Colorama effect” on page 393.
The alpha channel determines whether or not a shattered piece exists. A white alpha channel value results in a
shattered piece, and a black alpha channel value results in no piece. Using an alpha channel, you can make a tile map
with holes in it or generate simple 3D models like extruded text.
AFTER EFFECTS CS3
User Guide
514
Note: The custom shatter map determines the shapes of the pieces a layer shatters into, but not when the pieces shatter.
The timing is determined by the Force controls and can be further controlled by a gradient layer.
Wave World effect
Use this effect to create a grayscale displacement map for use with other effects such as Caustics or Colorama. This
effect creates waves based on a simulation of the physics of liquids. Waves emanate from an effect point, interact with
eachother,andrealisticallyreflectofftheirenvironment.UseWaveWorldtocreateatop-downviewofalogo,with
waves reflecting off the logo and the sides of the layer.
This effect works with 8-bpc color.
Wireframe view (top left), Height Map view (bottom left), and resulting image (bottom right). Result is used as Water Surface source for
Caustics effect example.
Wireframe view (left), Height Map view (center), and resulting image (right). Result is used as Input Phase for Colorama effect example.
To understand how this effect works, consider the following information about the physics of waves: A wave consists
of a peak and a trough. The amplitude of a wave is the height, or distance, between the peak and trough. The
wavelength is the distance from one peak to the next. Frequency is the number of waves per second passing a fixed
point.
View controls
View controls specify the method used to preview the Wave World effect. Choose one of the following views:
Height Map Displays the highest points as bright pixels and the lowest points as dark pixels. Use this view when
creating a displacement map.
Wireframe Preview Provides a visual depiction of how the wave is being created. The grayscale output represents a
height map: White represents the highest possible wave, and black represents the lowest. The two rectangular
outlines represent these two extremes: The cyan rectangle represents pure white, and the violet rectangle represents
pure black. The green grid represents the ground layer; it is flat by default but can be distorted by using a grayscale
image. The white grid represents the surface of the water.
AFTER EFFECTS CS3
User Guide
515
Wireframe controls
Wireframe controls fine-tune the appearance of the wireframe model. These controls don’t affect the grayscale
output.
Horizontal Rotation Rotates the wireframe preview around the horizontal axis (right and left). As you adjust this
control, the distortion of the wireframe model keeps the entire wireframe model in full view.
Vertical Rotation Rotates the wireframe preview around the vertical axis (up and down).
Vertical Scale Distortsthewireframepreviewverticallysothatyoucanseeheightsmoreeasily.Itdoesn’taffectthe
grayscale output.
Height Map controls
Height Map controls specify the appearance of the height map.
Note: WhileadjustingBrightnessandContrast,keepthewavesurfacelayerbetweenthecyanandvioletrectangles.Ifa
peak pokes through the cyan rectangle, it clips at pure white. If a trough pokes through the bottom of the violet rectangle,
it clips at pure black. If you want to create a displacement map, try to avoid clipping because it shows up as flat peaks
and valleys, which look unnatural.
Brightness Adjusts the overall height of the water surface. Adjusting it brightens or darkens the overall grayscale
output. If you use Wave World for displacement, this control moves the surface of the water up or down.
Contrast Changes the difference between the grays of the peaks and troughs, making the difference more or less
extreme. Lower values even out the grays, and higher values create a wider range from black to white (until clipping
occurs).
Gamma Adjustment ControlstheslopeofthewavesinrelationtotheBrightness.ResultsarevisibleonlyinHeight
Map view. Higher values result in rounder peaks and narrower valleys, while lower values result in smoother valleys
and pointier peaks.
Render Dry Areas As Specifies how the water surface is rendered when a dry area exists. Dry areas are created when
a portion of the ground layer rises above the surface of the water. You can manipulate the dry area by using the
Steepness control.
This control is useful for compositing a Wave World effect into a scene. For example, you can use a precomposed
Wave World scene with transparency as a displacement map for the Caustics effect, and as a track matte for the effect
layer.
Transparency Controls the clarity of the water by adjusting how opaque the alpha channel is in shallower areas. For
example, you can easily see to the bottom of a pool filled with fresh water, but you can see only an inch or two into
apoolfilledwithcoffee.ThiscontrolismostusefulwhencompositingaWaveWorldeffectintoanotherscene.For
example,youcanuseaWaveWorldcompositionasasourcelayerforCaustics,andalsoasatrackmattefortheeffect
layer.
Simulation controls
The Simulation controls specify the resolution of the water surface and ground grids.
Grid Resolution Specifies the number of horizontal and vertical divisions that make up the wave surface and ground
grids. Higher values greatly increase the precision of the simulation but require more memory and increase
rendering time.
Grid Res Downsamples Reduces the internal simulation resolution when the output resolution decreases, increasing
the rendering speed. However, the result may cause the output to look significantly different.
Wave Speed Specifies how fast waves travel away from their starting point.
AFTER EFFECTS CS3
User Guide
516
Damping Specifies how quickly a wave’s energy is absorbed by the liquid it travels through. The higher the value, the
quicker the wave energy is absorbed, and the shorter the distance the wave travels.
Wave Speed, Damping Specify the apparent viscosity of the liquid, and the apparent size of the body of liquid. For
example, waves in water move faster and farther than waves in honey; waves in a sink move much faster and fade out
much more quickly than waves in a lake.
Note: Wave World is optimized for small- to medium-sized bodies of water—anything from a teacup to a small lake.
Largebodiesofwater,likeanocean,includeswellsorwide,stablewaveswithnoapparentslowdown.Evenatthelowest
settings, Wave World cannot generate swells because the waves fade out relatively quickly.
Reflect Edges Specifies how waves bounce off the edges of the layer and back into the scene.
Pre-roll (seconds) Specifies when the waves start moving. By default, the effect starts with a still surface without
waves or ripples. Use this control to start the waves moving before the layer begins. The settings at the first frame of
the effect are applied to the layer during the pre-roll.
Ground controls
The Ground controls specify the appearance of the ground layer.
Ground Specifies the layer that appears at the bottom of the water. If you use an animated layer for the ground, Wave
World samples only the first frame. Wave World determines the intersection of the water’s surface with the edge of
the ground, computes the waves bouncing off the shore, and properly adjusts the speed of the waves depending on
the depth. The ground surface is determined by the layer’s brightness: White represents higher elevation, and black
represents lower elevation.
Steepness Adjusts the steepness of the ground by expanding and contracting the height of the displaced wireframe.
Themeshislockedattheblacklevel,soitalwaysgrowsupfromthebottom.Inotherwords,youcannotadjustthe
bottom of a canyon to be deeper; instead, you can adjust the rim to be higher. To make the canyon deeper, combine
a higher Steepness setting with a lower Height setting.
Height Controlsthedistancebetweenthewatersurfaceandtheground’sdeepestpossiblepoint.Usethiscontrolto
make the body of water deeper or shallower. When you change the depth of the water, the waves behave accordingly:
They move faster in deep water and slower in shallow water. (Adjusting the Height control when using the wireframe
preview may appear to lower the ground level, but the wireframe camera always moves with the water level.)
Wave Strength Controls how big the resulting waves are when the ground height or steepness is animated. A value
of 0 results in no waves.
Note: You can create a pulsing wave effect by animating the ground’s steepness so that the ground pokes through the
water, producing waves. Then use the Wave Strength control to intensify the effect.
Producer 1 and Producer 2 controls
The Producer controls specify the point at which the waves begin.
Type Specifies the type of producer. Ring creates a wave as if a stone were dropped into a pond; waves radiate
outward in circles (or ellipses, depending on the size settings of the effect point). Line creates waves that emanate
from the producer’s position in a line instead of an ellipse. This setting is useful for creating waves that look as though
they were generated from much farther away. The waves are produced perpendicular to the edges of the line. The
length of the line is based on the Height/Length setting.
Position Specifies the location of the center of the wave producer.
Height/Length Specifies the (vertical) height of a Ring producer and adjusts the length of a Line producer.
Width Specifies the (horizontal) width of the producer area.
AFTER EFFECTS CS3
User Guide
517
Angle Specifies the angle of the wave producer area for the Line and Ring types. This control sets the orientation of
the line and thus controls the initial direction of the waves, which emanate from either side of the line, perpendicular
to its length.
Amplitude Controls the height of the produced wave. Higher values create more dramatic waves but may result in
clipping, which you can repair by using the Brightness and Contrast controls.
Frequency Controls how many waves are produced per second. A value of 1 has the effect of waves surfacing once
every second.
Phase Specifies where in the wave phase the wave actually begins. For example, with the default setting of 0˚, the
first disturbance in the liquid is a convex wave (projecting upward from the surface of the water). With Phase set to
180˚, the first disturbance in the liquid is a concave wave.
Stylize effects
Brush Strokes effect
TheBrushStrokeseffectappliesaroughpaintedlooktoanimage.Youcanalsousethiseffecttoachieveapointillist
style by setting the length of the brush strokes to 0 and increasing the stroke density. Although you specify the
direction of strokes, they’re scattered randomly by a small amount to give a more natural result. This effect alters the
alpha channel, as well as the color channels; if you masked out a portion of the image, the brush strokes paint over
the edges of the mask.
This effect works with 8-bpc color.
Original (left), and with effect applied (right)
Stroke Angle The direction in which the strokes are made. The image is effectively shifted in this direction, poten-
tially causing some clipping at the layer boundaries.
Brush Size The size of the brush in pixels.
Stroke Length The maximum length of each stroke, in pixels.
Stroke Density Higher densities result in overlapping brush strokes.
Stroke Randomness Creates nonuniform strokes. The more randomness, the more the strokes vary from the brush
and stroke settings you’ve specified.
Paint Surface Specifies where brush strokes are applied:
•Paint On Original Image Puts the strokes on top of the unmodified layer. This setting is the default.
•Paint On Transparent Causes only the strokes themselves to appear, leaving the layer transparent between the
strokes.
•Paint On White/Paint On Black Applies strokes over a white or black background.
AFTER EFFECTS CS3
User Guide
518
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
Color Emboss effect
The Color Emboss effect works like the Emboss effect, without suppressing the image’s original colors.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
See also
“Emboss effect” on page 518
Emboss effect
The Emboss effect sharpens the edges of objects in an image and suppresses colors. The effect also highlights the
edgesfromaspecifiedangle.Thelayer’squalitysettinginfluencestheEmbosseffectbycontrollingtheReliefsetting.
Relief is calculated at the subpixel level in Best quality and rounded off to the pixel level in Draft quality.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Direction The direction from which the highlight source shines.
Relief The apparent height of the embossing, in pixels. The Relief setting actually controls the maximum width of
highlighted edges.
Contrast Determines the sharpness of the image.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the clip. For example, if you
set this value to 100%, the effect has no visible result on the clip; if you set this value to 0%, the original image doesn’t
show through.
AFTER EFFECTS CS3
User Guide
519
Find Edges effect
The Find Edges effect identifies the areas of an image that have significant transitions and emphasizes the edges.
Edges can appear as dark lines against a white background or colored lines against a black background. If the Find
Edges effect is applied, images often look like sketches or photographic negatives of the original.
Invert Inverts the image after the edges are found. If Invert isn’t selected, edges appear as dark lines on a white
background. If selected, edges appear as bright lines on a black background.
This effect works with 8-bpc color.
Glow effect
The Glow effect finds the brighter parts of an image and then brightens those and surrounding pixels to create a
diffuse, glowing aura. The Glow effect can also simulate overexposure of brightly lit objects. You can base the glow
on either the original colors of the image or on its alpha channel. Glows based on alpha channels produce diffuse
brightness only at the edges of the image, between the opaque and transparent regions. You can also use the Glow
effect to create a gradient glow between two colors (A and B colors) and to create multicolor effects with looping.
Rendering the Glow effect at Best quality can change the appearance of the layer. This change is especially true if you
use Adobe Photoshop arbitrary maps to color the glows. Be sure to preview at Best quality before you render the
effect.
Glows tend to be brighter and more realistic in 32-bpc projects. Consider working in 32-bpc color for this reason,
even if footage items don’t contain high–dynamic range color values.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (left), and with effect applied (right)
Glow Based OnDetermines whether glow is based on color values or transparency values.
Glow Threshold Sets a threshold as a percentage brightness to which the glow isn’t applied. A lower percentage
produces more glow; a higher percentage produces less.
Glow Radius The distance, in pixels, that the glow extends out from the bright areas of the image. Larger values
produce diffuse glows; smaller values produce glows with sharp edges.
Glow Intensity The brightness of the glow.
Composite Original Specifies how to composite the effect results with the layer. On Top places the glow on top of the
image, using the blending method selected for Glow Operation. Behind places the glow behind the image, creating
a backlighting result. None separates the glow from the image.
To reduce the layer to the glow only, choose None for Composite Original and None for Glow Operation. To achieve
a glow effect for text that knocks out (blocks) all layers below it, choose Silhouette Alpha for Glow Operation. These
glow effects are more noticeable if the image has a feathered edge.
Glow Colors Thecolorsoftheglow.A&BColorscreatesagradientglowusingthecolorsspecifiedbyColorAand
Color B controls.
AFTER EFFECTS CS3
User Guide
520
Color Looping The shape of the gradient curve to use if A & B Colors is selected for Glow Colors.
Color Loops Creates multicolor ringing in the glow, if you select two or more loops. A single loop cycles through the
gradient (or arbitrary map) specified for Glow Colors.
Color Phase Where in the color cycle to begin color loops. By default, color loops begin at the origin of the first loop.
A & B Midpoint The midpoint specifies the balance between the two colors used in the gradient. Lower percentages
use less of the A color. Higher percentages use less of the B color.
Color A, Color B The color of the glow if you choose A & B Colors for Glow Colors.
Glow Dimensions Specifies whether the glow is horizontal, vertical, or both.
Mosaic effect
The Mosaic effect fills a layer with solid-color rectangles, pixelating the original image. This effect is useful for
simulating low-resolution displays and for obscuring faces. You can also animate it for a transition. At Best quality,
the edges of the rectangles are anti-aliased.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Horizontal/Vertical Blocks The number of blocks in each row and column.
Sharp Colors Gives each tile the color of the pixel in the center of the corresponding region in the original image.
Otherwise, each tile is given the average color of the corresponding region in the original image.
Motion Tile effect
The Motion Tile effect replicates the source image across the output image. When you change the placement of the
tiles, it uses motion blur to accentuate the movement if motion blur is enabled.
This effect works with 8-bpc color.
Tile Center The center of the main tile.
Tile Width, Tile Height Dimensions of tiles as a percentage of the input layer dimensions.
Output Width, Output Height Dimensions of the output image as a percentage of the input layer dimensions.
Mirror Edges Flips adjacent tiles to form mirror images. If Phase is set to 0, selecting this option causes the edges of
the layer to be mirrored with the surrounding tiles.
Phase The horizontal or vertical offset of the tiles.
Horizontal Phase Shift Offsets tiles horizontally instead of vertically.
AFTER EFFECTS CS3
User Guide
521
Posterize effect
The Posterize effect lets you specify the number of tonal levels (or brightness values) for each channel in an image.
The Posterize effect then maps pixels to the closest matching level. For example, choosing two tonal levels in an RGB
image gives you two tones for red, two tones for green, and two tones for blue. Values range from 2 to 255.
Note: Another way to accomplish much the same result as the applying the Posterize Time effect to a layer is to
precompose the layer, change the frame rate for the precomposition in the Composition Settings dialog box, and set
Preserve Frame Rate When Nested Or In Render Queue for the precomposition on the Advanced tab. This causes the
precomposition to retain its own frame rate, and not inherit those settings from the containing composition.
Level The number of tonal levels for each channel.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
See also
“Nesting, precomposing, and pre-rendering” on page 113
“Work with composition settings” on page 110
Roughen Edges effect
The Roughen Edges effect makes an alpha channel rough and can add color to simulate rust and other kinds of
corrosion. This effect gives rasterized text or graphics a naturally rough look, like that of old typewriter text.
This effect works with 8-bpc color.
Original (left), and with effect applied (right)
Edge Type What kind of roughening to use.
Edge Color The color to apply to the edge for Rusty Color or Roughen Color, or to the fill for Photocopy Color.
Border How far, in pixels, the effect extends inward from the edge of the alpha channel.
Edge Sharpness Low values create softer edges. High values create sharper edges.
Fractal Influence The amount of roughening.
Scale The scale of the fractal used to calculate the roughness.
Stretch Width or Height The width or height of the fractal used to calculate the roughness.
AFTER EFFECTS CS3
User Guide
522
Offset (Turbulence) Determines the portion of the fractal shape that is used to create the roughness.
Complexity Determines the level of detail in the roughness.
Note: Increasing complexity results in longer rendering times. Reduce the Scale value rather than increasing Complexity
to achieve similar results.
Evolution Animating this setting results in changes of the roughness over time.
Note: Although the Evolution value is set in units called revolutions, it’s important to realize that these revolutions are
progressive. The Evolution state continues to progress infinitely at each new value. Use the Cycle Evolution option to
return the Evolution setting to its original state at each revolution.
Evolution Options EvolutionOptionsprovidecontrolsthatrendertheeffectforoneshortcycleandthenloopitfor
the duration of your layer. Use these controls to prerender your roughen elements into loops, and thus speed up
rendering time. Use the following controls to create a smooth, progressive, nonrepeating loop:
•Cycle Evolution Creates a loop that forces the Evolution state to return to its starting point.
•Cycle The number of revolutions of the Evolution setting that the fractal cycles through before it repeats. The
timing of the Evolution cycles is determined by the amount of time between Evolution keyframes.
Note: The Cycle control affects only the state of the fractal, not geometrics or other controls, so you can get different
results with different Size or Offset settings.
•Random Seed Specifies a value from which to generate the roughness texture. Animating this property results in
flashing from one set of fractal shapes to another within the same fractal type. For smooth transition of the
roughness, use the Evolution control.
Note: Create new roughness animations by reusing previously created Evolution cycles and changing only the Random
Seed value. Using a new Random Seed value alters the noise pattern without disturbing the Evolution animation.
Scatter effect
The Scatter effect scatters the pixels in a layer, creating a blurry or smeared appearance. Without changing the color
of each individual pixel, the Scatter effect redistributes the pixels randomly, but in the same general area as their
original positions.
This effect works with 8-bpc and 16-bpc color.
Original (left), and with effect applied (right)
Grain The direction in which to scatter the pixels—horizontally or vertically. Select None to scatter pixels in all
directions.
Scatter Randomness Specifies whether scattering changes at each frame. To animate scattering without keyframes
or expressions, select the Randomize Every Frame option.
AFTER EFFECTS CS3
User Guide
523
Strobe Light effect
The Strobe Light effect performs an arithmetic operation on a layer or makes the layer transparent at periodic or
random intervals. For example, every five seconds the layer could become completely transparent for one-tenth of a
second, or a layer’s colors could invert at random intervals.
This effect works with 8-bpc color.
Strobe Color The color of the strobe light.
Blend With Original The effect’s transparency. The result of the effect is blended with the original image, with the
effect result composited on top. The higher you set this value, the less the effect affects the layer. For example, if you
set this value to 100%, the effect has no visible result on the layer; if you set this value to 0%, the original image doesn’t
show through.
Strobe Duration (secs) How long, in seconds, each strobe lasts.
Strobe Period (secs) The time, in seconds, between the start of subsequent strobes.
Random Strobe Probability The probability that the strobe operation will apply to any given frame.
Strobe Choose Makes Layer Transparent for each strobe to make the layer transparent. Choose Operates On Color
Only to use the operation specified by Strobe Operator.
Strobe Operator The operation to use for each strobe.
Texturize effect
The Texturize effect gives a layer the appearance of having the texture of another layer. For example, you could make
theimageofatreeappearasifithadthetextureofbricks,andcontrolthedepthofthetextureandtheapparentlight
source. At Best quality, the texture layer is positioned and scaled with subpixel precision.
This effect works with 8-bpc color.
Original layers (left), and with whirl layer applied as the texture (bottom right)
Texture Layer The source of the texture.
Light Direction The angle at which light hits the texture.
Texture Contrast The magnitude of the result.
Texture Placement How the texture layer is applied to the effect layer:
•Tile Texture Applies the texture repeatedly.
AFTER EFFECTS CS3
User Guide
524
•Center Texture Positions the texture in the middle.
•Stretch Texture To Fit Stretches the texture to the dimensions of the effect layer.
Threshold effect
The Threshold effect converts grayscale or color images to high-contrast, black-and-white images. Specify a certain
level as a threshold; all pixels lighter than the threshold convert to white and all pixels darker convert to black.
This effect works with 8-bpc and 16-bpc color.
Effect applied with threshold settings of 44 (left), 70 (center), and 200 (right)
Text effects
Basic Text effect
The Basic Text effect places text on an existing layer—unlike text created on text layers or imported text created in
Adobe Photoshop or Adobe Illustrator, either of which becomes its own layer. Use text layers for greater control over
text formatting and text animation. (See Text.)
This effect works with 8-bpc color.
Original (top left) and after applying Basic Text (bottom left) and selecting Composite On Original (bottom right)
After Effects creates an alpha channel for text it creates. You can use a text effect’s alpha channel with features such
as track matte.
Note: The width and height of text aren’t constrained by the dimensions of the layer; the layer dimensions merely define
the visible region of the text. This feature makes it simple to scroll text over a layer.
Position The position of the text on the layer.
AFTER EFFECTS CS3
User Guide
525
Note: The behavior of the Position point is affected by the Alignment setting in the Basic Text dialog box. The point
always positions the vertical center of the text relative to the layer. However, if the text is left aligned, the point positions
the left edge; if the text is center aligned, the point positions the center; and if the text is right aligned, the point positions
the right edge.
Numbers effect
The Numbers effect generates random or sequential numbers in different formats, such as decimal number, dates,
and timecode—even the current date and time (at render time). The maximum offset for sequential numbers is
30,000.
Use text layers for greater control over text formatting and text animation. (See “Examples of text animation” on
page 295.)
ApplytheCurrentTimeFormatanimationpresettoatextlayertoshowthecurrenttimeintheformatcorresponding
to the project’s time display style.
This effect works with 8-bpc color.
Original (top left); after applying the Numbers effect (bottom left); and after setting Type to Numbers, Time, and Hexadecimal on three
different layers (bottom right)
The following options and values are available in the Font Style dialog box: Font, Style, Direction, and Alignment.
To open this dialog box again, click Options at the top of the effect’s entry in the Effect Controls panel.
Type The numbering system:
•Number Decimal numbers.
•Number [Leading Zeros] Decimal numbers with five digits to the left of the decimal point.
•Timecode [30], Timecode [25], and Timecode [24] Standard non-drop-frame timecode formats (XX:XX:XX:XX)
using the stated frame rate. The timecode types use the layer’s current time as the base.
•Time Hours and minutes. If you also select Current Time/Date, the Value/Offset/Random Max value is ignored.
If you select Random, the time is bounded by 0 (12:00 AM) and the slider value.
•Numerical Date, Short Date, and Long Date If you don’t also select Current Time/Date, the Value/Offset/Random
Max is the number of days since January 1, 1995 (0 on the slider corresponds to January 1, 1995). If you do select
Current Time/Date, Value/Offset/Random Max is the number of days since the current date (0 on the slider corre-
sponds to the current date). If you select Random, the date is bounded by 0 (either the current date or January 1,
1995) and the slider value.
AFTER EFFECTS CS3
User Guide
526
Note: Leap years are taken into consideration. Note that on some Mac operating systems, the clock starts on January 1,
1904, and doesn’t go beyond February 6, 2040.
•Hexadecimal Base-16 numbers (digits from 0 to F). Hexadecimal numbers increment by 0x1 for every 0.0000125
that the Value/Offset/Random Max value increases, and increments by 0x10000 for every 1.0 that the
Value/Offset/Random Max value increases. If you select Random, the number is bounded by 0 and the
Value/Offset/Random Max value.
Random Values Random values limited by the Value/Offset/Random Max value. If Value/Offset/Random Max is 0,
values are random across their maximum possible range.
Value/Offset/Random Max Varies based on the chosen type and whether or not Random Values is selected.
Decimal Places Specifies the number of places to the right of the decimal point.
Current Time/Date Select for time and date numbers to be based on the current time and date.
Position The position of the numbers on the layer.
Display Options Specifies the use of a fill or stroke or a combination of both on the text. Fill Only fills the characters
withacolor.StrokeOnlystrokestheedgesofthecharacterswithacolor.FillOverStrokeoverlapsthefillcoloronto
the stroke color. Stroke Over Fill overlaps the stroke color onto the fill color.
Size Size of the characters.
Tracking Average distance between characters.
Proportional Spacing Numbers use proportional spacing instead of monospacing.
Composite On Original Text is composited on top of the original image. If Composite On Original isn’t selected, the
original image isn’t visible.
Path Text effect
The Path Text effect lets you animate text along a path. You can define a path as a straight line, a circle of any
diameter, or a Bezier curve. You can also import a path created in another application, such as Adobe Photoshop or
Adobe Illustrator. The Path Text effect can work with nonsquare pixels, adjusting both character shape and path
shape accordingly.
Use text layers for greater control over text formatting and text animation. (See Text.)
This effect works with 8-bpc color.
Original (top left), after Path Text effect is applied (bottom left), and with Shape Type set to Bezier and Baseline Jitter and Scale Jitter values
increased (bottom right)
AFTER EFFECTS CS3
User Guide
527
Note: IfyouuseAdobeTypeManager(ATM)andlargetextlooksblockyordoesn’totherwiserenderproperly,increase
the Character Cache Size in the ATM control column.
When changing the shape of a Bezier path over time, make sure to create initial keyframes for all four path control
points; moving a control point without an initial keyframe doesn’t move it over time. You may find it easier to
animate a path by modifying the motion paths of individual control points in the Layer panel.
Note: Handles appear in the Composition panel only if the effect is selected in the Effect Controls panel and if you aren’t
animating text along a mask or path.
If you want to move a Bezier path across the composition, and you don’t want to change its shape, animate the layer
rather than the path. If you want to stretch, shrink, or wag one side of the Bezier path while keeping the other half
in the same position, move a tangent-vertex pair together. To do so, create keyframes for both by dragging the outer
circle of the appropriate vertex.
Note: When animating the control points of a Bezier path, don’t confuse the Bezier path shape with the Bezier spatial
interpolation of the keyframes. Like keyframes for other position controls, those for the vertex or tangent of a Bezier path
can be set to either linear or Bezier. The default spatial interpolation is specified in General Preferences. Spatial interpo-
lation can be selected for individual keyframes by choosing Animation > Keyframe Interpolation.
You can apply motion blur to motion that you create with the Path Text effect. Blurring occurs on each character.
Like motion blur for layers, blurring for characters is more visible when movement is quick. For example, blurring
is quite pronounced when you choose negative jitter values, which produce jumpy motion.
Path Options controls
Shape Type Defines the shape of the path. The Path Text effect name must be selected in the Effect Controls panel
to make the path visible in the Composition panel.
•Bezier Shapes text along a Bezier curve, defined by four control points (Vertex 1/Circle Center, Tangent 1/Circle
Point, Tangent 2, and Vertex 2). Characters that don’t fit on the path are placed off the end in a straight line.
•Circle Shapes text around the circumference of a circle, defined by two control points (Tangent 1/Circle Point, and
Vertex 1/Circle Center). If the text is longer than the circumference of the circle, the text overlaps itself. If an arbitrary
path is chosen and if the path is closed, this property forms the text around the path, as opposed to looping it.
•Loop Shapes text around the circumference of the circle, defined by two control points (Vertex 1/Circle Center,
and Tangent 1/Circle Point). If text is longer than the circumference of the circle, it flows off the Tangent 1 point in
a straight line. You can also use margin controls to make text enter or exit a circle in a straight line.
•Line Shapes text in a straight line, defined by two control points (Vertex 1/Circle Center, and Vertex 2). Note that,
as with the Bezier path, the distance between the two control points doesn’t affect the spacing of the text, unless
alignment is set to Force.
Control Points Specify the points on the path.
•Tangent 1/Circle Point Specifies the following points: starting tangent for a Bezier curve, diameter of a circle and
starting or ending point of text (depending on the specified alignment), and diameter of a loop and the point where
text enters.
•Vertex 1/Circle Center Specifies the starting vertex for a Bezier curve, center of a circle or loop, and starting or
ending point for text on a line (depending on the specified alignment).
•Tangent 2 Specifies the ending tangent of the Bezier curve. The line between Tangent 2 and Vertex 2 specifies the
slope of the curve at its ending point. For circles or loops, Tangent 2 is ignored.
AFTER EFFECTS CS3
User Guide
528
•Vertex 2 Specifies the ending vertex of a Bezier curve and the angle of a line. For circles or loops, Vertex 2 is
ignored.
Custom Path Specifies an arbitrary path. You can use a mask created in the Layer panel or in Adobe Illustrator.
Reverse Path Reverses the path.
Character controls
Size Size of the characters.
Tracking Average distance between characters.
Kerning Controls the horizontal distance between two characters. If you change the text, specified kerning is
preserved for all unchanged character pairs. You cannot use the Undo command to undo kerning changes. To change
horizontal spacing between characters over time, use Kerning Jitter Max or create keyframes for Tracking.
•Kerning Pair Specifies the pair of characters to kern. Click the arrow to move among the pairs.
•Kerning Value The amount of kerning to apply.
Orientation Specifies the orientation or rotation values of each character.
•Character Rotation Each character is rotated by the specified number of degrees from its current angle. The center
of rotation is on the point where the character intersects the path. Note that Perpendicular To Path changes the initial
angle of the characters.
•Perpendicular To Path Rotates each character so that it’s perpendicular to the path. If Perpendicular To Path is
deselected, characters always remain upright (unless rotated by Character Rotation).
•Vertical Writing Rotates each character so it’s vertical along the path.
•Rotate Roman Characters Rotates Roman characters vertically along the path; if Rotate Roman Characters isn’t
selected, only non-Roman characters are rotated.
Horizontal Shear Slants characters left or right, similar to italics. The slant is based on the point where the character
intersects the path. To slant characters from their centers, set Baseline Shift to make the path go through the centers
of the characters.
Horizontal Scale, Vertical Scale Resize the characters by the specified percentage in the horizontal and vertical direc-
tions. Text is scaled from the initial rasterization size, specified for Size. Setting the scaling percentage greater than
100 may result in blurred edges. For best results, set Size to a point size that doesn’t require scaling beyond 100% to
achieve the largest desired text size. For example, to increase the size text from 48 to 88 points, set Size to 88 and
specify a starting value for both Vertical and Horizontal Scale at 55%; then increase both scale values to 100% if you
want the text displayed at 88 points.
Paragraph controls
Alignment Specifies the horizontal alignment of the text on the specified path.
•Left Places the first character at the position specified by Left Margin; all other characters are drawn relative to it.
Right Margin is ignored.
•Right Places the last character at the position specified by Right Margin; all other characters are drawn relative to
it. Left Margin is ignored.
•Center Centers the text between Left Margin and Right Margin.
•Force Places the first character at the position specified by Left Margin and the last character at the position
specified by Right Margin, spacing all other characters evenly between. Tracking is ignored.
AFTER EFFECTS CS3
User Guide
529
Left Margin, Right Margin Specify the margins. Left Margin specifies the position of the first character in pixels,
relative to the starting point; Right Margin specifies the position of the last character, relative to the ending point. In
path shapes, the starting point for Bezier curves and lines is Vertex 1, and the starting point for circles and loops is
Tangent 1. The ending point for Bezier curves and lines is Vertex 2, and the ending point for circles and loops is
Tangent 1. To move text across the path shape that you’ve defined, create keyframes or expressions for the Left or
Right margins (depending on the specified alignment). Positive values move the text to the right; negative values
move it to the left.
Line Spacing Specifies the space between lines of characters.
Baseline Shift Specifies the distance in pixels between the path and the bottom of the characters. Depending on the
path shape, text may appear to be better spaced if the path passes through the centers of the characters. You can set
Baseline Shift to a negative value so that the centers of characters lie on the path.
Advanced controls
Visible Characters The number of characters that appear at the current time. Animate Visible Characters to display
one or more characters at a time to create the appearance of typing characters. Positive values specify the number of
visible characters from the beginning of the text to the end. Negative values specify the number of visible characters
from the end of the text to the beginning. Remember that spaces are characters, too.
YoucanalsousethiscontrolwithFadeTimetofadeincharacters.WhenFadeTimeis0,thenextcharacterappears
when the value of Visible Characters is halfway to the next whole number. For example, the second character appears
when the value of Visible Characters is 1.5, the third character appears when the value is 2.5, and so on. A Fade Time
value of 0 produces the appearance of typing characters.
Note: Visible Characters doesn’t alter the positions of characters defined by the path and other controls.
Fade Time Specifies a range of time over which a particular character is partially visible. Fade Time works in
conjunction with Visible Characters. If Fade Time is 0, each letter appears fully opaque at the appropriate Visible
Characters value. If Fade Time is 100%, a particular character is displayed with greater and greater opacity as the
value of Visible Characters increases between whole numbers. The exact opacity of the character is equal to the
fractional part of the Visible Characters value. For example, the eighth character is displayed at 10% opacity if the
value of Visible Characters is 7.10 and Fade Time is 100%; the same character is displayed at 60% opacity if the value
of Visible Characters is 7.60, and so on.
For Fade Time values between 0 and 100%, the opacity of the character is defined as a range across the halfway point
between whole-number values of Visible Characters. For example, if Fade Time is 20%, the eighth character begins
to appear at a Visible Character value of 7.40 and is fully opaque at 7.60. If Fade Time is set to 60%, the same character
begins to appear at a value of 7.20 and is fully opaque at 7.80.
Mode The blending mode used if characters overlap.
Jitter Settings Specify the maximum amount of deviation added randomly to baseline, kerning, rotation, or scale.
Higher values produce greater deviations. Positive values produce smooth motion; negative values produce jumpy
motion. Movement is created without keyframes or expressions, although you can use keyframes or expressions to
change the maximum values.
A specific jitter value generates the same seemingly random motion for identical text and settings. If a composition
contains duplicate animated text, you can generate different motion for each instance of the text by changing a setting
butmakingthechangeinvisible.Forexample,youcouldaddaspacetoasecondinstanceoftext,andthenadjustthe
kerning so that the space isn’t visible. This method creates an invisible change that will generate different motion.
AFTER EFFECTS CS3
User Guide
530
You can specify the following Jitter options:
•Baseline Jitter Max Sets a maximum distance, in pixels, that characters are randomly moved above or below the
path after Baseline Shift is applied.
•Kerning Jitter Max Sets a maximum distance, in pixels, that characters are randomly moved apart from one
another along the horizontal axis after kerning and tracking are applied.
•Rotation Jitter Max Sets a maximum amount, in degrees, that characters are randomly rotated after Character
Rotation is applied.
•Scale Jitter Max Sets a maximum amount, as a percentage, that characters are randomly scaled after Horizontal
Scale and Vertical Scale are applied. For best results, characters should not scale greater than 100%.
Move vertices, circle centers, and tangents
•To move the Vertex 1/Circle Center and the Tangent 1/Circle Point together, drag the outer circle of the Vertex
1/Circle Center.
•To move only the Vertex 1/Circle Center, drag its cross hair.
•To automatically snap the Tangent 1/Circle Point on top of the Vertex 1/Circle Center, select the Pen tool and then
click the outer circle of Tangent 1 (Windows) or Command-click the outer circle (not the cross hair) of Tangent 1
(Mac OS).
•To snap the Tangent 1/Circle Point to increments of 45˚ from the Vertex 1/Circle Center, Shift-drag the outer circle
of Tangent 1.
•To move Vertex 2 and Tangent 2 together, drag the outer circle of Vertex 2.
•To move only Vertex 2, drag its cross hair.
Timecode effect
The Timecode effect creates a text overlay that displays timecode or frame number information on a layer. This effect
doesn’t modify timecode embedded from external sources, such as QuickTime.
Use text layers for greater control over text formatting and text animation. (See Text.)
ApplytheCurrentTimeFormatanimationpresettoatextlayertoshowthecurrenttimeintheformatcorresponding
to the project’s time display style.
This effect works with 8-bpc color.
Display Format Specifies whether timecode is displayed in the SMPTE format, in frame numbers, or in feet and
frames of 35mm or 16mm film.
Time Units Frame rate in frames per second (fps) to be used by this instance of the Timecode effect. This setting
affects only the numbers displayed by the Timecode effect; it has no influence on composition frame rate or the
frame rate of the layer’s source footage item.
Drop Frame Select Drop Frame to generate drop-frame timecode or deselect it to generate non-drop-frame
timecode.
Starting Frame The frame number assigned to the first frame of the layer.
Text Position The position of the text overlay, in composition space.
Text Size The size of text, in points.
AFTER EFFECTS CS3
User Guide
531
Time effects
Echo effect
The Echo effect combines frames from different times in a layer. The Echo effect has a variety of uses, from a simple
visual echo to streaking and smearing effects. The results of this effect are visible only if there is change across time
in the layer, such as motion.
Note: A layer’s masks and any previously applied effects are ignored by the Echo effect. To echo the frames of a layer with
its masks and effects, precompose the layer before applying the Echo effect.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Echo effect
David Van Brink provides a blog post and sample project that show how to use the Echo effect, the Particle
Playground effect, and the loopOut expression to animate a swarm of stylized swimming bacteria:
www.adobe.com/go/learn_ae_ominosalmonella.
Echo Time (seconds) The time, in seconds, between echoes. Negative values create echoes from previous frames;
positive values create echoes from upcoming frames.
Number of Echoes The number of echoes. For example, if the value is 2, the result is a combination of three frames:
the current time, the current time + Echo Time, and the current time + (2 * Echo Time).
Starting Intensity The opacity of the first image in the echo sequence.
Decay Theratiooftheopacityofanechototheopacityoftheechoprecedingitintheechosequence.Forexample,
if Decay is 0.5, then the opacity of the first echo is half of the Starting Intensity; the second echo is half of that, or one
quarter of the Starting Intensity.
Echo Operator The blending operation used to combine the echoes.
•Add Combines the echoes by adding their pixel values. If the starting intensity is too high, this mode can quickly
overload and produce streaks of white.
•Maximum Combines the echoes by taking the maximum pixel values from all of the echoes.
•Minimum Combines the echoes by taking the minimum pixel values from all of the echoes.
•Screen Emulates combining the echoes by sandwiching them optically. This mode is similar to Add, but it won’t
overload as quickly.
•Composite In Back Causes the image from the current time to appear in back, with each echo appearing succes-
sively farther forward in the composite.
•Composite In Front Causes the image from the current time to appear in front, with each echo appearing succes-
sively farther back in the composite.
•Blend Averages the echoes.
AFTER EFFECTS CS3
User Guide
532
See also
“Precompose layers” on page 114
Posterize Time effect
The Posterize Time effect locks a layer to a specific frame rate. It’s useful on its own as a special effect, but it also has
more subtle uses. For example, 60-field-per-second video footage can be locked to 24 frames per second (and then
field rendered at 60 fields per second) to give a filmlike look. Also, nested compositions can be locked to a given
frame rate. This effect is sometimes called Strobe in hardware devices.
Note: A layer’s masks and any previously applied effects are ignored by the Posterize Time effect. To posterize the time
of a layer with its masks and effects, precompose the layer before applying the Posterize Time effect.
Animating the value of the Frame Rate slider can give unpredictable results. For this reason, the only interpolation
method allowed for the frame rate is Hold.
This effect works with 8-bpc and 16-bpc color.
Posterize Time effect
See also
“Precompose layers” on page 114
Time Difference effect
The Time Difference effect calculates the color difference between two layers and is a useful aid in color correction;
use it to extract color differences when matching a clean background plate with foreground footage. It’s also good for
creating mattes to be used to apply trails of smoke, fire, or echoing effects. Once you’ve applied Time Difference to
locate color differences in footage, use color and levels controls to apply the color corrections.
This effect works with 8-bpc color.
Time Difference effect
Use Time Difference with Particle Playground to shed particles only from moving sections.
Target Specifies the layer to be compared to the effect layer. The comparison layer’s Video switch doesn’t need to be
on (unless you select the source layer as the Target).
AFTER EFFECTS CS3
User Guide
533
Time Offset The relative time in the comparison layer, in seconds, where the layers are compared. If this control is
set to 0.00, the comparison occurs at the current time. To compare the effect layer to a point 3 seconds into the
comparison layer, for example, change the Time Offset value to 3. When you select the underlined offset value, you
can enter the specific frame offset value in the format frames/frame rate. After Effects automatically calculates the
value. For example, enter 3/30 to offset three frames forward in a 30-fps composition. The calculated value is 0.1, or
10% of the total time.
Contrast Adjusts the comparison result. This control can be especially helpful in fine-tuning color corrections.
Absolute Difference Displays the result of the comparison as an absolute value. Any area of the comparison layer
that isn’t different from the effect layer is represented by black, and any amount of difference is represented as
brighter than black. If this option is unselected, compared areas with no difference are represented as gray.
Alpha Channel Specifies how the alpha channel is calculated.
•Original Uses the effect layer’s alpha channel.
•Target Uses the target layer’s alpha channel.
•Blend Blends the effect and target layers’ alpha channels.
•Max Uses the most opaque of the original source and Target layers’ alpha channels.
•Full OnSets the alpha channel to completely opaque.
•Lightness Of Result Uses the lightness of the RGB difference as alpha.
•Max Of Result Uses the highest values of the RGB difference as alpha.
•Alpha Difference Calculates differences in the effect and target layers’ alpha channels the same way RGB
difference is calculated.
•Alpha Difference Only Calculates only the differences in the alpha channels. RGB is set to white.
Time Displacement effect
The Time Displacement effect distorts the image by shifting pixels across time, producing a wide variety of effects.
For example, the traditional slit-scan technique, which captures different stages of a moving image across time, can
be simulated using the Time Displacement effect.
This effect works with 8-bpc and 16-bpc color.
Time Displacement effect
Like the Displacement Map effect, the Time Displacement effect uses a displacement map, but it bases the movement
of pixels in the layer on luminance values in the map. Pixels in the layer that correspond to bright areas in the
displacement map are replaced by pixels in the same position but at a specified number of seconds forward in time.
Likewise, pixels in the layer that correspond to dark areas in the displacement map are replaced by pixels at a
specified number of seconds backward in time. You can use any layer as a displacement map, though using a
grayscale image lets you more easily see brightness levels and predict how pixels will be displaced.
AFTER EFFECTS CS3
User Guide
534
TheTimeDisplacementeffectautomaticallyreplacespixelsacrosstimewithoutkeyframesorexpressions.However,
you can animate other properties to vary the effect over time.
To better understand how pixels are displaced in time, think of the displacement occurring in steps, as follows:
1After Effects overlays the displacement map layer on top of the effect layer (the layer you’re distorting). If the
dimensions of the displacement map are different from those of the effect layer, you can specify whether the map is
centered or stretched to fit.
2You specify a maximum displacement amount, in seconds.
3After Effect uses the luminance value of each pixel in the displacement map to calculate the displacement of the
corresponding pixel in the effect layer, based on the maximum displacement amount.
In grayscale images, the luminance value range extends from 0 to 255, and it’s converted to a scale ranging from -1
to 1. A luminance value of 0 produces maximum backward displacement, meaning that pixels at the current time are
replaced by pixels from a previous time. A luminance value of 255 produces maximum positive displacement,
meaningthatpixelsatthecurrenttimearereplacedbythoseatafuturetime.Aluminancevalueof128producesno
displacement. For other values in grayscale displacement maps, you can calculate the displacement amount, in
seconds, using the following equation:
Displacement amount in seconds = maximum_displacement_time * (2 * (luminance_value – 128) / 256)
4After Effects displaces each pixel in the image by replacing a pixel in the image at the current time with the pixel
in the same position at another time. The other time is the displacement amount in seconds for the pixel, calculated
in step 3.
Suppose you specified 2 seconds as the maximum time displacement. After Effects finds the luminance value of each
pixel in the displacement map, and then it replaces the corresponding pixels at the current time with pixels from
another time based on the maximum time of 2 seconds. A luminance value of 255 in the displacement map replaces
that pixel with the pixel 2 seconds ahead in the same position. A luminance value of 42 replaces that pixel with the
pixel 1.34 seconds behind in the same position.
Time Displacement Layer Specifies the layer to use as the displacement map.
Max Displacement Time (sec) Sets the maximum time, in seconds, from which pixels are replaced, before or after the
current time. Note that only luminance values of 0 or 255 (maximum darkness and maximum brightness) produce
the maximum time. All other luminance values produce times less than the maximum time.
Time Resolution (fps)
Sets the number of frames per second in which to replace pixels. Typically, this value shouldn’t
be greater than the frame rate of the affected layer. Increasing Time Resolution can significantly increase rendering time.
Stretch Map To Fit Resizes the Time Displacement Layer to match the dimensions of the layer you’re distorting. If
this option isn’t selected, the time displacement layer is centered in the composition.
Apply the Time Displacement effect
1In the Composition panel, display both the layer you want to distort and the displacement map layer.
2Hide the displacement map layer by clicking the Video switch in the Timeline panel.
3In the Composition panel, select the layer you want to distort.
4Choose Effect > Time > Time Displacement.
5Choose a displacement map from the Time Displacement Layer menu, which lists all layers in the composition.
Grayscale maps are recommended.
AFTER EFFECTS CS3
User Guide
535
Note: After Effects uses the layer you select in its original form, without any masking, effects, or transformations you
may have applied. If you want to use the layer with those alterations included in the displacement map, precompose that
layer using the Move All Attributes into the New Composition option. (See “Precompose layers” on page 114.)
6Adjust the Time Displacement controls.
Timewarp effect
The Timewarp effect gives you precise control over a wide range of parameters when changing the playback speed
of a layer, including interpolation methods, motion blur, and source cropping to eliminate unwanted artifacts. The
Timewarp effect works independently of the Frame Blending switch in the Timeline panel.
Note: The Timewarp effect does not work on fields for interlaced footage. To use the Timewarp effect on a layer with an
interlaced footage item as its source, double the frame rate in the composition settings. When you render to final output,
modify your render settings in the Render Queue panel to set the frame rate appropriate for the output type.
This effect works with 8-bpc and 16-bpc color.
Timewarp effect
Method options
These options determine how interpolated frames are generated:
Whole Frames Duplicates the last frame shown.
Frame Mix Creates a new frame by blending existing frames.
Pixel Motion Creates a new frame by analyzing the pixel movement in nearby frames and creating motion vectors.
Adjust Time By controls
Choose Speed to specify a time adjustment as a percentage. Choose Source Frame to specify a time adjustment by
identifying which source frame is to play at which time. If you choose Source Frame for Adjust Time By, then you
must animate the Source Frame property to do anything other than freeze on one frame.
Tuning controls for Pixel Motion interpolation
Vector Details Determines how many motion vectors are used during interpolation. The more vectors used, the
longer the rendering time. A value of 100 produces one vector per pixel. If the layer has fast-moving motion, it may
look better with a lower Vector Details setting.
Smoothing These controls affect the sharpness of the image:
•Build From One Image Generates the final output from the closest single frame, as opposed to the closest two
frames. The result is a sharper image, but jerkier motion.
•Correct Luminance Changes Equalizes the luminance between frames before calculating motion.
•Filtering The quality of the filtering used to build the interpolated image. Extreme greatly increases rendering
time. The Filtering option affects only the sharpness of the final image; use Normal until you’re ready for final
rendering.
AFTER EFFECTS CS3
User Guide
536
Error Threshold Determines the precision of pixel matching from one frame to the next. A higher value results in
fewer motion vectors and more blending.
Note: If you see edge tearing in the image, try increasing the Error Threshold for more blending. If the image has heavy
grain, try decreasing the Error Threshold so the low-level motion of the grain is ignored.
Block Size Adjusts the size of the blocks used to calculate the vectors.
Weighting Controls the weighting of the red, green, and blue channels in calculations used to analyze the image. For
example, setting Red Weight and Green Weight to zero means that only the blue channel is analyzed for motion.
Motion Blur controls
Shutter Angle Determines the intensity of motion blur. The shutter angle is measured in degrees, simulating the
exposure caused by a rotating shutter. Simulated exposure time is determined by dividing the shutter angle by the
frame rate times 360˚. For example, a shutter angle of 90˚ causes an exposure of 1/96 of a second per frame: 90˚ /
(360˚ * 24 fps).
Shutter Samples Controls the quality of the motion blur. A higher value results in a smoother motion blur.
Matte, warp, and crop controls
Matte Layer Thelayertouseasamattefordefiningtheforegroundandbackgroundareasoftheimage.Whiteareas
in the matte represent the foreground, black areas represent the background, and gray attenuates between
foreground and background.
Matte Channel The channel to use as a matte.
Warp Layer Allows you to warp the layer to which the effect is applied by applying the motion vectors from the layer
that you choose.
Show Controls the portion of the layer to be time-remapped.
Source Crops If the image contains unwanted pixels or artifacts at the edges, use Source Crops controls to specify
image boundaries. Pixels from the boundaries are repeated to fill the area beyond the boundaries to the layer’s edges.
See also
“Work with composition settings” on page 110
“Work with render settings” on page 597
Transition effects
About Transition effects
All Transition effects but the Iris Wipe effect have a Transition Completion property. When this property is 100%,
the transition is complete, and the underlying layers show through; the layer to which the effect is applied is entirely
transparent. You typically animate this property from 0% to 100% over the time of the transition.
For an example of how to use animation presets to create custom transitions, see this entry in Stu Maschwitz's blog:
www.adobe.com/go/learn_ae_stufilmburn. From this page, you can download the Film Burn animation preset,
which adds film-like flicker to layers and adds a film burn transition to the ends of layers' durations.
AFTER EFFECTS CS3
User Guide
537
See also
“About animation, keyframes, and expressions” on page 183
Block Dissolve effect
The Block Dissolve effect makes a layer disappear in random blocks. The width and height of the blocks, in pixels,
can be set independently. At Draft quality, the blocks are placed with pixel precision and have sharply defined edges;
at Best quality, the blocks can be positioned with subpixel precision and have soft edges.
This effect works with 8-bpc and 16-bpc color.
Original (top left), and with effect applied (bottom left and right)
Card Wipe effect
This effect simulates a group of cards displaying a picture and then flipping to display another picture. Card Wipe
provides control over the number of rows and columns of cards, the flip direction, and the transition direction
(including the ability to use a gradient to determine flip order). You can also control randomness and jitter to make
the effect appear more realistic. By varying the rows and columns, you can also create venetian blind and Chinese
lantern effects.
The Card Wipe effect shares many controls with the Card Dance effect.
This effect works with 8-bpc color.
Original (top left), and with effect applied (bottom left and right)
AFTER EFFECTS CS3
User Guide
538
See also
“About randomness and random seeds” on page 354
“Common Lighting controls and Material controls” on page 486
Basic controls
Transition Width The width of the area that actively changes from the original to the new image.
Back Layer The layer that appears in segments on the backs of the cards. You can use any layer in the composition;
its Video switch can even be turned off. If the layer has effects or masks, precompose the layer first.
Rows & Columns Specifies the interaction of the numbers of rows and columns. Independent makes both the Rows
and Columns sliders active. Columns Follows Rows makes only the Rows slider active. If you choose this option, the
number of columns is always the same as the number of rows.
Rows The number of rows, up to 1000.
Columns The number of columns, up to 1000, unless Columns Follows Rows is selected.
Note: Rows and columns are always evenly distributed across a layer, so unusually shaped rectangular tiles don’t appear
along the edges of a layer, unless you’re using an alpha channel.
Card Scale The size of the cards. A value smaller than 1 scales the cards down, revealing the underlying layer in the
gaps. A value greater than 1 scales the cards up, creating a blocky mosaic as they overlap each other.
Flip Axis The axis around which each card flips.
Flip Direction The direction in which the cards flip around their axes.
Flip Order The direction in which the transition occurs. You can also use a gradient to define a custom flip order:
Cards flip first where the gradient is black and last where the gradient is white.
Gradient Layer The gradient layer to use for the Flip Order. You can use any layer in the composition.
Timing Randomness Randomizes the timing of the transition. If this control is set to 0, the cards flip in order. The
higher the value, the more random the order in which the cards flip.
Camera System Whether to use the effect’s Camera Position properties, the effect’s Corner Pins properties, or the
default composition camera and light positions to render 3D images of the cards.
Camera Position controls
X Rotation, Y Rotation, Z Rotation Rotate the camera around the corresponding axis. Use these controls to look at
the cards from the top, side, back, or any other angle.
X, Y Position Where the camera is positioned in x,y space.
Z Position Where the camera is positioned along the z axis. Smaller numbers move the camera closer to the cards,
and larger numbers move the camera away from the cards.
Focal Length The zoom factor. Smaller numbers zoom in.
Transform Order The order in which the camera rotates around its three axes, and whether the camera rotates before
or after it’s positioned using the other Camera Position controls.
AFTER EFFECTS CS3
User Guide
539
Corner Pins controls
CornerPinningisanalternativecameracontrolsystem.Useitasanaidforcompositingtheresultoftheeffectinto
a scene on a flat surface that is tilted with respect to the frame.
Upper Left Corner, Upper Right Corner, Lower Left Corner, Lower Right Corner Where to attach each of the corners
of the layer.
Auto Focal Length Controls the perspective of the effect during the animation. If Auto Focal Length is unselected,
thefocallengthyouspecifyisusedtofindacamerapositionandorientationthatpositionsthecornersofthelayer
at the corner pins, if possible. If not, the layer is replaced by its outline, drawn between the pins. If Auto Focal Length
is selected, the focal length required to match the corner points is used, if possible. If not, it interpolates the correct
value from nearby frames.
Focal Length Overrides the other settings if the results you’ve obtained aren’t what you need. If you set the Focal
Length to something that doesn’t correspond to what the focal length would be if the pins were actually in that
configuration, the image may look unusual (strangely sheared, for example). But if you know the focal length that
you are trying to match, this control is the easiest way to get correct results.
Jitter controls
Adding jitter (Position Jitter and Rotation Jitter) makes this transition more realistic. Jitter works on the cards before,
during, and after the transition occurs. If you want the jitter to happen only during the transition, start with the Jitter
Amount at 0, animate it up to the desired amount during the transition, and then animate it back down to 0 at the
completion of the transition.
Position Jitter Specifies the amount and speed of jitter at the x, y, and z axes. X, Y, and Z Jitter Amount specify the
amountofextraneousmovement.TheX,Y,andZJitterSpeedvaluesspecifythespeedofjitterforeachJitterAmount
option.
Rotation Jitter Specifies the amount and speed of rotation jitter around the x, y, and z axes. X, Y, and Z Rotation Jitter
Amount specify the amount of rotational jitter along an axis. A value of 90˚ makes it possible for a card to rotate up
to 90˚ in either direction. The X, Y, and Z Rot Jitter Speed values specify the speed of rotational jitter.
Gradient Wipe effect
The Gradient Wipe effect causes pixels in the layer to become transparent based on the luminance values of corre-
sponding pixels in another layer, called the gradient layer. Dark pixels in the gradient layer cause the corresponding
pixels to become transparent at a lower Transition Completion value. For example, a simple grayscale gradient layer
thatgoesfromblackonthelefttowhiteontherightcausestheunderlyinglayertoberevealedfromlefttorightas
Transition Completion increases.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
540
Original (top left), and with effect applied (bottom left and right)
Thegradientlayercanbeastillimageoramovingimage.Thegradientlayermustbeinthesamecompositionasthe
layer to which you apply Gradient Wipe.
You can create gradient layers in many ways, such as using the Ramp effect or creating them in Photoshop or
Illustrator.
Transition Softness The degree to which the transition is gradual for each pixel. If this value is 0%, pixels in the layer
to which the effect is applied are either completely opaque or completely transparent. If this value is greater than 0%,
pixels are semitransparent at the intermediate stages of the transition.
Gradient Placement How the gradient layer’s pixels are mapped to the pixels of the layer to which the effect is
applied:
•Tile Gradient Uses multiple tiled copies of the gradient layer.
•Center Gradient Uses a single instance of the gradient layer in the center of the layer.
•Stretch Gradient To Fit Resizes the gradient layer horizontally and vertically to fit the entire area of the layer.
Invert Gradient Inverts the gradient layer’s influence; lighter pixels in the gradient layer create transparency at a
lower Transition Completion value than do darker pixels.
Iris Wipe effect
The Iris Wipe effect creates a radial transition that reveals an underlying layer. Specify the number of points used to
create the iris using a range of 6 to 32 points, and specify whether an inner radius is used. If Use Inner Radius is
selected, you can specify values for both Inner Radius and Outer Radius; the iris isn’t visible if Outer Radius, Inner
Radius, or both are set to 0. The iris is roundest if both Outer Radius and Inner Radius are set to the same value.
TheIrisWipeeffectistheonlyTransitioneffectthatdoesn’thaveaTransitionCompletionproperty.Toanimatethe
Iris Wipe effect to expose the underlying layers, animate the Radius properties.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
541
Original (top left), and with effect applied (bottom left and right)
Linear Wipe effect
The Linear Wipe effect performs a simple linear wipe of a layer in a specified direction. At Draft quality, the edge of
the wipe isn’t anti-aliased; at Best quality, the edge of the wipe is anti-aliased and the feather is smooth.
Wipe Angle The direction that the wipe travels. For example, at 90˚ the wipe travels from left to right.
This effect works with 8-bpc and 16-bpc color.
Original (top left), and with effect applied (bottom left and right)
Radial Wipe effect
TheRadialWipeeffectrevealsanunderlyinglayerusingawipethatcirclesaroundaspecifiedpoint.AtBestquality,
the edges of the wipe are anti-aliased.
Start Angle The angle at which the transition starts. With a start angle of 0˚, the transition starts at the top.
Wipe Specifies whether the transition moves clockwise or counterclockwise, or alternates between the two.
This effect works with 8-bpc and 16-bpc color.
AFTER EFFECTS CS3
User Guide
542
Original (top left), and with effect applied (bottom left and right)
Venetian Blinds effect
The Venetian Blinds effect reveals an underlying layer using strips of specified direction and width. At Draft quality,
the strips are animated with pixel precision; at Best quality, the strips are animated with subpixel precision.
This effect works with 8-bpc and 16-bpc color.
Original (top left), and with effect applied (bottom left and right)
Utility effects
Cineon Converter effect
The Cineon Converter effect provides a high degree of control over color conversions of Cineon frames, but in most
cases you should convert the colors in a Cineon file using color management features. (See “Working with Cineon
footage items” on page 251.)
TousetheCineonConvertereffect,importaCineonfileandleaveitinitsdefaultstate;AfterEffectseithercondenses
the colors to 8 bpc or expands them to 16 bpc, depending on the mode you work in. You can then apply the Cineon
Converter effect to the file and precisely adjust the colors while interactively viewing the results in the Composition
panel. You can set keyframes or expressions to adjust for changes in tone over time—use keyframe interpolation and
ease handles to precisely match the most irregular lighting changes. Consider using other Color Correction effects
to perform these corrections instead. (See “Color Correction effects” on page 387.)
AFTER EFFECTS CS3
User Guide
543
The 10 bits of data available in each Cineon channel for each pixel make it easier to enhance an important range of
tones while preserving overall tonal balance. By carefully specifying the range, you can create a version of the image
that faithfully resembles the original.
Note: Each computer monitor has unique display characteristics that affect your perception of color on-screen. For best
results when evaluating tonal balance, use the Info panel in After Effects to see the true color values of pixels as you move
the pointer over them.
Conversion Type How the Cineon file is converted. Log To Linear converts an 8-bpc logarithmic non-Cineon layer
that you plan to render as a Cineon sequence. Linear To Log converts a layer containing an 8-bpc linear proxy of a
Cineon file into an 8-bpc logarithmic file so that its display characteristics are consistent with the original Cineon
file. Log To Log detects an 8-bpc or 10-bpc logarithmic Cineon file when you plan to render it as an 8-bpc
logarithmic proxy.
Note: For compatibility, obsolete versions of each option appear if you open a project that uses an earlier version of the
Cineon Converter effect.
10 Bit Black Point The black point (minimum density) for converting a 10-bpc logarithmic Cineon layer.
Internal Black Point The black point used for the layer in After Effects.
10 Bit White Point The white point (maximum density) for converting a 10-bpc logarithmic Cineon layer.
Internal White Point The white point used for the layer in After Effects.
Gamma Increase or decrease Gamma to lighten or darken midtones, respectively.
Highlight Rolloff The rolloff value used to correct bright highlights. If adjusting the brightest areas makes the rest of
the image appear too dark, use Highlight Rolloff to adjust these bright highlights. If highlights appear as white
blotches, increase Highlight Rolloff until details are visible. An image with high contrast may require a high rolloff
value.
See also
“Importing Cineon sequences” on page 85
“Set the color depth” on page 234
Color Profile Converter effect
The Color Profile Converter effect converts a layer from one color space to another by specifying input and output
profiles.
In most cases, you should use automatic color management features to convert from one color space to another,
rather than using the Color Profile Converter to manually do the conversions.
Important: In general, you should either work with color management features or use the Color Profile Converter—not both.
The profiles you select are embedded in the project, so you can use them even if you transfer the project to a
computer that doesn’t have the same profiles. When converting from one color space to another, you can specify how
After Effects handles the color conversion by selecting a rendering intent. You can also choose whether to linearize
the input or output profile.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
AFTER EFFECTS CS3
User Guide
544
To convert the color profile of the layer, select a color profile from the Input Profile menu. Select Project Working
Space to use the profile specified in the project settings (File > Project Settings). To linearize the input profile, select
the Linearize Input Profile option. Then select an output profile from the Output Profile menu. To linearize the
output profile, select the Linearize Output Profile. In the Intent menu, select a rendering intent.
Rendering intent options determine how source colors are adjusted. For example, colors that fall inside the desti-
nation gamut may remain unchanged, or they may be adjusted to preserve the original range of visual relationships
when translated to a smaller destination gamut.
The result of choosing a rendering intent depends on the graphical content of an image and on the profiles used to
specify color spaces. Some profiles produce identical results for different rendering intents.
When specifying a rendering intent, you can choose to use black point compression. Black point compression
ensures that the shadow detail in the image is preserved by simulating the full dynamic range of the output device.
The following rendering intents are available for the Color Profile Converter effect:
Perceptual Attempts to preserve the visual relationship between colors so it’s perceived as natural to the human eye,
even though the color values themselves may change. This intent is suitable for images with many of out-of-gamut
colors.
Saturation Attempts to produce vivid colors in an image at the expense of color accuracy. This rendering intent is
suitable for images, such as graphic logos, in which bright saturated colors are more important than the exact
relationship between colors.
Relative Colorimetric Compares the extreme highlight of the source color space to that of the destination color
space and shifts all colors accordingly. Out-of-gamut colors are shifted to the closest reproducible color in the desti-
nation color space. This rendering intent preserves more of the original colors in an image than Perceptual. This
rendering intent is used by default throughout After Effects.
Absolute Colorimetric Leaves colors that fall inside the destination gamut unchanged. Out-of-gamut colors are
clipped. No scaling of colors to the destination white point is performed. This intent aims to maintain color accuracy
at the expense of preserving relationships between colors.
Note: If you open an After Effects 7 project that uses DPX Scene and DPX Theater color profiles in the Color Profile
Converter effect, After Effects CS3 will not automatically update these profiles to the new equivalent profiles (Kodak
5218/7218 Printing Density and Kodak 2383 Theater Preview). Instead, the profiles will be listed as Embedded. You can
convert your project by manually assigning the new profiles in After Effects CS3. However, if the same profiles were
assigned to the footage or selected in Proof Colors in After Effects 7, they will be automatically updated to the new profiles
in After Effects CS3. (Proof Colors has been replaced by Output Simulation.)
See also
“Color management” on page 241
Grow Bounds effect
The Grow Bounds effect increases the layer size for the effect that directly follows it. This effect is most useful with
layers that have Collapse Transformations/Continuously Rasterize enabled, because they render using a buffer that’s
the size of the composition. For example, if you apply Drop Shadow to a text layer that’s partially out of the compo-
sition frame, the shadow will be clipped because only the portion of the text that’s in the composition frame will cast
ashadow.ApplyingtheGrowBoundseffectbeforetheDropShadoweffectpreventstheshadowfrombeingcutoff.
The number of pixels you specify increases the height and width of the layer’s buffer.
AFTER EFFECTS CS3
User Guide
545
Note: You should not need to use this effect when working with effects that work with 32-bpc color, because these effects
have been updated to automatically compensate for layer size.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
Original (top left); the Wave Warp effect is constrained by dimensions of layer (bottom left); Grow Bounds effect fixes problem (bottom right).
HDR Compander effect
The HDR Compander (compressor/expander) effect gives you a way to work with tools that don’t support high–
dynamic range color—such as 8-bpc and 16-bpc effects—without sacrificing the high dynamic range of footage.
The HDR Compander effect works by first compressing the highlight values in the HDR image so that they fall
within the range of an 8-bpc or 16-bpc image, and then expanding the values back to the 32-bpc range.
Apply the HDR Compander effect to a layer once before working with low-dynamic-range tools and effects. Then,
when you’re finished, use the HDR Compander effect to expand the dynamic range back to 32 bpc.
Because the first instance of the HDR Compander effect compresses the range of values through sampling, some
precision is lost. For this reason, use the HDR Compander effect only if you’re willing to trade off some precision in
values for the sake of high dynamic range.
This effect works with 8-bpc, 16-bpc, and 32-bpc color.
See also
“High dynamic range color” on page 235
“Set the color depth” on page 234
Apply the HDR Compander effect
1Apply the HDR Compander effect to a layer in a 32-bpc project.
2Select Compress Range for Mode.
3Set Gain to the maximum value to be represented in the compressed range—that is, the highest white value in the
image. Don’t set Gain too high; the more of the 16-bpc value that you use for highlights, the more compressed the
midtones (the majority of the pixels) will be, and the more data will be lost in this process.
4Set Gamma. Gamma affects the distribution of values in the range, allowing more precision in specific areas of
the range.
5Apply whatever low-dynamic-range effects you choose to the layer.
AFTER EFFECTS CS3
User Guide
546
6Apply another instance of the HDR Compander effect to the layer. Make sure that the second instance of HDR
Compander is ordered after (below) any 8-bpc or 16-bpc effects you’ve applied.
7Select Expand Range for Mode for the second instance of the HDR Compander effect.
8Set Gain and Gamma to the same values as set in the first instance of the HDR Compander effect.
A more convenient way to use the HDR Compander effect is to apply the Compress-Expand Dynamic Range
animation preset. This animation preset consists of an expression and two instances of the HDR Compander effect:
The first instance has Compress Range selected, and the second has Expand Range selected. The expression automati-
cally sets the Gain and Gamma for the second instance to be the same as that which you set for the first instance. Insert
whatever low-dynamic-range effects you choose between these two instances of the HDR Compander effect.
HDR Highlight Compression effect
The HDR Highlight Compression effect compresses the highlight values in a high–dynamic range image so that they
fall within the value range of a low-dynamic-range image. Adjust the amount of compression by setting the effect’s
Amount property.
See also
“High dynamic range color” on page 235
“Set the color depth” on page 234
547
Chapter 16: Expressions
Working with expressions
Many of the examples in this section are based on examples provided by Dan Ebberts. Dan Ebberts also has an
excellent collection of example expressions and tutorials for learning how to work with expressions on his website:
www.adobe.com/go/learn_ae_motionscripthome.
TheAEEnhancersforumprovideslotsofexamplesandusefulinformationaboutexpressions,aswellasscriptsand
animation presets: www.adobe.com/go/learn_ae_aeenhancershome.
About expressions
When you want to create and link complex animations, but would like to avoid creating tens or hundreds of
keyframes by hand, try using expressions. With expressions, you can create relationships between layer properties
and use one property’s keyframes to dynamically animate other layers. For example, if you set Rotation keyframes
for a layer and then apply the Drop Shadow effect, you can use an expression to link the Rotation property’s values
with the Drop Shadow effect’s Direction values; that way, the drop shadow changes accordingly as the layer rotates.
You can even use the pick whip to link path properties, so a mask can take its path from a brush stroke or a shape
layer object.
Expressions are based on the standard JavaScript language, but you do not need to know JavaScript to use expres-
sions. You can create expressions by using the pick whip or by copying simple examples and modifying them to suit
your needs.
Note: Two great sources of example expressions are the Expression Sampler template project (File > Browse Template
Projects) and the animation presets in the Behaviors category (Animation > Browse Presets).
You can do all of your work with expressions in the Timeline panel, though it is sometimes more convenient to drag
thepickwhiptoapropertyintheEffectControlspanel.Youcanusethepickwhiptocreateexpressions,oryoucan
enter and edit expressions manually in the expression field, a resizable text field in the time graph. The expression
field appears alongside the property in layer bar mode; the expression field appears at the bottom of the Graph Editor
in Graph Editor mode. You can write an expression in a text editor and then copy it into the expression field. When
you add an expression to a layer property, a default expression appears in the expression field. The default expression
essentially does nothing—it sets the property value to itself.
AFTER EFFECTS CS3
User Guide
548
Expression interface in the Timeline panel in layer bar mode
A. Enable Expression switch B. Show Post-Expression Graph button C. Pick whip D. Expression Language menu E. Expression field
While you are editing an expression, previews of all sorts are suspended; a red bar appears at the bottom of panels
that are waiting for you to exit text-editing mode.
The values for a property that contains an expression appear in red or pink type.
Animation presets can include expressions, or even consist entirely of an expression. Animation presets that use
expressions instead of keyframes are sometimes called behaviors.
Afteryouaddanexpressiontoaproperty,youcancontinuetoaddoreditkeyframesfortheproperty.Anexpression
can take the value of a property as determined by its keyframes and use that as input to generate new, modified
values. For example, the following expression on a layer’s Position property preserves the layer’s keyframed motion
and causes it to wiggle a little:
transform.position.wiggle(10, 10)
Note: Using the wiggle expression is often much faster and easier than using the Wiggler.
If an expression cannot be processed, After Effects displays a message explaining the error and automatically disables
the expression. A yellow warning icon appears next to the expression; click the warning icon to view the error
message again.
To show expressions that have errors, select one or more layers, right-click (Windows) or Control-click (Mac OS) a
selected layer in the Timeline panel, and choose Reveal Expression Errors from the context menu.
Some expressions rely on the names of layers or properties in your project; if you change the name of a layer or
property that is involved in an expression, After Effects will attempt to update the expression to use the new name.
However, in some complex cases, After Effects will be unable to automatically update the expression, in which case
the expression may produce an error message, and you must update the expression yourself.
Important: If you are running After Effects in a language other than the one for which an expression was written, or if
you have changed the names of items (such as layers, effects, or other property groups), then the expression may not work
until you modify the expression to use the new names or the strings that match the language in which you are running
After Effects. Because the examples in this document were created for the default state of After Effects running in English,
some examples in this document will not work without such modification.
Precomposing multiple layers will also cause expressions that refer to one of the layers’ properties to produce an
error, requiring you to update these expressions to refer to the layer within the new composition. (See “About nesting
and precomposing” on page 113.)
BCDE
A
AFTER EFFECTS CS3
User Guide
549
Note: The arguments for some After Effects effects have changed from those in previous versions. If you have existing
expressions that use argument index references rather than argument names, you may need to update the expressions to
use argument names.
When you are animating text, you can use the Expression selector to dynamically specify how much you want
characters to be affected by an animator property through the use of expressions. You can add one or more
Expression selectors to an animator group, and that animator group can contain one or more properties.
See also
“Save an animation preset” on page 353
“About animation, keyframes, and expressions” on page 183
“Work with selectors” on page 289
Add, edit, and remove expressions
You can enter entire expressions yourself, by manually typing them or by using the Expression Language menu; or
you can create an expression with the pick whip or paste it from an example or other property.
A good way to begin working with expressions is to create a simple expression with the pick whip and then adjust
the expression’s behavior using simple math operations, such as those listed in the following table:
For example, you can double the result by typing *2 attheendoftheexpression;oryoucanhalvetheresultbytyping
/2 at the end of the expression.
As you develop comfort editing expressions, you can combine these simple operations—and more. For example, you
can add /360*100 to the end of an expression to change its range from 0-360 to 0-100. This would be useful if you
wanted to convert the values of a 360-degree dial to a slider that is measured in percentages.
The Expression Language menu in the Timeline panel contains language elements specific to After Effects that you
can use in an expression. This menu is helpful for determining valid elements and their correct syntax; use it as a
reference for available elements. When you choose any object, attribute, or method from the menu, After Effects
automatically inserts it in the expression field at the insertion point. If text is selected in the expression field, that text
is replaced by the new expression text. If the insertion point is not in the expression field, all text in the field is
replaced by the new expression text.
The Expression Language menu lists arguments and default values. This makes it easy to remember which elements
you can control when you write an expression. For example, in the language menu, the wiggle method in the
Property category appears as wiggle(freq, amp, octaves=1, amp_mult=.5, t=time). There are five
arguments listed in the parentheses following wiggle. The = in the last three arguments indicates that using those
arguments is optional. If you specify no values for them, they default to 1, .5, and the current time, respectively.
Symbol Function
+ add
- subtract
/ divide
* multiply
*-1 perform opposite of original, such as
counterclockwise instead of clockwise
AFTER EFFECTS CS3
User Guide
550
Important: You must replace the argument names written by the Expression Language menu with actual values.
See also
“About animation, keyframes, and expressions” on page 183
Add, disable, or remove an expression
•To add an expression to a property, select the property in the Timeline panel and choose Animation > Add
Expression or press Alt+Shift+= (Windows) or Option+Shift+= (Mac OS); or Alt-click (Windows) or Option-
click (Mac OS) the stopwatch button next to the property name in the Timeline panel or Effect Controls panel.
•To temporarily disable an expression, click the Enable Expression switch . When an expression is disabled, a
slash appears through the switch .
•To remove an expression from a property, select the property in the Timeline panel and choose Animation >
Remove Expression, or Alt-click (Windows) or Option-click (Mac OS) the stopwatch button next to the property
name in the Timeline panel or Effect Controls panel.
Edit an expression with the pick whip
If you are not familiar with JavaScript or the After Effects expression language, you can still take advantage of the
power of expressions by using the pick whip. You simply drag the pick whip from one property to another to link
the properties with an expression, and the expression text is entered in the expression field at the insertion point. If
text is selected in the expression field, that text is replaced by the new expression text. If the insertion point is not in
the expression field, all text in the field is replaced by the new expression text.
Drag the pick whip to a property to create a link to the property’s value.
You can drag the pick whip to a property’s name or to its values. If you drag to the property’s name, the resulting
expression displays all the values as one. For example, if you drag the pick whip to the Position property’s name, an
expression like the following appears:
thisComp.layer("Layer 1").transform.position
If you drag the pick whip to one of the Position property’s values (such as the y value), an expression like the following
appears, in which both the x and y coordinates of the property are linked to the Position property’s y value:
temp = thisComp.layer("Layer 1").transform.position[1];
[temp, temp]
If the layer, mask, or effect that you drag the pick whip to does not have a unique name in its local context, After
Effects renames it. For example, if you have two or more masks named “Mask” on the same layer, and you drag the
pick whip to one of them, After Effects renames it “Mask 2”.
AFTER EFFECTS CS3
User Guide
551
The format of expressions created by the pick whip is determined by the Expression Pick Whip Writes Compact
English preference (Edit > Preferences > General (Windows) or After Effects > Preferences > General (Mac OS)). By
default, the pick whip creates compact English expressions, which use the Timeline panel’s name for the properties
within an expression. Because these names are coded into the application and never change, these expressions can
work when After Effects is running in another language. Any property names that you can change are enclosed in
double quotation marks and remain the same in any language. If you don’t plan on sharing your projects across
languages, you can deselect this preference. This preference does not affect effect names or effect properties.
Here is an example in compact English:
thisComp.layer("Layer 1").transform.position
Here is the same expression, not in compact English:
thisComp.layer("Layer 1")("Transform")("Position")
Note: BecausethedefaultistousecompactEnglish,thisdocumentusescompactEnglishinmostexamplesandillustra-
tions.
1Drag the pick whip to another property in the Timeline panel or Effect Controls panel.
2Optionally, modify the default expression in the expression field.
Edit an expression manually
1Click in the expression field to enter text-editing mode.
Note: When you enter text-editing mode, the entire expression is selected. To add to the expression, click within the
expression to place the insertion point; otherwise, you will replace the entire expression.
2Type and edit text in the expression field, optionally using the Expression Language menu.
To see more of a multiline expression, drag the bottom or top of the expression field to resize it.
3To exit text-editing mode and activate the expression, do one of the following:
•Press Enter on the numeric keypad.
•Click outside the expression field.
Example: Use the expression language reference to write an expression
Follow along with this example to learn how to use the After Effects expression language reference to write expres-
sions. The expression created in this example copies position values from one layer to another.
1Create two solid layers: Solid 1 and Solid 2.
2Animate the Position property values for Solid 1 using keyframes. (See “About animation, keyframes, and expres-
sions” on page 183.)
3Select the Position property for Solid 2 and choose Animation > Add Expression or Alt-click (Windows) or
Option-click the property’s stopwatch button. The following expression appears by default:
transform.position
4Type the following directly over transform.position:
thisComp
AFTER EFFECTS CS3
User Guide
552
5The element thisComp is a global attribute whose value is a Comp object representing the current composition.
To determine what can follow thisComp in your expression, look up the return value for thisComp under “Global
objects” on page 560.
Note that thisComp returns a Comp. Next, look at “Comp attributes and methods” on page 567 to see which
attributes and methods you can use with a Comp. One option is layer(index). The index, or number, inside the
parentheses specifies the layer that you want to use. For this example, we assume that Solid 1 is the first layer in your
composition. To retrieve values from the first layer in the active composition, type .layer(1) at the end of the
expression, to get the following:
thisComp.layer(1)
6Again, look at the expression elements reference to see that layer(index) returns a Layer. Look at “Layer
General attributes and methods” on page 570, and find the element you want to use. For example, if you want to
access the Position property’s values for the layer, type .position at the end of the expression to get the following:
thisComp.layer(1).position
7From “Layer General attributes and methods” on page 570, you can see that the position attribute returns a
property. Look up “Property attributes and methods” on page 576 and notice that you can add a time factor to the
expression. To add a specific time, such as current time plus 2 seconds, type .valueAtTime(time+2)at the end of
the expression to get the following:
thisComp.layer(1).position.valueAtTime(time+2)
8From “Property attributes and methods” on page 576, notice that the valueAtTime method returns a number or
Array.WhenanexpressionreturnsaNumber,Array,orBoolean(trueorfalse),youcannotaddfurtherattributesor
methods to the expression (if you want, however, you can add arithmetic operators, such as +,-,*, and /).
See also
“Using the expression elements reference” on page 559
Show expressions and the expression graph
In Graph Editor mode, the single expression field appears as a resizable text box at the bottom of the Graph Editor
and shows only the expression for the selected property. To show multiple expression fields simultaneously, the
Timeline panel must be in layer bar mode.
To toggle between layer bar mode and Graph Editor mode, press Shift+F3.
•To show only properties with expressions, select one or more layers, and then press EE.
•To show the expression field in the Graph Editor, choose Show Expression Editor from the Choose Graph Type
And Options menu at the bottom of the Graph Editor. When you add a new expression to a property, the
expression editor is shown, regardless of this setting.
To resize the expression field, drag its bottom edge up or down.
•To see how an expression changes the value or velocity graph, click the Show Post-Expression Graph button
while showing the value or velocity graph in the Graph Editor.
The dimly colored graph displays the value or velocity before the expression is applied, and the brightly colored graph
displays the value or velocity after the expression is applied. Turning on the graph overlay for the Position property
also changes the motion path display in the Composition panel so that you can see the expression-affected path.
AFTER EFFECTS CS3
User Guide
553
See also
“Work with the Graph Editor” on page 184
“Creating and modifying motion paths” on page 197
Writing expressions for source text
The Source Text property of a text layer is interpreted by expressions as a JavaScript String. You can use the pick whip
toretrievethesourcetextfromanothertextlayer;however,onlythestyleofthefirstcharacterofthedestinationlayer
is used.
For more information on the String object, consult a JavaScript guide.
You can use "\r" in a string expression to start a new line of text. For example, to copy the original text from one
layer onto the same layer and repeat it in all uppercase characters on a new line, use the following expression:
text.sourceText + "\r" + text.sourceText.toUpperCase()
Adding a text layer to a composition and adding an expression to its Source Text property can be a great way to
examine the property values of other layers. For example, the following expression on a Source Text property reports
the name and value of the Opacity property for the next layer in the layer stacking order:
thisComp.layer(index + 1).name + "\rOpacity = " + thisComp.layer(index + 1).opacity.value
The following example reports the name of the footage item used as the source of the topmost image layer in the
stacking order at the current time that has its Video switch set.
source_footage_name = "";
for (i = 1; i <= thisComp.numLayers; i++){
if (i == index) continue;
my_layer = thisComp.layer(i);
if (! (my_layer.hasVideo && my_layer.active)) continue;
if (time >= my_layer.inPoint && time < my_layer.outPoint){
try{
source_footage_name = my_layer.source.name;
}catch(err1){
source_footage_name = my_layer.name
}
break;
}
}
source_footage_name
See also
“Creating and editing text layers” on page 273
Add comments to an expression
If you write a complex expression and intend to reuse it later, you should add comments that explain what the
expression does and how its pieces work.
•Type // at the beginning of the comment. Any text between // and the end of the line is ignored. For example:
// This is a comment.
AFTER EFFECTS CS3
User Guide
554
•Type /* at the beginning of the comment and */ at the end of the comment. Any text between /* and */ is
ignored. For example:
/* This is a
multiline comment. */
Save and reuse expressions
Once you have written an expression, you can save it for future use by copying and pasting it into a text-editing appli-
cation or by saving it in an animation preset or template project. However, because expressions are written in relation
to other layers in a project and may use specific layer names, you must sometimes modify an expression to transfer
it between projects.
You can define your own functions within expressions using normal JavaScript function syntax. In this example, a
function is defined that calculates the average of two values, and the last line uses this function:
function average(a, b)
{
return (a + b) / 2;
}
average(position, thisComp.layer(1).position);
Note that you must define each function fully within each expression in which it is used; there is no global library of
functions that you can add to.
If you want to save an expression for use in another project, you should add comments to the expression. You should
also use variables so that you can change a value in one place rather than having to change it in several places.
For example, this expression has a multiline comment at the beginning that explains what the expression does and a
short comment after a variable is declared and initialized that tells what the variable is for:
/* This expression on a Source Text property reports the name
of a layer and the value of its Opacity property. */
var myLayerIndex = 1; // layer to inspect, initialized to 1, for top layer
thisComp.layer(myLayerIndex).name + ": \rOpacity = " +
thisComp.layer(myLayerIndex).opacity.value
You can save an animation preset that includes an expression and reuse it in other projects, as long as the expression
does not refer to properties that don’t exist in the other projects. When you save a preset in which a property has an
expression but no keyframes, only the expression is saved. If the property has one or more keyframes, the saved
preset will contain the expression along with all keyframe values.
You can copy an expression from a layer property, with or without the property’s keyframes. Copying an expression
without keyframes is particularly useful when you want to simultaneously copy multiple expressions and paste them
onto one or more new layers, or when you want to copy one expression and paste it onto more than one layer.
•To copy an expression and keyframes from one property to other properties, select the source layer property in
the Timeline panel, copy the layer property, select the target layer properties, and paste.
•To copy an expression from one property to other properties without copying keyframes, select the source
property, choose Edit > Copy Expression Only, select the target properties, and paste.
AFTER EFFECTS CS3
User Guide
555
Note: As with pasting keyframes and other items, you can often paste the item into the target layer and rely on After
Effects to determine which property should be the target of the paste operation. For example, this works for copying
Position properties from one layer to another, but you must select the target property yourself if you are pasting an
expression from a Position property into a Scale property.
See also
“Save an animation preset” on page 353
“Work with layer properties in the Timeline panel” on page 152
Using Expression Controls effects
Use Expression Controls effects to add a control that you can use to manipulate one or many properties’ values by
linking the property to the control using expressions. A single control can affect several properties at once.
You can apply Expression Controls effects to any layer; however, it is useful to apply them to a null layer, which you
cansimplyuseasacontrollinglayer.Youthenaddexpressionstopropertiesonotherlayerstotakeinputfromthat
control.
For example, you can add the Slider Control effect to a null layer (Null 1), and then apply this expression to the
Position properties of multiple layers:
position+[0,10*(index-1)*thisComp.layer("Null 1").effect("Slider Control")("Slider")]
In this example, as you drag the slider, each layer with this expression will move. The layers with greater index
numbers (layers toward the bottom in the Timeline panel) will be shifted more than the layers with lower index
numbers, at 10-pixel intervals. You can set keyframes for the slider on the null layer, and all of the other layers will
animate accordingly.
You apply Expression Controls effects to a layer in the same ways that you apply other effects, such as dragging the
effect onto the layer from the Effects & Presets panel.
To modify the range of a control, right-click (Windows) or Control-click (Mac OS) the control’s underlined property
value and choose Edit Value from the context menu.
Harry Frank shows how to use an Expression Controls effect (the Slider Control effect) as part of his video tutorial
about converting from RGB to HSL using expressions: www.adobe.com/go/learn_ae_harryrgb2hsl.
See also
“Create a null object” on page 159
“Apply an effect or animation preset” on page 351
Convert an expression to keyframes
In some situations, it may be useful to convert an expression to keyframes. For example, if you want to freeze the
values in an expression, you can convert the expression to keyframes and then adjust the keyframes accordingly; or,
if an expression takes a long time to evaluate, you can convert it to keyframes so that it renders more quickly. When
you convert an expression to keyframes, After Effects evaluates the expression, creating a keyframe at every frame,
and then disables the expression.
❖In the Timeline panel, select the property on which the expression is written and choose Animation > Keyframe
Assistant > Convert Expression To Keyframes.
AFTER EFFECTS CS3
User Guide
556
The expression language
About the expression language
The After Effects expression language is based on JavaScript 1.2, with an extended set of built-in objects. After Effects
uses only the core standard JavaScript 1.2 language, not the web browser–specific extensions. After Effects contains
its own set of extension objects—such as Layer, Comp, Footage, and Camera—that you can use to access most of the
values in an After Effects project.
For more information about JavaScript, see a JavaScript reference manual.
When creating expressions, keep the following in mind:
•JavaScript is case-sensitive.
•Semicolons are required to separate statements or lines.
•Spaces between words are ignored, except within a string.
In JavaScript, a value stored in an object is called a property.However,AfterEffectsusesthetermproperty to refer to
layer attributes as defined in the Timeline panel. Consequently, for clarity, After Effects documentation refers to a
JavaScript property as a method when the property takes arguments, or an attribute when it does not.
The value of an expression is the value of the last statement evaluated.
Accessing attributes and methods
You use the expression language to access attributes and methods of layer properties. To access a value, use a chain
of object references separated by the period (.) operator. To chain object references past the layer level (for example,
to chain effect properties, masks, or text animators), you can also use parentheses. For example, to link the Opacity
property in Layer A to the Gaussian Blur effect’s Blurriness property in Layer B, type the following expression in the
expression field for Layer A’s Opacity property:
thisComp.layer("Layer B").effect("Gaussian Blur")("Blurriness")
The default object for an expression is the property on which the expression is written, followed by the layer
containing the expression; therefore, you do not need to specify the property. For example, a wiggle expression
written on a layer’s Position property can be either of the following:
wiggle(5, 10)
position.wiggle(5, 10)
You do need to include the layer and property when retrieving them from outside the layer and property on which
the expression is written. For example, an expression written on Layer B’s Opacity property, linking it to Layer A’s
Rotation property would look like this:
thisComp.layer("Layer A").rotation
To see more examples of how this works, use the pick whip to link one layer property to another, and look at the
expressions it creates.
Arrays and multidimensional properties
An Array is a type of object that stores an ordered set of numbers. An Array is represented as a list of numbers
separated by commas and surrounded by brackets, as in this example:
[10, 23]
AFTER EFFECTS CS3
User Guide
557
You can assign an Array to a variable, making it easy to refer to Array values in other areas of the expression. For
example:
myArray = [10, 23]
The dimension of an Array is the number of elements in the Array. The dimension of myArray is 2. Different
properties in After Effects have different dimensions depending on the number of value arguments they have. In the
expression language, properties’ values are either single values (Numbers) or Arrays.
The following table provides examples of some properties and their dimensions:
You can access the individual elements of an Array by using brackets and an index number to indicate which element
youwant.TheelementsinanArrayareindexedstartingfrom0.Usingthepreviousexample,myArray[0] is 10 and
myArray[1] is 23.
The following two expressions are equivalent:
[myArray[0], 5]
[10, 5]
The Position property arrays are indexed as follows:
•position[0] is the x coordinate of position.
•position[1] is the y coordinate of position.
•position[2] is the z coordinate of position.
Colors are represented as four-dimensional arrays [red,green,blue,alpha]. In projects with a color depth of 8 or 16
bpc, each value in a color array ranges from 0 (black) to 1 (white). For example, red can range from 0 (no color) to 1
(red). So, [0,0,0,0] is black and transparent, and [1,1,1,1] is white and completely opaque. In projects with a color
depth of 32 bpc, values under 0 and over 1 are allowed.
If you use an index that is greater than the index of the highest-dimension component in an Array, After Effects
returns an error. For example, myArray[2] causes an error, but position[2] returns the z coordinate of Position.
Many of the properties and methods in the After Effects expression language take Array objects as arguments or
return them as values. For example, thisLayer.position is an Array that is either two-dimensional or three-
dimensional depending on whether your layer is 2D or 3D.
If you want to write an expression that keeps the y value of an object’s animation but fixes the x value at 9, you would
use the following:
Dimension Property
1 Rotation ˚
Opacity %
2 Scale [x=width, y=height]
Position [x, y]
Anchor Point [x, y]
3 Scale [width, height, depth]
3D Position [x, y, z]
3D Anchor Point [x, y, z]
4 Color [red, green, blue, alpha]
AFTER EFFECTS CS3
User Guide
558
y = position[1];
[9,y]
The following is even more succinct:
[9, position[1]]
This is an important point, so let’s look at one more example. If you want to combine the x position value from Layer
A with the y position value from Layer B, you would use the following:
x = thisComp.layer("Layer A").position[0];
y = thisComp.layer("Layer B").position[1];
[x,y]
You can create an expression that refers to just one value within the Array of a 2D or 3D property. By default, the first
value is used, unless you specify otherwise. For example, if you drag the pick whip from Layer A’s Rotation property
to Layer B’s Scale property, the following expression appears:
thisComp.layer("Layer B").scale[0]
By default, the above expression uses the first value of the Scale property, which is width. If you prefer to use the
height value instead, drag the pick whip directly to the second value instead of the property name, or change the
expression as follows:
thisComp.layer("Layer B").scale[1]
Conversely, if you drag the pick whip from Layer B’s Scale property to Layer A’s Rotation property, After Effects
automatically creates a variable, assigns the one-dimensional Rotation property’s value to it, and then uses that
variable for both dimensions of the Scale property:
temp = thisComp.layer(1).transform.rotation;
[temp, temp]
See also
“High dynamic range color” on page 235
Vectors
In After Effects, many properties and methods take or return vectors. After Effects refers to an Array as a vector if it
represents either a point or direction in space. For example, After Effects describes position as returning a vector.
However, though a function like audioLevels does return a two-dimensional value (the left and right channel
levels), it is not called a vector because it does not represent a point or direction. Some functions in After Effects
accept vector arguments, but they are generally only useful when the values passed represent a direction. For
example, cross(vec1, vec2) computes a third vector that is at right angles to the input vectors. This is useful when
vec1 and vec2 are two vectors representing directions in space, but not if they just represent two arbitrary collec-
tions of numbers.
Indices and labels
Indexing for Layer, Effect, and Mask elements in After Effects starts from 1. For example, the first layer in the
Timeline panel is layer(1).
AFTER EFFECTS CS3
User Guide
559
Generally, it is best to use the name of a layer, effect, or a mask instead of a number to avoid confusion and errors if
the layer, effect, or mask is moved, or if the arguments are changed during product updates and upgrades. When you
use a name, always enclose it in straight quotes. For example, the first expression below is easier to understand than
the second expression, and the first expression will continue to work even if you change the order of effects:
effect("Colorama").param("Get Phase From")
effect(1).param(2)
Expression time
Time within an expression is always in composition time (not layer time) and is measured in seconds. The default
time for any expression is the current composition time at which the expression is being evaluated. The following
expressions both use the default composition time and return the same values:
thisComp.layer(1).position
thisComp.layer(1).position.valueAtTime(time)
To use a relative time, add an incremental time value to the time argument. For example, to get the Position value 5
seconds before the current time, use the following expression:
thisComp.layer(1).position.valueAtTime(time-5)
Default time references to properties in nested compositions use the original default composition time, not
remapped time. However, if you use the source function to retrieve a property, the remapped time is used.
For example, if the source of a layer in the parent composition is a nested composition, and in the parent composition
youhaveremappedtime,whenyouaccessthepositionvaluesofalayerinthenestedcompositionwiththefollowing
expression, the position values use the composition’s default time:
comp("nested composition").layer(1).position
However, if you access layer 1 using the source function, the position values use the remapped time:
thisComp.layer("nested composition").source.layer(1).position
Note: If you use a specific time in an expression, After Effects ignores the remapped time.
After Effects expression elements reference
Using the expression elements reference
Use the After Effects expression elements along with standard JavaScript elements to write your expressions. You can
use the Expression Language menu at any time to insert methods and attributes into an expression, and you can use
the pick whip at any time to insert properties.
If an argument description contains an equal sign (=) and a value (such as t=time or width=.2), then the argument
uses the included default value if you don’t specify a different value.
Some argument descriptions include a number in square brackets—this number indicates the dimension of the
expected property or Array.
Some return-value descriptions include a number in square brackets—this number specifies the dimension of the
returned property or Array. If a specific dimension is not included, the dimension of the returned Array depends on
the dimension of the input.
•“Global objects” on page 560
AFTER EFFECTS CS3
User Guide
560
•“Time conversion methods” on page 561
•“Vector Math methods” on page 562
•“Random Numbers methods” on page 563
•“Interpolation methods” on page 565
•“Color Conversion methods” on page 566
•“Other Math methods” on page 566
•“Comp attributes and methods” on page 567
•“Footage attributes and methods” on page 569
•“Layer Sub-objects attributes and methods” on page 569
•“Layer General attributes and methods” on page 570
•“Layer Properties attributes and methods” on page 571
•“Layer 3D attributes and methods” on page 572
•“Layer Space Transforms methods” on page 573
•“Camera attributes and methods” on page 574
•“Light attributes and methods” on page 575
•“Effect attributes and methods” on page 576
•“Mask attributes and methods” on page 576
•“Property attributes and methods” on page 576
•“Key attributes and methods” on page 580
•“MarkerKey attributes” on page 581
See also
“About expressions” on page 547
“Add, edit, and remove expressions” on page 549
Global objects
comp(name) Return type: Comp.
Argument type: name is a String.
Retrieves another composition by name.
footage(name) Return type: Footage.
Argument type: name is a String.
Retrieves a footage item by name.
thisComp Return type: Comp.
Represents the composition containing the expression.
thisLayer Return type: Layer, Light, or Camera.
AFTER EFFECTS CS3
User Guide
561
Represents the layer containing the expression. Because thisLayer is the default object, its use is optional. For
example, you can start an expression with thisLayer.width or width and get the same result.
thisProperty Return type: Property.
Represents the property containing the expression. For example, if you write an expression on the Rotation property,
you can start an expression with thisProperty to refer to the Rotation property.
time Return type: Number.
Represents the composition time, in seconds, at which the expression is being evaluated.
colorDepth Return type: Number.
Returnstheproject’scolordepthvalue.Forexample,colorDepth returns 16 when the project’s color depth is 16 bits
per channel.
posterizeTime(framesPerSecond) Return type: Number.
Argument type: framesPerSecond is a Number.
The framesPerSecond value becomes the frame rate from which the rest of the expression operates. This allows you
to set the expression to a frame rate lower than that of the composition. For example, the following expression
updates the property value with a random value once per second:
posterizeTime(1);
random()
value Return type: Number, Array, or String.
Represents the value at the current time for the property containing the expression.
Time conversion methods
timeToFrames(t = time + thisComp.displayStartTime, fps = 1.0 / thisComp.frameDuration, isDuration = false)
Return type: Number.
Argument type: t and fps are Numbers; isDuration is a Boolean.
Converts the value of t, which defaults to the current composition time, to an integer number of frames. The number
of frames per second is specified in the fps argument, which defaults to the frame rate of the current composition
(1.0 / thisComp.frameDuration). The isDuration argument, which defaults to false, should be true if the tvalue
represents a difference between two times instead of an absolute time. Absolute times are rounded down towards
negative infinity; durations are rounded away from zero (up for positive values).
framesToTime(frames, fps = 1.0 / thisComp.frameDuration) Return type: Number.
Argument type: frames and fps are Numbers.
The inverse of timeToFrames. Returns the time corresponding to the frames argument,whichisrequired.Itdoesn’t
have to be an integer. See timeToFrames for explanation of the fps argument.
timeToTimecode(t = time + thisComp.displayStartTime, timecodeBase = 30, isDuration = false) Return type: String.
Argument type: t and timecodeBase are Numbers; isDuration is a Boolean.
Converts the value of t to a String representing timecode. See timeToFrames for an explanation of the t and
isDuration arguments. The timecodeBase value, which defaults to 30, specifies the number of frames in one second.
timeToNTSCTimecode(t = time + thisComp.displayStartTime, ntscDropFrame = false, isDuration = false) Return
type: String.
AFTER EFFECTS CS3
User Guide
562
Argument type: t is a Number, ntscDropFrame and isDuration are Booleans.
Converts t to a String representing NTSC timecode. See timeToFrames for an explanation of the t and isDuration
arguments. If ntscDropFrame is false (the default), the result String is NTSC non-drop-frame timecode. If ntscDrop-
Frame is true, the result String is NTSC drop-frame timecode.
timeToFeetAndFrames(t = time + thisComp.displayStartTime, fps = 1.0 / thisComp.frameDuration, framesPerFoot =
16, isDuration = false) Return type: String.
Argument type: t,fps, and framesPerFoot are Numbers; isDuration is a Boolean.
Converts the value of tto a String representing feet of film and frames. See timeToFrames for an explanation of the
t,fps,andisDuration arguments. The framesPerFoot argument specifies the number of frames in one foot of film. It
defaults to 16, which is the most common rate for 35mm footage.
timeToCurrentFormat(t = time + thisComp.displayStartTime, fps = 1.0 / thisComp.frameDuration, isDuration = false)
Return type: String.
Argument type: t and fps are Numbers; isDuration is a Boolean.
Converts the value of t to a String representing time in the current Project Settings display format. See timeToF-
rames for a definition of all of the arguments.
If you want more control over the look of timecode in your footage, use the timeToCurrentFormat method or other
timeTo methods to generate the timecode instead of using the Timecode or Numbers effect. Create a text layer, add
an expression to the Source Text property, and enter timeToCurrentFormat() in the expression field. This method
enables you to format and animate the timecode text. In addition, the timecode uses the same display style defined by
the current project settings.
See also
“Change time display units” on page 131
Vector Math methods
VectorMathfunctionsareglobalmethodsthatperformoperationsonarrays,treatingthemasmathematicalvectors.
Unlike built-in JavaScript methods, such as Math.sin, these methods are not used with the Math prefix. Unless
otherwise specified, Vector Math methods are lenient about dimensions and return a value that is the dimension of
the largest Array, filling in missing elements with zeros. For example, the expression add([10, 20], [1, 2, 3])
returns [11, 22, 3].
add(vec1, vec2) Return type: Array.
Argument type: vec1 and vec2 are Arrays.
Adds two vectors.
sub(vec1, vec2) Return type: Array.
Argument type: vec1 and vec2 are Arrays.
Subtracts two vectors.
mul(vec, amount) Return type: Array.
Argument type: vec is an Array, amount is a Number.
Multiplies every element of the vector by the amount.
AFTER EFFECTS CS3
User Guide
563
div(vec, amount) Return type: Array.
Argument type: vec is an Array, amount is a Number.
Divides every element of the vector by the amount.
clamp(value, limit1, limit2) Return type: Number or Array.
Argument type: value,limit1, and limit2 are Numbers or Arrays.
The value of each component of value is constrained to fall between the values of the corresponding values of limit1
and limit2.
dot(vec1, vec2) Return type: Number.
Argument type: vec1 and vec2 are Arrays.
Returns the dot (inner) product of the vector arguments.
cross(vec1, vec2) Return type: Array [2 or 3].
Argument type: vec1 and vec2 are Arrays [2 or 3].
Returns the vector cross product of vec1 and vec2. Refer to a math reference or JavaScript guide for more infor-
mation.
normalize(vec) Return type: Array.
Argument type: vec is an Array.
Normalizes the vector so that its length is 1.0. This is a short way of writing div(vec, length(vec)).
length(vec) Return type: Number.
Argument type: vec is an Array.
Returns the length of vector vec.
length(point1, point2) Return type: Number.
Argument type: point1 and point2 are Arrays.
Returns the distance between two points. The point2 argument is optional. For example, length(point1, point2)
is the same as length(sub(point1, point2)).
lookAt(fromPoint, atPoint) Return type: Array [3].
Argument type: fromPoint and atPoint are Arrays [3].
The argument fromPoint is the location in world space of the layer you want to orient. The argument atPoint is the
point in world space you want to point the layer at. The return value can be used as an expression for the Orientation
property, making the layer’s z-axis point at atPoint. This method is especially useful for cameras and lights. If you use
this on a camera, turn off auto-orientation. For example, this expression on the Orientation property of a spot light
makes the light point at the anchor point of layer number 1 in the same composition: lookAt(position,
thisComp.layer(1).position)
Random Numbers methods
seedRandom(offset, timeless=false) Return type: none.
Argument type: offset is a Number, timeless is a Boolean.
AFTER EFFECTS CS3
User Guide
564
The random and gaussRandom methods use a seed value that controls the sequence of numbers. By default, the seed
is computed as a function of a unique layer identifier, the property within the layer, the current time, and an offset
value of 0. Call seedRandom to set the offset to something other than 0 to create a different random sequence. Use
true for the timeless argument to not use the current time as input to the random seed; this allows you to generate
a random number that doesn’t vary depending on the time of evaluation. The offset value, but not the timeless value,
is also used to control the initial value of the wiggle function.
For example this expression on the Opacity property sets the Opacity value to a random value that does not vary with time:
seedRandom(123456, true);
random()*100
The multiplication by 100 in this example converts the value between 0 and 1 returned by the random method into
a number between 0 and 100; this range is more typically useful for the Opacity property, which has values from 0%
to 100%.
random() Return type: Number.
Returns a random number between 0 and 1.
random(maxValOrArray) Return type: Number or Array.
Argument type: maxValOrArray is a Number or Array.
If maxValOrArray is a Number, this method returns a number between 0 and maxValOrArray.IfmaxValOrArray is
an Array, this method returns an Array with the same dimension as maxValOrArray, with each component ranging
between 0 and the corresponding component of maxValOrArray.
random(minValOrArray, maxValOrArray) Return type: Number or Array.
Argument type: minValOrArray and maxValOrArray are Numbers or Arrays.
If minValOrArray and maxValOrArray are Numbers, this method returns a number between minValOrArray and
maxValOrArray. If the arguments are Arrays, this method returns an Array with the same dimension as the
argument with the greater dimension, with each component between the corresponding components of
minValOrArray and maxValOrArray. For example, the expression random([100, 200], [300, 400]) returns an
Array whose first value is between 100 and 300 and whose second value is between 200 and 400. If the dimensions
of the two input Arrays don’t match, higher-dimension values of the shorter Array are filled out with zeros.
gaussRandom() Return type: Number.
Returns a random number. The results have a Gaussian (bell-shaped) distribution. Approximately 90% of the results
are between 0 and 1, and the remaining 10% are outside this range.
gaussRandom(maxValOrArray) Return type: Number or Array.
Argument type: maxValOrArray is a Number or Array.
When maxValOrArray is a Number, this method returns a random number. Approximately 90% of the results are in
the 0 to maxValOrArray range, and the remaining 10% are outside of this range. When maxValOrArray is an Array,
this method returns an Array of random values, with the same dimension as maxValOrArray. Ninety percent of the
values range between 0 and the value in maxValOrArray, and the remaining 10% are outside of this range. The results
have a Gaussian (bell-shaped) distribution.
gaussRandom(minValOrArray, maxValOrArray) Return type: Number or Array.
Argument type: minValOrArray and maxValOrArray are Numbers or Arrays.
AFTER EFFECTS CS3
User Guide
565
If minValOrArray and maxValOrArray are Numbers, this method returns a random number. Approximately 90% of
the results are between minValOrArray and maxValOrArray, and the remaining 10% are outside of this range. If the
arguments are Arrays, this method returns an Array of random numbers with the same dimension as the argument
with the greater dimension. For each component, approximately 90% of the results are between the corresponding
components of minValOrArray and maxValOrArray, and the remaining 10% are outside of this range. The results
have a Gaussian (bell-shaped) distribution.
noise(valOrArray) Return type: Number.
Argument type: valOrArray is a Number or an Array [2 or 3].
Returns a number between -1 and 1. The noise is not actually random; it is based on Perlin noise, which means that
the return values for two input values that are near one another will also tend to be near one another. This kind of
noise is useful when you want a sequence of seemingly random numbers that don’t vary wildly from one to the
other—as is usually the case when animating any sort of apparently random natural motion. Example: rotation +
360*noise(time)
Interpolation methods
For all of the Interpolation methods, the argument tis often time or value, though it can have other values, instead.
If t is time, the interpolation between values happens over a duration. If t is value, then the expression maps one
range of values to a new range of values.
linear(t, tMin, tMax, value1, value2) Return type: Number or Array.
Argument type: t,tMin, and tMax are Numbers, and value1 and value2 are Numbers or Arrays.
Returns value1 when t<= tMin. Returns value2 when t>= tMax. Returns a linear interpolation between value1 and
value2 when tMin <t<tMax.
For example this expression on the Opacity property causes Opacity values to ramp linearly from 20% to 80% over
the time from 0 to 6 seconds:
linear(time, 0, 6, 20, 80)
This method—like all of the Interpolation methods—can also be used to convert from one range of values to another.
For example this expression on the Opacity property converts the Opacity values from the range 0%-100% to the
range 20%-80%:
linear(value, 0, 100, 20, 80)
linear(t, value1, value2) Return type: Number or Array.
Argument type: t is a Number, and value1 and value2 are Numbers or Arrays.
Returns a value that linearly interpolates from value1 to value2 as tranges from 0 to 1. Returns value1 when t<= 0.
Returns value2 when t>= 1.
ease(t, value1, value2) Return type: Number or Array.
Argument type: t is a Number, and value1 and value2 are Numbers or Arrays.
Similar to linear with the same arguments, except that the interpolation eases in and out so that the velocity is 0 at
the start and end points. This method results in a very smooth animation.
ease(t, tMin, tMax, value1, value2) Return type: Number or Array.
Argument type: t,tMin, and tMax are Numbers, and value1 and value2 are Numbers or Arrays.
AFTER EFFECTS CS3
User Guide
566
Similar to linear with the same arguments, except that the interpolation eases in and out so that the velocity is 0 at
the start and end points. This method results in a very smooth animation.
easeIn(t, value1, value2) Return type: Number or Array.
Argument type: t is a Number, and value1 and value2 are Numbers or Arrays.
Similar to ease, except that the tangent is 0 only on the value1 side and interpolation is linear on the value2 side.
easeIn(t, tMin, tMax, value1, value2) Return type: Number or Array.
Argument type: t,tMin, and tMax are Numbers, and value1 and value2 are Numbers or Arrays.
Similar to ease, except that the tangent is 0 only on the tMin side and interpolation is linear on the tMax side.
easeOut(t, value1, value2) Return type: Number or Array.
Argument type: t is a Number, and value1 and value2 are Numbers or Arrays.
Similar to ease, except that the tangent is 0 only on the value2 side and interpolation is linear on the value1 side.
easeOut(t, tMin, tMax, value1, value2) Return type: Number or Array.
Argument type: t,tMin, and tMax are Numbers, and value1 and value2 are Numbers or Arrays.
Similar to ease, except that the tangent is 0 only on the tMax side and interpolation is linear on the tMin side.
See also
“Interpolation” on page 204
“Automatically ease speed” on page 217
Color Conversion methods
Harry Frank provides a video tutorial that shows how to use these color conversion methods to change the color of
the waves produced by the Radio Waves effect: www.adobe.com/go/learn_ae_harryrgb2hsl.
rgbToHsl(rgbaArray) Return type: Array [4].
Argument type: rgbaArray is an Array [4].
Converts a color in RGBA space to HSLA space. The input is an Array of normalized red, green, blue, and alpha
channel values, all in the range of 0.0 to 1.0. The resulting value is an Array of hue, saturation, lightness, and alpha
channel values, also in the range of 0.0 to 1.0. Example:
rgbToHsl.effect("Change Color")("Color To Change")
hslToRgb(hslaArray) Return type: Array [4].
Argument type: hslaArray is an Array [4].
Converts a color in HSLA space to RGBA space. This is the opposite of rgbToHsl.
Other Math methods
degreesToRadians(degrees) Return type: Number.
Argument type: degrees is a Number.
Converts degrees to radians.
AFTER EFFECTS CS3
User Guide
567
radiansToDegrees(radians) Return type: Number.
Argument type: radians is a Number.
Converts radians to degrees.
Comp attributes and methods
layer(index) Return type: Layer, Light, or Camera.
Argument type: index is a Number.
Retrieves the layer by number (order in the Timeline panel). Example: thisComp.layer(3)
layer(name) Return type: Layer, Light, or Camera.
Argument type: name is a String.
Retrievesthelayerbyname.Namesarematchedbylayername,orsourcenameifthereisnolayername.Ifduplicate
names exist, After Effects uses the first (topmost) one in the Timeline panel. Example:
thisComp.layer("Solid 1")
layer(otherLayer, relIndex) Return type: Layer, Light, or Camera.
Argument type: otherLayer is a Layer object, and relIndex is a Number.
Retrieves the layer that is relIndex layers above or below otherLayer. For example, thisComp.layer(thisLayer,
1).active returns true if the next layer down in the Timeline panel is active.
marker Return type: MarkerProperty.
Important: You cannot access a composition-time marker by marker number. If you have a project created in a previous
version of After Effects that uses composition marker numbers in expressions, you must change those calls to use
marker.key(name) instead. Because the default name of a composition-time marker is a number, this is often just a
matter of surrounding the number with quotation marks.
marker.key(index) Return type: MarkerKey.
Argument type: index is a Number.
Returns the MarkerKey object of the marker with the specified index. The index refers to the order of the marker in
composition time, not to the name of the marker. For example, this expression returns the time of the first compo-
sition-time marker:
thisComp.marker.key(1).time
marker.key(name) Return type: MarkerKey.
Argument type: name is a String.
Returns the MarkerKey object of the marker with the specified name. The name value is the name of the marker, as
typed in the comment field in the marker dialog box, for example, marker.key("1"). For a composition-time
marker, the default name is a number. If more than one marker in the composition has the same name, this method
returns the marker that occurs first in time (in composition time). The value for a marker key is a String, not a
Number. For example, this expression returns the time of the composition-time marker with the name "0":
thisComp.marker.key("0").time
marker.nearestKey(t) Return type: MarkerKey.
Argument type: t is a Number.
AFTER EFFECTS CS3
User Guide
568
Returns the marker that is nearest in time to t. For example, this expression returns the time of the composition-time
marker nearest to the time of 1 second:
thisComp.marker.nearestKey(1).time
This expression returns the time of the composition-time marker nearest to the current time:
thisComp.marker.nearestKey(time).time
marker.numKeys Return type: Number.
Returns the total number of composition-time markers in the composition.
numLayers Return type: Number.
Returns the number of layers in the composition.
activeCamera Return type: Camera.
Returns the Camera object for the camera through which the composition is rendered at the current frame. This is
not necessarily the camera through which you are looking in the Composition panel.
width Return type: Number.
Returns the composition’s width, in pixels.
height Return type: Number.
Returns the composition’s height, in pixels.
duration Return type: Number.
Returns the composition’s duration, in seconds.
displayStartTime Return type: Number.
Returns the composition start time, in seconds.
frameDuration Return type: Number.
Returns the duration of a frame, in seconds.
shutterAngle Return type: Number.
Returns the shutter-angle value of the composition, in degrees.
shutterPhase Return type: Number.
Returns the shutter phase of the composition, in degrees.
bgColor Return type: Array [4].
Returns the background color of the composition.
pixelAspect Return type: Number.
Returns the pixel aspect ratio of the composition.
name Return type: String.
Returns the name of the composition.
AFTER EFFECTS CS3
User Guide
569
Footage attributes and methods
To use a footage item from the Project panel as an object in an expression, use the global footage method, as in
footage("file_name"), and then use any of the attributes below. You can also access a footage object using the
source attribute on a layer whose source is a footage item.
width Return type: Number.
Returns the width of the footage item, in pixels.
height Return type: Number.
Returns the height of the footage item, in pixels.
duration Return type: Number.
Returns the duration of the footage item, in seconds.
frameDuration Return type: Number.
Returns the duration of a frame in the footage item, in seconds.
pixelAspect Return type: Number.
Returns the pixel aspect ratio of the footage item.
name Return type: String.
Returns the name of the footage item as shown in the Project panel.
Layer Sub-objects attributes and methods
source Return type: Comp or Footage.
Returns the source Comp or source Footage object for the layer. Default time is adjusted to the time in the source.
Example: source.layer(1).position
effect(name) Return type: Effect.
Argument type: name is a String.
After Effects finds the effect by its name in the Effect Controls panel. The name can be the default name or a user-
defined name. If there is more than one effect with the same name, the effect closest to the top of the Effect Controls
panel is used. Example:
effect("Fast Blur")("Blurriness")
effect(index) Return type: Effect.
Argument type: index is a Number.
After Effects finds the effect by its index in the Effect Controls panel, starting at 1 and counting from the top.
mask(name) Return type: Mask.
Argument type: name is a String.
The name can be the default name or a user-defined name. If there is more than one mask with the same name, the
first (topmost) mask is used. Example:
mask("Mask 1")
mask(index) Return type: Mask.
AFTER EFFECTS CS3
User Guide
570
Argument type: index is a Number.
After Effects finds the mask by its index in the Timeline panel, starting at 1 and counting from the top.
Layer General attributes and methods
width Return type: Number.
Returns the width of the layer, in pixels. It is the same as source.width.
height Return type: Number.
Returns the height of the layer, in pixels. It is the same as source.height.
index Return type: Number.
Returns the index number of the layer in the composition.
parent Return type: Layer, Light, or Camera.
Returns the parent Layer object of the layer, if there is one. Example: position[0] + parent.width
hasParent Return type: Boolean.
Returns true if the layer has a parent or false if it doesn’t.
Use the hasParent attributetodetermineifalayerhasaparent.Youcanusethisattributeevenifthereisn’taparent
layeratpresent.Forexample,thefollowingexpressionindicatesthatthelayertowhichyouapplyitwillwigglebased
on the position of the layer’s parent. If the layer has no parent, then it will wiggle based on its own position. If the
layer is given a parent later, then the layer’s behavior will change accordingly:
idx = index;
if (hasParent) {
idx = parent.index;
}
thisComp.layer(idx).position.wiggle(5,20)
inPoint Return type: Number.
Returns the In point of the layer, in seconds.
Note: In general, the value of outPoint is greater than the value of inPoint.However,ifalayerisreversedintime,the
value of inPoint is greater than the value of outPoint.Similarly,thevalueofstartTime canbegreaterthanthevalue
of inPoint.
outPoint Return type: Number.
Returns the Out point of the layer, in seconds.
startTime Return type: Number.
Returns the start time of the layer, in seconds.
hasVideo Return type: Boolean.
Returns true if the layer has video, or false if it doesn’t.
hasAudio Return type: Boolean.
Returns true if the layer has audio or false if it doesn’t.
active Return type: Boolean.
AFTER EFFECTS CS3
User Guide
571
Returnstrueifthelayer’sVideoswitch isonandthecurrenttimeisbetweenthelayer’sInpointandOutpoint;
false otherwise.
audioActive Return type: Boolean.
Returnstrueifthelayer’sAudioswitch isonandthecurrenttimeisbetweenthelayer’sInpointandOutpoint;
false otherwise.
sampleImage(point, radius = [.5, .5], postEffect=true, t=time) Return type: Array [4].
Argument type: point is an Array [2], radius is an Array [2], postEffect is a Boolean, and t is a Number.
Samples the color and alpha channel values of a layer and returns the average alpha-weighted value of the pixels
within the specified distance of the point as an array: [red,green,blue,alpha]. If postEffect istrue,thesampledvalues
are for the layer after masks and effects on that layer have been rendered; if postEffect is false, the sampled values are
for the layer before masks and effects have been rendered. The input value point is in layer space; the point [0,0] is
the center of the top-left pixel in the layer. The input value radius specifies the horizontal and vertical distance from
the sample center to the edges of the sampled rectangle. The default value samples one pixel.
Note: The postEffect parameter refers to effects applied directly to the layer, not to effects applied indirectly, such as
with an adjustment layer.
This example samples a rectangle 4 pixels wide and 3 pixels high, centered around a point 100 pixels down and to
the right of the upper-left corner of the layer:
thisComp.layer(1).sampleImage([100, 100], [2, 1.5])
Dan Ebberts has an example of how to use the sampleImage method on his website:
www.adobe.com/go/learn_ae_danobscuration.
Layer Properties attributes and methods
When you add masks, effects, paint, or text to a layer, After Effects adds new properties to the Timeline panel. There
are too many of these properties to list here, so use the pick whip to learn the syntax for referring to them in your
expressions.
anchorPoint Return type: Property [2 or 3].
Returns the anchor point value of the layer in the layer’s space.
position Return type: Property [2 or 3].
Returns the position value of the layer, in world space if the layer has no parent or in the parent’s layer space if there
is a parent.
scale Return type: Property [2 or 3].
Returns the scale value of the layer, expressed as a percentage.
rotation Return type: Property.
Returns the rotation value of the layer in degrees. For a 3D layer, it returns the z rotation value in degrees.
opacity Return type: Property.
Returns the opacity value for the layer, expressed as a percentage.
audioLevels Return type: Property [2].
AFTER EFFECTS CS3
User Guide
572
Returns the value of the Audio Levels property of the layer, in decibels. This is a 2D value; the first value represents
the left audio channel, and the second value represents the right. The value is not the amplitude of the source
material’s audio track; instead, it is the value of the Audio Levels property, which may be affected by keyframes.
timeRemap Return type: Property.
Returns the value of the Time Remap property, in seconds, if Time Remap is enabled.
marker.key(index) Return type: MarkerKey.
Argument type: index is a Number.
Returns the MarkerKey object of the layer-time marker with the specified index.
marker.key(name) Return type: MarkerKey.
Argument type: name is a String.
Returns the MarkerKey object of the layer-time marker with the specified name. The name value is the name of the
marker, as typed in the comment field in the marker dialog box, for example, marker.key("ch1").Ifmorethanone
marker on the layer has the same name, this method returns the marker that occurs first in time (in layer time). The
value for a marker key is a String, not a Number.
This expression on a property ramps the property’s value from 0 to 100 between two markers identified by name:
m1 = marker.key("Start").time;
m2 = marker.key("End").time;
linear(time, m1, m2, 0, 100);
marker.nearestKey(t) Return type: MarkerKey.
Argument type: t is a Number.
Returns the layer-time marker that is nearest in time to t. For example, this expression returns the time of the marker
on the layer nearest to the time of 1 second:
marker.nearestKey(1).time
This expression returns the time of the marker on the layer nearest to the current time:
marker.nearestKey(time).time
marker.numKeys Return type: Number.
Returns the total number of markers on the layer.
name Return type: String.
Returns the name of the layer.
Layer 3D attributes and methods
orientation Return type: Property [3].
Returns the 3D orientation value, in degrees, for a 3D layer.
rotationX Return type: Property.
Returns the x rotation value, in degrees, for a 3D layer.
rotationYReturn type: Property.
Returns the y rotation value, in degrees, for a 3D layer.
AFTER EFFECTS CS3
User Guide
573
rotationZ Return type: Property.
Returns the z rotation value, in degrees, for a 3D layer.
lightTransmission Return type: Property.
Returns the value of the Light Transmission property for a 3D layer.
castsShadows Return type: Property.
Returns a value of 1.0 if the layer casts shadows.
acceptsShadows Return type: Property.
Returns a value of 1.0 if the layer accepts shadows.
acceptsLights Return type: Property.
Returns a value of 1.0 if the layer accepts lights.
ambient Return type: Property.
Returns the ambient component value as a percentage.
diffuse Return type: Property.
Returns the diffuse component value as a percentage.
specular Return type: Property.
Returns the specular component value as a percentage.
shininess Return type: Property.
Returns the shininess component value as a percentage.
metal Return type: Property.
Returns the metal component value as a percentage.
Layer Space Transforms methods
Use layer space transform methods to transform values from one space to another, such as from layer space to world
space. The “from” methods transform values from the layer’s space to the named space (composition or world). The
“to” methods transform values from the named space (composition or world) to the layer space. Each transform
method takes an optional argument to determine the time at which the layer’s transform is computed; however, you
can almost always use the current (default) time.
Use “Vec” transform methods when transforming a direction vector, such as the difference between two position
values. Use the plain (non-”Vec”) transform methods when transforming a point, such as position. Composition
(comp) and world space are the same for 2D layers. For 3D layers, however, composition space is relative to the active
camera, and world space is independent of the camera.
toComp(point, t=time) Return type: Array [2 or 3].
Argument type: point is an Array [2 or 3], and tis a Number.
Transforms a point from layer space to composition space.
fromComp(point, t=time) Return type: Array [2 or 3].
Argument type: point is an Array [2 or 3], and t is a Number.
AFTER EFFECTS CS3
User Guide
574
Transforms a point from composition space to layer space. The resulting point in a 3D layer may have a nonzero
value even though it is in layer space. Example: fromComp(thisComp.layer(2).position)
toWorld(point, t=time) Return type: Array [2 or 3].
Argument type: point is an Array [2 or 3], and t is a Number.
Transforms a point from layer space to view-independent world space. Example:
toWorld.effect("Bulge")("Bulge Center")
fromWorld(point, t=time) Return type: Array [2 or 3].
Argument type: point is an Array [2 or 3], and t is a Number.
Transforms a point from world space to layer space. Example: fromWorld(thisComp.layer(2).position)
toCompVec(vec, t=time) Return type: Array [2 or 3].
Argument type: vec is an Array [2 or 3], and t is a Number.
Transforms a vector from layer space to composition space. Example: toCompVec([1, 0])
fromCompVec(vec, t=time) Return type: Array [2 or 3].
Argument type: vec is an Array [2 or 3], and t is a Number.
Transforms a vector from composition space to layer space. Example (2D layer):
dir=sub(position, thisComp.layer(2).position);
fromCompVec(dir)
toWorldVec(vec, t=time) Return type: Array [2 or 3].
Argument type: vec is an Array [2 or 3], and t is a Number.
Transforms a vector from layer space to world space. Example:
p1 = effect("Eye Bulge 1")("Bulge Center");
p2 = effect("Eye Bulge 2")("Bulge Center");
toWorld(sub(p1, p2))
fromWorldVec(vec, t=time) Return type: Array [2 or 3].
Argument type: vec is an Array [2 or 3], and t is a Number.
Transforms a vector from world space to layer space. Example: fromWorld(thisComp.layer(2).position)
fromCompToSurface(point, t=time) Return type: Array [2].
Argument type: point is an Array [2 or 3], and t is a Number.
Projects a point located in composition space to a point on the surface of the layer (zero z-value) at the location where
it appears when viewed from the active camera. This is useful for setting effect control points. Use with 3D layers only.
Camera attributes and methods
Camera objects have the same attributes and methods as Layer objects, except for source,effect,mask,width,
height,anchorPoint,scale,opacity,audioLevels,timeRemap, and all of the material properties.
pointOfInterest Return type: Property [3].
Returns the camera’s point of interest values in world space.
AFTER EFFECTS CS3
User Guide
575
zoom Return type: Property.
Returns the camera’s zoom values in pixels.
Here's an expression for the Scale property of a layer that maintains the relative size of the layer in frame while
changing the layer's z position (depth) or the camera's Zoom value:
cam = thisComp.activeCamera;
distance = length(sub(position, cam.position));
scale * distance / cam.zoom;
depthOfField Return type: Property.
Returns 1 if the camera’s Depth Of Field property is on, or returns 0 if it is off.
focusDistance Return type: Property.
Returns the camera’s focus distance value, in pixels.
aperture Return type: Property.
Returns the camera’s aperture value, in pixels.
blurLevel Return type: Property.
Returns the camera’s blur level value as a percentage.
active Return type: Boolean.
Returnstrueifthecameraistheactivecameraforthecompositionatthecurrenttime:thecamera’sVideoswitch
is on, the current time is between the camera’s In and Out points, and it is the first (topmost) such camera listed in
the Timeline panel. Returns false otherwise.
See also
“Cameras, lights, and points of interest” on page 176
Light attributes and methods
Light objects have the same attributes and methods as Layer objects, except for source,effect,mask,width,
height,anchorPoint,scale,opacity,audioLevels,timeRemap, and all of the material properties.
pointOfInterest Return type: Property [3].
Returns the light’s point of interest values in world space.
intensity Return type: Property.
Returns the light’s intensity values as a percentage.
color Return type: Property [4].
Returns the light’s color value.
coneAngle Return type: Property.
Returns the light’s cone angle, in degrees.
coneFeather Return type: Property.
Returns the light’s cone feather value as a percentage.
shadowDarkness Return type: Property.
AFTER EFFECTS CS3
User Guide
576
Returns the light’s shadow darkness value as a percentage.
shadowDiffusion Return type: Property.
Returns the light’s shadow diffusion value, in pixels.
DavidVanBrinkprovidesaninstructionalblogpostandsampleprojectthatshowhowtouseexpressionswithlights:
www.adobe.com/go/learn_ae_ominoflashing.
See also
“Cameras, lights, and points of interest” on page 176
Effect attributes and methods
active Return type: Boolean.
Returns true if the effect is turned on (the Effect switch is selected).
param(name) Return type: Property.
Argument type: name is a String.
Returns a property within an effect. Effect control points are always in layer space. Example:
effect("Bulge").param("Bulge Height")
param(index) Return type: Property.
Argument type: index is a Number.
Returns a property within an effect. Effect control points are always in layer space. For example,
effect("Bulge").param(4) returns the Bulge Height property.
Mask attributes and methods
Note: You can link Mask Path properties to other path properties (paths in a shape layer and brush strokes), but the
properties are not accessible for direct numerical manipulation through expressions.
maskOpacity Return type: Property.
Returns the mask’s opacity value as a percentage.
maskFeather Return type: Property.
Returns the mask’s feather value, in pixels.
maskExpansion Return type: Property.
Returns the mask’s expansion value, in pixels.
invert Return type: Boolean.
Returns true if the mask is inverted or false if it is not.
Property attributes and methods
value Return type: Number, Array, or String.
Returns the property’s value at the current time.
valueAtTime(t) Return type: Number or Array.
AFTER EFFECTS CS3
User Guide
577
Argument type: t is a Number.
Returns the property’s value at the specified time, in seconds.
For example, to have a property's value for each frame be chosen randomly from a set of four values, set your four
values as keyframes at 0, 1, 2, and 3 seconds, and then apply the following expression to the property:
valueAtTime(random(4))
velocity Return type: Number or Array.
Returns the temporal velocity value at the current time. For spatial properties, such as Position, it returns the tangent
vector value. The result is the same dimension as the property.
velocityAtTime(t) Return type: Number or Array.
Argument type: t is a Number.
Returns the temporal velocity value at the specified time.
speed Return type: Number.
Returns a 1D, positive speed value equal to the speed at which the property is changing at the default time. This
element can be used only for spatial properties.
speedAtTime(t) Return type: Number.
Argument type: t is a Number.
Returns the spatial speed value at the specified time.
wiggle(freq, amp, octaves=1, amp_mult=.5, t=time) Return type: Number or Array.
Argument type: freq,amp,octaves,amp_mult, and t are Numbers.
Randomly shakes (wiggles) the value of the property.
freq value is the frequency in wiggles per second.
amp value is the amplitude in units of the property to which it is applied.
octaves is the number of octaves of noise to add together. This value controls how much detail there is in the wiggle.
Make this value higher than the default of 1 to include higher frequencies or lower to include amplitude harmonics
in the wiggle.
amp_mult is the amount that amp is multiplied by for each octave. This value controls how fast the harmonics drop
off. The default is 0.5; make it closer to 1 to have the harmonics added at the same amplitude as the base frequency,
or closer to 0 to add in less detail.
tisthebasestarttime.Thisvaluedefaultstothecurrenttime.Usethisparameterifyouwanttheoutputtobeawiggle
of the property value sampled at a different time.
Example: position.wiggle(5, 20, 3, .5) will produce about 5 wiggles per second with an average size of about
20 pixels. In addition to the main wiggle, two more levels of detailed wiggles will occur with a frequency of 10 and
20 wiggles per second, and sizes of 10 and 5 pixels, respectively.
This example, on a two-dimensional property such as Scale, wiggles both dimensions by the same amount:
v = wiggle(5, 10);
[v[0], v[0]]
This example, on a two-dimensional property, wiggles only along the y axis:
AFTER EFFECTS CS3
User Guide
578
freq = 3;
amp = 50;
w = wiggle(freq,amp);
[value[0],w[1]];
temporalWiggle(freq, amp, octaves=1, amp_mult=.5, t=time) Return type: Number or Array.
Argument type: freq,amp,octaves,amp_mult, and t are Numbers.
Samples the property at a wiggled time. The freq value is the frequency in wiggles per second, amp is the amplitude
in units of the property to which it is applied, octaves is the number of octaves of noise to add together, amp_mult is
theamountthatamp is multiplied by for each octave, and tisthebasestarttime.Forthisfunctiontobemeaningful,
the property it samples must be animated, because the function alters only the time of sampling, not the value.
Example: scale.temporalWiggle(5, .2)
smooth(width=.2, samples=5, t=time) Return type: Number or Array.
Argument type: width,samples, and t are Numbers.
Smooths the property’s values over time, converting large, brief deviations in the value to smaller, more evenly
distributed deviations. This is accomplished by applying a box filter to the value of the property at the specified time.
The width value is the range of time (in seconds) over which the filter is averaged. The samples value is the number
of discrete samples evenly spaced over time; use a larger value for greater smoothness (but decreased performance).
Generally, you’ll want samples to be an odd number so that the value at the current time is included in the average.
Example: position.smooth(.1, 5)
loopIn(type="cycle", numKeyframes=0) Return type: Number or Array.
Loopsasegmentoftimethatismeasuredfromthefirstkeyframeonthelayerforwardtowardthelayer’sOutpoint.
Theloopplaysfromthelayer’sInpoint.ThenumKeyframes value determines what segment is looped: The segment
looped is the portion of the layer from the first keyframe to the numKeyframes+1 keyframe. For example,
loopIn("cycle", 3) loops the segment bounded by the first and fourth keyframes. The default value of 0 means
that all keyframes will loop.
You can use keyframe-looping methods to repeat a series of keyframes. You can use these methods on any property
except a marker or Source Text property. Keyframes or duration values that are too large are clipped to the maximum
allowable value. Values that are too small result in a constant loop.
loopOut(type="cycle", numKeyframes=0) Return type: Number or Array.
Loops a segment of time that is measured from the last keyframe on the layer back toward the layer’s In point. The
loop plays until the layer’s Out point. The segment to loop is determined by the specified number of keyframes. The
numKeyframes value sets the number of keyframe segments to loop; the specified range is measured backward from
Loop type Result
cycle (default) Repeats the specified segment.
pingpong Repeats the specified segment, alternating between forward and backward.
offset Repeats the specified segment, but offsets each cycle by the difference in the value of the prop-
erty at the start and end of the segment, multiplied by the number of times the segment has
looped.
continue Does not repeat the specified segment, but continues to animate a property based on the
velocity at the first or last keyframe. For example, if the last keyframe of a layer’s Scale property
is 100%, the layer continues to scale from 100% to the Out point, instead of looping directly
back to the Out point. This type does not accept a keyframes or duration argument.
AFTER EFFECTS CS3
User Guide
579
the last keyframe. For example, loopOut("cycle", 1) loops the segment bounded by the last keyframe and
second-to-last keyframe. The default value of 0 means that all keyframes will loop. See the entry for loopIn for more
information.
David Van Brink provides a blog post and sample project that show how to use the Echo effect, the Particle
Playground effect, and the loopOut expression to animate a swarm of stylized swimming bacteria:
www.adobe.com/go/learn_ae_ominosalmonella.
loopInDuration(type="cycle", duration=0) Return type: Number or Array.
Loopsasegmentoftimethatismeasuredfromthefirstkeyframeonthelayerforwardtowardthelayer’sOutpoint.
The loop plays from the layer’s In point. The segment to loop is determined by the specified duration. The duration
value sets the number of composition seconds in a segment to loop; the specified range is measured from the first
keyframe. For example, loopInDuration("cycle", 1) loops the first second of the entire animation. The default
of 0 means that the segment to loop begins at the layer Out point. See the entry for loopIn for more information.
loopOutDuration(type="cycle", duration=0) Return type: Number or Array.
Loops a segment of time that is measured from the last keyframe on the layer back toward the layer’s In point. The
loop plays until the layer’s Out point. The segment to loop is determined by the specified duration. The duration
value sets the number of composition seconds in a segment to loop; the specified range is measured backward from
thelastkeyframe.Forexample,loopOutDuration("cycle", 1) loopsthelastsecondoftheentireanimation.The
default of 0 means that the segment to loop begins at the layer In point. See the entry for loopIn for more infor-
mation.
key(index) Return type: Key or MarkerKey.
Argument type: index is a Number.
Returns the Key or MarkerKey object by number. For example, key(1) returns the first keyframe.
key(markerName) Return type: MarkerKey.
Argument type: markerName is a String.
Returns the MarkerKey object with this name. Use only on marker properties.
nearestKey(t) Return type: Key or MarkerKey.
Returns the Key or MarkerKey object nearest to a designated time.
numKeys Return type: Number.
Returns the number of keyframes on a property. Returns the number of markers on a marker property.
propertyGroup(countUp = 1) Return type: Group.
Returns a group of properties relative to the property on which the expression is written. For example, if you add the
propertyGroup(1) expression to a Brush stroke’s Rotation property, the expression targets the Transform property
group, which contains the Rotation property. If you add propertyGroup(2) instead, the expression targets the
Brush property group. This lets you establish name-independent relationships in the property hierarchy. This is
especially useful when duplicating properties that contain expressions.
propertyIndex Return type: Number.
Returns the index of a property relative to other properties in its property group, including property groups within
masks, effects, text animators, selectors, shapes, trackers, and track points.
AFTER EFFECTS CS3
User Guide
580
Example: Animating with the propertyGroup method and propertyIndex attribute
Values of propertyGroup relative to brush stroke’s Position property
A. propertyGroup(4) B. propertyGroup(3) C. propertyGroup(2) D. propertyGroup(1) E. Position’s propertyIndex value is 2; Rotation’s
propertyIndex value is 4.
In this example, each brush stroke’s propertyGroup method targets the Brush property group because that group is
two property groups up from the Rotation property. The propertyIndex attribute in each Brush stroke then returns
a unique value for each Brush stroke. The resulting value is then multiplied by the time and 200 and applied to each
rotation value, rotating each brush stroke differently, creating swirling paint strokes:
propertyGroup(2).propertyIndex * time * 200
Animating a brush stroke with an expression
Key attributes and methods
When you access a Key object, you can get time,index, and value properties from it. For example, the following
expression gives you the value of the third Position keyframe: position.key(3).value.
The following expression, when written on an Opacity property with keyframes, ignores the keyframe values and
uses only the keyframes’ placement in time to determine where a flash should occur:
d = Math.abs(time - nearestKey(time).time);
easeOut(d, 0, .1, 100, 0)
value Return type: Number or Array.
Returns the value of the keyframe.
time Return type: Number.
Returns the time of the keyframe.
D
C
B
A
E
AFTER EFFECTS CS3
User Guide
581
index Return type: Number.
Returns the index of the keyframe.
MarkerKey attributes
You can access values for composition-time markers and layer-time markers using the same methods. Access layer-
time markers through the thisLayer.marker object; access composition-time markers through the
thisComp.marker object.
For the purpose of expressions, markers are a special kind of Key object, so you can use methods such as
nearestKey(time) to access markers, and markers also have time and index attributes. The index attribute is not
the number (name) of the marker; it is the keyframe index number, representing the marker’s order in the time ruler.
Expressions have access to all of the values for a marker that you can set in the Composition Marker or Layer Marker
dialog box. This expression on a text layer’s Source Text property displays the time, index, comment (name), chapter,
URL, frame target, and cue point name for the layer marker nearest the current time, and whether the marker is for
an event cue point:
m = thisLayer.marker.nearestKey(time);
s = "time:" + timeToCurrentFormat(m.time) + "\r" +
"key index: " + m.index + "\r" +
"comment:" + m.comment + "\r" +
"chapter:" + m.chapter + "\r" +
"URL:" + m.url + "\r" +
"frame target: " + m.frameTarget + "\r" +
"cue point name: " + m.cuePointName + "\r" +
"Event cue point? " + m.eventCuePoint + "\r";
for (param in m.parameters){
s += "parameter: " + param + " value: " + m.parameters[param] + "\r";
}
s
comment Return type: String.
Contents of Comment field in marker dialog box.
chapter Return type: String.
Contents of Chapter field in marker dialog box.
url Return type: String.
Contents of URL field in marker dialog box.
frameTarget Return type: String.
Contents of Frame Target field in marker dialog box.
eventCuePoint Return type: Boolean.
Setting for cue point type in marker dialog box. True for Event; false for Navigation.
cuePointName Return type: String.
Contents of cue point Name field in marker dialog box.
parameters Return type: associative array of String values.
Contents of Parameter Name and Parameter Value fields in marker dialog box.
AFTER EFFECTS CS3
User Guide
582
For example, if you have a parameter named “background color”, then you can use the following expression to access
its value at the nearest marker:
thisComp.marker.nearestKey(time).parameters["background color"]
Expression examples
Many of the examples in this section are based on expressions provided by Dan Ebberts. Dan Ebberts also has an
excellent collection of example expressions and tutorials for learning how to work with expressions on his website:
www.adobe.com/go/learn_ae_motionscripthome.
ColinBraileyprovidesatutorialandexampleprojectthatshowhowtouseexpressionstomakeonelayerrepelothers
in a natural-seeming manner: www.adobe.com/go/learn_ae_colinrepelexpression.
TheAEEnhancersforumprovideslotsofexamplesandusefulinformationaboutexpressions,aswellasscriptsand
animation presets. In this post, Paul Tuersley provides a tutorial and example project that show how to use expres-
sions to animate several layers in a swarm: www.adobe.com/go/learn_ae_paulswarmexpression.
Rick Gerard provides an example that demonstrates rolling a square object along a floor so that the sides stayed in
contact with the floor plane: www.adobe.com/go/learn_ae_ricksquarewheels.
Example: Make a layer revolve in a circle
You can create an expression without using properties from other layers. For example, you can make a layer revolve
in a perfect circle.
1Select a layer, press P to reveal its Position property in the Timeline panel, and Alt-click (Windows) or Option-
click (Mac OS) the stopwatch to the left of the property name.
2Enter the following in the expression field:
[(thisComp.width/2), (thisComp.height/2)] + [Math.sin(time)*50, -Math.cos(time)*50]
Example: Rotate the hands of a clock
You can use the pick whip to link rotation values between layers to animate the hands on a clock—as the hour hand
moves from hour to hour, the minute hand rotates the full circumference of the clock face. This type of animation
would take a long time to create if you had to set each keyframe for both hand layers, but with the pick whip, you can
do it in a matter of minutes.
1Import or create two long, narrow solid-color layers: an hour hand and a minute hand. (See “Create or modify a
solid-color layer” on page 136.)
2Set the anchor points at the ends of the layers. (See “Work with layer anchor points” on page 154.)
3Move the layers so that the anchor points are at the center of the composition. (See “Move layers in space” on
page 139.)
4Set Rotation keyframes for the hour hand. (See “Set keyframes” on page 187.)
5Select the Rotation property for the minute hand and choose Animation > Add Expression.
6Drag the pick whip to the hour hand’s Rotation property. The following expression appears:
thisComp.layer("hour hand").rotation
7Tomaketheminutehandrotate12timesasfastasthehourhand,add*12 at the end of the expression as follows:
AFTER EFFECTS CS3
User Guide
583
thisComp.layer("hour hand").rotation*12
Guy Chen provides a simple project that takes this idea further, connecting a clock's minute hand and hour hand's
rotation to the rotation of the second hand: www.adobe.com/go/learn_ae_guyclockexpression.
Example: Position one layer between two others
This example expression positions and maintains one layer at a balanced distance between two other layers.
1Start with three layers. (See “Creating layers” on page 133.)
2Animate the positions of the first two layers in the Timeline panel. (See “Creating and modifying motion paths”
on page 197.)
3Select the third layer, press P to reveal the Position property, and Alt-click (Windows) or Option-click (Mac OS)
the stopwatch button to the left of the property name.
4Enter the following in the expression field:
(thisComp.layer(1).position + thisComp.layer(2).position)/2
Example: Create a trail of images
This example expression instructs a layer to be at the same position as the next higher layer in the Timeline panel,
but delayed by a specified amount of time (in this case, 0.5 seconds). You can set similar expressions for the other
geometric properties.
1Start with two solid-color layers that are scaled to approximately 30% of the composition size. (See “Create or
modify a solid-color layer” on page 136.)
2Animate the position of the first layer. (See “Creating and modifying motion paths” on page 197.)
3Select the second layer, press P to reveal the Position property, and Alt-click (Windows) or Option-click (Mac OS)
the stopwatch button to the left of the property name.
4Enter the following in the expression field:
thisComp.layer(thisLayer, -1).position.valueAtTime(time - .5)
5Duplicate the last layer five times by selecting it and pressing Ctrl+D (Windows) or Command+D (Mac OS) five
times.
All layers follow the same path, and each is delayed 0.5 seconds from the previous.
Example: Create a bulge between two layers
ThisexampleexpressionsynchronizestheBulgeCenterargumentoftheBulgeeffectinonelayerwiththeposition
of another layer. For example, you can create an effect that looks like a magnifying glass moving over a layer, with
the contents under the magnifying glass bulging as the lens (that is, the overlying layer) moves. This expression uses
the fromWorld method,whichmakestheexpressionworkcorrectlyregardlessofwhetheryoumovethemagnifying
glass layer or the underlying layer. You can rotate or scale the underlying layer, and the expression stays intact.
You can also use other effects, such as Ripple, with this expression.
1Start with two layers. Make one layer a magnifying glass or similar object with a hole in the middle and name it
Magnifier. (See “Creating layers” on page 133.)
2Animate the position of the magnifying glass layer. (See “Creating and modifying motion paths” on page 197.)
3Apply the Bulge effect to the other layer. (See “Apply an effect or animation preset” on page 351.)
AFTER EFFECTS CS3
User Guide
584
4SelecttheBulgeeffect’sBulgeCenterpropertyintheTimelinepanelandchooseAnimation>AddExpression,or
Alt-click (Windows) or Option-click (Mac OS) the property’s stopwatch button.
5Select the default expression text and type the following:
fromWorld(thisComp.layer("Magnifier").position)
Example: Fade a 3D layer’s opacity based on distance from camera
❖Apply the following expression to a 3D layer’s Opacity property:
startFade = 500; // Start fade 500 pixels from camera.
endFade = 1500; // End fade 1500 pixels from camera.
try{ // Check whether there's a camera.
C = thisComp.activeCamera.toWorld([0,0,0]);
}catch(err){ // No camera, so assume 50mm.
w = thisComp.width * thisComp.pixelAspect;
z = (w/2)/Math.tan(degreesToRadians(19.799));
C = [0,0,-z];
}
P = toWorld(anchorPoint);
d = length(C,P);
linear(d,startFade,endFade,100,0)
The fade starts at a distance of 500 pixels from the camera and is complete at 1500 pixels from the camera. The
linear interpolation method is used to map distance values to opacity values.
See also
“Add, edit, and remove expressions” on page 549
“Create a camera layer and change camera settings” on page 176
Example: Make a 3D layer invisible if facing away from camera
❖Apply the following expression to a 3D layer’s Opacity property:
if (toCompVec([0, 0, 1])[2] > 0 ) value else 0
See also
“Add, edit, and remove expressions” on page 549
“Create a camera layer and change camera settings” on page 176
Example: Flip layer horizontally if facing away from camera
❖Apply the following expression to a 3D layer’s Scale property:
if (toCompVec([0, 0, 1])[2] > 0 ) value else [-value[0], value[1], value[2]]
See also
“Add, edit, and remove expressions” on page 549
“Create a camera layer and change camera settings” on page 176
AFTER EFFECTS CS3
User Guide
585
Example: Animate scale at each layer-time marker
❖Apply the following expression to a Scale property to make a layer wobble at each marker:
n = 0;
t = 0;
if (marker.numKeys > 0){
n = marker.nearestKey(time).index;
if (marker.key(n).time > time) n--;
}
if (n > 0) t = time - marker.key(n).time;
amp = 15;
freq = 5;
decay = 3.0;
angle = freq * 2 * Math.PI * t;
scaleFact = (100 + amp * Math.sin(angle) / Math.exp(decay * t)) / 100;
[value[0] * scaleFact, value[1] / scaleFact];
See also
“Add, edit, and remove expressions” on page 549
Example: Start or stop wiggle at specific time
Yo u c a n u s e a n y e x p re s s i o n i n p l a c e o f t h e wiggle expression used here, to begin and end any expression’s influence
at a specific time.
•Apply the following expression to a property to wiggle it beginning at time 2 seconds:
timeToStart = 2;
if (time > timeToStart){
wiggle(3,25);
}else{
value;
}
•Apply the following expression to a property to stop wiggling it at time 4 seconds:
timeToStop = 4;
if (time > timeToStop){
value;
}else{
wiggle(3,25);
}
•Apply the following expression to a property to start wiggling it at time 2 seconds and stop wiggling it at time 4
seconds:
timeToStart = 2;
timeToStop = 4;
if ((time > timeToStart) && (time < timeToStop)){
wiggle(3,25);
}else{
value;
}
AFTER EFFECTS CS3
User Guide
586
See also
“Add, edit, and remove expressions” on page 549
Example: Match camera’s focal plane to another layer
❖Apply the following expression to a camera layer’s Focus Distance property to have its focus distance match the
distance to the anchor point of a layer named “target”:
target = thisComp.layer("target");
V1 = target.toWorld(target.anchorPoint) - toWorld([0,0,0]);
V2 = toWorldVec([0,0,1]);
dot(V1,V2);
See also
“Add, edit, and remove expressions” on page 549
“Create a camera layer and change camera settings” on page 176
587
Chapter 17: Rendering and exporting
Basics of rendering and exporting
About rendering and exporting
Rendering is the creation of the finished frames of a movie from a composition. The rendering of a frame is the
creation of a composited two-dimensional image from all of the layers, settings, and other information in a compo-
sition that make up the model for that image. The rendering of a movie is the frame-by-frame rendering of each of
the frames that make up the movie. For more information on how each frame is rendered, see “Render order and
collapsing transformations” on page 115.
After a composition is rendered for final output, it is processed by one or more output modules that encode the
rendered frames into one or more output files.
Amoviecanbemadeintoasingleoutputfile(suchasaFlashVideomovie)thatcontainsalloftherenderedframes,
or it can be made into a sequence of still images (as you would do when creating output for a film recorder).
Though it is common to speak of rendering as if this term only applies to final output, the processes of creating
previewstoshowintheFootage,Layer,andCompositionpanelsarealsokindsofrendering.Infact,itispossibleto
save a RAM preview as a movie and use that as your final output. (See “Preview video and audio” on page 120.)
Note: Some kinds of exporting don’t involve rendering and are for intermediate stages in a workflow, not for final output.
For example, you can export a project as an Adobe Premiere Pro project by choosing File > Export > Adobe Premiere
Pro Project. The project information is saved without rendering.
To see a video tutorial on rendering and exporting, visit the Adobe website at www.adobe.com/go/vid0262.
After Effects provides a variety of formats and compression options for output. Which format and compression
optionsyouchoosedependsonhowyouroutputwillbeused.Forexample,ifthemoviethatyourenderfromAfter
Effects is the final product that will be played directly to an audience, then you need to consider the medium from
which you’ll play the movie and what limitations you have on file size and data rate. By contrast, if the movie that
you create from After Effects is an intermediate product that will be used as input to a video editing system, then you
should output without compression to a format compatible with the video editing system.
Aharon Rabinowitz has an article on the Creative COW website about planning your project and deciding what
formats and settings to use for final output: www.adobe.com/go/learn_ae_aharonplanning.
Keep in mind the fact that you can use different encoding and compression schemes for different phases of your
workflow. For example, you may choose to export a small number of frames as full-resolution still images (e.g., TIFF
files) when you need approval from a customer about the colors in a shot; whereas you may export the movie using
a lossy encoding scheme (e.g., H.264) when you need approval for the timing of the animation.
Important: You do not need to render a movie multiple times to export it to multiple formats with the same render
settings.Youcanexportmultipleversionsofthesamerenderedmoviebyaddingoutputmodulestoarenderiteminthe
Render Queue panel.
AFTER EFFECTS CS3
User Guide
588
In the Render Queue panel, you can manage several render items at once, each with its own render settings and
output module settings. Render settings determine such characteristics as output frame rate, duration, resolution,
and layer quality. Output module settings—which are applied after render settings—determine such post-rendering
characteristics as output format, compression options, cropping, and whether to embed a link to the project in the
output file. You can create templates that contain commonly used render settings and output module settings. Using
the Render Queue panel, you can render the same composition to different formats or with different settings, all with
one click of the Render button:
•You can output to a sequence of still images, such as a Cineon sequence, which you can then transfer to film for
cinema projection.
•You can output using lossless compression (or no compression) to a QuickTime container for transfer to a non-
linear editing (NLE) system for video editing.
•You can output to H.264 or another highly compressed format for playback on mobile devices such as cellular
phones or the Apple iPod.
•You can output to MPEG-2 for playback from DVD.
Note: To transfer the output rendered from After Effects to film or video, you must have the proper hardware for film or
video transfer, or have access to a service bureau that can provide transfer services.
If you output your movie in the H.264 format for mobile devices, then you can use Adobe Device Central to view
your movie as it will appear on any of a large number of mobile devices. Adobe Device Central emulates cellular
phones, portable media players (such as the Apple iPod), and many other common viewing devices. (See “Preview a
movie on a virtual mobile device using After Effects” on page 618.)
Rendering a composition into a movie can take a few seconds or many hours, depending on the composition’s frame
size, quality, complexity, and compression method. As After Effects renders the item, you are unable to work in the
program. An audio alert indicates when rendering is complete.
A chime plays when all items in the render queue have been rendered and exported; a different noise plays if a render
operation fails. You can replace the render-complete sounds on Windows by placing files named rnd_okay.wav and
rnd_fail.wav in this folder: C:\Documents and Settings\[user_name]\Application Data\Adobe\After Effects\8.0 .
GridIron Software provides Nucleo Pro 2, which improves rendering performance in After Effects in several ways:
www.adobe.com/go/learn_ae_gridironnucleopro.
Lloyd Alvarez provides a script that takes items that are ready to render in the render queue and sends them to render
in the background using aerender: www.adobe.com/go/learn_ae_lloydbgrenderer.
See also
“Work with render settings” on page 597
“Work with output module settings” on page 599
Supported output formats
Unless otherwise noted, all image file formats are exported at 8 bits per channel (bpc).
Additional output formats may be available in the File > Export menu, depending on which QuickTime components
and codecs you have installed. To export to some image sequence formats, choose File > Export > Image Sequence.
You can add the ability to export other kinds of data by installing plug-ins or scripts provided by parties other than
Adobe. For example, Paul Tuersley provides a script with which you export After Effects composition data as Cinema
4D project data: www.adobe.com/go/learn_ae_paulaftereffectstocinema4d.
AFTER EFFECTS CS3
User Guide
589
Video and animation formats
•3GPP (3GP, 3G2, AMC; requires QuickTime 6.5 or later)
•Adobe Clip Notes (PDF containing rendered movie)
•Animated GIF (GIF)
•Cineon (CIN, DPX; 16 and 32 bpc converted to 10 bpc)
•ElectricImage (IMG, EIZ)
•Filmstrip (FLM)
•Flash (SWF)
•Flash Video (FLV)
•H.264 and H.264 Blu-ray
•MPEG-2 (Windows and Mac OS on Intel-based Mac only)
•MPEG-2 DVD (Windows and Mac OS on Intel-based Mac only)
•MPEG-2 Blu-ray (Windows and Mac OS on Intel-based Mac only)
•MPEG-4
•OMF (media [essence] only, Windows only)
•QuickTime (MOV, DV; requires QuickTime for 8 bpc and codec support for 16 bpc)
•RealMedia (RAM, RM; Windows only)
•Video for Windows (AVI)
•Windows Media (Windows only)
After Effects can read and render QuickTime files in 16-bpc color depth. When you select a QuickTime codec that
supports 16-bpc color depth in the Output Module dialog box, such as the None16 codec, Trillions Of Colors is
available. For information on the None16 and Microcosm codecs, see the Digital Anarchy website:
www.adobe.com/go/learn_ae_digitalanarchynone16. To find out whether your video codec supports 16-bpc color depth,
contact the manufacturer directly.
Video project formats
•Adobe Premiere Pro project (PRPROJ; Windows and Mac OS on Intel-based Mac only)
Still-image formats
•Adobe Photoshop (PSD; 8, 16, and 32 bpc)
•Bitmap (BMP, RLE)
•CompuServe GIF (GIF)
•Maya IFF (IFF; 16 bpc)
•JPEG (JPG, JPE)
•Open EXR (EXR)
•Pict (PCT, PIC)
•PNG (PNG; 16 bpc)
•Radiance (HDR, RGBE, XYZE)
•RLE (RLE)
AFTER EFFECTS CS3
User Guide
590
•SGI (SGI, BW, RGB, 16 bpc)
•Targa (TGA, VBA, ICB, VST)
•TIFF (TIF; 8, 16, and 32 bpc)
Audio-only formats
•AU audio file (AU)
•Audio Interchange File Format (AIFF)
•MP3 (MP3)
•WAV
See also
“Supported import formats” on page 48
Render and export a movie using the render queue
1SelectthecompositionfromwhichtomakeamovieintheProjectpanel,andthendooneofthefollowingtoadd
the composition to the render queue:
•Choose Composition > Make Movie. Specify a name and location for the output file, and click Save.
•Choose Composition > Add To Render Queue.
•Drag the composition to the Render Queue panel.
2Click the triangle next to the Output To heading in the Render Queue panel to choose a name for the output file
based on a naming convention, and then choose a location; or click the text next to the Output To heading to enter
any name. If you used Make Movie to add the composition to the render queue, then you can skip this step. (See
“Specify file names and locations for rendered output” on page 595.)
3Click the triangle to the right of the Render Settings heading to choose a render settings template, or click the
underlined text to the right of the Render Settings heading to customize the settings. (See “Work with render
settings” on page 597.)
4Choose a Log type from the Log menu.
5Click the triangle to the right of the Output Module heading to choose an output module settings template, or
click the underlined text to the right of the Output Module heading to customize the settings. You use the output
module settings to specify the file format of the output movie. In some cases, a format-specific dialog box opens after
you choose a format, in which you can specify format-specific settings. (See “Work with output module settings” on
page 599 and “Encoding and compression options for movies” on page 612.)
When an output name and location have been set, and render settings and an output module have been selected, the
entry in the Render column will automatically become selected (shown by a check mark) and the status will change
to Queued. This means that the render item is in the render queue.
Press the Caps Lock key before you start rendering to prevent the Composition panel from displaying rendered
frames. By not updating the Composition panel, After Effects requires less time to process simple render items with
a lot of frames.
6Click the Render button in the upper-right corner of the Render Queue panel.
AFTER EFFECTS CS3
User Guide
591
To create a new composition from a footage item and add that composition to the render queue, drag the footage
item from the Project panel to the Render Queue panel. This is a convenient way to convert a footage item from one
format to another.
Work in the Render Queue panel
Use the Render Queue panel to render compositions, apply render settings and output module settings, and obtain
information on the rendering process.
When you place a composition into the Render Queue panel, it becomes a render item. You can add many render
items to the render queue, and After Effects can render multiple items in a batch, unattended. When you click the
Render button in the upper-right corner of the Render Queue panel, all items with the status of Queued are rendered
and output in the order in which they are listed in the Render Queue panel.
When rendering of a render item is complete, it remains in the Render Queue panel with its status changed to Done
until you remove the item from the Render Queue panel. You cannot re-render a completed item, but you can
duplicate it to create a new item in the queue with the same settings or with new settings.
When working with multiple render items, it is often useful to add comments in the Comments column in the Render
Queue panel. If the Comments column is not visible, right-click (Windows) or Control-click (Mac OS) a column
heading, and choose Columns > Comments.
See also
“Render and export a movie using the render queue” on page 590
Render item statuses
Each render item has a status, which appears in the Status column in the Render Queue panel:
Unqueued The render item is listed in the Render Queue panel but is not ready to render. Confirm that you have
selected the desired render settings and output module settings, and then select the Render option to queue the
render item.
Queued The render item is ready to render.
Needs Output An output file name has not been specified. Choose a value from the Output To menu, or click the
underlined Not Yet Specified text next to the Output To heading to specify a file name and path.
Failed After Effects was unsuccessful in rendering the render item. Use a text editor to view the log file for specific
information on why the rendering was unsuccessful.
User Stopped The rendering process was stopped.
Done The rendering process for the item is complete.
Manage render items and change render statuses
•Toremovearenderitemfromtherenderqueue(changeitsstatusfromQueuedtoUnqueued),deselectitsentry
in the Render column. The item remains in the Render Queue panel.
•To change a render item’s status from Unqueued to Queued, select its entry in the Render column.
•To remove a render item from the Render Queue panel, select the item and press Delete, or choose Edit > Clear.
•To rearrange items in the Render Queue panel, drag an item up or down the queue. A heavy black line appears
between render items, indicating where the item will be placed.
AFTER EFFECTS CS3
User Guide
592
Pause or stop rendering
•To pause rendering, click Pause. To resume rendering, click Continue.
While rendering is paused, you cannot change settings or use After Effects in any other way.
•To stop rendering with the purpose of starting the same render over again, Alt-click (Windows) or Option-click
(Mac OS) Stop.
The render item for which rendering was stopped is assigned the status User Stopped, and a new item with the status
of Queued is added to the Render Queue panel. The new item uses the same output file name and has the same
duration as the original render item.
•To stop rendering with the purpose of resuming the same render, click Stop.
The render item for which rendering was stopped is assigned the status User Stopped, and a new item with the status
ofUnqueuedisaddedtotheRenderQueuepanel.Thenewitemusesanincrementedoutputfilenameandresumes
rendering at the frame at which rendering was stopped.
Information shown for current render operations
Basic information about the current batch of renders is shown at the top of the Render Queue panel:
Message A status message.
RAM Memory available for the rendering process.
Renders Started The time at which the current batch of renders was started.
Total Time Elapsed The rendering time elapsed (not counting pauses) since the current batch of renders was started.
Log File The name and location of the file to which rendering status messages have been written (None if no log
information has been written). Use the Log menu for each render item to choose which information is written to the
log file.
To view more information about the current render operation, click the triangle to the left of Current Render Details.
The Current Render Details pane will collapse (close) after a short time. To expand the pane so that it does not
collapse after a time-out period, Alt-click (Windows) or Option-click (Mac OS) the triangle next to Current Render
Details. To view details of a completed render, review the log file.
Re-render a previously rendered item
1Select the render item.
2Do one of the following:
•To render with the same file name, choose Edit > Duplicate With File Name.
•To render with a new file name, choose Edit > Duplicate, click the underlined file name next to Output To, enter
a new file name, and click Save.
3Click Render.
Rendering and exporting movies using QuickTime components
If you have QuickTime installed, you can export a movie using components provided by QuickTime, without using
the Render Queue panel. Compositions exported using QuickTime components are rendered using the Compo-
sition panel’s current quality and resolution settings. Only the work area is rendered.
Note: You can also export movies to QuickTime using the Render Queue panel. However, some QuickTime options, such
as Fast Start and Hinted Streaming, are available only through the File > Export menu.
AFTER EFFECTS CS3
User Guide
593
The specific file formats that you can export to using QuickTime depend on how you’ve configured QuickTime. If
you install new export modules as they become available from Apple or other parties, those modules appear in the
File > Export menu in After Effects.
For more information about QuickTime effects and file formats supported by QuickTime, see QuickTime Help.
See also
“Render and export a movie using the render queue” on page 590
“Set the work area” on page 112
Render with OpenGL
OpenGL is a set of standards for high-performance processing of 2D and 3D graphics for a wide variety of applica-
tions. For After Effects users, OpenGL provides fast, high-quality rendering for previews and final output by moving
rendering from the CPU to the OpenGL hardware (GPU).
To use OpenGL in After Effects, you’ll need an OpenGL card that supports OpenGL 2.0 and has Shader support and
support for NPOT (Non Power of Two) textures.
Note: After Effects provides limited support for OpenGL 1.5 on Macintosh computers with PowerPC processors.
Feature support in After Effects is dependent on the OpenGL hardware; contact the hardware manufacturer for
details. When you first start After Effects, it attempts to determine if your OpenGL card meets the requirements, and
then enables or disables OpenGL as appropriate.
For information regarding specific OpenGL hardware, visit the After Effects section of the Adobe website at
www.adobe.com/go/learn_ae_openglsupport.
OpenGL in After Effects supports the following features:
•Shadows, except point light shadows (Colored shadows appear gray.)
•Lights (eight maximum)
•Masks
•Alpha channels
•Track mattes
•Intersecting layers
•Transformations for 2D and 3D layers
•GPU-accelerated effects, including Alpha Levels, Bevel Alpha, Box Blur, Brightness & Contrast, Channel Blur,
Color Balance, Color Balance (HLS), Curves, Directional Blur, Drop Shadow, Fast Blur, Find Edges, Gaussian Blur,
Hue/Saturation, Invert, Noise, Radial Blur, Ramp, Sharpen, and Tint.
•All blending modes except Dissolve and Dancing Dissolve
•Metal property settings for 3D layers
•Cone feather settings for light layers
•2D motion blur
•Adjustment layers
•Anti-aliasing
AFTER EFFECTS CS3
User Guide
594
Important: Use caution when enabling the OpenGL renderer in a network rendering environment. Inconsistencies may
arise if the sets of features supported by the OpenGL cards in the network aren’t the same.
When OpenGL does not support a feature, it simply renders without using that feature. For example, if your layers
contain shadows and your OpenGL hardware does not support shadows, the output will not contain shadows.
•To enable OpenGL for rendering final output, click the underlined text next to Render Settings in the Render
Queue panel, and select Use OpenGL Renderer.
•To enable OpenGL for rendering previews, choose Edit > Preferences > Previews (Windows) or After Effects >
Preferences > Previews (Mac OS), and select Enable OpenGL.
•To see what features your OpenGL card supports, choose Edit > Preferences > Previews (Windows) or After
Effects > Preferences > Previews (Mac OS), and click OpenGL Info.
•To modify the amount of texture memory, choose Edit > Preferences > Previews (Windows) or After Effects >
Preferences > Previews (Mac OS), click OpenGL Info, and enter a value for Texture Memory of no more than 80%
of the installed video RAM (VRAM) on your video card.
Note: Mac OS provides the total amount of Texture Memory available on the display card in the OpenGL Info panel;
Windows does not.
See also
“Work with render settings” on page 597
“Preview video and audio” on page 120
Collect files in one location
TheCollectFilescommandgatherscopiesofallofthefilesinaprojectorcompositionintoasinglelocation.Thisis
useful as a step before rendering, for archiving, or for moving a project to a different computer system or user
account.
When you use the Collect Files command, After Effects creates a new folder in which it saves a new copy of the
project, copies of the footage files, proxy files as specified, and a report describing the files, effects, and fonts
necessary to recreate the project and render the compositions.
After you collect files, you can continue making changes to a project, but be aware that those changes are stored with
the original project and not with the newly collected version.
1Choose File > Collect Files.
2In the Collect Files dialog box, choose an appropriate option for Collect Source Files.
All Collects all footage files, including unused footage and proxies.
For All Comps Collects all footage files and proxies used in any composition in the project.
For Selected Comps Collects all footage files and proxies used in compositions currently selected in the Project
panel.
For Queued Comps Collects all footage files and proxies used directly or indirectly in any of the compositions with
a Queued status in the Render Queue panel.
None (Project Only) Copies the project to a new location without collecting any source footage.
3Select other options, as appropriate:
Generate Report Only Selecting this option does not copy the files and proxies.
AFTER EFFECTS CS3
User Guide
595
Obey Proxy Settings Use this option with compositions that include proxies to specify whether you want the copy
to include the current proxy settings. If this is selected, only the files used in the composition are copied. If this is not
selected, the copy contains both proxies and source files, so you can later change proxy settings in the collected
version.
Note: If you choose For Queued Comps in the Collect Source Files dialog box, After Effects uses the proxy settings from
the render settings, not the composition.
Reduce Project Removes all unused footage items and compositions from the collected files when the following
options are chosen in the Collect Source Files menu: For All Comps, For Selected Comps, and For Queued Comps.
Change Render Output To Usetoredirecttheoutputmodulestorenderfilestoanamedfolderinthecollectedfiles
folder. This option ensures that you have access to your rendered files when you’re rendering the project from
another computer. Note that the rendering status must be valid (Queued, Unqueued, or Will Continue) for the
output modules to render files to this folder.
Enable ‘Watch Folder’ Render YoucanusetheCollectFilescommandtosaveprojectstoaspecifiedwatchfolderand
then initiate watch-folder rendering over a network. After Effects also includes a render control file called [project
name]_RCF.txt, which signals to watching computers that the project is available for rendering. After Effects and any
installed render engines can then render the project together across a network. (See “Set up watch-folder rendering”
on page 626.)
Maximum Number Of Machines Use to specify the number of render engines or licensed copies of After Effects that
you want to allocate to render the collected project. Below this option, After Effects reports how many items in the
project will be rendered using more than one computer.
Note: If rendering time is unusually long, you may have set Maximum Number Of Machines too high, and the network
overhead required to track rendering progress among all computers is out of proportion to the time spent actually
rendering frames. The optimal number depends on many variables related to the network configuration and the
computers on it; experiment to determine the optimal number for your network.
4To add your own information to the report that will be generated, click Comments, type your notes, and click OK.
The comments appear at the end of the report.
5Click Collect. Name the folder and specify a location for your collected files.
Once you start the file collection, After Effects creates the folder and copies the specified files to it. The folder
hierarchy is the same as the hierarchy of folders and footage items in your project. The new folder includes a
(Footage) folder and may include an output folder (if you selected Change Render Output To).
The names of these folders appear in parentheses to signal to any attending render engines that they should not
search these folders for projects.
Specify file names and locations for rendered output
You can locate a previously rendered item or check the destination of a queued render item by expanding the Output
Module group in the Render Queue panel and clicking the underlined file path, or by right-clicking (Windows) or
Control-clicking (Mac OS) the Output Module heading.
AFTER EFFECTS CS3
User Guide
596
Click the triangle to open the Output To menu, or click the underlined text to enter a destination.
Specify the file name and location for a single render item
•To manually enter a file name and destination folder, click the underlined text next to the Output To heading.
•To name a file using a file naming template, click the triangle next to the Output To heading, and choose a template
from the menu.
Change the destination for multiple queued render items
1In the Render Queue panel, Ctrl-click (Windows) or Command-click (Mac OS) multiple queued render items to
select them.
2Click the underlined file name next to Output To for any item.
3Choose the folder in which you want to place the rendered files. The destinations for all selected items change to
the new destination folder.
Create and use a custom file naming template
You can use custom templates to name the output according to properties of the composition and project.
To make a file naming template the default template, hold down Ctrl (Windows) or Command (Mac OS) as you
choose the template from the Output To menu.
1In the Render Queue panel, choose Custom from the Output To menu.
2If you want to base the new file naming template on an existing template, choose the existing template from the
Preset menu.
3Click in the Template box where you want to insert a file naming rule, and do any of the following:
•To add a preset property to the file name, choose the property from the Add Property menu.
•Type text in the Template box.
Note: Make sure that the insertion point is outside the square brackets ([ ]) of preset properties.
4Do any of the following:
•TosavethefilenamingtemplateasapresetforfutureuseintheOutputTomenu,clicktheSavebutton .Inthe
Choose Name dialog box, enter a name for the file naming template, and click OK.
•To always use the selected file naming template, select Default.
•To apply the selected file naming template to the current Output Module, click OK.
AFTER EFFECTS CS3
User Guide
597
Name output files automatically
The Use Default File Name And Folder preference ensures that all compositions added to the render queue are
automatically assigned a unique output file name (except for files created by saving RAM previews, which still use
the composition name). When this option is selected, each render item is assigned the same folder name as the
previous render item until you change the path. If a composition is rendered more than once, After Effects adds a
number to the file name (for example, composition_name_1).
Note: Avoid using high-ASCII or other extended characters in file names for projects to be used on different platforms
or rendered using a watch folder.
1Choose Edit > Preferences > Output (Windows) or After Effects > Preferences > Output (Mac OS).
2Select Use Default File Name And Folder.
Work with render settings
Render settings apply to each render item and determine how the composition is rendered for that specific render
item. By default, the render settings for a render item are based on the current project settings, composition settings,
and switch settings for the composition on which the render item is based. However, you can modify the render
settings for each render item to override some of these settings.
Render settings apply to the root composition for a render item, as well as all nested compositions.
Important: Rendersettingsonlyaffecttheoutputoftherenderitemwithwhichthey’reassociated;thecompositionitself
is not affected.
Click the triangle to open the Render Settings menu, or click the underlined text to open the Render Settings dialog box.
See also
“Work with composition settings” on page 110
“Layer switches and columns in the Timeline panel” on page 147
Change render settings
•To change render settings for a render item, click the underlined render settings template name next to the Render
Settings heading in the Render Queue panel, and choose settings in the Render Settings dialog box.
•To apply a render settings template to selected render items, click the triangle next to the Render Settings heading
in the Render Queue panel, and choose a template from the menu. You can choose a custom render settings
template or one of the preset render settings templates:
Best Settings Often used for rendering to final output.
Draft Settings Often appropriate for reviewing or testing motion.
DV Settings Similar to Best Settings, but with Field Rendering turned on, set to Lower Field First.
Multi-machine Settings Similar to Best Settings, but with Storage Overflow set to Off.
AFTER EFFECTS CS3
User Guide
598
Note: The default render settings template is assigned to a render item when it is created. To change which render settings
template is the default, hold down Ctrl (Windows) or Command (Mac OS) as you choose a render settings template from
the menu.
Create, edit, and manage render settings templates
You perform the following tasks in the Render Settings Templates dialog box. To open the Render Settings Templates
dialog box, choose Edit > Templates > Render Settings, or click the triangle next to the Render Settings heading in
the Render Queue panel and choose Make Template.
•To make a new render settings template, click New, specify render settings, and click OK. Enter a name for the new
template.
•To edit an existing render settings template, choose a template from the Settings Name menu, click Edit, and
specify render settings.
Note: Changes to an existing template do not affect render items that are already in the render queue.
•
To specify a default render settings template to be used when rendering movies, individual frames, pre-rendered
movies, or proxies, choose a template from a menu in the Defaults area of the Render Settings Templates dialog box.
•To save all currently loaded render settings templates to a file, click Save All.
•
To load a saved render settings template file, click Load, select the render settings template file, and then click Open.
Render settings
Each of these settings overrides composition settings, project settings, or layer switch settings.
Quality The quality setting to use for all layers. (See “Layer image quality” on page 150.)
Resolution Resolution of the rendered composition, relative to the original composition dimensions. (See
“Resolution” on page 128.)
Note: If you render at reduced resolution, set the Quality option to Draft. Rendering at Best quality when reducing
resolution produces an unclear image and takes longer than Draft quality.
Disk Cache Determines whether the disk cache preferences are used during rendering. Read Only writes no new
frames to the disk cache while After Effects renders. Current Settings (default) uses the disk cache settings defined
in the Memory & Cache preferences. (See “Memory, storage, and performance” on page 37.)
Use OpenGL Renderer Determines whether OpenGL is used for rendering. (See “Render with OpenGL” on
page 593.)
Proxy Use Determines whether to use proxies when rendering. Current Settings uses the settings for each footage
item. (See “Work with placeholders and proxies” on page 61.)
Effects Current Settings (default) uses the current settings for Effect switches . All On renders all applied effects.
All Off renders no effects.
Solo Switches Current Settings (default) uses the current settings for Solo switches for each layer. All Off renders
as if all Solo switches are off. (See “Solo a layer” on page 149.)
Guide Layers Current Settings renders guide layers in the top-level composition. All Off (the default setting) does
not render guide layers. Guide layers in nested compositions are never rendered. (See “Work with guide layers” on
page 159.)
Color Depth Current Settings (default) uses the project bit depth. (See “Set the color depth” on page 234.)
AFTER EFFECTS CS3
User Guide
599
Frame Blending On For Checked Layers renders frame blending only for layers with the Frame Blending switch
set, regardless of the composition’s Enable Frame Blending setting. (See “Apply frame blending to a layer” on
page 225.)
Field Render Determines the field-rendering technique used for the rendered composition. Choose Off if you are
rendering for film or for display on a computer screen. (See “Separate video fields” on page 71.)
3:2 Pulldown Specifies the phase of 3:2 pulldown. (See “Introduce 3:2 pulldown” on page 633.)
Motion Blur Current Settings uses the current settings for the Motion Blur layer switch and the Enable Motion
Blur composition switch. On For Checked Layers renders motion blur only for layers with the Motion Blur layer
switch set, regardless of the composition’s Enable Motion Blur setting. Off For All Layers renders all layers without
motion blur regardless of the layer switch and composition switch settings. (See “Use motion blur” on page 200.)
Time Span Howmuchofthecompositiontorender.Torendertheentirecomposition,chooseLengthOfComp.To
render only the part of the composition indicated by the work-area markers, choose Work Area Only. To render a
custom time span, choose Custom. (See “Set the work area” on page 112.)
Frame Rate The sampling frame rate to use when rendering the movie. Select Use Comp’s Frame Rate to use the
frame rate specified in the Composition Settings dialog box, or select Use This Frame Rate to use a different frame
rate. The actual frame rate of the composition is unchanged. The frame rate of the final encoded movie is determined
by the output module settings. (See “Change frame rate” on page 53.)
Use Storage Overflow Determines whether rendering continues when the first assigned storage volume overflows.
If this option isn’t selected, rendering stops when the first assigned volume reaches capacity. (See “Overflow volumes
and segment settings” on page 629.)
Skip Existing Files Lets you re-render part of a sequence of files without wasting time on previously rendered frames.
When rendering a sequence of files, After Effects locates files that are part of the current sequence, identifies the
missing frames, and then renders only those frames, inserting them where they belong in the sequence. You can also
use this option to render an image sequence on multiple computers. (See “Render a still-image sequence with
multiple computers” on page 628.)
Note: The current image sequence must have the same name as the existing image sequence, and the starting frame
number,framerate,andtimespanmustbethesame.Youmustrendertothefolderthatcontainsthepreviouslyrendered
frames.
Work with output module settings
Output module settings apply to each render item and determine how the rendered movie is processed for final
output. Use output module settings to specify file format, output color profile, compression options, and other
encoding options for final output.
Youcanalsouseoutputmodulesettingstocroporstretcharenderedmovie;doingthisafterrenderingisoftenuseful
when you are generating multiple kinds of output from a single composition.
Output module settings are applied to the rendered output that is generated according to the render settings.
For some formats, an additional dialog box opens when you choose the format in the Output Module Settings dialog
box. You can modify these settings and use settings presets to specify format-specific options, such as compression
options.
Youcanapplymorethanoneoutputmoduletoeachrenderitem.Thisisusefulwhenyouwanttomakemorethan
one version of a movie at the same time. For example, you can automate the creation of a movie and its alpha matte,
or you can create high-resolution and low-resolution versions of a movie.
AFTER EFFECTS CS3
User Guide
600
To duplicate an output module, select it and press Ctrl+D (Windows) or Command+D (Mac OS).
Note: Before rendering, check the Audio Output settings in the Output Module Settings dialog box to ensure that they
are correct. To render audio, Audio Output must be selected. If your composition does not include audio, do not select
Audio Output, so that the size of the rendered file will not increase needlessly.
Click the triangle to open the Output Module Settings menu, or click the underlined text to open the Output Module Settings dialog box.
See also
“Encoding and compression options for movies” on page 612
Change output module settings
•To change output module settings for a render item, click the underlined output module settings template name
next to the Output Module heading in the Render Queue panel, and choose settings in the Output Module
Settings dialog box.
•Toapplyanoutputmodulesettingstemplatetoselectedrenderitems,clickthetrianglenexttotheOutputModule
heading in the Render Queue panel, and choose a template from the menu.
You can choose a custom output module settings template or one of the preset output module settings templates.
Several templates are provided, including the Lossless template for creating movies for transfer to video, film, or an
NLE system.
Note: The default output module settings template is assigned to a render item when it is created. To change which
output module template is the default, hold down Ctrl (Windows) or Command (Mac OS) as you choose an output
module template from the menu.
Create, manage, and edit output module templates
You perform the following tasks in the Output Module Templates dialog box. To open the Output Module Templates
dialog box, choose Edit > Templates > Output Module, or click the triangle next to the Output Module heading in
the Render Queue panel and choose Make Template.
•To make a new output module settings template, click New, specify output module settings, and click OK. Enter a
name for the new template.
•To edit an existing output module settings template, choose a template from the Settings Name menu, click Edit,
and specify output module settings.
Note: Changes to an existing template do not affect render items that are already in the render queue.
•To specify a default output module settings template to be used when processing movies, individual frames, RAM
previews, pre-rendered movies, or proxies, choose a template from a menu in the Defaults area of the Output
Module Templates dialog box.
•To save all currently loaded output module templates to a file, click Save All.
•
To load a saved output module template file, click Load, select the output module template file, and then click Open.
AFTER EFFECTS CS3
User Guide
601
Add an output module to selected render items
•Choose Composition > Add Output Module
Output module settings
For information on using controls in the Color Management area of the Output Module Settings dialog box, see
“Assign an output color profile” on page 246.
Format Specifies the format for the output file or sequence of files.
Embed Specifies whether to include information in the output file that links to the source project in After Effects.
When you open the output file in another application, such as Adobe Premiere Pro, you can use the Edit Original
command to edit the source project in After Effects. Selecting Project Link creates a link between the output file and
the source project. Selecting Project Link And Copy creates a link and adds an embedded copy of the linked project
totheoutputfile;iftheprojectismissingorupdatedwhenyouchooseEditOriginalinanotherapplication,youcan
choose whether to open the source project or the saved copy of the project.
Post-Render Action Specifies an action for After Effects to perform after the composition is rendered. (See “Use a
post-render action” on page 602.)
Format Options Opens a dialog box in which you specify format-specific options.
Channels The output channels contained in the output movie. After Effects creates a movie with an alpha channel
if you choose RGB+Alpha, implying a depth of Millions of Colors+. Not all codecs support alpha channels.
Note: All files created with a color depth of Millions of Colors+, Trillions of Colors+, or Floating Point + have labeled
alpha channels; information describing the alpha channel is stored in the file. Therefore, you do not have to specify an
alpha interpretation each time you import an item created in After Effects.
Depth Specifies the color depth of the output movie. Choose from color or grayscale options. Certain formats may
limit depth and color settings.
Color Specifies how colors are created with the alpha channel. Choose from either Premultiplied (Matted) or
Straight (Unmatted). (See “About straight and premultiplied channels” on page 253.)
Note: PNG files don’t support premultiplied alpha.
Starting # Specifies the number for the starting frame of a sequence. For example, if this option is set to 38, After
Effects names the first frame [file_name]_00038. The Use Comp Frame Number option adds the starting frame
number in the work area to the starting frame of the sequence.
Stretch Specifies the size of your output movie. Select Lock Aspect Ratio To if you want to retain the existing frame
aspect ratio when stretching the frame size. Select Low Stretch Quality when rendering tests, and select High Stretch
Quality when creating a final movie. (See “Scaling a movie down” on page 631 and “Scaling a movie up” on
page 632.)
Crop Used to subtract or add rows or columns of pixels to the edges of the output movie. You can specify the number
of rows or columns of pixels to be added or subtracted from the top, left, bottom, and right sides of the movie. Use
positive values to crop, and use negative values to add rows or columns of pixels. Select Region Of Interest to render
only the region of interest selected in the Composition or Layer panel.
By adding one row of pixels to the top and subtracting one row from the bottom of a movie, you can change the field
order.
Audio Output Specifies the sample rate, sample depth (8 Bits or 16 Bits), and playback format (Mono or Stereo).
Choose a sample rate that corresponds to the capability of the output format. Choose an 8-bit sample depth for
AFTER EFFECTS CS3
User Guide
602
playback on the computer, and a 16-bit sample depth for CD and digital audio playback or for hardware that supports
16-bit playback.
Use a post-render action
You can use post-render actions to automate simple tasks that occur after a composition is rendered.
A common example of the use of post-render actions is with pre-rendering: Choosing Composition > Pre-render
adds the selected composition to the render queue and sets the Post-Render Action option to Import & Replace
Usage.
Note: You choose Post-Render Action options in the Output Module group, so be aware that changing the Output
Module template could also change the Post-Render Action option. (See “Work with output module settings” on
page 599.)
1Expand the Output Module group in the Render Queue panel by clicking the arrow to the left of the Output
Module heading.
2Choose one of the following from the Post-Render Action menu:
None Performs no post-render action. This option is the default.
Import Imports the rendered file into the project as a footage item when the rendering is complete.
Import & Replace Usage Imports the rendered file into the project and substitutes it for the specified item. Drag the
pick whip to the item to replace in the Project panel to specify it.
Use the Import & Replace Usage option to create a chain of dependent render items. For example, you can set one
render item to use a watch folder and multiple computers to create a still-image sequence, and then the next render
item can render a single movie file from that still-image sequence. (See “Network rendering with watch folders” on
page 625.)
Set Proxy Sets the rendered file as a proxy for the specified item. Drag the pick whip to the item in the Project panel
item to specify it.
See also
“Work with placeholders and proxies” on page 61
“Pre-render a nested composition” on page 114
Rendering and exporting to Flash formats
About render and export of Flash formats
You can render and export movies from After Effects as Adobe Flash (SWF) files or Flash Video (FLV) files. Incor-
porating these movies into web pages and adding interactivity is typically accomplished using the Flash authoring
application.
To see a video tutorial on rendering and exporting to Flash formats, visit the Adobe website at
www.adobe.com/go/vid0261.
AFTER EFFECTS CS3
User Guide
603
Flash (SWF)
SWF files are small files that are often used to deliver animated vector graphics (such as cartoons), audio, and other
data types over the Internet. SWF files also allow viewer interaction, such as following a web link or controlling
animation. To play SWF files, you need Adobe Flash Player, a plug-in for your web browser. SWF files exported from
After Effects can be played by Flash Player or imported into the Flash authoring application for additional editing.
Flash Video (FLV)
FLV files contain only pixel-based (rasterized) video, not vector graphics, and they aren’t interactive. To play a movie
in the FLV format, you must import the FLV file into Flash and publish it in a SWF file.
After Effects markers can be included as cue points in an output FLV file. To transfer keyframes or global property
values into Flash from After Effects, run the Convert Selected Properties To Markers.jsx script before rendering and
exporting an FLV file.
You render and export a movie to the FLV format using the render queue, just as you do with other formats. (See
“Render and export a movie using the render queue” on page 590.)
Important: Some applications install a QuickTime export component for Flash Video that appears as an entry in the
File > Export menu for Flash Video (FLV). Adobe recommends that you not use this command, but instead render and
export Flash Video files using the Render Queue panel. Some features, such as export of cue points from After Effects,
only work for render and export through the Render Queue panel.
To include the alpha channel in the FLV output, use the On2 VP6 codec and select Encode Alpha Channel in the
Video tab of the Adobe Flash Video export settings dialog box.
See also
“Working with Flash and After Effects” on page 33
“Encoding and compression options for movies” on page 612
Render and export a composition as a Flash (SWF) file
While rendering to SWF, After Effects maintains vectors as much as possible. However, raster images, blending
modes, motion blur, some effects, and the contents of nested compositions cannot be represented as vectors in the
SWF file and are rasterized.
You can choose to ignore these unsupported items so that the SWF file includes only those After Effects features that
can be converted into native SWF elements, or you can choose to rasterize frames that contain unsupported features
and add them to the SWF file as JPEG-compressed bitmap images, which may reduce the efficiency of the SWF file.
Audio is encoded in MP3 format and added to the SWF file as an audio stream.
When After Effects creates a SWF file, it also saves a report ([SWF file_name]R.htm) to the same folder as the SWF
file. The report also contains a link to the SWF file so that you can preview the output using the Flash Player plug-
in. Open the report in a browser to view the SWF file and see which items in the composition are unsupported.
AFTER EFFECTS CS3
User Guide
604
The exported SWF file includes each unchanged item in the After Effects composition once, and then references it
for each use. If a layer is used in multiple frames, each use refers to the same object, even if the layer’s transform
properties (such as Position) are animated. However, if the content of the layer changes—for example, if a mask on
the layer is animated or if the layer’s source footage item is video—a new object is created for each frame in which
thelayerisvisible.Ifmultiplelayersinthecompositionsharethesamesourcefootageitem,thesourceisaddedonce
andisthenreferencedforeveryadditionallayerthatsharesthesource.IfthesourceisanIllustratorfile,aSWFmovie
clip is created and referenced. Text characters are added as vectors once and then referenced on all subsequent
frames, unless you choose Fill Over Stroke from the Fill And Stroke options menu; in that case, the characters are
added as vectors on every frame.
Note: If color management is enabled for the project, then colors are converted from the project’s working color space to
the sRGB IEC61966-2.1 color space for output. This output color space is appropriate for movies shown in a web browser.
(See “Color management” on page 241.)
1Select the composition you want to export, and then choose File > Export > Adobe Flash (SWF).
2Type a file name (making sure to include the .swf extension) and location, and then click Save.
3Specify options as appropriate, and then click OK.
SWF export settings
JPEG Quality Specifies the image quality of rasterized. The higher the quality, the larger the file. (If you select
Rasterize for Unsupported Features, the JPEG Quality setting is used for all JPEG-compressed bitmap images
exported to the SWF file, including bitmap images generated from composition frames or Adobe Illustrator files.)
Unsupported Features Specifies whether to rasterize features that SWF format doesn’t support. Choose Ignore to
exclude unsupported features, or choose Rasterize to render all frames that contain unsupported features as JPEG-
compressed bitmap images and include them in the SWF file. If you choose Rasterize, the SWF Exporter rasterizes
source files for each layer in the composition (except layers that use Illustrator files or solids as the source footage)
and nested compositions with Collapse Transformations enabled.
Audio Bit Rate The bit rate of the exported audio. Choose Auto to get the lowest bit rate available for the specified
Sample Rate and Channels settings. Higher bit rates increase file size. Flash audio is in MP3 format.
Loop Continuously Specifies that the exported SWF file loops continuously during playback. If you plan to specify
looping by writing HTML code to control the Flash Player, deselect Loop Continuously.
Prevent Import Creates a SWF file that digital image or video-editing programs can’t import.
Include Object Names Includes layer, mask, and effect names in the file, for use as input to ActionScript programs.
Selecting this option increases file size. Rasterized objects are not named.
Each mask is exported as a separate SWF object, the name of which is the layer name followed by the mask name. If
all masks use Difference mode, all masks are exported as one SWF object, and the name is the layer name. Each text
character is exported as a separate SWF object.
Flatten Illustrator Artwork Splits all overlapping objects into non-overlapping pieces. When you select this option,
you don’t need to convert Illustrator text to outlines before exporting. (This option supports source files from
Illustrator 9.0 or later.)
There are advantages and disadvantages to flattening Illustrator artwork. When you flatten Illustrator artwork, text
is exported to SWF properly, so you don’t need to convert text to outlines. Overlapping objects are removed, so
compositedlayersappearthesameinbothAfterEffectsandtheSWFfile.Endcaps,joins,andtransparencygroups
are exported properly, and artwork outside crop marks, which is not visible in the SWF file, is not included. However,
SWF files don’t necessarily become smaller. In addition, the flattening process may introduce unsupported objects
AFTER EFFECTS CS3
User Guide
605
that are then ignored or rasterized, and white fringes may appear around some objects. The process can be slow,
memory-intensive, and possibly ineffective for complex Illustrator artwork.
Include Layer Marker Web Links Makes layer-time markers behave as web links. The Include Layer Marker Web
Links option adds web links and a Get URL action to the SWF file by using information from layer-time markers.
This option also adds a frame label to each SWF frame that has a layer-time marker. You can specify how the browser
opens the web link with standard target commands (for example, _blank). (See “Create a web link, chapter link, or
cue point from a marker” on page 118.)
Target commands for web links in a SWF file
_blank Loads the web link into a new browser window.
_parent Loads the web link into the parent frame of the frame in which the current file is playing.
_self Loads the web link into the current frame.
_top Loads the web link into the top frame in the current window.
_level0 Loads another SWF file into level 0. The current file typically plays at level 0; another file loaded into level 0
usually replaces the current file. Note that the URL must refer to another SWF file.
_level1 Loads another SWF file into level 1 if the URL refers to another SWF file.
Supported features for SWF export
Layers After Effects text layers are exported to SWF as vector graphics. The following layer types and layer switches
aren’t supported: track mattes, 3D layers, 3D cameras, 3D lights, adjustment layers, shape layers, Preserve Trans-
parency, Collapse Transformations, and motion blur. The Fill Over Stroke character option and the Blur animator
property aren’t supported, and only Normal blending mode is supported. Nested compositions aren’t supported and
are rasterized.
Masks Only masks with Add mask mode or Difference mask mode are supported; multiple masks in a layer must
use the same mask mode. If Add mode is specified, partial opacity and the Inverted option are also supported. Mask
feather is not supported. The result of overlapping masks with Add mode and partial opacity may appear differently
in the SWF file than in After Effects. (See “Mask modes” on page 260.)
Effects Path Text, Audio Waveform, and Audio Spectrum are supported for output to SWF.
All Path Text options are supported, except the following: Composite On Original, Fill Over Stroke, and Difference mode.
Lines drawn by the Audio Spectrum and Audio Waveform effects are converted to vectors. The following unsup-
ported features are ignored: Outside Color (only Inside Color is used), Softness, and Composite On Original. In
addition, only uniformly thick lines are included in the SWF file. For example, if you select the Use Polar Path option
in Audio Spectrum, lines become thicker farther from the center in After Effects, but in the SWF file the lines remain
at the same thickness.
The waveforms may increase the SWF file size, so decrease the Displayed Samples value in the Audio Waveform
effect or the Frequency Bands value in the Audio Spectrum effect, or decrease the frame rate to make the SWF file
smaller.
Resolution SWF files are always created at full resolution (size of composition); JPEG-compressed bitmap images
are rendered at full resolution.
Adobe Illustrator files Only stroked paths and filled paths in CMYK or RGB color spaces are supported.
Layers that have Illustrator source files are converted to corresponding SWF items if the layer does not contain masks
or have Collapse Transformations enabled. Illustrator layers that contain masks or have Collapse Transformations
AFTER EFFECTS CS3
User Guide
606
enabled are rasterized. The SWF file maintains the Illustrator crop marks. Artwork outside the crop marks is
included in the SWF file even though it’s not visible, thereby increasing the file size.
The SWF export report lists information for unsupported features in Illustrator files for the first frame in which the
Illustrator file is visible. Unsupported features are ignored or rasterized (depending on whether you’ve selected
Ignore or Rasterize Unsupported Features) on all frames in which the footage is visible.
Rendering and exporting still images and still-image
sequences
Creating motion-picture film
Ifyouintendtodisplayyourfinishedprojectonmotionpicturefilm,youshouldplanyourworkflowcarefully.You
mayemployamatchback process, in which you shoot on film, transfer to video, and then conform the film negative
to your edits. On the other hand, you may choose to shoot and edit using a video format (ideally, a high-definition
format, and perhaps shoot at 24 fps to match theatrical film frame-rate) and transfer the finished project to film. In
any case, you’ll need to consider the important ways film and video formats differ—such as in their image resolu-
tions, aspect ratios, and frame rates—and how to reconcile those differences.
For the production phase, you’ll need to consider the acquisition format that best suits your needs. During post-
production, you may need to transfer the source footage to the appropriate format for editing, effects, and sound
design (using programs such as Adobe Premiere Pro, After Effects, and Soundbooth). When exporting from post-
production software, you must determine the file settings appropriate to the film stock you’ll use, or you’ll need to
decide how to best translate your editing decisions to film. If you choose to transfer video to film, it’s likely you’ll
employ a facility that can accomplish the transfer using a film recorder, a device that prints video frames to motion
picture film frames. To determine the best course, consult the production and post-production facilities before you
begin.
Rendering and exporting a sequence of still images
Youcanexportarenderedmovieasasequenceofstillimages,inwhichcaseeachframeofthemovieisoutputasa
separate still-image file. When you render one movie using multiple computers on a network, the movie is always
output as a still-image sequence. Many 3D animation programs accept sequences of still images. Sequences of PNG
files are often a good choice for transfer of visual elements from After Effects to Flash.
If you are creating a movie for transfer to film, you will need to create a sequence of still images that you can then
transfer to film using a film recorder.
Creating a sequence of PSD files is a good way to transfer frames to Photoshop for touchup and editing. You can then
import the image sequence back into After Effects.
When specifying the output file name for a still-image sequence, you actually specify a file-naming template. The
name that you specify must contain pound signs surrounded by square brackets ([#####]). As each frame is rendered
and a file name created for it, After Effects replaces the [#####] portion of the name with a number indicating the
order of the frame in the sequence. For example, specifying mymovie_[#####].tga would cause output files to be
named mymovie_00001.tga, filmout_00002.tga, and so on.
The maximum number of frames in a still-image sequence is 32,766.
AFTER EFFECTS CS3
User Guide
607
See also
“Render and export a movie using the render queue” on page 590
Export a single frame of a composition
You can export a single frame from a composition, either as an Adobe Photoshop (PSD) file with layers intact or as
a rendered image. This is useful for editing files in Adobe Photoshop, preparing files for Adobe Encore, creating a
proxy, or exporting an image from a movie for posters or storyboards.
The Photoshop Layers command preserves all layers from a single frame of an After Effects composition in the
resultingPhotoshopfile.NestedcompositionsuptofivelevelsdeeparepreservedinthePSDfileaslayergroups.The
PSD file inherits the color bit depth from the After Effects project.
In addition, the layered Photoshop file contains an embedded composite (flattened) image of all the layers. This
ensures that the file is compatible with applications that don’t support Photoshop layers; such applications display
the composited image and ignore the layers.
A layered Photoshop file saved from After Effects may look different from the frame viewed in After Effects if the
frameusesfeaturesthataren’tsupportedbyPhotoshop.Forexample,iftheframecontainsablendingmodethatisn’t
available in Photoshop, a blending mode that most resembles it is substituted in the layer, but the embedded
composite image (viewable only by applications that don’t support Photoshop layers) looks the same. Alternatively,
you can render the frame using the Composition > Save Frame As > File command to export a flattened and rendered
version of the file to the PSD format.
1Go to the frame that you want to export so that it is shown in the Composition panel.
2Do one of the following:
•To render a single frame, choose Composition > Save Frame As > File. Adjust settings in the Render Queue panel
if necessary, and then click Render.
•To export a single frame as an Adobe Photoshop file with layers, choose Composition > Save Frame As >
Photoshop Layers.
To copy the frame in the active Composition, Layer, or Footage panel to the clipboard so that you can paste it into
another application, you can use the Copy Image plug-in, from ObviousFX:
www.adobe.com/go/learn_ae_obviousfxcopyimage.
See also
“Work in the Render Queue panel” on page 591
About Filmstrip format
In Adobe Photoshop, you can edit video frames, or even paint directly on them—a process known as rotoscoping.
One method is to first export the video frames from your video application in filmstrip format.
Note: You can also use the video layers feature in Adobe Photoshop Extended to edit video files not in filmstrip format,
and you can rotoscope with paint tools in After Effects without using the filmstrip format. For help in choosing whether
to use filmstrip format, or whether to use Photoshop or After Effects for a given task, see Photoshop Help.
AFTER EFFECTS CS3
User Guide
608
From some video editing and compositing applications such as Adobe Premiere Pro (Windows only) and After
Effects, you can export part or all of a composition, sequence, or clip as a single filmstrip file. Because video
compression isn’t used in creating filmstrip files, they can be large. If your computer doesn’t have enough memory
for Photoshop to load the filmstrip file, you can break the file into any number of smaller files by setting the work
area to a different portion of the composition or sequence before rendering or exporting each portion, or you can
export the composition, clip, or sequence as numbered still images so that you can edit each frame as a separate file.
Note: If you simply want to export a single frame, you don’t need to use Filmstrip format.
A filmstrip opens in Adobe Photoshop as a series of frames in a column, with each frame labeled by number, reel
name, and timecode. If the column created by the filmstrip frames is more than 30,000 pixels tall, the frames
continue in a second column. The number of frames displayed depends on the duration of the footage or clip and
the frame rate selected when you render the filmstrip.
When editing a filmstrip in Adobe Photoshop, use the following guidelines for best results:
•After Effects and Adobe Premiere Pro display only the part of each frame that lies within the frame border;
however, you can paint on the gray lines dividing the frames of the filmstrip without damaging the file.
•You can edit the red, green, blue, and alpha channels in the filmstrip file. Use only channel 4 as the alpha channel;
other alpha channels aren’t recognized.
•Don’t resize or crop the filmstrip.
•Flatten any layers you add in Adobe Photoshop.
Exporting project information to other Adobe
applications
Export an After Effects project to Adobe Premiere Pro
You can export an After Effects project as an Adobe Premiere Pro project without rendering.
Note: After Effects CS3 projects saved as Premiere Pro projects cannot be opened by Premiere Pro 2.0 or earlier.
When you export an After Effects project as an Adobe Premiere Pro project, Adobe Premiere Pro uses the settings
from the first composition in the After Effects project for all subsequent sequences. Keyframes, effects, and other
properties are converted in the same way as when you paste an After Effects layer into an Adobe Premiere Pro
sequence.
1Choose File > Export > Adobe Premiere Pro Project.
2Specify a file name and location for the project, and click Save.
Note: You can also import Adobe Premiere Pro projects into After Effects.
See also
“Importing from After Effects and Adobe Premiere Pro” on page 63
AFTER EFFECTS CS3
User Guide
609
About Dynamic Link (Production Premium only)
In the past, sharing media assets among post-production applications has required you to render your work in one
application before importing it into another—an inefficient and time-consuming workflow. If you wanted to make
changes in the original application, you had to rerender the asset. Multiple rendered versions of an asset consume
disk space and can lead to file-management challenges.
Adobe Dynamic Link, a feature of Adobe Creative Suite Production Premium, offers an alternative to this workflow:
the ability to create dynamic links, without rendering, between new or existing compositions in Adobe After Effects
and either Adobe Premiere Pro or Adobe Encore. Creating a dynamic link is as simple as importing any other type
of asset, and dynamically linked compositions appear with unique icons and label colors to help you identify them.
Dynamic links are saved as part of the Adobe Premiere Pro or Encore project.
Changes you make to a dynamically linked composition in After Effects appear immediately in the linked files in
Adobe Premiere Pro or Encore; you don’t have to render the composition or even save changes first.
When you link to an After Effects composition, it appears in the target component’s Project panel. You can use the
linked composition as you would any other asset. When you insert a linked composition into the target component’s
timeline, a linked clip, which is simply a reference to the linked composition in the Project panel, appears in the
Timeline panel. After Effects renders the linked composition on a frame-by-frame basis during playback in the target
application.
•In Adobe Premiere Pro, you can preview the linked composition in the Source Monitor, set In and Out points, add
it to a sequence, and use any of the Adobe Premiere Pro tools to edit it. When you add a linked composition that
contains both footage and audio layers to a sequence, Adobe Premiere Pro inserts linked video and audio clips in
the timeline. (You can unlink these to edit them separately; search for “Unlink video and audio” in Adobe
Premiere Pro Help.)
•In Encore, you can use the linked composition to create a motion menu or insert it into a timeline, and use any of
the Adobe Encore tools to edit it. When you add a linked composition that contains both video and audio layers
to an Encore timeline, Encore inserts separate video and audio clips in the timeline.
Other ways to share content among Production Premium components include copying and pasting between After
EffectsandAdobePremierePro,exportingAfterEffectsprojectstoAdobePremierePro,usingtheCaptureInAdobe
Premiere Pro command in After Effects, creating After Effects compositions from Encore menus, or importing Adobe
Premiere Pro projects into After Effects. For more information, see the relevant component’s Help.
For a tutorial on Adobe Dynamic Link, see www.adobe.com/go/learn_dv_tutorial_dynlink.
Saving and Dynamic Link (Production Premium only)
YoumustsaveyourAfterEffectsprojectatleastoncebeforeyoucancreateadynamiclinkfromAdobePremierePro
or Encore to a composition within it. However, you don’t have to subsequently save changes to an After Effects
project to see changes to a linked composition in Adobe Premiere Pro or Encore.
If you use the Save As command to copy an After Effects project that contains compositions referenced by Adobe
Dynamic Link, Adobe Premiere Pro or Encore uses the original composition—not the new copy—as its source for
the linked composition. You can relink a composition to the new copy at any time.
Managing performance and Dynamic Link (Production Premium only)
Because a linked composition may reference a complex source composition, actions you perform on a linked compo-
sition may require additional processing time as After Effects applies the actions and makes the final data available
to Adobe Premiere Pro or Encore. In some cases, the additional processing time may delay preview or playback.
AFTER EFFECTS CS3
User Guide
610
If you’re working with complex source compositions and experiencing playback delays, you can take the compo-
sition offline or disable a linked clip to temporarily stop referencing a dynamically linked composition, or render the
composition and replace the dynamically linked composition with the rendered file. If you commonly work with
complex source compositions, try adding RAM or using a faster processor.
Color and Dynamic Link (Production Premium only)
Adobe After Effects works in the RGB (red, green, blue) color space. Adobe Premiere Pro, however, works in the
YUV color space. When you work with a dynamically linked composition, Adobe Premiere Pro either converts it to
YUV or retains the RGB color space, depending on the output format.
Dynamically linked compositions are rendered in the color depth of the After Effects project (8-, 16-, or 32-bpc,
depending on project settings). Set the After Effects project color depth to 32-bpc if you’re working with HDR (high
dynamic range) assets.
In Adobe Premiere Pro, choose Project > Project Settings > Video Rendering, and select Maximum Bit Depth to have
Adobe Premiere Pro process at the highest possible quality. This option may slow processing.
Link to a new composition with Dynamic Link (Production Premium only)
When you link to a new composition from Adobe Premiere Pro or Encore, After Effects starts and creates a new
project and composition with the dimensions, pixel aspect ratio, frame rate, and audio sample rate of your Adobe
Premiere Pro or Encore project. (If After Effects is already running, it creates a new composition in the current
project.) The new composition name is based on the Adobe Premiere Pro or Encore project name, followed by
“Linked Comp [x].”
1InAdobePremiereProorAdobeEncore,chooseFile>AdobeDynamicLink>NewAfterEffectsComposition.
2IftheAfterEffectsSaveAsdialogboxappears,enteranameandlocationfortheAfterEffectsproject,andclickSave.
When you link to a new After Effects composition, the composition duration is set to 30 seconds. To change the
duration, select the composition in After Effects and choose Composition > Composition Settings. Click the Basic tab,
and specify a new value for Duration.
Link to an existing composition with Dynamic Link (Production Premium only)
For best results, composition settings (such as dimensions, pixel aspect ratio, frame rate, and audio sample rate)
should match those used in the Adobe Premiere Pro or Adobe Encore project.
❖Do one of the following:
•In Adobe Premiere Pro or Encore, choose File > Adobe Dynamic Link > Import After Effects Composition.
Choose an After Effects project file (.aep), and then choose one or more compositions.
•Drag one or more compositions from the After Effects Project panel to the Adobe Premiere Pro or the Encore
Project panel.
•InAdobePremierePro,chooseFile>Import.ChooseanAfterEffectsprojectfileandclickOpen,andthenchoose
a composition in the Import Composition dialog box and click OK.
•In Adobe Premiere Pro, drag an After Effects project file into the Project panel. If the After Effects project file
contains multiple compositions, Adobe Premiere Pro displays the Import Composition dialog box.
Note: You can link to a single After Effects composition multiple times in a single Adobe Premiere Pro project. In an
Adobe Encore project, however, you can link to an After Effects composition only once.
AFTER EFFECTS CS3
User Guide
611
Encore and After Effects: If you are linking to Dynamic Link compositions that were created using Create After
Effects Composition from Encore, turn off subpicture highlight layers in After Effects so that you can control their
display in Encore. For more information, search for “subpicture” in Adobe Encore DVD Help or Adobe After
Effects Help.
Dynamically linked After Effects compositions
Delete a dynamically linked composition or clip (Production Premium only)
You can delete a linked composition from an Encore project if the composition isn’t used in the project. You can
delete a linked composition from an Adobe Premiere Pro project at any time, even if the composition is used in a
project.
You can delete linked clips, which are simply references to the linked composition in the Project panel, from the
timeline of an Adobe Premiere Pro sequence or from an Encore menu or timeline at any time.
❖In Adobe Premiere Pro or Encore, select the linked composition or clip and press the Delete key.
Edit a dynamically linked composition in After Effects (Production Premium only)
Use the Edit Original command in Adobe Premiere Pro or Encore to edit a linked After Effects composition. Once
After Effects is open, you can make edits without having to use the Edit Original command again.
1Select the After Effects composition in the Adobe Premiere Pro or Encore Project panel, or choose a linked clip
in the Timeline, and choose Edit > Edit Original.
2Make edits in After Effects, and then switch back to Adobe Premiere Pro or Encore to view your changes.
ThechangesmadeinAfterEffectswillappearinAdobePremierePro,butanypreviewfilesAdobePremierePromay
have rendered for the clip prior to the changes will be invalidated.
Note: If you change the name of the composition in After Effects after you’ve created a dynamic link to it from Adobe
Premiere Pro, Adobe Premiere Pro doesn’t update the linked composition name in the Project panel, but retains the
dynamic link.
Offline compositions and Dynamic Link (Production Premium only)
Adobe Premiere Pro and Encore display dynamically linked compositions as offline in any of the following circum-
stances:
•You’ve renamed, moved, or deleted the After Effects project that contains the composition.
•You’ve purposely taken the composition offline.
•You’ve opened the project that contains the composition on a system on which Production Premium isn’t installed.
•You’re working with a project trimmed by the Adobe Premiere Pro Project Manager. Project Manager does not
move the After Effects source compositions to the trimmed project folder. You must do this manually.
AFTER EFFECTS CS3
User Guide
612
Offline compositions appear with an Offline icon in the Adobe Premiere Pro Project panel. In Encore, the
thumbnail preview displays the Offline icon when an offline asset is selected in the Project panel. If you’re working
with an offline composition, you can relink it to the original After Effects composition. You can also choose to relink
a linked composition to a different source composition.
Take a dynamically linked composition offline (Production Premium only)
You can take a dynamically linked composition offline if system resources are low, preventing you from smoothly
playing back or previewing, or if you want to share your project without having to open it on a system with
Production Premium installed. When you take a composition offline, you sever the dynamic link with After Effects,
and the linked composition is replaced in the Project panel with an offline composition.
You can temporarily suppress a linked clip in Adobe Premiere Pro by selecting the clip and choosing Clip > Enable.
To relink the clip, choose Clip > Enable again (a check mark next to the command indicates that the clip is enabled).
For more information about disabling clips, see Adobe Premiere Pro Help.
1In Adobe Premiere Pro, select the composition in the Project panel.
2Choose Project > Make Offline.
Relink a dynamically linked composition (Production Premium only)
❖Do one of the following:
•In Adobe Premiere Pro, select the composition and choose Project > Link Media. In the Import Composition
dialog box, choose an After Effects project, and then choose a composition.
•In Encore, right-click the composition and choose Locate Asset. In the Locate Asset dialog box, locate the compo-
sition you want to link to and then click Select (Windows) or Open (Mac OS).
Encoding and compression options for movies
Format options and export settings
After Effects uses the Adobe Media Encoder to encode most movie formats through the Render Queue panel. You
can use QuickTime to encode other movie formats (such as raw DV streams) through the File > Export menu.
For most output formats, you can specify format-specific encoding and compression options. In many cases, a dialog
boxopensandpresentstheseoptionswhenyouchooseaformattoexportto,eitherintheOutputModuleSettings
dialog box or from the File > Export menu.
Formats encoded by the Adobe Media Encoder share a similar export settings dialog box, which you can open by
clicking the Format Options button in the Output Module Settings dialog box.
When exporting with the Adobe Media Encoder, choosing a format automatically makes available a list of associated
presets designed for particular delivery scenarios (for example, the Apple iPod Video Small preset for the H.264
format). Choosing a preset activates the appropriate options in the various settings panels (Video, Audio, and so on).
Note: It is possible in some cases to specify a setting in an export settings dialog box that conflicts with a setting made in
theRenderSettingsorOutputModuleSettingsdialogbox.Insuchcases,AfterEffectswarnsyouofthemismatchsothat
you can correct it before continuing.
AFTER EFFECTS CS3
User Guide
613
See also
“Render and export a movie using the render queue” on page 590
“Work with output module settings” on page 599
About the Adobe Media Encoder
The Adobe Media Encoder is an encoding mechanism employed by programs such as Adobe Premiere Pro, After
Effects, Soundbooth, and Encore for output to certain media formats. Depending on the program, the Adobe Media
Encoder provides a specialized Export Settings dialog box that accommodates the numerous settings associated with
certain export formats, such as MPEG-2, Adobe Flash Video, and H.264. For each format, the Export Settings dialog
box includes a number of presets that are tailored for particular delivery media. You can also save custom presets,
which you can share with others or reload as needed.
Although the Export Settings dialog box’s appearance varies slightly and is accessed differently in different software,
its general form and function are consistent. The Export Settings dialog box always contains a section for general
export settings (such as Format and Preset) and one or more tabbed sections. The sections available depend on the
format and preset you specify. The tab menu also contains commands specific to the selected format.
When you export a movie file for delivery media other than full-screen, full frame-rate television, you usually need
to deinterlace the frames, crop the image, or apply certain filters. Through the Export Settings dialog box, the Adobe
Media Encoder offers these tasks as pre-encoding options, because it’s best to perform them prior to encoding the
file. You can also specify post-encoding tasks, which include generating a log file or uploading the exported file to a
specified server automatically.
About MPEG
MPEG is the name of a family of file formats specified by the ISO/IEC Moving Picture Experts Group. MPEG
formats include several compression methods. It requires significant processing power and time to generate these
keyframe-based file formats from other video formats.
MPEG-1 Generally used for the Internet and CD-ROM, providing picture quality comparable with VHS quality at
quarter-screen frame size.
MPEG-2 Delivers higher quality video than MPEG-1. A specific form of MPEG-2 was chosen as the standard for
compressing video for DVD video. This is called DVD-compliant MPEG-2. MPEG-2 compression is also used in
HDV, and supported in the HD-DVD, and Blu-ray formats.
MPEG-4 Includes many of the features of MPEG-1 and MPEG-2, and adds support for interactivity. It offers better
compression and reduces file size while maintaining the same perceptual quality level as MPEG-2. MPEG-4 part 10
(H.264, AVC) is the supported by the Blu-ray and HD-DVD formats.
After Effects and Adobe Premiere Pro offer a number of MPEG presets to optimize the output quality for various
project types. If you’re experienced with MPEG encoding, you can further fine-tune projects for specific playback
situations by customizing the presets in the Export Settings dialog box.
In After Effects, you can create MPEG-2 and MPEG-2 DVD video. In Adobe Premiere Pro, you can create various
types of MPEG video by using the File > Export > Adobe Media Encoder command or export directly to
DVD-compliant video by using the Export To Encore command (any video you export to DVD is automatically
transcoded to MPEG-2 if it isn’t already in that format).
AFTER EFFECTS CS3
User Guide
614
After Effects and Adobe Premiere Pro add metadata to MPEG-2 files that Encore can read for aid in authoring and
building DVDs. This metadata contains information that enables Encore to multiplex audio and video, automati-
cally generate DVD chapter points, and open clips in the applications from which they were rendered. For more infor-
mation, see Encore Help.
Filter options for encoding
Noise, grain, and similar artifacts can interfere with the efficient compression of images. For this reason, the size of
the final output file may in some cases be reduced by applying a noise reduction filter to an image or movie before
compression takes place.
In the Export Settings dialog box, you can specify whether to apply a noise reduction filter before compression, and
you can also set the amount of noise filtering to apply.
If you intend to remove noise and grain from a project for reasons other than reduction of compressed file size,
consider using the Noise & Grain effects in Adobe Premiere Pro or After Effects.
Video options for encoding
In the Export Settings dialog box, the options available in the Video tab depend on the format you’ve specified. Video
settings include some or all of the following options:
Codec Specifies the codec used to encode the video from those available on your system.
Quality Specifies the encoding quality. Generally, higher values increase rendering time and file size.
Encode Alpha Channel Enables encoding of an alpha channel into the exported file for formats, such as Adobe Flash
Video, that support alpha channels.
TV Standard Conforms the output to the NTSC or PAL standard.
Frame Width Scales the output frame’s horizontal aspect to the specified width.
Frame Height Scales the output frame’s vertical aspect to the specified height.
Frame Rate The output frame rate for either NTSC or PAL formats.
Field Order Specifies whether the output file’s frames are interlaced, and if so, whether the upper or lower field is first
in the scanning order.
Pixel Aspect Ratio Specifies the ratio of each pixel’s width to height, which determines the number of pixels required
to achieve a given image aspect ratio. Some formats use square pixels, while others use nonsquare pixels.
Bitrate Encoding Specifies whether the codec achieves a constant or variable bitrate in the exported file:
•Constant Bit Rate (CBR) Compresses each frame in the source video to the fixed limit you specify, producing a file
with a fixed data rate. Therefore, frames containing more complex data are compressed more, while less complex
frames are compressed less.
•Variable Bit Rate (VBR) Allows the exported file’s data rate to vary within a range you specify. Because a given
amount of compression degrades the quality of a complex image more than it degrades the quality of a simple image,
VBR encoding compresses complex frames less and compresses simple frames more.
In general, an image is complex and more difficult to compress efficiently if it contains great detail or if it differs
significantly from previous frames, as it would in a scene containing motion.
AFTER EFFECTS CS3
User Guide
615
Note: When comparing CBR and VBR files of the same content and file size, you can make the following generalizations:
A CBR file may play back more reliably over a wider range of systems, because a fixed data rate is less demanding on a
media player and computer processor. However, a VBR file tends to have a higher image quality, because VBR tailors
the amount of compression to the image content.
Bitrate Specifies the number of megabits per second of playback for the encoded file. (This setting is available only
if you select CBR as the Bitrate Encoding option.)
The following options appear only if you select VBR as the Bitrate Encoding option:
Encoding Passes Specifies the number of times the encoder will analyze the clip before encoding. Multiple passes
increase the time it takes to encode the file, but generally result in more efficient compression and higher image
quality. (Adobe After Effects doesn’t support multiple encoding passes.)
Target Bitrate Specifies the number of megabits per second of playback for the encoded file.
Maximum Bitrate Specifies the maximum number of megabits per second of playback you want the encoder to
allow.
Minimum Bitrate Specifiestheminimumnumberofmegabitspersecondofplaybackyouwanttheencodertoallow.
The minimum bitrate differs according to the format. For MPEG-2-DVD, the minimum bitrate must be at least
1.5 Mbps.
M frames Specifies the number of B frames (Bi-directional frames) between consecutive I frames (Intra-frames) and
P frames (Predicted frames).
N frames Specifies the number of frames between I frames (Intra-frames). This value must be a multiple of the M
frames value.
Closed GOP Every Specifies the frequency of each Closed Group of Pictures (Closed GOP), which cannot reference
frames outside of the closed GOP. A GOP consists of a sequence of I, B, and P frames. (This option is available if you
choose MPEG-1 or MPEG-2 as the format.)
Automatic GOP Placement When selected, sets the placement of Group of Pictures (GOP) automatically. (This
option is available if you choose MPEG-1 as the format.)
Note: MPEG-1 and MPEG-2 formats include numerous advanced options not listed here. In most cases, selecting a
format or preset designed for your target output sets the appropriate options automatically. For detailed information on
options not listed, consult the specifications for the MPEG-1 (ISO/IEC 11172) and MPEG-2 (ISO/IEC 13818) formats.
Audio options for encoding
In the Export Settings dialog box, the options available in the Audio tab depend on the format you’ve specified. Some
common audio options include the following:
Codec Specifies the codec used to encode the audio:
•AAC (Advanced Audio Coding) A high-quality encoding format supported by many mobile devices. This codec is
the default for the H.264 format.
•SurCode for Dolby Digital 5.1 A high-quality encoding format developed for multichannel digital sound and the
most common encoder for DVD-video. (This codec is available only in Adobe Premiere Pro.)
•MainConcept MPEG Audio A high-quality encoder developed by MainConcept media technologies, and included
with Adobe Premiere Pro, After Effects, and Soundbooth.
•PCM (pulse-code modulation) Audio A lossless audio format. Files of this format tend to be larger than files of the
other formats.
AFTER EFFECTS CS3
User Guide
616
Audio Format Determines the audio type.
Bit Rate Specifies the output bit rate of the audio. Generally, higher bit rates increase both quality and file size. This
option is available for Dolby® Digital, MainConcept MPEG, and some Windows Media audio codecs.
Note: Options not documented here are specific to the selected format. For detailed information, consult the specifica-
tions for the selected format.
Alternates and Audiences options for encoding
In the Export Settings dialog box, specifying a streaming media codec in RealMedia or Windows Media formats
enables Audiences options, while QuickTime streaming media codecs enable a similar set of Alternates options. Both
allow you to output variations of a movie suited to different network speeds. The player software associated with the
format detects and selects the most appropriate version to ensure smooth playback. For example, Windows Media
includes Audiences such as Dial-up Modems (56 Kbps) and Broadband Or Cable Modem/DSL (384 Kbps). Whereas
QuickTime generates individual movies suited for each export type, RealMedia and Windows Media generate a
single movie that stores the variations.
Note: Some codec-specific settings are not documented here. For more detailed information regarding a particular codec,
check the documentation provided by its developer.
Add Alternates or Audiences
1Choose a format that supports streaming media (QuickTime, RealMedia, or Windows Media).
2From the Preset menu in the Export Settings dialog box, choose a streaming option.
3Select the Filters, Video, Audio, and Others tabs and specify the options you want.
4Do either of the following:
•For RealMedia or Windows Media output, select Audiences and specify options.
•For QuickTime output, select Alternates and specify options.
5With any tab selected, choose Add/Remove Audiences (or Add/Remove Alternates) from the tab menu.
6In the Select Audiences (or Select Alternates) dialog box, click Add.
7In the System Audiences (or System Alternates) dialog box, select the options appropriate for your intended
viewers, and click OK.
8Click OK to close the Select Audiences (or Select Alternates) dialog box.
Note: You can’t have more than ten alternates or audiences. If necessary, you can delete the ones you don’t want, and
add the ones you want.
Copy or delete an Alternate or Audience
1Choose a format that supports streaming media (QuickTime, RealMedia, or Windows Media).
2From the Preset menu in the Export Settings dialog box, choose a streaming option.
3Select the Filters, Video, Audio, and Others tabs and specify options.
4Do either of the following:
•For RealMedia or Windows Media output, select Audiences and specify options.
•For QuickTime output, select Alternates and specify options.
5With any tab selected, choose Add/Remove Audiences (or Add/Remove Alternates) from the tab menu.
AFTER EFFECTS CS3
User Guide
617
6In the Select Audience (or Select Alternate) dialog box, select the item you want to copy or delete, and click
Duplicate or Remove.
7If copying, double-click the name of the duplicate item, type a new name, and then click OK.
8When you finish, click OK.
Note: Removing an item from the Alternates or Audiences list can’t be undone.
Others options for encoding
The Others tab of the Export Settings dialog box allows you to upload the exported file to an FTP (File Transfer
Protocol) server that has storage space allocated for file sharing. FTP is a common method for transferring files over
a network and is especially useful for sharing relatively large files using an Internet connection. The server’s admin-
istrator can provide you with the correct information to connect to the server.
The Others tab includes the following options:
Server Name Enter the DNS or IP address of the server on which the FTP site is located.
Port Specify the number assigned to the FTP server’s command port, which is 21 by default.
Remote Directory Enter the location on the FTP server to access, expressed as a file path.
User Login Enter the user’s identity, as designated by the server’s administrator.
Password Enter the password to a password-protected server.
Retries Specify the number of attempts to contact the server if a connection isn’t established.
Send Local File To Recycle Bin (Windows) or Send Local File to Trash (Mac OS) Deletes the local copy of the exported
file once it’s been uploaded to the FTP server.
Test Verifies the connection with the FTP server.
Log File Details Specify whether to generate a log file, and select the information that the log file includes (errors,
warnings, settings, and render frame time). (Not supported for Windows Media, QuickTime, or Adobe Flash Video).
Media Encoder MPEG multiplexer preset options
Multiplexer preset options control how After Effects and Adobe Premiere Pro merge MPEG video and audio data
into a single stream. The exact options available depend on the MPEG format you choose.
When you choose the MPEG-2 format, all Multiplexer options provided by the MPEG standard are available for
manual control. In most cases, it’s better to select an MPEG format specifically targeted to your output medium (such
as MPEG-2 DVD).
For more information on the options available, see the official web site of the MPEG organization at www.chiari-
glione.org/mpeg/.
MPEG format ISO/IEC standard
MPEG-4 ISO/IEC 14496
MPEG-2 ISO/IEC 13818
MPEG-1 ISO/IEC 11172
AFTER EFFECTS CS3
User Guide
618
Add XMP metadata to an exported file
Metadata is descriptive file information that can be searched and processed by a computer. Adobe’s eXtensible
Metadata Platform (XMP) lets you include metadata with a file to provide information about the contents of the file.
Applications that support XMP can read, edit, and share this information across databases, file formats, and
platforms. Some Adobe software, such as Adobe Bridge, can use or write XMP information.
You can specify XMP metadata to be included with files you export using the Adobe Media Encoder.
❖In the Export Settings dialog box, select XMP Info on the settings tab menu, and then enter information in the
appropriate fields.
Preview a movie on a virtual mobile device using After Effects
Using Adobe Device Central, you can preview movies formatted for mobile devices in emulations of those devices.
This option is available for most of the H.264 formats listed in the Adobe Media Encoder.
1Start After Effects.
2In the Project panel, select the composition to preview.
3Choose Composition > Add to Render Queue.
4In the Render Queue panel, click the underlined text to the right of Output Module, or select Custom from the
Output Module menu.
5In the Output Modules Settings dialog box, choose H.264 from the Format menu.
6In the Export Settings section of the H.264 dialog box, select Open in Device Central.
7Modify other settings as desired and click OK.
8Click OK to close the Output Module Settings dialog box.
9In the Render Queue panel, click Render.
Rendering may take a few minutes, depending on the size of the file. When rendering is complete, a temporary file
is displayed in the Adobe Device Central Emulator tab. To continue testing, double-click the name of a different
device in the Device Sets or Available Devices lists.
About compression of movie files
Compressionisessentialtoreducingthesizeofmoviessothattheycanbestored,transmitted,andplayedbackeffec-
tively. When exporting or rendering a movie file for playback on a specific type of device at a certain bandwidth, you
choose a compressor/decompressor (also known as an encoder/decoder, or codec), to compress the information and
generate a file readable by that type of device at that bandwidth.
A wide range of codecs is available; no single codec is best for all situations. For example, the best codec for
compressing cartoon animation is generally not efficient for compressing live-action video. When compressing a
movie file, you can fine-tune it for the best-quality playback on a computer, a mobile device, the web, or a DVD
player. Depending on which encoder you use, you may be able to reduce the size of compressed files by removing
artifacts that interfere with compression, such as random camera motion and excessive film grain.
Thecodecyouusemustbeavailabletoyourentireaudience.Forinstance,ifyouuseahardwarecodeconacapture
card, your audience must have the same hardware codec installed, or a software codec that emulates it.
For more information about compression, see www.adobe.com/go/learn_dv_primer_compression.
AFTER EFFECTS CS3
User Guide
619
About data rate
With some video and audio codecs, you can specify the data rate,alsocalledthebit rate, which controls the amount
of video information that must be processed each second during playback. Specifying a data rate actually sets the
maximum data rate, because the actual data rate varies depending on the visual content of each frame.
To maximize the quality of encoded video, set the data rate as high as the target delivery medium can support. If you
plan to stream video to an audience using dial-up Internet access, this may be as low as 20 kilobits per second;
however, if you plan to distribute video on DVD, it may be as high as 7 megabits per second. The data rate you specify
depends on the purpose of the video. The following list describes data rate guidelines for some uses:
DVD production The data rate should maximize quality while fitting the entire program within the space available
on the DVD.
Non-DV videotape production The data rate should fall within the capabilities of the computer and hard disk that
perform the final playback to tape.
Hard-disk playback If the final video will be played back from hard disks, determine the typical data transfer rate of
your audience’s hard disks and set the data rate accordingly. If you’re exporting video to be used in another editing
system or to be imported into a compositing application, you’ll want to export at the maximum quality. Use a lossless
codec or the codec supported by your video capture card, and specify the data rate that the editing system supports
for video capture and editing.
CD-ROM playback The data rate for video played from a CD-ROM depends on the speed of the drive. For example,
if you’re preparing a final video file for a quad-speed CD-ROM drive (600 kilobytes per second), you might specify
between 300 and 500 kilobytes per second to account for both the data rate of the drive and for the system overhead
required to move the data.
Intranet playback The data rate can be 1 megabit per second or faster, depending on the speed of the intranet.
Streaming video over the web The data rate should account for real-world performance at the target data rate. For
example, the data rate for streaming video designed for a 56-kilobit-per-second connection is often set to 40 kilobits
per second. The difference accounts for factors such as data volume and line quality that often prevent telephone-
based Internet connections from consistently achieving their stated data rate. For broadband connections, set the
data rate for streaming video to 128 kilobits per second.
Downloading a video file over the web Thedatarateislessimportantthanthesizeofthevideofileondisk,because
themainconcernishowlongittakestodownloadthefile.However,itstillmaybedesirabletoreducethedatarate
for downloaded video because doing so reduces the size of the video file, making it download faster.
In Adobe Premiere Pro, use the File > Get Properties For command to analyze the data rate of files you export.
Specify QuickTime compression settings
1In the Render Queue panel, click the underlined name of the output module.
2For Format, choose QuickTime.
3Click Format Options in the Video Output section.
4In the Compression Settings dialog box, choose a compressor.
Note: Set the color depth in the Compression Settings dialog box instead of in the Output Module Settings dialog box.
This ensures that non-Adobe plug-ins receive color depth information from After Effects. See step 8.
5Select a Quality level from Least to Best.
AFTER EFFECTS CS3
User Guide
620
Note: (Mac OS only) If you intend to use key frames in the movie, hold down Option and adjust the Quality slider to
control the temporal compression of the movie. Temporal compression compresses a movie by comparing successive
frames and keeping only changed data. High temporal quality maintains smoothness of motion. Low temporal quality
tends to produce jerkiness of motion because a pixel doesn’t change unless the difference between frames is great.
6If you want the smallest possible files, and your compressor choice allows for a key frame rate, select the box and
type a number in the Key Frame Every box. Generally, you should type a number equal to the frame rate. For
example, if you set a frame rate of 30 fps, type 30 in the Key Frame box. This sets one key frame every 30 frames of
your movie.
Note: IfyouaregoingtousetheresultingmovieinanotherAfterEffectscomposition,typeasmallvalue(lessthan5)in
the Key Frame Every box or deselect the Key Frame Every option. The presence of key frames greatly increases the
memory required to edit and render a movie.
7Click OK.
8If your compressor choice supports different image color depths, choose the appropriate color depth in the Output
Module Settings dialog box:
•Choose Millions Of Colors+ if you want 24-bit color quality and you want your composition background to be
transparent (to include an alpha channel). The composition’s background color is disregarded. Only Animation
and None can support the Millions Of Colors+ color depth.
•Choose Millions Of Colors if you want 24-bit color quality but want to include your composition background
color (no alpha channel).
Note: Color depth settings of Thousands Of Colors or lower may cause banding and dithered images.
9Specify other settings in the Output Module Settings dialog box, and then click OK.
See also
“Work in the Render Queue panel” on page 591
“Work with output module settings” on page 599
QuickTime compression options
Choices you make in the Compression Settings dialog box require tradeoffs between file size and movie quality. The
higher the visual quality of your movie, the larger the file size.
Quality The Quality control specifies the spatial compression of the movie, which compresses the data in each frame
of a composition. Higher quality produces better image quality but results in a bigger movie file. Note that this
quality is unrelated to each layer’s quality setting in After Effects.
Key Frame Every In QuickTime terminology, the term key frames is different from the change-over-time keyframes
placed in the After Effects Timeline panel. In QuickTime, key frames are frames that occur at regular intervals in the
movie. During compression they are stored as complete frames. Each intermediate frame that separates them is
comparedtothepreviousframe,andonlychangeddataisstored.Thisgreatlyreducesmoviesize.Shorterintervals
between key frames enable faster seeking and reverse playback, but can significantly increase the size of the file.
Specify Video for Windows compression options
1In the Render Queue panel, click the underlined name of the output module.
2Choose Video For Windows from the Format menu.
3Click Format Options in the Video Output section.
AFTER EFFECTS CS3
User Guide
621
4In the Video Compression dialog box, choose a compressor from the first menu in the Compressor section.
Chooseacompressorbasedonthetypeoforiginalimagesyouhaveandthepurposeoftherenderedmovie(available
compressors depend on the Video for Windows codecs installed on your computer).
You can render with 10-bpc YUV compression to create 10-bpc AVI files for use with HD footage in Adobe Premiere
Pro: choose 10-bit YUV (4:2:2 YUV) from the Compressor menu.
5Select a Compression Quality level.
6If you selected either Cinepak or Microsoft Video 1 in step 4, click the Configure button to set other options:
•For Cinepak, choose whether the movie is compressed to color or to black and white.
•For Microsoft Video 1, choose a level for the temporal compression quality of the movie. Temporal compression
compresses a movie by comparing successive frames and keeping only changed data. High temporal quality
maintains smoothness of motion. Lower temporal quality tends to produce jerkiness of motion because a pixel
doesn’t change unless the difference between frames is great.
7If you want the smallest possible files, and your compressor choice allows for a key frame rate, select the Key
Frame Every option and type a number of frames. Generally, you should type a number equal to the frame rate. For
example, if you set a frame rate of 30 fps, type 30 in the Key Frame box. This sets one key frame every 30 frames of
your movie.
Note: IfyouaregoingtousetheresultingmovieinanotherAfterEffectscomposition,typeasmallvalue(lessthan5)in
the Key Frame Every field or deselect the Key Frame Every option. The presence of keyframes greatly increases the
memory required to edit and render a movie.
8Click OK.
9If your compressor choice supports different image color depths, choose the appropriate color depth in the Output
Module Settings dialog box.
10 Specify other settings in the Output Module Settings dialog box, and then click OK.
See also
“Work in the Render Queue panel” on page 591
“Work with output module settings” on page 599
Video for Windows compression options
Microsoft RLE Use for lossless compression limited to 256 colors.
Microsoft DV Use for digital video camcorders.
No Compression Use for a depth setting of Millions Of Colors+ when an alpha channel is required.
Intel Indeo/Microsoft Video Use when compressing video for playback from CD.
Cinepak Use when compressing 16-bit and 24-bit video for playback from CD or for desktop presentations. For best
results, use the Cinepak compressor on raw source data that has not been previously compressed with a highly lossy
compressor. Note that this is a slow compression method. With Cinepak, decompression is much faster than
compression,andthedatarateforplaybackcanbedefinedbytheuser.However,youcannotsaveanalphachannel
using the Cinepak compressor.
AFTER EFFECTS CS3
User Guide
622
Render a composition to OMF (Windows only)
You can render a composition to the OMF (Open Media Framework Interchange) format to generate Avid media (or
essence) files; these files contain only media —not metadata or project data. Each OMF codec has a fixed frame size
and frame rate, depending on the output resolution you choose. Make sure that the composition or render settings
are set appropriately: If you use an unsuitable frame size or frame rate, After Effects doesn’t render the file and
returns an error displaying the expected frame size or frame rate.
The OMF file format doesn’t support audio, so any audio tracks aren’t exported, but you can output audio tracks
separately, if desired.
1IntheRenderQueuepanel,clicktheOutputModuletemplatenametoopentheOutputModuleSettingsdialogbox.
2From the Format menu, select OMF.
3Click Format Options.
4Choose a format (NTSC or PAL), an AVR (Avid Video Resolution) codec, and an OMF version.
Note: OMFI version 1.0 is supported for backward compatibility with older Avid systems.
See also
“Work in the Render Queue panel” on page 591
“Work with output module settings” on page 599
Automated rendering and network rendering
Automating rendering with aerender
The executable file aerender (aerender.exe on Windows) is a program with a command-line interface with which you
can automate rendering. The executable file is located in the same folder as the primary After Effects application.
The default locations:
•Windows: \Program Files\Adobe\Adobe After Effects CS3\Support Files
•Mac OS: /Applications/Adobe After Effects CS3
Youusetheprogrambyenteringthecommandaerender on the command line (or in a batch script), followed by a
series of optional arguments. Some of the arguments are simple options that take no arguments of their own (e.g., -
reuse), whereas others take arguments of their own (e.g., -project project_path).
Enter the command aerender -help to show some of the usage information in this section.
The render may be performed either by an already running instance of After Effects or by a newly invoked instance.
By default, aerender invokes a new instance of After Effects, even if one is already running. To instead use the
currently running instance, use the –reuse argument.
AVR codec NTSC PAL
1:1 720 x 480 (interlaced), 29.97 fps 720 x 576 (interlaced), 25 fps
1:1 (24p/25p) 720 x 486 (progressive), 24 fps 720 x 576 (progressive), 25 fps
DV 720 x 480 (interlaced), 29.97 fps 720 x 576 (interlaced), 25 fps
AFTER EFFECTS CS3
User Guide
623
This example command tells After Effects to render frames 1 through 10 of Composition_1 in project_1.aep to a
numbered sequence of Photoshop files using a multi-machine render:
aerender -project c:\projects\project_1.aep -comp "Composition_1" -s 1 -e 10
-RStemplate "Multi-Machine Settings" -OMtemplate "Multi-Machine Sequence"
-output c:\output\project_1\frames[####].psd
To render just Composition_1 to a specified file, enter this command:
aerender -project c:\projects\project_1.aep -comp "Composition_1" -output c
:\output\project_1\project_1.avi
To render everything in the render queue with current settings in the project file, enter this command:
aerender -project c:\projects\project_1.aep
Argument Description
–help Print usage message.
–version Display the version number of aerender to the console. Does not render.
–v verbose_flag verbose_flag specifies the type of messages reported:
ERRORS : Reports only fatal and problem errors.
ERRORS_AND_PROGRESS : (default) Reports errors and progress of
rendering.
–reuse Reuse the currently running instance of After Effects (if found) to perform the
render. When an already running instance is used, aerender saves preferences
to disk when rendering has completed, but does not quit After Effects. If this
argument is not used, aerender starts a new instance of After Effects, even if
one is already running. It quits that instance when rendering has completed,
and does not save preferences.
–mem_usage
image_cache_percentmax_
mem_percent
image_cache_percent specifies the maximum percentage of memory
used to cache already rendered images and footage. max_mem_percent
specifies the total percentage of memory that can be used by After Effects.
For both values, if installed RAM is less than a given amount (n gigabytes), the
value is a percentage of the installed RAM, and is otherwise a percentage of
n. The value of nis 2 GB for 32-bit Windows, 4 GB for 64-bit Windows, and 3.5
GB for Mac OS.
–project project_path project_path is a file path or URI specifying a project file to open. If this
argument is not used, aerender works with the currently open project. If no
project is specified and no project is open, the result is an error.
–comp comp_name comp_name specifies a composition to be rendered. If the composition is in
the render queue already, then the first instance of that composition in the
render queue is rendered. If the composition is in the project but not in the
render queue, then it is added to the render queue and rendered. If this argu-
ment is not used, aerender renders the entire render queue; in this case, only
the –project,–log,–output,–v,–mem_usage, and –close argu-
ments are used, and all other arguments are ignored.
–s start_frame start_frame is the first frame to render. If this argument is not used,
aerender uses the start frame in the file.
–e end_frame end_frame is the last frame to render. If this argument is not provided,
aerender uses the end frame in the file.
AFTER EFFECTS CS3
User Guide
624
Lloyd Alvarez provides a script that takes items that are ready to render in the render queue and sends them to render
in the background using aerender: www.adobe.com/go/learn_ae_lloydbgrenderer.
See also
“Basics of rendering and exporting” on page 587
“Memory & Cache preferences” on page 39
–i increment increment is the number of frames to advance before rendering a new
frame. A value of 1 (the default) causes normal rendering of all frames. Higher
values render a frame and use it increment times in output, and then skip
ahead increment frames to begin the cycle again. Higher values result in
faster renders but choppier motion.
–OMtemplate
output_module_template
output_module_template is the name of a template to apply to the
output module. If the template does not exist, this causes an error. If this argu-
ment is not used, aerender uses the template already defined for the output
module.
–RStemplate render_sett
ings_template
render_settings_template is the name of a template to apply to
the render item. If the template does not exist, this causes an error. If this
argument is not used, aerender uses the render template already defined for
the item.
–output output_path output_path is a file path or URI specifying the destination for the final
output file. If this argument is not used, aerender uses the path defined in the
project file.
–log log_file_path log_file_path is a file path or URI specifying the location of the log file.
If this argument is not used, aerender uses standard output (stdout).
–sound sound_flag If sound_flag is ON, a sound is played when rendering is complete.
Default is OFF.
–close close_flag close_flag specifies whether or not to close the project when rendering
is complete, and whether or not to save changes:
DO_NOT_SAVE_CHANGES : (default) The project is closed without saving
changes.
SAVE_CHANGES : The project is closed and changes are saved.
DO_NOT_CLOSE : The project is left open if using an already-running
instance of After Effects. (New instances of After Effects must always quit
when done.)
-rqindex
index_in_render_queue
-rqindex works just like -comp, except that it won't create a render item
from the composition automatically.
-mp enable_flag If enable_flag is 0, additional processes will not be created to render
multiple frames simultaneously.
If enable_flag is 1, additional processes may be created to render
multiple frames simultaneously, depending on system configuration and
preference settings. (See “Render multiple frames simultaneously” on
page 40.)
Argument Description
AFTER EFFECTS CS3
User Guide
625
Network rendering with watch folders
You can render one or more compositions from a project using multiple computers over a network in a fraction of
the time that a single computer would require. Network rendering involves copying the project and source files to a
networked folder, and then rendering the project.
If you have a full licensed copy of After Effects, you can set it up to work with render-only versions of After Effects
called render engines. Your license entitles you to install as many copies of the render engine as you want on your
network, as long as one activated copy of After Effects is installed on that network.
You install render engines in the same manner as the full version of the application, but you do not activate them.
You run the render engine using the Adobe After Effects Render Engine shortcut in the Adobe After Effects CS3
folder. (See “Installation” on page 1.)
Note: Formoreinformation,seetheReadMefileontheinstallationDVDorvisittheAdobeAfterEffectssupportwebsite
at www.adobe.com/go/learn_ae_support.
You cannot use a watch folder and multiple render engines to simultaneously render a single movie file. However,
you can use multiple render engines to render a movie as a sequence of still-image files. You can then use a post-
render action to create a single movie file from that still-image sequence. (See “Use a post-render action” on
page 602.)
When you have multiple render engines on multiple computers monitoring a watch folder, they cooperate to achieve
optimal efficiency. If your queued render items are set to Skip Existing Files (a Render Settings option), the render
engines all work on a single render item at once—no render engine renders any frame another render engine has
already worked on. If this option is not selected, each render engine handles a render item itself.
Computer with full version of After Effects (A) saves a project and all source files to a folder (B) on a server. Computers with the render engine
installed (C) open the project and render a still-frame sequence to a designated output folder (D) on the server.
Network considerations
When working with multiple render engines on multiple computers, keep the following guidelines in mind:
•When possible, identify folders using absolute file paths so that the paths are correctly identified for all render
engines. This may mean mapping network drives to a particular drive letter on all machines (for example,
H:\renders\watch\). Avoid using relative paths (for example, \\renders\watch).
•Each Macintosh computer monitoring the watch folder must have a unique name. This means that you should
rename your computers to not use the default name.
•Make sure that all servers and clients (computers monitoring the watch folder) have hard disks with unique names.
•Do not use the same computer to serve a watch folder and to run After Effects in Watch Folder mode. Use a
dedicated server that’s accessible to all render engines to serve your watch folder.
A
B
D
C
AFTER EFFECTS CS3
User Guide
626
•DonotrendertoorinitiateWatchFoldermodeontherootofavolumeorasharedfolderthatappearsastheroot
when viewed from another computer. Specify a subfolder instead. Also, avoid using high-ASCII or other extended
characters and slashes in file names. For multiple-computer rendering, After Effects includes the Multi-Machine
sample template that you can use as a starting point.
When rendering across a network that includes volumes using different network or operating systems, such as
Windows, Mac OS, Novell, and UNIX, make sure that you specify output files using a file-naming convention that’s
compatible with all rendering or destination volumes.
Project considerations
Make sure that you install all fonts, effects, and encoders (compressors) used in the project on all computers
monitoring the watch folder. If a computer monitoring the watch folder can’t find fonts, effects, or encoders used in
a project, the render fails.
When you install an After Effects render engine on a computer, it contains all the plug-ins included with After
Effects. If a composition uses a plug-in from another manufacturer, that plug-in must be present on all computers
that will render the composition. However, support for network rendering varies among plug-in manufacturers.
Before you set up a network to render effects created by third-party plug-ins, see your plug-in’s documentation or
contact the plug-in manufacturer and get answers to the following questions:
•Does the plug-in’s license agreement allow installing multiple copies on a network for the purposes of rendering?
•Are there any other limitations or tips that apply to using that plug-in for network rendering?
Collect Files folder considerations
When you use the File > Collect Files command, files relevant to a project are copied to a single folder. This folder
includes a copy of the project file, a render control file (RCF), and other files, depending on the options you choose
in the Collect Files dialog box. If you save the Collect Files folder to a networked computer other than a server, don’t
run a render engine on that computer. Avoid saving the Collect Files folder to a local disk, the root level of a disk
(such as C: in Windows or the Macintosh HD in Mac OS), or a shared folder, all of which can signify different
locations to each render engine. All render engines must interpret the path in the same way.
Once the collected files appear in the watch folder, all monitoring render engines start rendering automatically. If you
prefer, you can use the Collect Files command to store compositions and their source footage to a specified location
and then initiate the watch-folder rendering process later. Doing so renders the projects in alphabetical order, rather than
the order in which they were saved to the location.
See also
“Basics of rendering and exporting” on page 587
Set up watch-folder rendering
1Install the After Effects render engine on as many computers as you want to involve in network rendering. (For
information on installing After Effects as a render engine, see “Installation” on page 1.)
Note: If rendering time is unusually slow, you may be rendering to too many computers, and the network overhead
required to track rendering progress among all computers is out of proportion to the time spent actually rendering
frames. The optimal number depends on many variables related to the network configuration and the computers on it;
experiment to determine the optimal number for your network.
2Create a watch folder called AE Watch Folder on a computer that’s accessible to all of the After Effects render
engines on your network.
AFTER EFFECTS CS3
User Guide
627
3In each render engine, choose File > Watch Folder, and select the watch folder that you’ve created.
4Create your projects and compositions, and set them up in the render queue with the render settings and output
modules you want to use. (All render items in the project must have output names; otherwise the Enable Watch
Folder Render option in the Collect Files dialog box isn’t available.)
5Choose File > Collect Files to copy completed projects to your specified watch folder. Once you choose Collect
Files, After Effects copies the project or composition and all source files to the watch folder.
Note: AfterEffectscan’tcopysourcefilesthatarelargerthan2GBusingtheCollectFilescommand:youmustcopythem
manually to the (Footage) folder in the Collect Files folder.
6Choose For Queued Comps from the Collect Source Files menu (unless you’re manually moving source files), and
then select Change Render Output To. This option creates a folder on the networked server for rendered files—all of
the render engines need access to this folder to complete their rendering tasks.
7Select Enable Watch Folder Render, click Collect, and name the Collect Files folder.
8Save the Collect Files folder to a networked computer, preferably to a networked server.
9Monitor the progress of the render engines by using a web browser to view HTML pages saved in the watch folder.
After Effects generates these pages automatically when the rendering begins. Click the Reload button in your
browser to see the updated status. These HTML pages will describe any errors that occur.
After Effects renders the item to the specified destination folder and, if necessary, to the overflow volumes you have
specified in the Output preferences (see “Overflow volumes and segment settings” on page 629). When After Effects
finishes rendering all of the queued items in a given project, it closes that project without saving it and then scans
the watch folder for new projects to render. Because it doesn’t save the project, After Effects ignores any Post-Render
Actions in the Output Module settings dialog box that specify to import the item when it is rendered.
See also
“Basics of rendering and exporting” on page 587
Track dependencies of a watch-folder render
You can track render dependencies when you render over a network by setting Post-Render Action options. When
yousettheseoptions,AfterEffectsconfirmsthatalloftheitemsthatitneedstorenderarereadyandavailable.For
example, if one item depends on another to render, and the first has not finished rendering or has received an error,
the second does not render.
You can use this process to render a single QuickTime or AVI movie from a watch-folder render. The movie is
actually created on only one computer.
Note: This procedure assumes that you have already created a multiple-computer watch-folder. (See “Set up watch-folder
rendering” on page 626.)
1In the Render Queue panel, drag the output module to the Project panel. After Effects creates a placeholder for
that item's output.
2Drag the placeholder back to the Render Queue panel.
3Set the render settings and output module settings for the placeholder, and click Render.
AFTER EFFECTS CS3
User Guide
628
Start in watch-folder mode
Watch-folder mode applies only to rendering from a folder on your local computer.
•TostartAfterEffectsinwatch-foldermodeautomatically,saveaprojectwiththefilenameWatchThisFolder.aep.
After Effects watches the folder containing the project if you open that project.
•To start After Effects in watch-folder mode when you start your computer, create a shortcut (Windows) or alias
(Mac OS) to the Watch This Folder.aep project and move it to your Startup folder (Windows) or your Startup
Items folder (Mac OS). After Effects watches the folder containing the project if you open that project.
•(Windows only) To start After Effects in watch-folder mode from the command line, choose Start > Run, and then
enter the following, modifying the application path to the exact name of the folder in which you installed After
Effects, and replacing C:\[temp] with the path to your watch folder: “C:\Program Files\Adobe\Adobe After
Effects CS3\Support Files\afterfx.exe" -wf C:\[temp]
Note: You can also use this command line in batch files.
See also
“Network rendering with watch folders” on page 625
Render a still-image sequence with multiple computers
Although the preferred method of rendering for multiple computers is using the Watch Folder feature, you can also
use multiple computers and multiple copies of After Effects to render a composition across a network. You can use
multiple computers to render only still-image sequences; you cannot use multiple computers to render a single
movie.
When you render a still-image sequence with multiple computers, rendering in each copy of After Effects starts at
approximately the same time. By specifying that each copy skip existing frames or frames in progress, multiple
computers can render the project simultaneously, writing the still-image sequence to a single folder.
There is no limit to the number of computers that you can use for rendering; in general, the more computers, the
faster the rendering. However, if too many computers are used across a busy network, network traffic may slow down
the entire process. You can detect network slowdown by observing the time spent in the Compressing & Writing
stage in the Current Render Details section of the Render Queue panel.
Note: Adobe does not provide technical support for general network configuration; consult your network administrator.
Aharon Rabinowitz goes through and explains the steps for rendering a still-image sequence with multiple
computers in this video tutorial: www.adobe.com/go/learn_ae_aharonmultimachinerender.
1Install After Effects on each computer that will be used to render the project. Make sure that you have the same
fonts installed on each computer.
Note: Do not share plug-ins across a network. Make sure that you have a copy of the plug-ins folder on each computer
that is running After Effects. When using third-party plug-ins, also be sure that the same plug-ins are available on all
computers and that you have sufficient licenses for the plug-ins.
2Open the project on one computer, select the composition, and then choose Composition > Add To Render
Queue.
3Specify a sequence format in the Output Module area, and specify a folder in the Output To area. This folder must
be available for all the computers that are rendering.
AFTER EFFECTS CS3
User Guide
629
4In the Render Queue panel, select Skip Existing Files in the Render Settings section so that multiple computers
do not render the same frames. Make sure that Use Storage Overflow is not selected. Do not use multiple output
modules for one render item when using Skip Existing Files.
5Save the project on the computer where you opened it in step 2.
6On each computer that will be rendering, open and save the project. This ensures that After Effects records the
new relative paths to each computer in the following step.
7Unless the network can handle large file transfers rapidly, copy the project file and all its source footage to each
rendering computer.
8Open the Render Queue panel on each computer and click Render. You do not need to start rendering on each
computer simultaneously, but to ensure equal workloads, start them at approximately the same time. As each
computer finishes rendering a frame, After Effects searches the Output folder for the next unrendered frame and
starts rendering again.
9You can stop and start any computer at any time. However, if you stop a computer without starting it again, the
frame that it was rendering may not be finished. If one or more computers stop during rendering, starting any one
computer will ensure that all frames in the sequence get rendered.
See also
“Network rendering with watch folders” on page 625
“Work in the Render Queue panel” on page 591
Overflow volumes and segment settings
Overflow volume and segment settings are in the Output Preferences category.
Choose Edit > Preferences > Output (Windows) or After Effects > Preferences > Output (Mac OS).
When the disk volume to which After Effects is writing files is full, it can continue writing files to an overflow volume.
You can set preferences to make After Effects render to up to six different disk volumes, as specified in the Overflow
Volumes list. You can change the amount of disk space remaining on a volume before After Effects considers it an
overflow by modifying the Minimum Diskspace Before Overflowing value.
Note: The log file reports when a render overflows.
After Effects can also render sequences and movie files into segments that are limited to a specified number of files
or by file size; this is useful when preparing a movie for a medium such as CD-ROM, for which file or folder size may
need to be limited to chunks of 650 MB or less. Use the Segment Movie Files At value to set the maximum size for
segments in megabytes. Use the Segment Sequences At value to set the maximum number of still-image files in a
folder.
If you are exporting a movie that is larger than the maximum file size for your hard disk formatting scheme, then
you can set the Segment Movie Files At value to a value under this maximum. Hard disks formatted for Windows
can be formatted using the FAT, FAT32, or NTFS scheme. The maximum file size in the FAT scheme is 2GB, and the
maximum file size in the FAT32 scheme is 4GB. The maximum size for a file for NTFS is very large (approximately
16 terabytes), so you are unlikely to hit this limit with a single movie.
Audio is also rendered in segments, the length of which is set by the Audio Block Duration value. If you hear pops
in audio, you may be hearing a faulty transition between segments; if you have enough memory, increase the Audio
Block Duration to be longer than your output to avoid this problem.
AFTER EFFECTS CS3
User Guide
630
Converting movies
Convert footage items between video formats
YoucanuseAfterEffectstoconvertonetypeofvideotoanother.Whenconvertingvideo,keepthefollowinginmind:
•Changes in resolution may result in a loss of picture clarity, especially when up-converting from a standard-
definition format to a high-definition format.
•Changes in frame rate may require the use of frame blending to smooth out the interpolated frames. For longer
footage items, this can result in very long render times.
1Import the footage you’re converting into a composition using the preset of the format you’re converting to.
Example: if you’re converting NTSC to PAL, add your NTSC footage item to a composition with the appropriate PAL
composition settings preset.
2Select the layer with the footage to be converted and choose Layer > Transform > Fit To Comp Width (or Fit To
Comp Height).
Note: For converting between two formats with the same frame aspect ratio, either of these two Fit commands will do
the same thing; if the frame aspect ratios differ (e.g., going from 4:3 to 16:9), fitting to width or height will choose between
cropping or letterboxing the resulting image.
3Do one of the following:
•If there are no scene cuts in your footage, choose Layer > Frame Blending > Pixel Motion. This will provide the
best results for interpolation of frames, but may require long rendering times.
•If there are scene cuts in your footage, or if you want to sacrifice quality for shorter rendering times, choose
Layer > Frame Blending > Frame Mix.
4Select Composition > Make Movie.
5In the Render Queue panel, next to Render Settings, select the appropriate preset from the menu. For example, if
you’re converting to DV footage, select DV Settings from the menu.
6IntheRenderQueuepanel,nexttoOutputModule,selecttheappropriateoutputmodulepresetfromthemenu,
or select Custom to enter custom settings. For example, if you’re converting to DV PAL, select the D1/DV-PAL
output module preset with the audio sampling rate that you require.
7Click the name of the output module preset that you chose in step 6 to select additional Format Options.
8Click the Render button to render your movie.
See also
“Work with output module settings” on page 599
“Work in the Render Queue panel” on page 591
Convert DV footage from PAL to NTSC using pulldown
Because After Effects can easily convert film (24 fps) to video (29.97 fps) using 3:2 pulldown, you can perform a clean
PAL-to-NTSC transfer by setting up 25-fps PAL video to act like 24-fps film. This lets you apply 3:2 pulldown to the
footage when converting to 29.97 fps. This technique works particularly well for progressive (noninterlaced) PAL
video.
1Create a new composition with the DV NTSC or DV NTSC Widescreen preset.
AFTER EFFECTS CS3
User Guide
631
2Import your DV PAL footage into the new composition.
3Select the layer with the DV PAL footage, and choose Layer > Transform > Fit To Comp Width (or Fit To Comp
Height).
4Do one of the following:
•To preserve audio synchronization but slightly lower the pitch, choose Layer > Time > Time Stretch, and then
enter 95.904 in the Stretch Factor box.
•To preserve audio pitch but not synchronization, or for clips without audio, right-click (Windows) or Control-
click (Mac OS) the footage item in the Project panel, select Interpret Footage > Main, select Conform To Frame
Rate, and then enter 23.976 in the Conform To Frame Rate box.
5Select Composition > Make Movie.
6Choose Custom from the Render Settings menu.
7In the Render Settings pane, enable Field Rendering (choose the field order required by your output type), select
any option from the 3:2 Pulldown menu, and then click OK.
8Choose the output type from the Render Queue Output Module menu (for example, Microsoft DV NTSC 32kHz).
9Click the Render button to render your movie.
See also
“Work with output module settings” on page 599
“Work in the Render Queue panel” on page 591
Scaling a movie down
There are several methods for producing a reduced-size movie from your composition, each with tradeoffs between
speed and quality:
Nest the composition Create a new composition at the smaller dimensions, and nest the large composition inside it.
For example, if you create a 640 x 480 composition, place it in a 320 x 240 composition. Use the Fit To Comp
command to scale the composition to fit the new smaller composition size: Press Ctrl+Alt+F (Windows) or
Command+Option+F (Mac OS), and then collapse transformations by choosing Layer > Switches > Collapse. The
resulting composition rendered at full resolution and best quality will have excellent image quality, better than if you
had rendered using a reduced resolution.
Stretch the composition This method produces the highest quality reduced-size movie but is slower than nesting.
For example, if you create a 640 x 480 composition and render it at full resolution, you can set the stretch value in
the Output Module Settings dialog box to 50% to create a 320 x 240 movie. For a composition rendered at full
resolution, the image quality is excellent when the Stretch Quality is set to High.
Note: Do not use stretching to change the vertical dimensions of a movie when field rendering is on. Stretching vertically
mixes the field order, which distorts motion. Use either cropping or composition nesting if you need to vertically resize a
field-rendered movie.
Crop the composition Thismethodisidealforreducingthesizeofamoviebyafewpixels.UsetheCropoptionsin
the Output Module Settings dialog box. Remember that cropping cuts off part of the movie, so objects centered in
the composition may not appear centered unless the movie is cropped evenly on opposite edges.
AFTER EFFECTS CS3
User Guide
632
Crop to a region of interest To render just a portion of the composition frame, define a region of interest in the
Composition panel. Then, select the Region Of Interest option in the Output Module Settings dialog box before
rendering. (See “Work with the region of interest” on page 111.)
Note: Cropping an odd number of pixels from the top of a field-rendered movie reverses the field order. For example, if
you crop one row of pixels from the top of a movie with Upper Field First field rendering, the field-rendering order then
becomes Lower Field First. Remember that if you crop pixels from the top of the movie, you need to add to the bottom
row of the movie to maintain the original size. If you are willing to lose one scan line, this gives you a way to output two
movies from one render, each with a different field order.
Render the composition at a reduced resolution This is the fastest method to create reduced-size movies. For
example, if you create a 640 x 480 composition, you can set the composition resolution to one half, reducing the size
of the rendered composition to 320 x 240. You can then create movies or images at this size. Note that the reduced
resolution reduces the sharpness of the image and is best used for creating preview or draft movies.
Note: When rendering at reduced resolution, set the quality of the composition to Draft. Rendering at Best quality while
reducing resolution does not produce a clean image and takes longer to render than rendering at Draft quality.
See also
“Work with output module settings” on page 599
“Work in the Render Queue panel” on page 591
Scaling a movie up
Increasing the size of the output from a rendered composition reduces the image quality of a movie and is not recom-
mended.Ifyoumustenlargeamovie,tomaintainhighestimagequality,enlargeacompositionthatwasrenderedat
full resolution and highest quality using one of the following methods:
Nest the composition Create a new composition at the larger dimensions and nest the smaller composition inside it.
For example, if you create a 320 x 240 composition, you can place it in a 640 x 480 composition. Stretch the compo-
sition to fit the new larger composition size, and then collapse transformations by choosing Layers > Switches >
Collapse. The resulting composition rendered at full resolution and best quality will have better image quality than
if you had stretched the movie. However, this method also renders slower than if you created a composition and
stretched it.
Note: To create a draft movie with specific dimensions, use both the Stretch option and reduced resolution in the
rendered composition.
Stretch the composition For example, if you create a 320 x 240 composition and render it at full resolution, you can
set the stretch value in the Output Module Settings dialog box to 200% to create a 640 x 480 movie. For a composition
rendered at full resolution, the image quality will usually be acceptable.
Note: Do not use stretching to change the vertical dimensions of a movie with field rendering. Stretching vertically mixes
the field order, which distorts any motion. Use either cropping or composition nesting if you need to vertically resize a
field-rendered movie.
Crop the composition Toenlargeamoviebyafewpixels,increasethesizeusingnegativevaluesfortheCropoptions
in the Output Module Settings dialog box. For example, to increase the size of a movie by 2 pixels, type –2 in the
Cropping section of the Output Module Settings dialog box. Remember that negative cropping adds to one side of a
movie, so objects originally centered in the composition may not appear centered when the movie is cropped.
AFTER EFFECTS CS3
User Guide
633
Note: Adding an odd number of pixels to the top of a field-rendered movie reverses the field order. For example, if you
add one row of pixels to the top of a movie with Upper Field First field rendering, the field-rendering order then becomes
Lower Field First. Remember that if you add pixels to the top of the movie, you need to crop from the bottom row of the
movie to maintain the original size.
See also
“Work with output module settings” on page 599
“Work in the Render Queue panel” on page 591
Create a composition and render source footage items simultaneously
You can simultaneously create a composition from source footage and prepare it for rendering. This process is useful
when you want to change some characteristic of the source footage, such as frame rate or compression method, and
have that rendered version available in your project.
1DragoneormorefootageitemsfromtheProjectpaneltotheRenderQueuepanel,orselectthefootageitemsin
the Project panel and press Ctrl+Shift+/ (Windows) or Command+Shift+/ (Mac OS). After Effects creates both a
new item in the render queue and a new composition in the Project panel for each footage item.
2Adjust the render settings as desired, and click Render.
See also
“Work with render settings” on page 597
“Work in the Render Queue panel” on page 591
Introduce 3:2 pulldown
If you are creating output for film that’s been transferred to video, or if you want to simulate a film look for animation,
use 3:2 pulldown. Footage items that were originally film transferred to video and had 3:2 pulldown removed when
imported into After Effects can be rendered back to video with 3:2 pulldown reintroduced. You can introduce 3:2
pulldown by choosing one of five different phases. (See “Remove 3:2 or 24Pa pulldown from video” on page 72.)
Note: It is important to match the phase of a segment that had 3:2 pulldown removed if it will be edited back into the
video footage it came from.
1In the Render Queue panel, select the render item and then click the underlined text next to the Render Settings
heading.
2For Field Render, choose a field order.
3For 3:2 Pulldown, choose a phase.
4Select other settings as appropriate, and then click Render.
See also
“Work with render settings” on page 597
“Work in the Render Queue panel” on page 591
AFTER EFFECTS CS3
User Guide
634
Test field-rendering order
When you render a composition containing separated footage, set the Field Rendering option to the same field order
as your video equipment. If you field-render with the incorrect settings, the final movie may appear too soft, jerky,
or distorted. A simple test can determine the order in which your video equipment requires fields.
Note: The field order might get altered if you change the hardware or software of your production setup. For example,
changing your device control software or VCR after setting the field order can reverse your fields. Therefore, any time
you make a change to your setup, test the field-rendering order.
The test takes about 15 to 20 minutes and involves creating two movie versions of the same composition (one
rendered with Upper Field First and one with Lower Field First), and then playing the movies to see which choice
looks right.
1Create a simple composition with the correct frame size and frame rate. Choose an NTSC or PAL preset in the
Composition Settings dialog box, and make the composition at least 3 seconds long.
2Within the composition, make a layer that is a small rectangular solid. The layer can be any color as long as it
contrasts sharply with the composition background. You may want to add a title (such as “Upper Field First”) to the
solid to make identification of the movie easier.
3Apply some fast movement to the solid using keyframes in its Position property. Set keyframes from the upper left
of the Composition panel to the lower right for 1 second.
4Save the project, and then drag the composition to the Render Queue panel.
5Click the underlined Render Settings name, and then choose Upper Field First from the Field Render menu.
6Click OK, and then click Render to make the movie.
7In the composition, change the color of the solid in the Composition panel, and add a new title, such as “Lower
Field First,” to identify it.
8Render the composition again, choosing Lower Field First from the Field Render menu in the Render Settings
dialog box.
9Record both movies to the same device.
10 Play both movies.
One movie will look distorted and have jumpy horizontal motion or shape distortion during vertical motion. The
other movie will play back smoothly, with sharply defined edges. Use the field order for the smooth-playing movie
whenever you render movies with that particular hardware configuration.
See also
“Work with render settings” on page 597
“Work in the Render Queue panel” on page 591
Reviewing movies with Clip Notes comments
About Clip Notes comments
Use Clip Notes to submit a movie to reviewers for comments. When you render a movie for Clip Notes comments,
a copy of the movie or a link to the movie is included in an Adobe PDF file. The movie can be in Windows Media
(Windows only) or QuickTime format.
AFTER EFFECTS CS3
User Guide
635
Composition-time markers (After Effects) and sequence markers (Adobe Premiere Pro) are included with the movie
as comments, so you can submit questions to reviewers or solicit comments about specific parts of the movie.
Note: When you create a Clip Notes review movie, you can specify FTP settings in the Others tab of the export settings
dialog box to automatically place the PDF file on an FTP server for convenient exchange of files and comments.
When your reviewers open the PDF, they can play the movie and enter comments. Each comment is associated with
a specific time in the movie.
A reviewer then exports the comments to a file and sends the file back to you. When you import the comments, the
reviewer’s comments appear in the comments field of markers placed in the Timeline panel.
To view the PDF, a reviewer must have Adobe Acrobat Standard, Acrobat Professional, or Adobe Reader (version
7.0.5 or later). Adobe Reader is available as a free download from
www.adobe.com/go/learn_dv_download_adobereader.
Note: To keep comments from being associated with the wrong part of a movie, avoid changing the sequence or compo-
sition until you have imported all Clip Notes comments related to it.
Rendering and exporting a movie for Clip Notes comments
You render and export a movie for Clip Notes comments using the render queue in the same way that you render
other kinds of movies, though the export options are more limited than for most formats intended for final output.
Note: YoucanalsousetheFile>ExportmenutoaddacompositiontotherenderqueuetocreateamovieforClipNotes
comments.
When you create a Clip Notes review movie, you can specify FTP settings in the Others tab of the export settings
dialog box to automatically place the PDF file on an FTP server for convenient exchange of files and comments.
Beforeyourenderandexportacomposition’sworkareaforreviewwithClipNotes,makesurethattheworkareais
not set to begin at a frame other than the first frame of the composition. When you import Clip Notes comments
into the composition, After Effects assumes that the first frame of the Clip Notes movie matches the first frame of
the composition. If the work area is set to begin at a later frame, then the imported comments will be offset in time.
(See “Set the work area” on page 112.)
See also
“Render and export a movie using the render queue” on page 590
“Work in the Render Queue panel” on page 591
Clip Notes export settings
Export settings
Format QuickTime movie or Windows Media movie.
Preset Preset based on broadcast standard, data rate, aspect ratio, and quality.
Settings in the Clip Notes tab
Embed Video Embeds the rendered movie into the PDF.
AFTER EFFECTS CS3
User Guide
636
Stream Video Posts the rendered movie to an FTP (File Transfer Protocol) server and includes a link to the movie
inthePDF.ThesizeofthePDFissmallerthanitwouldbeifyouembeddedthemovie,butyouandyourreviewers
must have access to an FTP server that is also a web server.
Password Requires the reviewer to enter the password to open the PDF.
Instructions Instructions to reviewers. You can edit this field. The contents of this field will be presented to
reviewers in an Instructions dialog box when they open the Clip Notes PDF. If you leave this field empty, then the
Instructions dialog box will not be presented to reviewers.
Return Comments To E-mail address to which reviewers’ comments are sent upon export.
Add Clip Notes comments
1Open the Clip Notes PDF file in Adobe Acrobat Standard, Acrobat Professional, or Adobe Reader (version 7.0.5
or later).
2Ifprompted,specifyyourpreferenceintheManageTrustForMultimediaContentdialogbox.Ifpromptedfora
password, enter the password and click OK. If prompted with an Instructions dialog box, read the instructions and
click OK.
Note: You can view the instructions at any time by clicking the View Instructions button .
3Enter your name in the Reviewer Name field. This name will appear in your comments.
4Navigate to frames and add comments to them:
•To navigate to a specific frame, use the media player’s playback controls.
•To move to another comment, choose it in the Go To menu, or click the Go To Previous Comment button or
Go To Next Comment button .
•To add a comment, click the Add Comment button and enter your comment.
•To save your comments, click the Save Comment button .
•To delete a comment, go to the comment and then click the Delete Comment button .
Clip Notes prefixes your comment with the current reviewer name and timecode automatically. You can add your
own comment at the same frame as other reviewers; this is especially useful for responding to questions entered in
the comment field of a marker.
5When you finish adding comments, click the Export button. The comment file is an XFDF file. (When this file is
imported into After Effects or Premiere Pro by the person who initiated the review, the comments appear as
markers.)
6If prompted by your e-mail client software (such as Microsoft Outlook), edit and send the e-mail message that has
your Clip Notes comments file attached.
Note: You are prompted by your e-mail client software if an e-mail address was specified in the Return Comments To
field, when the Clip Notes PDF was created.
Import Clip Notes comments
1Select the composition into which to import the Clip Notes comments.
This should be the composition from which you rendered the movie that was sent for comments. If you have
modified the composition since you rendered the movie for comments, the imported comments may not be
associated with the appropriate parts of the composition.
AFTER EFFECTS CS3
User Guide
637
2Choose File > Import > Adobe Clip Notes.
3Select the XFDF file that contains the comments, and click Open.
Clip Notes comments appear as composition-time markers. Double-click a marker to read its comment.
See also
“Work with composition-time markers” on page 117
638
Chapter 18: Keyboard shortcuts
Using and modifying keyboard shortcuts
Use keyboard shortcuts to speed up common tasks.
Note: On Mac OS, some keyboard commands for interacting with the operating system conflict with keyboard
commands for interacting with After Effects. Select Use System Shortcut Keys in the General preferences to override the
After Effects keyboard command in cases in which there's a conflict with the Mac OS keyboard command.
To modify keyboard shortcuts, use the KeyEd Up script from Jeff Almasol, which is available on the Adobe After
Effects Exchange website: www.adobe.com/go/learn_ae_jeffscriptswithkeyedup.
For information on remapping keyboard shortcuts for keyboard layouts other than the standard US English layout,
see Jonas Hummelstrand’s website: www.adobe.com/go/learn_ae_jonaskeyboardmapping.
Shortcuts, general
Result Windows Mac OS
Select all Ctrl+A Command+A
Deselect all F2 or Ctrl+Shift+A F2 or Command+Shift+A
Rename selected layer, composi-
tion, folder, effect, group, or mask
Enter on main keyboard Return
Open selected layer, composition,
or footage item
Enter on numeric keypad Enter on numeric keypad
Move selected layers, masks, or
effects down (back) or up
(forward) in stacking order
Ctrl+Alt+Down Arrow or
Ctrl+Alt+Up Arrow
Command+Option+Down Arrow
or Command+Option+Up Arrow
Move selected layers, masks, or
effects to bottom (back) or top
(front) of stacking order
Ctrl+Alt+Shift+Down Arrow or
Ctrl+Alt+Shift+Up Arrow
Command+Option+Shift+Down
Arrow or
Command+Option+Shift+Up
Arrow
Extend selection to next item in
Project panel or Effect Controls
panel
Shift+Down Arrow Shift+Down Arrow
Extend selection to previous item
in Project panel or Effect Controls
panel
Shift+Up Arrow Shift+Up Arrow
Duplicate selected layers, masks,
effects, text selectors, animators,
puppet meshes, shapes, or
compositions
Ctrl+D Command+D
Quit Ctrl+Q Command+Q
AFTER EFFECTS CS3
User Guide
639
Shortcuts for working with projects
Shortcuts for working with preferences
Shortcuts for panels, viewers, workspaces, and windows
Note: (Mac OS) Shortcuts involving function keys F9-F12 may conflict with shortcuts used by the operating system. See
Mac OS Help for instructions to reassign Dashboard & Expose shortcuts.
Undo Ctrl+Z Command+Z
Redo Ctrl+Shift+Z Command+Shift+Z
Purge all Ctrl+Alt+/ (on numeric keypad) Command+Option+/ (on numeric
keypad)
Result Windows Mac OS
New project Ctrl+Alt+N Command+Option+N
Open project Ctrl+O Command+O
Open most recent project Ctrl+Alt+Shift+P Command+Option+Shift+P
New folder in Project panel Ctrl+Alt+Shift+N Command+Option+Shift+N
Open Project Settings dialog box Ctrl+Alt+Shift+K Command+Option+Shift+K
Find in Project panel Ctrl+Alt+G Command+Option+G
Find again in Project panel Alt+Shift+G Option+Shift+G
Cycle through color bit depths for
project
Alt-click bit-depth button at
bottom of Project panel
Option-click bit-depth button at
bottom of Project panel
Open Project Settings dialog box Click bit-depth button at bottom
of Project panel
Click bit-depth button at bottom
of Project panel
Result Windows Mac OS
Open Preferences dialog box Ctrl+Alt+; (semicolon) Command+Option+; (semicolon)
Restore default preferences
settings
Hold down Ctrl+Alt+Shift while
starting After Effects
Hold down
Command+Option+Shift while
starting After Effects
Result Windows Mac OS
Open or close Project panel Ctrl+0 Command+0
Open or close Render Queue
panel
Ctrl+Alt+0 Command+Option+0
Open or close Tools panel Ctrl+1 Command+1
Open or close Info panel Ctrl+2 Command+2
Open or close Time Controls panel Ctrl+3 Command+3
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
640
Shortcuts for activating tools
Note: You can activate some tools only under certain circumstances. For example, you can activate a camera tool only
when the active composition contains a camera layer.
Open or close Audio panel Ctrl+4 Command+4
Open or close Effects & Presets
panel
Ctrl+5 Command+5
Open or close Character panel Ctrl+6 Command+6
Open or close Paragraph panel Ctrl+7 Command+7
Open or close Paint panel Ctrl+8 Command+8
Open or close Brush Tips panel Ctrl+9 Command+9
Open or close Effect Controls
panel for selected layer
F3 or Ctrl+Shift+T F3 or Command+Shift+T
Open Flowchart panel for project
flowchart
Ctrl+F11 Command+F11
Switch to workspace Shift+F10, Shift+F11, or Shift+F12 Shift+F10, Shift+F11, or Shift+F12
Close active viewer or panel
(closes content first)
Ctrl+W Command+W
Close active panel or all viewers of
type of active viewer (closes
content first). E.g., if a Timeline
panel is active, this closes all Time-
line panels.
Ctrl+Shift+W Command+Shift+W
Split the frame containing the
active viewer and create a new
viewer with opposite
locked/unlocked state
Ctrl+Alt+Shift+N Command+Option+Shift+N
Maximize or restore panel under
pointer
` (accent grave) ` (accent grave)
Resize application window or
floating window to fit screen.
(Press again to resize window so
that contents fill the screen.)
Ctrl+\ (backslash) Command+\ (backslash)
Move application window or
floating window to main monitor;
resize window to fit screen. (Press
again to resize window so that
contents fill the screen.)
Ctrl+Alt+\ (backslash) Command+Option+\ (backslash)
Toggle activation between
Composition panel and Timeline
panel for current composition
\ (backslash) \ (backslash)
Cycle to previous or next item in
active viewer
Shift+, (comma) or Shift+. (period) Shift+, (comma) or Shift+. (period)
Cycle to previous or next panel in
active frame
Alt+Shift+, (comma) or Alt+Shift+.
(period)
Option+Shift+, (comma) or
Option+Shift+. (period)
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
641
To momentarily activate a tool with a single-letter keyboard shortcut, hold down the shortcut key; release the
shortcut key to return to the previously active tool. To activate a tool and keep it active, press the shortcut key and
immediately release it.
See also
“Activate a tool” on page 20
Result Windows Mac OS
Cycle through tools Alt-click tool button in Tools panel Option-click tool button in Tools
panel
Activate Selection tool V V
Activate Hand tool H H
Temporarily activate Hand tool Hold down spacebar. Hold down spacebar.
Activate Zoom In tool Z Z
Activate Zoom Out tool Alt (when Zoom In tool is active) Option (when Zoom In tool is
active)
Activate Rotation tool W W
Activate and cycle through
Camera tools (Orbit, Track XY, and
Track Z)
CC
Activate Pan Behind tool Y Y
Activate and cycle through mask
and shape tools (Rectangle,
Rounded Rectangle, Ellipse,
Polygon, Star)
QQ
Activate and cycle through Type
tools (Horizontal and Vertical)
Ctrl+T Command+T
Activate and cycle through pen
tools (Pen, Add Vertex, Delete
Vertex, and Convert Vertex)
GG
Temporarily activate Selection
tool when a pen tool is selected
Ctrl Command
Temporarily activate pen tool
when the Selection tool is
selected and pointer is over a path
(Add Vertex tool when pointer is
over a segment; Convert Vertex
tool when pointer is over a vertex)
Ctrl+Alt Command+Option
Activate and cycle through Brush,
Clone Stamp, and Eraser tools
Ctrl+B Command+B
Activate and cycle through
Puppet tools
Ctrl+P Command+P
Temporarily convert Selection
tool to Shape Duplication tool
Alt (in shape layer) Option (in shape layer)
Temporarily convert Selection
tool to Direct Selection tool
Ctrl (in shape layer) Command (in shape layer)
AFTER EFFECTS CS3
User Guide
642
Shortcuts for working with compositions and the work area
Shortcuts for working with previews
Result Windows Mac OS
New composition Ctrl+N Command+N
Open Composition Settings
dialog box for selected composi-
tion
Ctrl+K Command+K
Set composition background
color
Ctrl+Shift+B Command+Shift+B
Set beginning or end of work area
to current time
B or N B or N
Set work area to duration of
selected layers or, if no layers are
selected, set work area to compo-
sition duration
Ctrl+Alt+B Command+Option+B
Result Windows Mac OS
Start or stop standard preview spacebar spacebar
RAM preview 0 on numeric keypad* 0 on numeric keypad*
RAM preview with alternate
settings
Shift+0 on numeric keypad* Shift+0 on numeric keypad*
Save RAM preview Ctrl-click RAM Preview button or
press Ctrl+0 on numeric keypad*
Command-click RAM Preview
button or press Command+0 on
numeric keypad*
Save RAM preview with alternate
settings
Ctrl+Shift-click RAM Preview
button or press Ctrl+Shift+0 on
numeric keypad*
Command+Shift-click RAM
Preview button or press
Command+Shift+0 on numeric
keypad*
Preview only audio, from current
time
. (decimal point) on numeric
keypad*
. (decimal point) on numeric
keypad*
Preview only audio, in work area Alt+. (decimal point) on numeric
keypad*
Option+. (decimal point) on
numeric keypad*
Manually preview (scrub) video Drag or Alt-drag current-time indi-
cator, depending on Live Update
setting
Drag or Option-drag current-time
indicator, depending on Live
Update setting
Manually preview (scrub) audio Ctrl-drag current-time indicator Command-drag current-time indi-
cator
Wireframe preview Alt+0 on numeric keypad* Option+0 on numeric keypad*
Wireframe preview, leaving panel
contents
Alt+Shift+0 on numeric keypad* Option+Shift+0 on numeric
keypad*
Show current frame on video
preview device
/ (on numeric keypad) / (on numeric keypad)
Turn display color management
on or off for active view
Shift+/ (on numeric keypad) Shift+/ (on numeric keypad)
AFTER EFFECTS CS3
User Guide
643
Note: Some shortcuts are marked with an asterisk (*) to remind you to make sure that Num Lock is on when you use
the numeric keypad.
Shortcuts for time navigation
Toggle Output Device preference
between Desktop Only and video
preview device
Ctrl+/ (on numeric keypad) Command+/ (on numeric keypad)
Take snapshot Shift+F5, Shift+F6, Shift+F7, or
Shift+F8
Shift+F5, Shift+F6, Shift+F7, or
Shift+F8
Display snapshot in active panel F5, F6, F7, or F8 F5, F6, F7, or F8
Purge snapshot Ctrl+Shift+F5, Ctrl+Shift+F6,
Ctrl+Shift+F7, or Ctrl+Shift+F8
Command+Shift+F5,
Command+Shift+F6,
Command+Shift+F7, or
Command+Shift+F8
Result Windows Mac OS
Go to specific time Alt+Shift+J Option+Shift+J
Go to beginning or end of work
area
Shift+Home or Shift+End Shift+Home or Shift+End
Go to previous or next visible item
in time ruler (keyframe, marker,
work area beginning or end)
J or K J or K
Go to beginning of composition,
layer, or footage item
Home or Ctrl+Alt+Left Arrow Home or Command+Option+Left
Arrow
Go to end of composition, layer, or
footage item
End or Ctrl+Alt+Right Arrow End or Command+Option+Right
Arrow
Go forward 1 frame Page Down or Ctrl+Right Arrow Page Down or Command+Right
Arrow
Go forward 10 frames Shift+Page Down or
Ctrl+Shift+Right Arrow
Shift+Page Down or
Command+Shift+Right Arrow
Go backward 1 frame Page Up or Ctrl+Left Arrow Page Up or Command+Left Arrow
Go backward 10 frames Shift+Page Up or Ctrl+Shift+Left
Arrow
Shift+Page Up or
Command+Shift+Left Arrow
Go to layer In point I I
Go to layer Out point O O
Go to previous In point or Out
point
Ctrl+Alt+Shift+Left Arrow Command+Option+Shift+Left
Arrow
Go to next In point or Out point Ctrl+Alt+Shift+Right Arrow Command+Option+Shift+Right
Arrow
Scroll to current time in Timeline
panel
DD
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
644
Shortcuts for working with footage
Shortcuts for using and modifying views
Result Windows Mac OS
Import one file or image sequence Ctrl+I Command+I
Import multiple files or image
sequences
Ctrl+Alt+I Command+Option+I
Open movie in an After Effects
Footage panel
Alt-double-click Option-double-click
Add selected items to most
recently activated composition
Ctrl+/ (on main keyboard) Command+/ (on main keyboard)
Replace selected layers’ source
footage with footage item
selected in Project panel
Ctrl+Alt+/ (on main keyboard) Command+Option+/ (on main
keyboard)
Replace a selected layer’s source Alt-drag footage item from
Project panel onto selected layer
Option-drag footage item from
Project panel onto selected layer
Delete a footage item without a
warning
Ctrl+Backspace Command+Delete
Open Interpret Footage dialog
box for selected footage item
Ctrl+F Command+F
Remember footage interpretation Ctrl+Alt+C Command+Option+C
Edit selected footage item in
application with which it’s associ-
ated (Edit Original)
Ctrl+E Command+E
Replace selected footage item Ctrl+H Command+H
Reload selected footage items Ctrl+Alt+L Command+Option+L
Set proxy for selected footage
item
Ctrl+Alt+P Command+Option+P
Scan for changed footage Ctrl+Alt+Shift+Q Command+Option+Shift+Contro
l+Q
Result Windows Mac OS
Show red, green, blue, or alpha
channel as grayscale
Alt+1, Alt+2, Alt+3, Alt+4 Option+1, Option+2, Option+3,
Option+4
Show colorized red, green, or blue
channel
Alt+Shift+1, Alt+Shift+2,
Alt+Shift+3
Option+Shift+1, Option+Shift+2,
Option+Shift+3
Toggle showing straight RGB color Alt+Shift+4 Option+Shift+4
Reset view in the Composition
panel to 100% and center compo-
sition in the panel
Double-click Hand tool Double-click Hand tool
Zoom in in Composition, Layer, or
Footage panel
. (period) on main keyboard . (period) on main keyboard
Zoom out in Composition, Layer,
or Footage panel
, (comma) , (comma)
AFTER EFFECTS CS3
User Guide
645
Shortcuts for effects and animation presets
Shortcuts for working with layers
Note: Some operations do not affect shy layers.
Zoom to 100% in Composition,
Layer, or Footage panel
/ (on main keyboard) / (on main keyboard)
Zoom to fit in Composition, Layer,
or Footage panel
Shift+/ (on main keyboard) Shift+/ (on main keyboard)
Zoom up to 100% to fit in Compo-
sition, Layer, or Footage panel
Alt+/ (on main keyboard) Option+/ (on main keyboard)
Set resolution to Full, Half, or
Custom in Composition panel
Ctrl+J, Ctrl+Shift+J, Ctrl+Alt+J Command+J, Command+Shift+J,
Command+Option+J
Open View Options dialog box for
active Composition panel
Ctrl+Alt+U Command+Option+U
Zoom in Timeline panel to single-
frame units
; (semicolon) ; (semicolon)
Zoom in time = (equals sign) on main keyboard = (equals sign) on main keyboard
Zoom out time - (hyphen) on main keyboard - (hyphen) on main keyboard
Suspend image updates Caps Lock Caps Lock
Show or hide safe zones ' (apostrophe) ' (apostrophe)
Show or hide grid Ctrl+' (apostrophe) Command+' (apostrophe)
Show or hide proportional grid Alt+' (apostrophe) Option+' (apostrophe)
Show or hide rulers Ctrl+R Command+R
Show or hide guides Ctrl+; (semicolon) Command+; (semicolon)
Turn snapping to grid on or off Ctrl+Shift+' (apostrophe) Command+Shift+' (apostrophe)
Turn snapping to guides on or off Ctrl+Shift+; (semicolon) Command+Shift+; (semicolon)
Lock or unlock guides Ctrl+Alt+Shift+; (semicolon) Command+Option+Shift+; (semi-
colon)
Show or hide layer controls Ctrl+Shift+H Command+Shift+H
Result Windows Mac OS
Delete all effects from selected
layers.
Ctrl+Shift+E Command+Shift+E
Apply most recently applied effect
to selected layers.
Ctrl+Alt+Shift+E Command+Option+Shift+E
Apply most recently applied
animation preset to selected
layers.
Ctrl+Alt+Shift+F Command+Option+Shift+F
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
646
Result Windows Mac OS
New solid layer Ctrl+Y Command+Y
New null layer Ctrl+Alt+Shift+Y Command+Option+Shift+Y
Select layer (1-999) by its number
(enter digits rapidly for two-digit
and three-digit numbers)
0-9 on numeric keypad* 0-9 on numeric keypad*
Toggle selection of layer (1-999)
by its number (enter digits rapidly
for two-digit and three-digit
numbers)
Shift+0-9 on numeric keypad* Shift+0-9 on numeric keypad*
Select next layer in stacking order Ctrl+Down Arrow Command+Down Arrow
Select previous layer in stacking
order
Ctrl+Up Arrow Command+Up Arrow
Extend selection to next layer in
stacking order
Ctrl+Shift+Down Arrow Command+Shift+Down Arrow
Extend selection to previous layer
in stacking order
Ctrl+Shift+Up Arrow Command+Shift+Up Arrow
Deselect all layers Ctrl+Shift+A Command+Shift+A
Scroll topmost selected layer to
top of Timeline panel
XX
Show or hide Parent column Shift+F4 Shift+F4
Show or hide Layer Switches and
Modes columns
F4 F4
Turn off all other solo switches Alt-click solo switch Option-click solo switch
Turn Video switch on or off for
selected layers
Ctrl+Alt+Shift+V Command+Option+Shift+V
Turn off Video switch for all video
layers other than selected layers
Ctrl+Shift+V Command+Shift+V
Open settings dialog box for
selected solid, light, camera, null,
or adjustment layer
Ctrl+Shift+Y Command+Shift+Y
Paste layers at current time Ctrl+Alt+V Command+Option+V
Split selected layers (If no layers
are selected, split all layers.)
Ctrl+Shift+D Command+Shift+D
Precompose selected layers Ctrl+Shift+C Command+Shift+C
Open Effect Controls panel for
selected layers
Ctrl+Shift+T Command+Shift+T
Open source of a layer in Footage
panel
Alt-double-click a layer Option-double-click a layer
Reverse selected layers in time Ctrl+Alt+R Command+Option+R
Enable time remapping for
selected layers
Ctrl+Alt+T Command+Option+T
AFTER EFFECTS CS3
User Guide
647
Note: Some shortcuts are marked with an asterisk (*) to remind you to make sure that Num Lock is on when you use
the numeric keypad.
Shortcuts for showing properties in the Timeline panel
Note: This table contains double-letter shortcuts (for example, LL). To use these shortcuts, press the letters in quick
succession.
Move In point or Out point of
selected layers to current time
[ (left bracket) or ] (right bracket) [ (left bracket) or ] (right bracket)
Trim In point or Out point of
selected layers to current time
Alt+[ (left bracket) or Alt+] (right
bracket)
Option+[ (left bracket) or
Option+] (right bracket)
Add or remove expression for a
property
Alt-click stopwatch Option-click stopwatch
Add an effect (or multiple selected
effects) to selected layers
Double-click effect selection in
Effects & Presets panel
Double-click effect selection in
Effects & Presets panel
Set In point or Out point by time-
stretching
Ctrl+Shift+, (comma) or Ctrl+Alt+,
(comma)
Command+Shift+, (comma) or
Command+Option+, (comma)
Move In point of selected layers to
beginning of composition
Alt+Home Option+Home
Move Out point of selected layers
to end of composition
Alt+End Option+End
Lock selected layers Ctrl+L Command+L
Unlock all layers Ctrl+Shift+L Command+Shift+L
Set Quality to Best, Draft, or Wire-
frame for selected layers
Ctrl+U, Ctrl+Shift+U, or
Ctrl+Alt+Shift+U
Command+U,
Command+Shift+U,
Command+Option+Shift+U
Cycle forward or backward
through blending modes for
selected layers
Shift+ - (hyphen) or Shift+=
(equals sign) on the main
keyboard
Shift+ - (hyphen) or Shift+=
(equals sign) on the main
keyboard
Result Windows Mac OS
Toggle expansion of selected
layers to show all properties
Ctrl+` (accent grave) Command+` (accent grave)
Toggle expansion of property
group and all child property
groups to show all properties
Ctrl-click triangle to the left of the
property group name
Command-click triangle to the left
of the property group name
Show only Anchor Point property
(for lights and cameras, Point Of
Interest)
AA
Show only Audio Levels property L L
Show only Mask Feather property F F
Show only Mask Path property M M
Show only Mask Opacity property TT TT
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
648
Shortcuts for modifying properties
Show only Opacity property (for
lights, Intensity)
TT
Show only Position property P P
Show only Rotation and Orienta-
tion properties
RR
Show only Time Remap property RR RR
Show only Scale property S S
Show only Effects property group E E
Show only mask property groups MM MM
Show only Material Options prop-
erty group (3D)
AA AA
Show only expressions EE EE
Show only modified properties UU UU
Show only paint strokes and
Puppet pins
PP PP
Show only audio waveform LL LL
Show only properties with
keyframes or expressions
UU
Show only selected properties
and groups
SS SS
Hide property or group Alt+Shift-click property or group
name
Option+Shift-click property or
group name
Add or remove property or group
from set that is shown
Shift+property or group shortcut Shift+property or group shortcut
Add or remove keyframe at
current time
Alt+Shift+property shortcut Option+Shift+property shortcut
Result Windows Mac OS
Modify property value by default
increments
Drag property value Drag property value
Modify property value by 10x
default increments
Shift-drag property value Shift-drag property value
Modify property value by 1/10
default increments
Ctrl-drag property value Command-drag property value
Open Auto-Orientation dialog
box for selected layers
Ctrl+Alt+O Command+Alt+O
Open Opacity dialog box for
selected layers
Ctrl+Shift+O Command+Shift+O
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
649
Shortcuts for 3D layers
Note: (Mac OS) Shortcuts involving function keys F9-F12 may conflict with shortcuts used by the operating system. See
Mac OS Help for instructions to reassign Dashboard & Expose shortcuts.
Open Rotation dialog box for
selected layers
Ctrl+Shift+R Command+Shift+R
Open Position dialog box for
selected layers
Ctrl+Shift+P Command+Shift+P
Move selected layers 1 pixel at
current magnification (Position)
arrow key arrow key
Move selected layers 10 pixels at
current magnification (Position)
Shift+arrow key Shift+arrow key
Move selected layers 1 frame
earlier or later
Alt+Page Up or Alt+Page Down Option+Page Up or Option+Page
Down
Move selected layers 10 frames
earlier or later
Alt+Shift+Page Up or
Alt+Shift+Page Down
Option+Shift+Page Up or
Option+Shift+Page Down
Increase or decrease Rotation (Z
Rotation) of selected layers by 1˚
+ (plus) or - (minus) on numeric
keypad
+ (plus) or - (minus) on numeric
keypad
Increase or decrease Rotation (Z
Rotation) of selected layers by 10˚
Shift++ (plus) or Shift+- (minus)
on numeric keypad
Shift++ (plus) or Shift+- (minus)
on numeric keypad
Increase Scale of selected layers
by 1%
Ctrl++ (plus) or Alt++ (plus) on
numeric keypad
Command++ (plus) or Option++
(plus) on numeric keypad
Decrease Scale of selected layers
by 1%
Ctrl+- (minus) or Alt+- (minus) on
numeric keypad
Command+- (minus) or Option+-
(minus) on numeric keypad
Increase Scale of selected layers
by 10%
Ctrl+Shift++ (plus) or Alt+Shift++
(plus) on numeric keypad
Command+Shift++ (plus) or
Option+Shift++ (plus) on numeric
keypad
Decrease Scale of selected layers
by 10%
Ctrl+Shift+- (minus) or Alt+Shift+-
(minus) on numeric keypad
Command+Shift+- (minus) or
Option+Shift+- (minus) on
numeric keypad
Modify Rotation or Orientation in
45˚ increments
Shift-drag with Rotation tool Shift-drag with Rotation tool
Modify Scale, constrained to
footage frame aspect ratio
Shift-drag layer handle with Selec-
tion tool
Shift-drag layer handle with Selec-
tion tool
Reset Rotation to 0˚ Double-click Rotation tool Double-click Rotation tool
Reset Scale to 100% Double-click Selection tool Double-click Selection tool
Scale and reposition selected
layers to fit composition
Ctrl+Alt+F Command+Option+F
Scale and reposition selected
layers to fit composition width,
preserving aspect ratio
Ctrl+Alt+Shift+H Command+Option+Shift+H
Scale and reposition selected
layers to fit composition height,
preserving aspect ratio
Ctrl+Alt+Shift+G Command+Option+Shift+G
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
650
See also
“Shortcuts for showing properties in the Timeline panel” on page 647
Shortcuts for keyframes
Note: (Mac OS) Shortcuts involving function keys F9-F12 may conflict with shortcuts used by the operating system. See
Mac OS Help for instructions to reassign Dashboard & Expose shortcuts.
Result Windows Mac OS
Switch to 3D view 1 (defaults to
Front)
F10 F10
Switch to 3D view 2 (defaults to
Custom View 2)
F11 F11
Switch to 3D view 3 (defaults to
Active Camera)
F12 F12
Return to previous view Esc Esc
New light Ctrl+Alt+Shift+L Command+Option+Shift+L
New camera Ctrl+Alt+Shift+C Command+Option+Shift+C
Move the camera and its point of
interest to look at selected 3D
objects
Ctrl+Alt+Shift+\ Command+Option+Shift+\
Turn Casts Shadows property on
or off for selected 3D layers
Alt+Shift+C Option+Shift+C
Result Windows Mac OS
Toggle between Graph Editor and
layer bar modes
Shift+F3 Shift+F3
Select all keyframes for a property Click property name Click property name
Select all visible keyframes and
properties
Ctrl+Alt+A Command+Option+A
Deselect all keyframes, properties,
and property groups
Shift+F2 or Ctrl+Alt+Shift+A Shift+F2 or
Command+Option+Shift+A
Move keyframe 1 frame later or
earlier
Alt+Right Arrow or Alt+Left Arrow Option+Right Arrow or
Option+Left Arrow
Move keyframe 10 frames later or
earlier
Alt+Shift+Right Arrow or
Alt+Shift+Left Arrow
Option+Shift+Right Arrow or
Option+Shift+Left Arrow
Set interpolation for selected
keyframes (layer bar mode)
Ctrl+Alt+K Command+Option+K
Set keyframe interpolation
method to hold or Auto Bezier
Ctrl+Alt+H Command+Option+H
Set keyframe interpolation
method to linear or Auto Bezier
Ctrl-click in layer bar mode Command-click in layer bar mode
Set keyframe interpolation
method to linear or hold
Ctrl+Alt-click in layer bar mode Command+Option-click in layer
bar mode
AFTER EFFECTS CS3
User Guide
651
Shortcuts for working with text
Easy ease selected keyframes F9 F9
Easy ease selected keyframes in Shift+F9 Shift+F9
Easy ease selected keyframes out Ctrl+Shift+F9 Command+Shift+F9
Set velocity for selected
keyframes
Ctrl+Shift+K Command+Shift+K
Add or remove keyframe at
current time (For property short-
cuts, see “Shortcuts for showing
properties in the Timeline panel”
on page 647.)
Alt+Shift+property shortcut Option+Shift+property shortcut
Result Windows Mac OS
New text layer Ctrl+Alt+Shift+T Command+Option+Shift+T
Align selected horizontal text left,
center, or right
Ctrl+Shift+L, C, or R Command+Shift+L, C, or R
Align selected vertical text top,
center, or bottom
Ctrl+Shift+L, C, or R Command+Shift+L, C, or R
Extend or reduce selection by one
character to right or left in hori-
zontal text
Shift+Right Arrow or Shift+Left
Arrow
Shift+Right Arrow or Shift+Left
Arrow
Extend or reduce selection by one
word to right or left in horizontal
text
Ctrl+Shift+Right Arrow or
Ctrl+Shift+Left Arrow
Command+Shift+Right Arrow or
Command+Shift+Left Arrow
Extend or reduce selection by one
line up or down in horizontal text
Shift+Up Arrow or Shift+Down
Arrow
Shift+Up Arrow or Shift+Down
Arrow
Extend or reduce selection by one
line to right or left in vertical text
Shift+Right Arrow or Shift+Left
Arrow
Shift+Right Arrow or Shift+Left
Arrow
Extend or reduce selection one
word up or down in vertical text
Ctrl+Shift+Up Arrow or
Ctrl+Shift+Down Arrow
Command+Shift+Up Arrow or
Command+Shift+Down Arrow
Extend or reduce selection by one
character up or down in vertical
text
Shift+Up Arrow or Shift+Down
Arrow
Shift+Up Arrow or Shift+Down
Arrow
Select text from insertion point to
beginning or end of line
Shift+Home or Shift+End Shift+Home or Shift+End
Move insertion point to beginning
or end of line
Home or End Home or End
Select all text on a layer Double-click text layer Double-click text layer
Select text from insertion point to
beginning or end of text frame
Ctrl+Shift+Home or
Ctrl+Shift+End
Command+Shift+Home or
Command+Shift+End
Select text from insertion point to
mouse click point
Shift-click Shift-click
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
652
In horizontal text, move insertion
point one character left or right;
one line up or down; one word left
or right; or one paragraph up or
down
Left Arrow or Right Arrow; Up
Arrow or Down Arrow; Ctrl+Left
Arrow or Ctrl+Right Arrow; or
Ctrl+Up Arrow or Ctrl+Down
Arrow
Left Arrow or Right Arrow; Up
Arrow or Down Arrow;
Command+Left Arrow or
Command+Right Arrow; or
Command+Up Arrow or
Command+Down Arrow
In vertical text, move insertion
point one character up or down;
one left or right; one word up or
down; or one paragraph left or
right
Up Arrow or Down Arrow; Left
Arrow or Right Arrow; Ctrl+Up
Arrow or Ctrl+Down Arrow; or
Ctrl+Left Arrow or Ctrl+Right
Arrow
Up Arrow or Down Arrow; Left
Arrow or Right Arrow;
Command+Up Arrow or
Command+Down Arrow; or
Command+Left Arrow or
Command+Right Arrow
Select word, line, paragraph, or
entire text frame
Double-click, triple-click,
quadruple-click, or quintuple-
click with Type tool
Double-click, triple-click,
quadruple-click, or quintuple-
click with Type tool
Turn All Caps on or off for selected
text
Ctrl+Shift+K Command+Shift+K
Turn Small Caps on or off for
selected text
Ctrl+Alt+Shift+K Command+Option+Shift+K
Turn Superscript on or off for
selected text
Ctrl+Shift+= (equals) Command+Shift+= (equals)
Turn Subscript on or off for
selected text
Ctrl+Alt+Shift+= (equals) Command+Option+Shift+=
(equals)
Set horizontal scale to 100% for
selected text
Ctrl+Shift+X Command+Shift+X
Set vertical scale to 100% for
selected text
Ctrl+Alt+Shift+X Command+Option+Shift+X
Auto leading for selected text Ctrl+Alt+Shift+A Command+Option+Shift+A
Reset tracking to 0 for selected
text
Ctrl+Shift+Q Command+Shift+Control+Q
Justify paragraph; left align last
line
Ctrl+Shift+J Command+Shift+J
Justify paragraph; right align last
line
Ctrl+Alt+Shift+J Command+Option+Shift+J
Justify paragraph; force last line Ctrl+Shift+F Command+Shift+F
Decrease or increase type size of
selected text by 2 units
Ctrl+Shift+, (comma) or
Ctrl+Shift+. (period)
Command+Shift+, (comma) or
Command+Shift+. (period)
Decrease or increase type size of
selected text by 10 units
Ctrl+Alt+Shift+, (comma) or
Ctrl+Alt+Shift+. (period)
Command+Option+Shift+,
(comma) or
Command+Option+Shift+.
(period)
Increase or decrease leading by 2
units
Alt+Down Arrow or Alt+Up Arrow Option+Down Arrow or
Option+Up Arrow
Increase or decrease leading by 10
units
Ctrl+Alt+Down Arrow or
Ctrl+Alt+Up Arrow
Command+Option+Down Arrow
or Command+Option+Up Arrow
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
653
Shortcuts for working with masks
Decrease or increase baseline shift
by 2 units
Alt+Shift+Down Arrow or
Alt+Shift+Up Arrow
Option+Shift+Down Arrow or
Option+Shift+Up Arrow
Decrease or increase baseline shift
by 10 units
Ctrl+Alt+Shift+Down Arrow or
Ctrl+Alt+Shift+Up Arrow
Command+Option+Shift+Down
Arrow or
Command+Option+Shift+Up
Arrow
Decrease or increase kerning or
tracking 20 units (20/1000 ems)
Alt+Left Arrow or Alt+Right Arrow Option+Left Arrow or
Option+Right Arrow
Decrease or increase kerning or
tracking 100 units (100/1000 ems)
Ctrl+Alt+Left Arrow or
Ctrl+Alt+Right Arrow
Command+Option+Left Arrow or
Command+Option+Right Arrow
Toggle paragraph composer Ctrl+Alt+Shift+T Command+Option+Shift+T
Result Windows Mac OS
New mask Ctrl+Shift+N Command+Shift+N
Select all points in a mask Alt-click mask Option-click mask
Select next or previous mask Alt+` (grave accent) or Alt+Shift+`
(grave accent)
Option+` (grave accent) or
Option+Shift+` (grave accent)
Enter free-transform mask editing
mode
Double-click mask with Selection
tool or select mask in Timeline
panel and press Ctrl+T
Double-click mask with Selection
tool or select mask in Timeline
panel and press Command+T
Exit free-transform mask editing
mode
Esc Esc
Scale around center point in Free
Transform mode
Ctrl-drag Command-drag
Move selected path points 1 pixel
at current magnification
arrow key arrow key
Move selected path points 10
pixels at current magnification
Shift+arrow key Shift+arrow key
Toggle between smooth and
corner points
Ctrl+Alt-click vertex Command+Option-click vertex
Redraw Bezier handles Ctrl+Alt-drag vertex Command+Option-drag vertex
Invert selected mask Ctrl+Shift+I Command+Shift+I
Open Mask Feather dialog box for
selected mask
Ctrl+Shift+F Command+Shift+F
Open Mask Shape dialog box for
selected mask
Ctrl+Shift+M Command+Shift+M
Result Windows Mac OS
AFTER EFFECTS CS3
User Guide
654
Shortcuts for working with paint tools
Note: Some shortcuts are marked with an asterisk (*) to remind you to make sure that Num Lock is on when you use
the numeric keypad.
Result Windows Mac OS
Swap paint background color and
foreground colors
XX
Set paint foreground color to
black and background color to
white
DD
Set foreground color to the color
currently under any paint tool
pointer
Alt-click Option-click
Set foreground color to the
average color of a 4-pixel x 4-pixel
area under any paint tool pointer
Ctrl+Alt-click Command+Option-click
Set a paint tool’s brush size Ctrl-drag Command-drag
Set a paint tool’s brush hardness Ctrl-drag, then release Ctrl while
dragging
Command-drag, then release
Command while dragging
Join current paint stroke to the
previous stroke
Hold Shift while beginning stroke Hold Shift while beginning stroke
Set starting sample point to point
currently under Clone Stamp tool
pointer
Alt-click Option-click
Momentarily activate Eraser tool
with Last Stroke Only option
Ctrl+Shift Command+Shift
Show and move overlay. (Change
aligned Clone Stamp tool’s Offset
value or change unaligned Clone
Stamp tool’s Source Position
value.)
Alt+Shift-drag with Clone Stamp
tool
Option+Shift-drag with Clone
Stamp tool
Duplicate a Clone Stamp tool
preset in Paint panel
Alt-click the preset Option-click the preset
Set a paint tool’s opacity Digit on numeric keypad (e.g.,
9=90%, 1=10%)*
Digit on numeric keypad (e.g.,
9=90%, 1=10%)*
Set a paint tool’s opacity to 100% . (decimal) on numeric keypad* . (decimal) on numeric keypad*
Set a paint tool’s flow Shift+a digit on numeric keypad
(e.g., 9=90%, 1=10%)*
Shift+a digit on numeric keypad
(e.g., 9=90%, 1=10%)*
Set a paint tool’s flow to 100% Shift+. (decimal) on numeric
keypad*
Shift+. (decimal) on numeric
keypad*
Move earlier or later by number of
frames specified for stroke Dura-
tion
Ctrl+Page Up or Ctrl+Page Down Command+Page Up or
Command+Page Down
AFTER EFFECTS CS3
User Guide
655
Shortcuts for working with shape layers
Shortcuts for working with markers
Result Windows Mac OS
Group selected shapes Ctrl+G Command+G
Ungroup selected shapes Ctrl+Shift+G Command+Shift+G
Enter free-transform path editing
mode
Select Path property in Timeline
panel and press Ctrl+T
Select Path property in Timeline
panel and press Command+T
Increase star inner roundness Page Up when dragging to create
shape
Page Up when dragging to create
shape
Decrease star inner roundness Page Down when dragging to
create shape
Page Down when dragging to
create shape
Increase number of points for star
or polygon; increase roundness
for rounded rectangle
Up Arrow when dragging to
create shape
Up Arrow when dragging to
create shape
Decrease number of points for
star or polygon; decrease round-
ness for rounded rectangle
Down Arrow when dragging to
create shape
Down Arrow when dragging to
create shape
Reposition shape during creation Hold spacebar when dragging to
create shape
Hold spacebar when dragging to
create shape
Set rounded rectangle roundness
to 0 (sharp corners); decrease
polygon and star outer roundness
Left Arrow when dragging to
create shape
Left Arrow when dragging to
create shape
Set rounded rectangle roundness
to maximum; increase polygon
and star outer roundness
Right Arrow when dragging to
create shape
Right Arrow when dragging to
create shape
Constrain rectangles to squares;
constrain ellipses to circles;
constrain polygons and stars to
zero rotation
Shift when dragging to create
shape
Shift when dragging to create
shape
Change outer radius of star Ctrl when dragging to create
shape
Command when dragging to
create shape
Result Windows Mac OS
Set layer-time marker at current
time (works during RAM preview
and audio-only preview)
* (multiply) on numeric keypad * (multiply) on numeric keypad
Set layer-time marker at current
time and open marker dialog box
Alt+* (multiply) on numeric
keypad
Option+* (multiply) on numeric
keypad
Set and number a composition-
time marker (0-9) at the current
time
Shift+0-9 on main keyboard Shift+0-9 on main keyboard
AFTER EFFECTS CS3
User Guide
656
Shortcuts for motion tracking
Shortcuts for saving, exporting, and rendering
Go to a composition-time marker
(0-9)
0-9 on main keyboard 0-9 on main keyboard
See the duration between two
layer-time markers or keyframes
in the Info panel
Alt-click the markers or keyframes Option-click the markers or
keyframes
Remove marker Ctrl-click marker Command-click marker
Result Windows Mac OS
Move feature region, search
region, and attach point 1 pixel at
current magnification
arrow key arrow key
Move feature region, search
region, and attach point 10 pixels
at current magnification
Shift+arrow key Shift+arrow key
Move feature region and search
region 1 pixel at current magnifi-
cation
Alt+arrow key Option+arrow key
Move feature region and search
region 10 pixels at current magni-
fication
Alt+Shift+arrow key Option+Shift+arrow key
Result Windows Mac OS
Save project Ctrl+S Command+S
Increment and save project Ctrl+Alt+Shift+S Command+Option+Shift+S
Save As Ctrl+Shift+S Command+Shift+S
Add active composition or
selected items to render queue
Ctrl+Shift+/ (on main keyboard) Command+Shift+/ (on main
keyboard)
Add active or selected composi-
tion to render queue and specify
name of output file (Make Movie)
Ctrl+M Command+M
Add current frame to render
queue
Ctrl+Alt+S Command+Option+S
Duplicate render item with same
output file name as original
Ctrl+Shift+D Command+Shift+D
Result Windows Mac OS
657
Index
Numerics
16-bpc color 234
24Pa pulldown 72
3:2 pulldown
adding 633
removing 72
32-bpc color 234
3D Channel effects
3D Channel Extract effect 368
about 367
Depth Matte effect 368
Depth Of Field effect 369
Fog 3D effect 370
ID Matte effect 371
3D files, importing 77, 78, 79
Photoshop and Illustrator 78
Vanishing Point exchange 78
3D Glasses effect 481
3D layers
about 171
auto-orientation 146
axes 173
axis modes 174
effects and masks 175
expression elements 572
nesting 116, 175
render order 116, 175
text 293
views 127
3D properties 171
3D text properties 293
3D views 127
4-Color Gradient effect 419
8-bpc color 234
A
AAF (Advanced Authoring
Format) 75
acceptsLights (expression
element) 573
acceptsShadows (expression
element) 573
accessibility
of Help 4
action-safe zone 130
activation of software 1
active (expression element) 570, 575,
576
activeCamera (expression
element) 568
Adaptive Resolution preview
mode 125
add (expression element) 562
Add Grain effect 455, 457, 459
Add Vertex command 323
adjusting exposure 129
adjustment layers
about 136
lights 178
Adobe After Effects
conversion of layers in Adobe
Premiere Pro 65
integration with Adobe Bridge 28
integration with Adobe Encore 35
integration with Adobe Premiere
Pro 35
integration with Flash 33
integration with Photoshop 32
testing mobile content created
in 618
Adobe Audition 76
Adobe Bridge 28
Adobe Design Center 9
Adobe Dynamic Link
about 609
and color spaces 610
deleting links 611
editing linked compositions 611
Import After Effects Composition
command 610
Link Media command 612
linking to compositions 610
managing performance 609
New After Effects Composition
command 610
offline compositions 611
relinking compositions 612
Save As command, behavior 609
saving projects 609
suppressing linked clips in Adobe
Premiere Pro 612
unlinking compositions 612
Adobe Encore
chapter markers 118
creating buttons in After Effects 35
Adobe Fireworks
copying paths 324
Adobe Flash
integration with After Effects 33
Adobe Help 2
Adobe Illustrator
continuous rasterization 151
copying paths 85, 324
preparing and importing files 85
text from 273
Adobe InDesign
text from 273
Adobe Media Encoder 612
about 613
Audio options 615
command 613
Filters options 614
Video options 614
Adobe Photoshop
3D files 78
copying paths 324
creating new files 137
integration with After Effects 32
layer styles 168
preparing and importing files 83
rendering a frame to 607
text from 273
transparency 83
Adobe Premiere 6.0 and 6.5 35
Adobe Premiere Pro
capture 64
conversion of assets in After
Effects 66
exporting projects to 608
projects, importing 64
working with After Effects 35
Adobe Soundbooth
using in After Effects 76
Adobe Video Workshop 5
Advanced 3D rendering plug-in 181
Advanced composition settings 110
Advanced Lightning effect 420
INDEX 658
aerender 622
aeselflink 40
After Effects. See Adobe After Effects
aligning
layers 140
text 283, 294
alpha channels
about 252
copying channels to 386
creating masks from 256
interpretation methods 52
matted and unmatted 253
matted with color 385
premultiplied and straight 253
track mattes and 263
viewing 129
Alpha Levels effect 381
alpha matte 440
ambient (expression element) 573
analog film 68
analog video 68
Anamorphic 2:1 setting 57
anchor points
layer 154
text layers 292
anchorPoint (expression
element) 571
angles, conversion 566
animated GIF 36
animating
3D rotation 173
about 183
anchor point 154
deformation 226
with expressions 547
paint strokes 310
paths 325
scale 155
text 285
text, examples 295, 296, 297, 298,
299, 300, 301
animation presets
about 347
expressions 548
saving 353
text 285
animator groups, text 286
anti-aliasing 151
aperture (expression element) 575
aperture, camera setting 178
Arithmetic effect 381
arrays (expressions) 556
Asian text. See CJK text
aspect ratio 55
frame 55
pixel 55, 57
attach point 335
attributes (expressions) 556
Audiences encoding settings 616
audio
changing pitch 224
conforming 67
displaying spectrum 421
editing in Adobe Audition 76
editing in Adobe Soundbooth 76
layers 157
output options 601
previewing 122
reversing 371
Audio effects
Backwards effect 371
Bass & Treble effect 372
Delay effect 372
Flange & Chorus effect 372
High-Low Pass effect 373
Modulator effect 373
Parametric EQ effect 374
Reverb effect 374
Stereo Mixer effect 375
Tone effect 375
Audio Spectrum effect 421
audio tracks
conversion in After Effects 67
audio transitions
conversion in After Effects 67
audio volume 157
conversion in Adobe Premiere
Pro 66
Audio Waveform effect 423
audioActive (expression
element) 571
audioLevels (expression
element) 571
Audition. See Adobe Audition
Auto Bezier interpolation 207
Auto Color effect 388
Auto Contrast effect 388
Auto Levels effect 389
automation
post-render actions 602
rendering 622
scripts 45
Auto-Orient options 146
Auto-trace command 256
Avid formats
output 622
AVR codec options 622
B
background color 111
Backwards effect 371
baking Maya data 79
baseline 274
baseline shift 281
Basic 3D effect 483
Basic Fill effect. See Paint Bucket
effect
Basic Text effect 524
Bass & Treble effect 372
batch scripts 622
Beam effect 423
behaviors 347, 548
Best layer quality 150
Bevel Alpha effect 484
Bevel And Emboss layer style 169
Bevel Edges effect 484
Bezier paths 321
Bezier Warp effect 404
bgColor (expression element) 568
bit depth, color 234
bit rate 614, 619
bitmap images 312
bits per channel (bpc) 234
Blend effect 382
blending modes
about 163
Calculations effect 383
Checkerboard effect 426
Circle effect and 426
Color Link effect 393
with Eyedropper Fill effect 426
4-Color Gradient effect 419
Fractal Noise 463
Lightning effect 431
Magnify effect and 409
for overlapping text 282
Paint Bucket effect and 432
INDEX 659
reference 164
Solid Composite effect 387
Blending Options properties 171
blending, linear 244
blending, restricting to channels 171
Block Dissolve effect 537
bluescreen. See keying
blur
camera (depth of field) 177
masks 267
motion 200
Blur & Sharpen effects
Box Blur effect 376
Channel Blur effect 376
Compound Blur effect 377, 379
Directional Blur effect 377
Fast Blur effect 377
Gaussian Blur effect 378
Lens Blur effect 378
Radial Blur effect 379
Reduce Interlace Flicker effect 379
Sharpen effect 380
Smart Blur effect 380
Unsharp Mask effect 380
blurLevel (expression element) 575
bounding box
free-transform 327
text 276
Box Blur effect 376
bpc (bits per channel) 234
Brainstorm 160
Bridge Home 8
Bridge. See Adobe Bridge
Brightness & Contrast effect 389
Bring Layer Forward command 138
Broadcast Colors effect 390
broadcast-safe colors 250
brush dynamics 305
brush strokes 302
Brush Strokes effect 517
Brush tool 302, 305
See also paint tools
brushes 303, 305
bubbles, creating with Cell Pattern
effect 424
Bulge effect 404
buttons for Adobe Encore 35
C
caches
media 67
RAM and disk 39
Calculations effect 383
calibrating monitors 243
Camera Raw
See also camera raw files
about 88
database 104
preview controls 91
profile adjustments 99
XMP files 104
camera raw files
about 86
cache in Adobe Bridge 88, 91
chromatic aberration 100
copying and pasting settings in
Adobe Bridge 105
correcting a color cast 99
cropping and straightening
images 101
database for settings 105
export settings 106
histogram and RGB values 94
importing 89
non-neutral colors in 99
preview controls 91
profile adjustments 99
reducing noise 103
saving and restoring settings 104
saving to other file formats 93
sharpening 103
sidecar XMP files 105
tonal adjustment controls for 97
view controls 91
vignetting 101
white balance in 95
camera raw images
color management 245
cameras
about 176
Comp Camera attribute 349
expression elements 574
point of interest 179
settings 177
tools 180
capital letters 281
Caps Lock, preventing panel
updates 43
capturing video 64
Card Dance effect 487
Card Wipe effect 537
case, text 281
castsShadows (expression
element) 573
Caustics effect 489
CBR encoding 614
CD-ROM
setup 30
Cell Pattern effect 424
Change Color effect 390
Change To Color effect 391
Channel Blur effect 376
Channel Combiner effect 383
Channel effects
Alpha Levels effect 381
Arithmetic effect 382
Blend effect 382
Calculations effect 383
Channel Combiner effect 383
Compound Arithmetic effect 384
Invert effect 384
Minimax effect 385
Remove Color Matting effect 386
Set Channels effect 386
Set Matte effect 386
Shift Channels effect 387
Solid Composite effect 387
Channel Mixer effect 392
Channel Volume effect
conversion in After Effects 67
channels
copying 386
creating masks from 256
viewing 129
chapter (expression element) 581
character offset 288, 295
Character panel 278
character value 288
Checkerboard effect 425
child layers 158
choker, matte 450, 451
chroma keying. See keying
Cineon Converter effect 542
Cineon footage 85, 251
Circle effect 426
CJK text 282
formatting exceptions 284
INDEX 660
clamp (expression element) 563
clip markers, conversion in After
Effects 67
Clip Notes 635, 636
Clone Stamp tool 302, 307
See also paint tools
codecs
about 618
Collapse Transformations switch 115
Collect Files command 594, 627
color (expression element) 575
Color Balance (HLS) effect 392
Color Balance effect 392
Color Conversion methods
(expressions) 566
color correction 238
Color Correction effects
Auto Color effect 389
Auto Contrast effect 388
Auto Levels effect 389
Brightness & Contrast effect 389
Broadcast Colors effect 390
Change Color effect 390
Change To Color effect 391
Channel Mixer effect 392
Color Balance (HLS) effect 392
Color Balance effect 392
Color Link effect 392
Color Stabilizer effect 393
Colorama effect 393
common controls 389
Curves effect 396
Exposure effect 397
Gamma/Pedestal/Gain effect 398
Hue/Saturation effect 398
Leave Color effect 399
Levels (Individual Controls)
effect 400
Levels effect 399
Photo Filter effect 400
PS Arbitrary Map effect 401
Shadow/Highlight effect 402
Tint effect 403
Tritone effect 403
color depth 234
Color Difference Key effect 440
Color Emboss effect 518
Color Finesse 238, 250
Color Key effect 442
color keying. See keying
Color Link effect 392
color management
about 241
camera raw 245
color profiles 242
enabling 243
input color profile 245
linear working space 244
monitor profile 247
output color profile 246
simulation profile 248
working color space 243
color models 238
Color Overlay layer style 169
Color Picker 237
Color Picker effect. See Eyedropper
Fill effect
Color Profile Converter effect 543
color profiles
about 242
embedded 245
embedding 246
input 245
monitor 243, 247
output 246
simulation 248
Color Range effect 442, 443
color spaces 238
Color Stabilizer effect 393
Colorama effect 393
colorDepth (expression element) 561
Colorize control, Hue/Saturation
effect 398
columns 18
command line 622
comment (expression element) 581
comments, Clip Notes 635, 636
comp (expression element) 560
Comp Camera attribute 349
Comp expression elements 567
compositing
about 252
composition method for text 285
Composition panel
about 107
background color 111
composition settings 30, 110
compositions
creating 108
importing layered files as 83
offline, with Adobe Dynamic
Link 612
resolution 128
thumbnail images 111
Compound Arithmetic effect 384
Compound Blur effect 376
compression
about 618
Adobe Media Encoder 612
QuickTime 620
Video for Windows 621
compressor/decompressor. See
codecs
coneAngle (expression element) 575
coneFeather (expression
element) 575
conforming audio 67
Consolidate All Footage
command 60
Constant Bit Rate. See CBR encoding
continue, keyframe looping
argument 578
Continuous Bezier interpolation 207
continuous rasterization 115, 151
conversion, angles 566
Convert Audio To Keyframes
keyframe assistant 203
Convert Expression To Keyframes
keyframe assistant 555
Convert To Paragraph Text
command 276
Convert To Point Text command 276
Convert Vertex tool 323
converting movies 630
copying and pasting
between Adobe Premiere Pro and
After Effects 65
Corner Pin effect 405
corner points 313, 323
Create Layers At Composition Start
Time preference 134
Create Outlines command 320
Crop effect
conversion in After Effects 67
cropping movies 631
cross (expression element) 563
cross-platform projects 36, 63
INDEX 661
crystals, creating with Cell
Pattern 424
cue points 118
cuePointName (expression
element) 581
current-time display 132
current-time indicator 109
moving 123
moving to keyframe 188
Curves effect 396
cycle, keyframe looping
argument 578
D
D1/DV pixel aspect ratio 57
dashed lines 328
data rate 619
degreesToRadians (expression
element) 566
Delay effect 372
Delete Vertex tool 323
depth (3D) 171
Depth Matte effect 368
depth of field 177
Depth Of Field effect 369
depth, color 234
depthOfField (expression
element) 575
Design Center 9
difference keying 443
difference keying. See keying
Difference Matte effect 443
diffuse (expression element) 573
digital disk recorders (DDRs) 76
Digital Picture Exchange (DPX)
files 85
digital video 68
direction handles and lines 321
Graph Editor 209
direction handles and lines.path 313
Directional Blur effect 377
disk cache 39
disk space 38
Displacement Map effect 406
displayStartTime (expression
element) 568
Distort effects
Bezier Warp effect 404
Bulge effect 404
Corner Pin effect 405
Displacement Map effect 406
Liquify effect 406
Magnify effect 408
Mesh Warp effect 409
Mirror effect 410
Offset effect 410
Optics Compensation effect 410
Polar Coordinates effect 411
Reshape effect 413
Ripple effect 414
Smear effect 415
Spherize effect 416
Transform effect 417
Turbulent Displace effect 417
Twirl effect 418
Warp effect 418
Wave Warp effect 419
distributing layers 140
div (expression element) 563
docking panels 14
dot (expression element) 563
double-byte text. See CJK text
downloads
updates, plug-ins, and tryouts 10
Draft 3D preview mode 124
Draft layer quality 150
Drop Shadow effect 484
Drop Shadow layer style 169
drop-frame timecode 132
duplicating layers 145
duration
about 131
time-stretching 218
duration (expression element) 568,
569
Dust & Scratches effect 460
DVCPRO
HD 69
pixel aspect ratio 57
DVD
setup 30
Dynamic Link. See Adobe Dynamic
Link
E
ease (expression element) 565
easeIn (expression element) 566
easeOut (expression element) 566
Easy Ease keyframe assistant 213, 217
Echo effect 531
Edit Original command 60
editing mode, text 277
effect (expression element) 569
effect control points 353
Effect Controls panel 350
effect properties 152
effect properties, conversion in
Adobe Premiere Pro 66
effects
about 348
applying to masks 254
cameras and lights 349
Expression Controls 349, 555
expression elements 576
expression example 583
positioning 353
properties 350
removing 352
turning off and on 352
Effects & Presets panel 348, 350
EI format, importing 77
Ellipse effect 426
Ellipse tool 319
Emboss effect 518
Enable Per-character 3D
command 293
Enable Time Remapping
command 222, 225
encoders 618
Equalize effect 396
Eraser tool 302, 310
See also paint tools
error messages, for expressions 548
eventCuePoint (expression
element) 581
Every-line Composer 285
examples
expressions 551, 582, 583, 584, 585,
586
expressions, pick whip 582
text animation 295, 296, 297, 298,
299, 300, 301
experimenting with property
values 160
exploding a layer or particle 498
Exponential Scale keyframe
assistant 218
Export command 592
Export To DVD command 613
INDEX 662
exporting
about 587
After Effects project to Adobe
Premiere Pro 608
Clip Notes 634
output module settings 599
render queue 590, 591
supported formats 588
to film 606
using preset settings 612
using QuickTime components 592
Exposure effect 397
exposure, adjusting 129
Expression Controls effects 349, 555
expression field 552
Expression Language menu 549
Expression Sampler template
project 547
Expression selector 300, 301
expressions
about 547
animating at markers 585
animation presets 548
arrays 556
attributes 556
behaviors 548
converting to keyframes 555
copying 554
creating and modifying 549
disabling 550
error messages 548
examples 551, 582, 583, 584, 585,
586
examples with pick whip 582
examples, text animation 300, 301
global objects 560
indices 558
Interpolation methods 565
language 556
Mask Path property 576
math methods 566
methods 556
pick whip 550
random number methods 563
reference 559
saving 554
Source Text property 553
start or stop at specific time 585
time 559
time conversion 562
vectors 558
viewing 552
extending layers 141
extensions, filename 37
Extract effect 445
Extras 7
Eyedropper Fill effect 426
eyedropper tool 236, 441
F
Fast Blur effect 377
fast motion. See time-stretching
Fast Previews 124
favorites. See animation presets
feathering mask edges 262
feature region 335
Feet + Frames time display 132
field order 72, 634
field rendering 71, 599
field separation 71
fields
in interlaced frames 70
file formats. See formats
file systems 36
filenames
conventions 37
for output 595
Fill effect 427
fill layers 263
fill rules 331
fills 328
film 30, 68
film size, camera setting 178
Filmstrip (FLM) format
guidelines for editing 608
filters. See effects
Find Edges effect 519
first vertex 325
Flange & Chorus effect 372
Flash (SWF)
rendering and exporting 603
Flash Video (FLV)
cue points 118
rendering and exporting 603
Flash. See Adobe Flash
flipping layers 156
FLM format
guidelines for editing 608
floating windows 14
Flowchart panel 24
FLV. See Flash Video (FLV)
Foam effect 491
focal length, camera setting 178
focal plane, specifying 369
focus distance, camera setting 177
focusDistance (expression
element) 575
Fog 3D effect 370
folders
project hierarchy 36
Project panel 58
font installation 2
font size 278
footage
editing source in original
application 60
preparing before importing 47
footage (expression element) 560,
569
footage items
about 47
Adobe Photoshop files 137
importing and interpreting 50
looping 63
managing 58
placeholders 61
proxies 61
replacing 47
Footage panel 59
formats
See also individual formats
for export 588
for import 48
formatting text
characters 278
paragraphs 283
Fractal effect 427
Fractal Noise effect 461
frame aspect ratio 55
frame blending 225
Frame Hold, conversion in After
Effects 67
Frame Mix 225
frame rate 53, 83
frameDuration (expression
element) 568, 569
frames
freezing 208, 222
in interlaced video 70
INDEX 663
framesToTime (expression
element) 561
frameTarget (expression
element) 581
Free Transform Points command 327
freeze frame 208, 222
fromComp (expression element) 573
fromCompToSurface (expression
element) 574
fromCompVec (expression
element) 574
fromWorld (expression element) 574
fromWorldVec (expression
element) 574
f-stops, camera setting 178
G
gamma
about 239
Gamma/Pedestal/Gain effect 397
garbage mattes 270
Gaussian Blur effect 378
gaussRandom (expression
element) 564
Generate effects
Advanced Lightning effect 420
Audio Spectrum effect 421
Audio Waveform effect 423
Beam effect 424
Cell Pattern effect 424
Checkerboard effect 425
Circle effect 426
Ellipse effect 426
Eyedropper Fill effect 426
Fill effect 427
4-Color Gradient effect 419
Fractal effect 427
Grid effect 429
Lens Flare effect 429
Lightning effect 430
Paint Bucket effect 431
Radio Waves effect 432
Ramp effect 435
Scribble effect 435
Stroke effect 437
Vegas effect 438
Write-on effect 439
Get Properties For command 619
GIF, animated 36
global expression objects 560
Glow effect 519
GPU 593
Gradient Overlay layer style 169
Gradient Wipe effect 539
gradients
creating with Ramp effect 435
editing 236
gradients (shape layers) 328
grain 452
Graph Editor 184
graphics tablets and paint tools 305
grayscale images
colorizing 99
converting to black and white 524
creating 392
greenscreen. See keying
Grid effect 429
grids 131
grouping shapes 315, 317
Grow Bounds effect 544
guide layers 159
guides 131
H
H.264 69
halos 52, 385
handheld cameras 342
hand-tinted images 392
hanging punctuation 284
hard disk cache 39
hard disk space 38
hasAudio (expression element) 570
hasParent (expression element) 570
hasVideo (expression element) 570
HD
pixel aspect ratio 57
HDR (high dynamic range)
images 235, 545
HDR Compander effect 545
HDR Highlight Compression
effect 546
HDV 69
pixel aspect ratio 57
height (expression element) 568, 569,
570
Help
about 2
Hide Layer Controls command 173
high-definition video 69
highlight clipping 387
highlights, adjusting 402
High-Low Pass effect 373
histograms
adjusting color with 387
History command 25
Hold interpolation 207
hold-out matte 270
horizontal scale of text 281
horizontal scan lines 70
horizontal text, converting to
vertical 276
HSL/Color/Grayscale panel 99
hslToRgb (expression element) 566
Hue/Saturation effect 398
I
ICC (International Color
Consortium) 242
ID Matte effect 371
Illustrator. See Adobe Illustrator
image noise, defined 103
importing
3D files 77, 78, 79, 171
See also individual formats
about 47
Adobe Illustrator files 85
Adobe Photoshop files 83
Adobe Premiere 6.0 and 6.5
projects 64
Adobe Premiere Pro projects 64
After Effects projects 63
camera raw files 89
Cineon files 85
Digital Picture Exchange (DPX)
files 85
formats 48
methods 50
still images and sequences 80
Vanishing Point exchange
(.vpe) 78
In point 141
indenting paragraphs 284
InDesign. See Adobe InDesign
index (expression element) 570, 581
indices (expressions) 558
influence, keyframe direction
handles 213
Inner Glow layer style 169
Inner Shadow layer style 169
Inner/Outer Key effect 446
INDEX 664
inPoint (expression element) 570
input color profiles 245
installation 1
intensity (expression element) 575
inter-character blending 282
interlaced video 70, 71
International Press
Telecommunications Council.
See IPTC
interpolation
about 204
acceleration 213
applying and changing 208
expressions 565
motion paths 204
Smart Mask Interpolation 265
types 207
Interpolation methods
(expressions) 565
interpretation rules 52
interpreting footage items
about 51
alpha channel 52
field order 72
frame rate 83
separating fields 71
invert (expression element) 576
Invert effect 384
IPTC 105
Iris Wipe effect 540
ITPC 105
J
JavaScript, as expression
language 556
justifying text 284
K
kerning 280
key (expression element) 567, 572,
579
keyboard shortcuts 20
3D 650
animation presets 645
compositions 642
effects 645
exporting 656
footage 644
general 638
in Help 4
keyframe 650
layers 646
markers 655, 656
masks 653
paint 654
preferences 639
previews 642
projects 639
properties, modifying 648
properties, showing 647
rendering 656
saving 656
shape layers 655
text 651
time navigation 643
tools 641
views 644
workspaces 639
Keyframe Interpolation
command 217
keyframe menu 189
keyframe navigator 188
Keyframe Velocity dialog box 216
keyframe-looping methods 578
keyframes
about 183
adding to a motion path 198
controlling speed between 212
copying and pasting 191
creating from expressions 555
deleting 190
editing with spreadsheets 192
expression elements 580
influence 215
modifying multiple 195
moving 193
roving 216
smoothing 202
time-stretching 218
value graph 191
values 195
keying 253
color 269
difference 443
effects 268
for a single frame 269
Keylight 268
linear keys 447
matte tools 269
removing traces of key color 449
static background 443
Ultra 268
Keying effects
Color Difference Key effect 440
Color Key effect 442
Color Range effect 442
Difference Matte effect 443
Extract effect 445
Inner/Outer Key effect 446
Linear Color Key effect 447
Luma Key effect 448
Spill Suppressor effect 449
Keylight effect 268
keys
about 253
kumimoji text 282
L
layer (expression element) 567
layer bar mode 184
layer expression elements 569, 570,
572
layer modes. See blending modes
layer outline 152
layer properties
about 152
animating 184
expression elements 571
layer stacking order 115
layer styles 168, 169, 170
layers
about 133
adjustment layers 136
Adobe Photoshop files 137
aligning and distributing 140
animating 183
child 158
color labels 149
copying and pasting 145
creating 135
creating from Adobe Premiere
Pro 65
guide 159
image quality 150
locking and unlocking 149
parent 158
placing in time 143
renaming 147
INDEX 665
rotating 157
selecting 138
sequencing 144
solid-color 136
splitting 146
stacking and render order 138
trimming and extending 141
layer-time markers, conversion in
Adobe Premiere Pro 66
leading 279, 282
Leave All Attributes In option 114
Leave Color effect 399
length (expression element) 563
Lens Blur effect 378
Lens Flare effect 429
Levels (Individual Controls)
effect 400
Levels effect 399
levels, adjusting with Auto Levels
effect 389
Lightning effect 430
lights (3D) 178, 179
lights, expression elements 575
lightTransmission (expression
element) 573
Line Anchor animator 297
linear (expression element) 565, 584
linear blending 239, 244
Linear Color Key effect 447
linear keys 447
Linear Wipe effect 541
links, web 118
lip-synching 220
Liquify effect 406
Live Update preview mode 124
LiveDocs 2
Local Axis mode 174
locking
layers 149
masks 259
lookAt (expression element) 563
loopIn (expression element) 578
loopInDuration (expression
element) 579
looping
footage items 63
Fractal Noise effect 463
previews 122
loopOut (expression element) 578
loopOutDuration (expression
element) 579
lower-field first field order 72
luma expansion 250
Luma Key effect 448
luminance keying. See keying
M
Magnify effect 408
magnifying. See zooming
Make Movie command 590
manual preview 123
margins, safe-zone 130
marker (expression element) 567
MarkerKey (expression element) 581
markers
about 116
chapter links 118
composition 117
cue points 118
layer 118
synchronizing to audio 119
mask (expression element) 569
Mask Expansion property 262
Mask Path property 576
maskExpansion (expression
element) 576
maskFeather (expression
element) 576
maskOpacity (expression
element) 576
masks
3D layers 175
about 253
adjusting and expanding edges 262
applying effects to 254
color 260
creating 318, 320, 321
creating motion paths from 199
deleting 259
expression elements 576
feathering 262
locking and unlocking 259
modes, blending 260
modifying 323
motion blur 267
moving 267
Pan Behind tool 267
saving and reusing 259
selecting 258
using with grain effects 453
viewing 257
masks, conversion in Adobe
Premiere Pro 66
masks, creating
about 254
from channels 256
from motion paths 255
Match Grain effect 455, 457, 458, 460,
464
material options (3D) 181
math, expressions 566
Matte Choker effect 271, 450
Matte effects
Matte Choker effect 450
Simple Choker effect 451
matted alpha channels 253
matted channels 53
mattes
about 253
closing holes 271
refining 269
removing 385
spreading and choking 450, 451
track and traveling 263
using with grain effects 453, 454
mattes, conversion in Adobe
Premiere Pro 66
Maya format
importing 77, 79
media cache 67
Media Encoder. See Adobe Media
Encoder
media player setup 30
Median effect 466
Memory & Cache preferences 39
memory requirements 37
memory, caches 39
menus 19
Merge Paths 333
Mesh Warp effect 409
mesh, Puppet 231
metadata
about 618
in MPEG-2 files 613
metal (expression element) 573
methods (expressions) 556
Metrics kerning 281
Microsoft RLE compression 621
Minimax effect 385
INDEX 666
Mirror effect 410
mixing audio 375
mobile devices
setup 30
Modulator effect 373
monitors
profiling 243
Monochrome control, Channel
Mixer effect 392
Mosaic effect 520
motion blur 200, 267
motion paths
auto-orientation 146
changing speed numerically 216
creating 197
creating from masks 199
Motion Sketch 199
smoothing 202
spatial interpolation and 204
speed 210
Motion Sketch 199
Motion Tile effect 520
motion tracking
about 335
applying to another layer 345
attach point 335
correcting drift 345
feature region 335
search region 335
stabilizing motion 342
track points 335, 343
tracking data 341
tracking rotation 342
tracking scale 342
workflow 336
Motion values, conversion in After
Effects 67
motion-picture film 69, 606
Move All Attributes Into The New
Composition option 114
movies, making from
compositions 590
MPEG formats
about 613
multiplexer preset options 617
presets 613
MPEG indexing 67
mul (expression element) 562
multiple monitors 17
multiplexing 617
multiprocessing 40
mutation 160
MXF 49
importing 74
N
name (expression element) 568, 569,
572
names
footage files 37
project files 37
navigation shortcuts, in Adobe
Help 4
nearestKey (expression element) 567,
572, 579
nested compositions
3D layers 116
about 113
prerendering 114
network rendering 625, 626, 627, 628
noise
in camera raw images 103
Noise & Grain effects
Add Grain effect 459
Dust & Scratches effect 460
Fractal Noise effect 461
Match Grain effect 464
Median effect 466
Noise Alpha effect 466
Noise effect 466
Noise HLS Auto effect 468
Noise HLS effect 467
Remove Grain effect 468
noise (expression element) 565
Noise Alpha effect 466
Noise effect 466
Noise HLS Auto effect 467
Noise HLS effect 467
noise sampling, grain effects 456, 464
non-drop-frame timecode 132
noninterlaced video 70
normalize (expression element) 563
NTSC to PAL 630
null objects
about 159
using with Expression Controls
effects 555
Numbers effect 525
numKeys (expression element) 568,
572, 579
numLayers (expression element) 568
O
offline compositions 611
Offset effect 410
offset, keyframe-looping
argument 578
OMF (Open Media Framework)
format
importing 75
rendering and exporting 622
online resources 7
opacity (expression element) 571
Opacity values, conversion in After
Effects 67
OpenGL 125, 593
OpenType fonts 278
operating system considerations 36
optical kerning 280
Optics Compensation effect 410
Orbit Camera tool 180
orientation (expression element) 572
orthogonal views 127
Out point 141
Outer Glow layer style 169
out-of-memory alert 38
outPoint (expression element) 570
output color profiles 246
output module settings 599
overflow volumes 629
Overlap controls, Puppet 231
overscan 130
P
P2 media
importing 74
Paint Bucket effect 431
Paint effect 471
paint operations, shape layers 314,
328
Paint panel 302
paint strokes 302, 310
paint tools 302
PAL to NTSC 630
Pan Behind tool 154, 267
Panasonic P2 49
INDEX 667
panels
docking and grouping 14
opening and closing 17
resizing 16
panning
anchor point 154
audio 375
masks 266
Paragraph panel 283
paragraph text
See also text
converting to point 276
param (expression element) 576
parameters (expression element) 581
Parametric EQ effect 374
parametric shape paths 314
parent (expression element) 570
parent layers 158
Particle Playground effect 499
patches, Mesh Warp 409
path names 36
path operations, shape layers 314, 332
Path Options property, text 294
Path Text effect 526
Pathfinder effects 333
paths
about 313
animating 325
converting to RotoBezier 323
creating 318, 320, 321
direction handles 209
modifying 258, 323, 327
placing text along 293
PDF files
exporting Clip Notes comments
as 634
Pen tool
drawing paths 321
editing paths 323
keyframes and motion paths 198
per-character 3D text properties 293
performance, improving 41
Perspective effects
3D Glasses effect 482
Basic 3D effect 483
Bevel Alpha effect 484
Bevel Edges effect 484
Drop Shadow effect 484
Radial Shadow effect 485
Photo Filter effect 400
Photoshop. See Adobe Photoshop
PIC format, importing 77
pick whip, creating expressions
with 550
pingpong, keyframe looping
argument 578
pins, Puppet 226, 231
pitch
changing 224
pixel aspect ratio 55, 57
Pixel Motion 225
pixelAspect (expression
element) 568, 569
pixels 312
placeholders 61
planning 28
platforms and importing 63
playback. See previews
plug-ins 7, 44
in Adobe Store 10
point of interest 179
point text
See also text
converting to paragraph 276
pointOfInterest (expression
element) 574, 575
Polar Coordinates effect 411
Polygon tool 319
Portable Document Format. See PDF
files
position
expression example 583
Pan Behind tool 266
position (expression element) 571
Posterize effect 521
Posterize Time effect 532
posterizeTime (expression
element) 561
post-render actions 602
precomposing 113, 114
preferences
resetting 21
Premiere Pro. See Adobe Premiere
Pro
premultiplied channels 53, 253
preparing source footage 47
prerendering 114
Preserve Underlying Transparency
option 264
preset export settings 612
presets. See animation presets
pressure setting 305
previews
about 120
alpha and color channels 129
choosing a viewer 124
color management 247, 248
external video monitors 126
grain effects 455
memory requirements 38
methods 120
modes 124
performance 41
viewers 19
work area 112
profiling a monitor 243
progressive scanning 70
Project panel 58
project settings 29
project templates 23
projects 23, 60, 63
properties
effects 350
expression elements 576
layers 152
properties and property groups 152
propertyGroup (expression
element) 579, 580
propertyIndex (expression
element) 579, 580
proxies 61
PS Arbitrary Map effect
about 401
Pucker & Bloat path operation 332
pulldown
adding 633
removing 72
punctuation, hanging 284
Puppet tools
about 226
automatically animating 229
manually animating 228
mesh and pins 231
outlines and paths 230
Overlap controls 231
Starch controls 232
purge 38
INDEX 668
Q
quality, layer image 150
QuickTime
compression settings 619
encoding presets 616
QuickTime (MOV) format
exporting 592
QuickTime video
exporting 33
quotation marks 279
R
Radial Blur effect 379
Radial Shadow effect 485
Radial Wipe effect 541
radiansToDegrees (expression
element) 567
Radio Waves effect 432
RAM (random access memory) 38,
39
RAM previews 121
Ramp effect 435
random (expression element) 564
Random Numbers methods
(expressions) 563
random seed 354
Randomness (Brainstorm) 160
Range selector 289, 295, 298
raster images 312
rasterization, continuous 151
read me file 2
RealMedia files, exporting 616
Reduce Interlace Flicker effect 379
Reduce Project command 60
reflectivity, 3D layers 181
region of interest 111
registration of software 1
reloading footage items 60
remap-time marker 220
Remove Color Matting effect 385
Remove Grain effect 468
Remove Unused Footage
command 60
renaming 147
Render Multiple Frames
Simultaneously preference 40
render order 115, 138
Render Queue panel
about 591
output module settings 599
render settings 597
render settings 597
rendering
about 587
audio 601
command-line 622
field order 72
file naming 595
frame blending 225
log file 592
memory requirements 38
network 625, 626, 627
OpenGL 593
output module settings 599
overflow and segment settings 629
pausing and stopping 591
performance 41
post-render actions 602
render queue 590, 591
render settings 597
re-rendering 591, 592
still-image sequences 606
watch folders 625, 626
work area 112
rendering intent, Color Profile
Converter effect 543
renmoji text 282
Repeater 333
replicating shapes 333
requirements, system 1
Reshape effect 412
resizing
movies 631, 632
resolution
compositions 128
revealing footage items 60
Reverb effect 374
reversing audio 371
reversing paths 331
Revert command 25
reviewing with Clip Notes 635, 636
RGB 238
rgbToHsl (expression element) 566
Ripple effect 414
RLA format, importing 77, 78
rotating layers 157
rotation
3D layers 173
expression example 582
selected paths 327
rotation (expression element) 571
rotationX (expression element) 572
rotationY (expression element) 572
rotationZ (expression element) 573
RotoBezier paths
adjusting tension 324
converting 323
creating 313
rotoscoping 306
See also paint tools, paint strokes
Roughen Edges effect 521
roving keyframes 216
RPF Camera Import keyframe
assistant 78
RPF format, importing 77, 78
rulers 130
S
safe zones 130
sampleImage (expression
element) 571
Satin layer style 169
saturation
adjusting a specific color range 99
Save Animation Preset 353
Save Frame As command 607
Save RAM Preview command 121
scale
exponential 218
paths and points 327
tracking 342
scale (expression element) 571
scaling
layers 155
movies 631, 632
scan lines 70
Scatter effect 522
Scribble effect 435
scripts 45
scrolling 18
scrubbing. See previews
search region 335
seedRandom (expression
element) 563
segment settings 629
INDEX 669
selecting
layers 138
selectors
adding 289
Expression 300, 301
Range 289, 295, 298
Wiggly 289, 296, 300
selflink 40
Send Layer Backward command 138
separating fields 71
Sequence Layers keyframe
assistant 144
sequence markers, conversion in
After Effects 67
sequences of still images 81, 606
Set Channels effect 386
Set First Vertex command 325
Set Matte effect 386
setting up projects 28
shadow clipping 387
Shadow Map Resolution 181
Shadow/Highlight effect 402
shadowDarkness (expression
element) 575
shadowDiffusion (expression
element) 576
shadows (3D) 175, 178
shaky footage, stabilizing 342
shape groups 315, 317
shape layers 314, 318
shapes
adding attributes 328
creating 318, 320, 321
duplicating 328
modifying 323
replicating 333
selecting 325
strokes and fills 328
Sharpen effect 380
Shatter effect 508
Shift Channels effect 387
shininess (expression element) 573
shortcuts, keyboard. See keyboard
shortcuts
Show Layer Controls 173
showing and hiding
axes (layer controls) 173
expressions 552
layers 149
safe zones and grids 131
shutterAngle (expression
element) 568
shutterPhase (expression
element) 568
shy layers 150
sidecar files 104, 105
silhouette blending modes 166
Simple Choker effect 451
Simulation effects
Card Dance effect 488
Caustics effect 490
Foam effect 492
Particle Playground effect 496
Shatter effect 509
Wave World effect 514
single frame, rendering and
exporting 607
Single-line Composer 285
slip edit 142
slow motion. See time-stretching and
Timewarp
Smart Blur effect 380
Smart Mask Interpolation 265
Smear effect 415
smooth (expression element) 578
smooth points 313, 323
Smoother, The 202
smoothing motion 217
SMPTE timecode 132
snapshots 125
software
activation 1
downloads 10
registration 1
Solid Composite effect 387
solid-color layers 136
solo layers 149
Soundbooth. See Adobe Soundbooth
source (expression element) 569
source footage
See also individual formats.
supported formats for import 48
Source Text property 273, 553
spacebar play 120
spatial interpolation and motion
paths 204
spatial properties 152
specular (expression element) 573
speed
about 213
easing 217
gradual starts and stops 215
graphs 210
motion paths 210
speed (expression element) 577
Speed property, conversion in After
Effects 67
speedAtTime (expression
element) 577
Spherize effect 416
Spill Suppressor effect 449, 450
Split tone 99
splitting layers 146
Spread (Brainstorm) 160
spreading mattes 451
spreadsheets 192
square pixels 57
stabilizing motion 342
stacking order 115, 138
standard preview 120
Starch controls, Puppet 232
startTime (expression element) 570
stencil blending modes 166
Stereo Mixer effect 375
Stereo Mixer effect, conversion in
Adobe Premiere Pro 66
still images
changing duration 141
formats for export 588
preparing and importing 80
stopwatch 184
storage 38
straight channels 53, 253
stretching a layer in time 219
Strobe Light effect 523
Stroke effect 437
Stroke layer style 169
strokes 328
See alsopaint strokes
Stylize effects
Brush Strokes effect 517
Color Emboss effect 518
Emboss effect 518
Find Edges effect 519
Glow effect 519
Mosaic effect 520
Motion Tile effect 520
Roughen Edges effect 521
INDEX 670
Scatter effect 522
Strobe Light effect 523
Texturize effect 523
Threshold effect 524
sub (expression element) 562
subscript text 281
superscript text 281
super-slow motion 535
SWF. See Flash (SWF)
Switch 3D View command 127
switches
about 147
Continuously Rasterize 151
Lock 149
Quality 150
Shy 150
Solo 149
Video 148
synthetic layers 314
system requirements 1
T
tablets, graphics 305
tate-chuu-yoko text 282
technical support 1
telecine transfer 69
template projects 23
templates
for output module settings 599
for render settings 597
Temporal Filtering, Remove Grain
effect 468
temporal properties 152
temporalWiggle (expression
element) 578
text
aligning on a path 294
baseline 274
baseline shift 281
bounding box 276
case 281
changing direction 276
color 280
composition 285
conversion, paragraph and
point 276
creating 273
creating shapes from 320
editing 277
fill and stroke 279
formatting 278, 283
from other applications 273
from version 6.0 project 280
justified 284
kerning and tracking 280
leading 279, 282
offsetting character values 288
paragraph text 273, 275, 276
as particles 500
Path Options 294
point text 273, 274, 276
scaling 281
selecting 277, 289
superscript and subscript 281
text animation presets 285
text animator groups 288
Text effects
Basic Text effect 524
Numbers effect 526
Path Text effect 526
Timecode effect 530
text, animating
about 285
effects 527
examples 295, 297, 298, 299, 300,
301
on a path 293
with animator groups 286
Texturize effect 523
thisComp (expression element) 560
thisLayer (expression element) 560
thisProperty (expression
element) 561
Threshold effect 524
thumbnail images 111
time
display style 132
in expressions 559
time (expression element) 561, 580
time conversion, with
expressions 562
Time Difference effect 532
Time Displacement effect 533
Time effects
Echo effect 531
Posterize Time effect 532
Time Difference effect 532
Time Displacement effect 533
Timewarp effect 535
time graph 109, 112
time ruler 123
Time Stretch property, conversion in
Adobe Premiere Pro 66
timecode 132
Timecode effect 530
Timeline panel 109
timeRemap (expression element) 572
time-remapping 220, 223, 224
time-remapping (expressions) 559
Time-Reverse Keyframes keyframe
assistant 220
time-stretching 219
timeToCurrentFormat (expression
element) 562
timeToFeetAndFrames (expression
element) 562
timeToFrames (expression
element) 561
timeToNTSCTimecode (expression
element) 561
timeToTimecode (expression
element) 561
time-vary stopwatch 184
Timewarp effect 535
Tint effect 403
title-safe zones 130
toComp (expression element) 573
toCompVec (expression
element) 574
Toggle Hold Keyframe 208
tonal adjustments 397
tonal levels, posterizing 399, 400
tonal range
adjusting 387
tonal range, adjusting 396, 402
Tone effect 375
tone response 239
tool tips 20
tools 20
toWorld (expression element) 574
toWorldVec (expression
element) 574
tracing channels 256
track mattes 263
track points 335, 343
Track XY Camera tool 180
Track Z Camera tool 180
Tracker Controls panel 339
tracking data 341
tracking motion. See motion
tracking.
INDEX 671
tracking, text 280
transfer modes, conversion in Adobe
Premiere Pro 66
transfer modes. See blending modes
Transform effect 417
Transform properties, conversion in
Adobe Premiere Pro 66
transformations, collapsing 115
Transition Completion property 536
Transition effects 536
Block Dissolve effect 537
Card Wipe effect 537
Iris Wipe effect 540
Linear Wipe effect 541
Venetian Blinds effect 542
transparency
Adobe Photoshop files 83
alpha channels 252
keying 252
paint strokes 303
preserving during
compositing 264
traveling mattes 263, 386
trimming
footage items 59
layers 141
Tritone effect 403
TrueType fonts 278
tryouts 10
tsume text 282
Turbulent Displace effect 417
Tweaking controls, Grain effects 460
tweening. See keyframes
Twirl effect 418
Twist path operation 332
twitter 379
Type 1 fonts 278
type. See text
U
Ultra 268
uncompressed high-definition
video 69
Undo command 25
Unicode characters 288
unlocking layers 149
unmatted channels 53, 253
Unsharp Mask controls, Remove
Grain effect 470
Unsharp Mask effect 380
updates 10
upper-field first field order 72
url (expression element) 581
user interface brightness 18
Utility effects
Cineon Converter effect 543
Color Profile Converter effects 543
Grow Bounds effect 544
HDR Compander effect 545
HDR Highlight Compression
effect 546
V
value (expression element) 561, 576,
580
value graphs 191, 206, 222
valueAtTime (expression
element) 576
Vanishing Point exchange 78
vector graphics 151, 312
Vector Math methods
(expressions) 562
Vector Paint effect 471
vectors 562
vectors (expressions) 558
Vegas effect 438
velocity
easing 216
time-remapping 220
velocity (expression element) 577
velocityAtTime (expression
element) 577
Venetian Blinds effect 542
vertical scale of text 281
vertical text
converting to horizontal 276
vertices, path 323
vertices.path 313
video
capturing 64
exporting QuickTime 33
fields and frames 70
high-definition 69
importing from Premiere Pro 65
interlacing 70
progressive scanning 70
removing pulldown 72
video fields, separating 71
Video filter properties, conversion in
After Effects 67
Video for Windows format
compression 621
video formats
analog 68
converting 630
digital 68
Video switch 148
video transitions, conversion in After
Effects 67
Video Workshop 5
videotape
setup 30
View Axis mode 174
viewers 19
views
orthogonal 127
3D 127
vignetting, correcting in camera raw
files 101
Volume audio filter, conversion in
After Effects 67
volume, audio 157
W
Wacom tablets 305
Warp effect 418
warping images 404, 410
Watch Folder command 627
watch folders 625, 626, 627, 628
Wave Warp effect 419
Wave World effect 514
waveforms
animating with Audio
Spectrum 421
animating with Audio
Waveform 423
web links 118
web video, setup 30
white balance for camera raw files 95
wide-angle lens 177
width (expression element) 568, 569
wiggle (expression element) 577
Wiggler, The 202
Wiggly selector 289, 291, 296, 300
windows
floating 14
opening and closing 17
Windows Media format
specifying codecs 616
Wireframe layer quality 150
INDEX 672
Wireframe preview mode 124
WM9 HDTV 69
work area 112
workflow 26
working color space 244
workspaces
about 13
choosing 14
deleting 18
docking and grouping 14
drop zones 14
floating windows 14
multiple monitors 17
resetting 18
resizing panel groups 16
saving custom layouts 17
World Axis mode 174
Write On option 310
Write-on effect 439
X
XMP (Extensible Metadata Platform)
exporting 618
XMP sidecar files
in Camera Raw 104
viewing in Adobe Bridge 105
Z
z axis 171, 173
Zig Zag path operation 332
zoom (expression element) 575
zoom lens 218
zooming 18, 128
zooming in time 112
ZPIC format, importing 77

Navigation menu