Manual turntable. & 960282-4 or -5 ... The manual turntable will play one 33'13 or 78 r.p.m. record up to twelve inches in diameter. The speed is con-.
rr WI SERVICE DATA m sti Iell VOLUME VIII 1952 -' %AMC RECEWERS PHONOGRAPHS TELEVISION maniampAmmetwitivoin RADIO CORPORATION OF AMeRICA RCA Victor Division Harrison, N. J., U. S. A. RCAVICTOR SERVICE DATA HIS ASTER'S VOICE" TELEVISION RECEIVERS RADIO RECEIVERS PHONOGRAPHS This volume is a compilation of Service Data previously issued for the year 1952 with the latest changes and corrections. Trademarks Copyright, 1953. Radio Corporation of America . "RCA Victor," "Victor," "Victrola" "Radiola," "Radiotron," "Chanalyst," "VoltOhmyst." Reg. U. S. Pat. Off. First Edition-First Printing Printed in U. S. A. PREPARED BY RCA SERVICE CO., INC FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION HARRISON, N. J., U. S. A. INDEX The page numbers given in the index below refer to the number at the top of the pages. The numbers which are found in the text and at the bottom of some pages refer only to that particular Service Data. The regular Service Data will be found on the pages indicated by boldface numbers (1, 2, 3, etc.). Supplementary data is indicated by lightface numbers. RADIOS AND PHONOGRAPHS Model No. Chassis No. Page No. 2B400, 2B401, 2B402, 2B403, 2B404, 2B405..RC-1114 1 2BX63 RC -1115 5 2C511 RC -1118 9 2C512 RC -1118A 9 2C513 RC -1118B 9 2C514 RC -1118C 9 2C521 RC -1120, RC -1120B 13 2C522, 2C527 ....RC -1120A, RC -1120C 13 2ES3 RS -142 17 2ES31 RS -142 19 2ES38 RS -142 17 2JS1 Record Player 21 2R51, 2R51A, 2R52, 2R52A..RC-1119 23 2S7 RC -1117D 2S10 RC -1111, RS -141 29 2US7 RC -1117A, RC -1117C 37 2X61 RC -1080C 41 2X62 RC -1080D 41 2X621 RC -1085B 43 2XF91 RC -1121 47 2XF931, 2XF932, 2XF933, 2XF934 RC -1121A 53 15E, 15E-1 RS -139A 59 RECORD CHANGERS 930409 Series 63 TELEVISION 17T150, 17T151, 17T163 KCS-66C 77 17T200, 17T201, 17T202, 17T211, 17T220 KCS-72, KCS-72M1, KCS-72M2 .109 17T250DE, 17T261DE KCS-74, KCS-74M1 141 21T159, 21T165..KCS-68E 173 Model No. Chassis No. Page No. 21T159DE, 21T166DE, 21T174DE, 21T178DE, 21T179DE ....KCS-68F 173 21T176, 21T177, 21T178, 21T179 KCS-68C 173 21T197DE KCS-68H, RC -1111A, RS -141A 180-193, 209 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 KCS-72A 229 21T242 KCS-72D-1, RC -1117B 236-249, 261 21T244 KCS-72D-2, RC -1111B, RS -141C 236-249, 261 U -IA KRK-19A 285 U -1B KRK-19 285 U-2 KCS-79 289 U -2A KCS-79A 289 U-70 KCS-70 295 Supplementary Information: General notes on KCS-66, KCS-66A, KCS-68C, KCS-68E XVII Interchangeability of R -F tuners XIX Oscillator switch wafers XIX R -F unit oscillator tracking XX Use of WR39A and WR39B Television Cali- brators XX Correcting pix i-f response XX High-pass filter XXI High voltage arcs at kinescopes XXI Adjustment of A -G -C control XXI Television receiver cross-reference XXII MISCELLANEOUS Complete Index to Models -Vol. I to Vol. VIII IV Index to Chassis Numbers XII Model Number vs. Record Changer XVI Sales Name vs. Model Number XVI Fixed composition resistor stock number code XXI Crystal pickup cross-reference XXVI IV COMPLETE INDEX OF MODELS NOTES: fdenotes "Radiola" denotes "Victor" All others "RCA" or "RCA Victor" Refer to the index of the listed Volume for additional information contained in that Volume. VOL. I VOI . II VOL. III VOL. IV VOL. V VOL. VI VOL. VII VOL. VIII 1923 to 1937 1938 to 1942 1943 to 1946 1947 to 1948 1949 1950 1951 19 52 Modal Chassis No. or Description Vol. Page AA -1400 Detector -Amplifier I - 238A AA -1520 tAC tAR R -F Amplifier Audio Amplifier R -F Amplifier III ---23218AAA AR -1300 A-55 A-78 A-82 A-91 A-101 A-106 A-108 BC6-4 BC6-6 I - 238A VI - 5 RC -1087 VI - 1 RC -1084A RC -1094 RC -1095 RC -1096, RC -1096B RC -622 Correction to Parts List. RC -1096, RC -1096B VI- 11 VI- 15 VVII-- 3233 . VII- V VI- 41 I - 90B I - 94B BC7-9 I - 122B BK-41 RC -449 II -458C BK-42 RC -408C II -460C BP -10 RC -544 II -297C BP -55, BP -56, BP -85 ..RC -455 BT6-3 II -522C I - 90B BT6-5 I - 94B BT6-10 I - 90B BT7-8 I - 122B BT -40 RC -408 II -456C BT -41 RC -449 II -458C BT -42 BX-6 BX-55 BX-57 f B-50 RC -408A RC -1082, RC -1082A RC -1088, RC -1088B RC -1088A, RC -1088C RC -1004H II- 460C VI - 47 VI - 51 VI - 55 II -399C fB-52 B-411 RC -1004D RC -1098, RC -1098A II -407C VI- 43 CR D-9 A.0 Record Demonstrator I - 186B CR D-9 D.0 Record Demonstrator I - 188B CV -8 Power Unit I - 160B CV -9 RS -79B II - 610C CV -40 RS -98 II -458C CV -42 CV -45 RS -1000 RS -1001 IIIII --40647C CV -110 RS -83C II - 34C CV -111 RS -95 II 44C CV -112 CV -112X CV -120 RS -111 RS -111A Power Unit II 23C IVI -- 8X7VCI C6-2 I 98B C6-8 I 103B C6-12 107B C7-6 127B C7-14 98B C8-15 146 B C8-17 1528 C8-19, C8-20 161 B C9-4 146B C9-6 152B C11-1, C113 215B C13-2, C13-3 230 B C15-3, C15-4 253 B D7-7 127B D8-28 161B D9-19 I - 152B D11-2 D22-1, D22 -1A I - 219B I -262B E-35 Electrola I - 138A E-135 R-32 Amp. & Speaker E-152 R-32 Amp. & Speaker G-8 Armchair Control I -619B H F-1 RC -339 5C Model H F-2 H F-4 H F-6 H F-8 K -50 K -60 2nd Prod. K -61 K -62 K-80 2nd Prod. K -81, K -82 K -105 K -130 MB -1, MB -2, MB -3 MI -8122 MI -13174 M-30 M-32 M-34 M-50 M-60 M-70 M-101, M-105 M-107 M-108 M-109 M-116 M-123 OSC. 22 0-1 0-2 0-3 0-6, 0-10 0-11 0-12, 0-14 0-15 0-16, 0-19 0-50 PLF-10 PSU-8A, PSU-8B, PSU -8C PSU -8E PSU -10A, PSU -10B, PSU -10C PSU-10E PT -33 PX61-10 PX-600 tP-5 P-31 QB-1 QB-2 QB-3 QB-5 QB-6 QB-9 QB-11, QB-12 QB - 13 QB-55 QB-55X QB-60 QH-1 QK -23 QU-2C QU -2M Chassis No. or Description RC -354B RC -354A RC -331A RC -331 RC -418A, RC -497 RC -415 RC -415B RC -498F RC -415B RC -415A RC -415C, RC -415D RC -415C RC -476 RC -501A, RS -102C Repl. Motor Board Power Unit Coin Operated Radio RC -357 J RC -357K RC -394 Phono. Oscillator Portable Victrola Portable Victrola Portable Victrola Portable Victrola Portable Victrola Portable Victrola Portable Victrola Portable Victrola Record Player Power Line Filter Vol. Page II - 14C II 14C II -124C II -124C II -504C II -531C II -537C II -548C II -537C II -531C II -537C II 537C II -664C II -498C I - 13A IVI --34XCV I - 118A I - 135A I -2878 II -217C II -222C II -560C I -409B I -420B I - 437B I - 409B I -449B I -459B I - 480B III--3915BC II - 20C II - 33C III --210BC III --210BC I I - 20C II - 509C II - 81C Power Unit Power Unit II -211C II - 213C Power Unit Power Unit Record Player RC -1023B RC -1110 RC -465, RC -1020B RC -529A RC -529 RC -539D RC -563A RC -529D RC -529H RC -529A RC -612 RC -563A RC -563K RC -607 Correction to Parts List Record Player RC -507B RC -507C RC -507D II -211C II -213C IIII--149AIII VII - 45 II - 83C III --1828CA II - 23C II - 34C II - 87C IIIIIIIIII----28737CC III - 41 III - 43 IVV-- 1X1V3 I IV - 1 II- 27C II II- 2727CC V COMPLETE INDEX OF MODELS (Continued) Model Chassis No. or Description Vol. Page QU -3C QU -3M QU -5 RC -507F RC -507H RC -530, RS -110 II- 39C II- 39C II- 89C QU -7 RC -551, RS -112A II - 147C QU -8 RC -551, RS -112 II - 147C QU-51C,QU-51M RC -563 II -511C QU -52C RC -507L 11- 516C QU -52M RC -507N II 516C QU -55 RC -568A II 511C QU -56C, QU -56M RC -566A II 526C QU -61 RC -568B III 59 QU -62 QU-68 RC -602B RC -601B IV IV- 21189 QU -72, QU -72A RC -1035 III 103 Q-10, Q -10A, Q-10-2 Q -10A-2 RC -594C III 5 Q-10-3 Q-11 Q-12 Q-14, Q-15 RC -594C III III RC -563E, RC -563F 11 309C RC -563, -563B, -563C, -563 D .11 309C RC -566 " -330C Q -14E, Q -15E Q-16 RC -566B RC -561 II 330C 11-361C Q -16E RC -561C II -361C Q-17 Q-18 Q-20, Q-21 Q-22 Q -22A Q-23 Q-24 Q-25 Q-26 Q-27 RC -561A RC -477 RC -514 RC -507 RC -507 RC -592 RC -508 RC -507A RC -507J RC -507K 11 369C 11 62C 11 381C 11 27C III 15 11 396C 11 401C 11 27C II 39C 11 27C Q-30 Q-31 Q-32 RC -538B RC -538C RC -507 11 438C II 438C III 15 Q-33 RC -539 II 452C Q-34 Q-36 RC -539E RC -585 III 19 III 23 Q-44 RC -531 II 462C Q-103, Q -103A, Q -103A-2, Q-103-2 ...RC -1044 Q-103AX, Q-103AX-2, III 107 Q -103X, Q -103X-2 ...RC -1044B Q-109 RC -602 III 107 IV 143 Q - 109X Q-110 Q-121 RC -602A RC -594C RC -507, RC -507U IV 143 III IV. III 111 Q-122 RC -601, RC -601D III 115 Q- 122X RC -601A, RC -601E III 115 Radiola II Radiola III, IIIA Radiola IV, V AR -800 AR -805, AR -806 AR -880, AR -885A 3A 4A 6A Radiola VI AR -895 Radiola VII, VIIB Radiola Super VIII .... AR -810 Radiola IX 7A 8A 9A 10A Radiola X Radiola Grand Rad. Regenoflex 11A I- 113AA Rad. Superheterodyne . AR -804 98A RAE -26 49A RAE -59 77A RAE -68 195A RAE -79 - 77A RAE -84 - 207A RAE -84 -SW RAE -84 with SW -3 Converte 1-13C RC -3 RE -16 RE -16A RE -17 Detector -Amplifier Victor R-15 1A 60A I - 27A I - 32A 1- 60A RE -18, RE -18A RE 19 RE -20 I - 49A I - 38A I - 77A RE -40, RE -40P RE -45 RE -57 I - 282B I - 138A I - 151A RE -73 RE -75 I -151A I - 138A RE -80 I -310B RE -81 RE -81 -SW RE -154 I - 200A RE -81 with SW -3 Converter.1 Similar to RE -45 Model RE -156 R K-24 RK-137-1, RK-137-2 RO-23 RP -132 Series RP -139 Series RP -140 RP -145 Series RP -151 RP -152, RP -153, RP -155, RP -157 RP -158, RP -160, RP -161, RP -162 RP -168 Series RP -176 Series RP -177 RP -177 Series RP -178 RP -190 Series RP -193 tRS tRT R -3B R -3C R-4 R-5 R-5 D. C. R -5X R-6 R-7 R -7A R-7 D C. R-7 L W. R-8 R-8 D. C. R-9 R-9 D. C. R-10 R-10 D. C. R-11 R-12 R-14, R-15 R-17, R -17M, R -17W R -18W' R-21 R-22 R-24 R -24A R -24A R -24B R-25 D. C. R-27 R-28 Series R -28P *R-32 R-34 *R-35 R-37, R-38 R -37P, R -38P R-39 .,, R-43 R-50 R -51B OR -52 R -53B R-55 R-56 R-60 -I-R-65BR9 R-70 R-71 R -71B R-72 R-73 R -73A R-74 R-75 R -75A R-76, R-77 R-73 R -78SW R-89 Chassis No. or Description Vol. PGge Similar to RE -45 I Phono. Osc. (Stock No. Ceramic Pickup Kit 9554)V.1-- 2X81VBI I - 94A Automatic Record Changer.II -698C Automatic Record Changer. II -698C Automatic Record Changer. I1 -698C Automatic Record Changer.Il -698C Automatic Record Changer. II -713C Automatic Record Changer.II -726C Automatic Record Changer.lI -737C Automatic Record Changer.V - 109 VI - 93 Automatic Record Changer.I I I - 121 Automatic Record Changer.IlI - 133 Automatic Record Changer.IV - 151 Automatic Record Changer. IV - 167 Automatic Record Changer. VI - 107 VII - 33 Automatic Record Changer. Detector -Amplifier Antenna Coupler V1IIII -----1421319BAA6 I - 19A Radiolette 1I-- 2232AA 1- 24A I - 19A Superette I - 27A I - 32A I - 34A I - 36A I - 38A I- 43A I - 27A 1 - 34A I - 38A I - 34A I - 49A 1 - 38A I - 60A I -25913 I -261B I - 49A I - 279B R-71 with SW -3 Converter... R-73 with SW -3 Converter... R -73A with SW -3 Converter.. I- R -71B with SW -3 Converter.. 413 1 -2598 I -282B I -282B I - 138A I - 151A I - 151A I -290B I - 29213 I - 151A I- 163A I- 77A I - 295B 1- 138A I -295B I - 77A Record Player II -530C Record Player RC -1045 IIIII--509CIV I - 198A I 304B I -307B I- 3048 I -310B I - 313B I -200A 1-310B I -313B I - 200A I - 207A R-78 with SW -3 Converter... Record Player II -568C VI Model R-90, R -90P R-91 R -91B R-92 R-93. R -93A R -93B, R -93C R -93F R -93S, R-93-2 R-94 R -94B R-95 R-96, R-97 R-98 R-99 R-100 R -103S tR-560P 1'R -566P tSR SR -1, SR -2, SR -3 SWA-2, SW -2 SW -3 SW -10 S-1000 TA -128 TA -129 TA -169 TC-124, TC-125, TC-127 TC-165, TC-166, TC-167, TC-168 TH-10 TRK-5 TRK-9, TRK-12 TRK -90, TRK -120 TT -5 T4-8, T4-9 T4 -8A, T4 -9A T4-10 T5 T5-2 T6-1 T6-7 T6-9 T6-11 T7-5 T7-12 T8-14 T8-16 T8-18 T9-7, T9-8 T9-9 T9-10 T10-1 T10-3 T11-8 T-55, T -55S T-56 T-60 T-62 T-63 T-64, T-65 T-80 T-100 T-120, T-121 T-164 UY-122E UY-124 U1 -A U1 -B U2 U2 -A U-8 U-9 U -10 U-12 U-20 U-25, U-26 U-30 U-40 U-42 U-43 COMPLETE INDEX OF MODELS (Continued) Chassis No. or Description Record Player Recorder Record Player Record Player Record Player Record Player Record Player Record Player Record Player Record Player Record Player Record Player Record Player Record Player RC -517F RC -517J Two -speed Turntable Short Wave Converter Short Wave Converter Short Wave Converter KCS-31, RC -6176 KCS-42A, RK-135D KCS-41A, RK-135D KCS-43, RK-135D Vol. Page I -3786 II -569C I 3826 1 383B 1 385B II 571C II -572C 1-385B 1 385B II1-3959246C I 395B II 652C I 398B II 572C 11 661C 11 668C II 708C 1 2A I 13A I 16A I 5B I -234A VI -307 VI 223 VI 243 VI -289 KCS-34B VI 221 KCS-40A D.C. Inverter VI -261 I -213B KC -3, KC -3A, RC -429, RS -89A II - 93C Television & Radio Comb...II -251C Television & Radio Comb. .11 -251C KC -3, KC -3B II 93C 14B 17B 19B Record Player 25A 52B 98B 103B 110B 1076 I -127B I 98B I -1466 1-152B I -161B I -190B I 152B I 146B I -204B I -208B 1-208B RC -418 RC -418 RC -425 II -504C II -504C 11-543C RC -425D RC -472F RC -416 RC -416A KCS-38 KCS-34C KCS-40 RC -352B RC -352C 11 543C II -551C II -554C 11-554C VI - 179 VI - 193 VI -261 II -692C II -692C KRK-19A KRK-19 KCS-79 KCS-79A V111-285 VIII 285 VIII -289 VIII -289 RC -404A II 215C RC -482B, RC -482C II 283C RC -418B II 299C RC -425A II 320C RC -498 RC -386B RC-335KR RC -498A RC -498B, RS -89B RC -498E II 384C II -409C II 444C II -384C II -384C 11 -384C Model Chassis No. or Description Vol. Page U-44 U-45 U-46 U-50 U-70 U-101 U -102E U-103 U-104 U-105 U-106 U-107 U-108, U-109 U-111 U-112 U-115 U-119 U-121 U -122E U-123 U-124 U-125 U-126 U -127E U-128 U-129 U-130 U-132 U-134 VA -15 VA -20, VA -21 VA -22, VA -24 VE7-3 to VE15-1 VH R -202 VH R-207 VH R-212 VH R -307 VH R -407 VV2-35 to VV9- 18 V-30 V-100 V-101 V-102 V-105 V-135 V-140 V-170 V-175 V-200 V-201 V-205 V-209 V-210 V-215 V-219 V-221 V-225 V-300 V-301, V-302 V-405 WCC-9 X-55 X-60 X-551 X-552 X-711 1AX, 1AX2 1R81 1X, 1X2 1X51 RC -486B, RS -102A RC -486C, RS -102D RC -501, RS -102B RC -414C KCS-70 11-467C 11-467C II -498C II - 62C VIII -295 I -414B 1-326B 1-414B RC -354H II -662C 1-423B RC -319B I -429B 1-423B I -441B RC -341, RC -341M RC -341C, RC-341CM RC -348E RC -351 E RC -348J RC -351D RC -348H, RC -421 RC -351C RC -386 RC -335D RC -348L RC -335D RC -335K RC -354 RC -331C RC -331B Record Player Wireless Record Player II -677C II -677C II - 680C II -683C 11-687C II - 683C II - 687C 11 - 683C - 694C II -444C 11 - 687C II -444C II -444C II - 14C II -124C - 124C 11-343C II - 392C Wireless Record Player 11 - 343C Refer to numerical listing.... RC -548 RC -547 II -761C II -761C RC -574 11-782C RC -555 RC -547A 11-799C 11-761C Refer to numerical listing.... Record Player RC -517 RC -540 I -249A II -654C II -656C RC -524 RC -517C RC -517H RC -572A RC -523 RC -582 RC -519 RC -522 II -658C II -668C 11-708C II -710C II -749C II - 753C II -756C II -756C RC -521 RC -573 11 -771C II -775C RC -573A 11 -775C RC -564 11-789C RC -564A RC -564 RC -564B RC -518 RC -518A RC -521B Carrying Case RC -473A RC -474D RC -1089B Added Resistor RC -1089C Added Resistor RC -1070A RC -1003A 11-789C II -789C II -789C I I -794C II -794C II -771C V - XIV II -524C II -546C VI - 59 VII - V VI - 59 VII - V VI - 61 II - 1C RC -1102, RC -1102A, RC -1102B, VII- RC -1102C 1 II - 1C RC -1003 RC -1104, RC -1104-1, RC -1104C VII- 13 1X52 RC -1104A, RC -1104A-1, RC -1104D VII- 13 1X53, 1X54, 1X55, 1X56. RC -1104B, RC -1104B-1, RC -1104E VII - 13 1X57 1X591 1X592 RC -1104A, RC -1104A-1, RC -1104D RC -1079K RC -1079L VVIIII-- 1137 VII- 17 Model 2-8-400, 2-B-401, 2-B-402, 2-B-403, 2-B-404, 2-B-405 2-BX-63 2-C-511 2-C-512 2-C-513 2-C-514 2-C-521 2C-522, 2C-527 2 -ES -3 2 -ES -31 2 -ES -38 2 -JS -1 2-R-51, 2 -R -51A, 2-R-52, 2 -R -52A 2S7ED 24-10 2T51 2T60 2T81 2 -US -7 2-X-61 2-X-62 2-X-621 2-XF-91 2-XF-931, 2-XF-932, 2-X F-933, 2-XF-934 2 -19 1935 Prod. 2-25 2-35 2-55 2-65 4QB 4QB3 4QB3X 4Q B4 4T 4T101 4T141 4X, 4X3, 4X4 5BT 5H 5H1, 5H2 5M 5QA5 5Q1 5"2 5U2X 55Q(4. 5QP., 5Q8 5Q12 5Q12A 5Q21 5Q22, 5Q27 5Q31 5Q31X 5Q55, 5Q56 5Q66 5T 5T1 5T4 5T5 5T6, 5T7 5T7 -O 5T8 5U 5X, 5XA 5XA3, 5XA4 5X2 5X3, 5X4 5X5- I 5X5 -W 6BK, 6BK6 6BT, 6BT6 6J, 6JM COMPLETE INDEX OF MODELS (Continued) Chassis No. or Description Vol. Page RC -1114 RC -1115 RC -1118 RC -1118A RC -1118B RC -1118C RC -1120, RC -1120B, RC -1120D RC -1120A, RC -1120C, RC -1120E RS -142 RS -142 RS -142 Record Player RC -1119 RC -1117D Record Player RC -1111, RS -141 KCS-45 KCS-45A KCS-46 & RC -1090 RC -1117A, RC -1117C RC -1080C RC -1080D RC -1085B RC -1121 VIII 1 VIII 5 VIII 9 VIII 9 VVIIIIII- 9 9 VIII 13 VIII 13 VVIIIIII- 1917 VIII 17 VIII 21 VVIIIVIIII--- 2253 3 VIII - 29 VI -325 VI -325 VI -353 VIII- 37 VIII - 41 VVIIIIII- 4431 VIII- 47 RC -1121A Record Player Record Player Record Player Record Player Record Player Record Player RC -440 RC -1071 RC -1071A RC -440A KCS-61 KCS-62, RC -1090 Record Player Record Player RC -1072 RC -315C VIII I-I-- I-I IIII----- 53 14A 2B 14A 17A 18A 15A 44C V- 1 V- 1 IlI---44C VVIIII--841988 I - 11B IIIIIII---211BIII VI --274B ll - 50C RC -325C II - 53C RC -325D II - 56C RC -366 II - 59C RC -396, RC -477 II - 62C RC -477A II - 70C RC -396B, RC -477B RC -396D RC -396E -Z II - 73C IIII RC1053, RC1053A, RC1053B.IV - 5 RC1053 RC1054 RC1054E IIVV-- IV - 5 8 XI RC -396 I I - 62C RC -477C II - 79C I - 29B I - 32B I - 35B I - 38B I - 42B I - 42B I - 42B I - 38B I - 45B I - 45B I - 49B I 45B RC -406A RC -406 II 81C II - 81C I - 55B Record Player IIII --535B Model 6K 6K1 6K2 2nd Prod. 6K3 6K10 6M 6M2 6QK8 6QP3 6QU 6QU3 6QV3 6Q1 6Q4 6Q4X 6Q7 6Q8 6Q33 6Q33X 6T 6T2 6T5 6T10 6T53, 6T54 6T64, 6T65, 6T71 6T72 6T74, 6T75, 6T76 6T84 6T86, 6T87 6X2 7K 7K1 7QB, 7QBK 7QK4 7QV5 7Q4 7Q4X 7Q51 7Q51 X 7T 7T1 7T103, 7T104 7T103B, 7T104B 7T111B 7T112, 7T122 7T112B, 7T122B 7T123, 7T124 7T123B 7T125B 7T132 7T143 7U 7U2 7X. 7X1 *7-1 *7-2 *7-3 *7-10 *7 11 *7-25 *7-26 *7-30 8BK, 8BK6 8BT, 8BT6 8BX5 8BX6 8BX54, 8BX55 8BX65 8841 8642 8643 8B46 8F43 8K, 8K1 8K11 8M 8M1 8M2 Chassis No. or Description RC -414B RC -1067 RC -414 RC -1054C RC -1054D RC -441 RC -441A RC -442 RC -414A RC -414B RC -1054A RC -1054B KCS-47, KCS-47T KCS-47A, KCS-47AT KCS-40B KCS-47A, KCS-47AT KCS-48, KCS-48T & RC -1090 KCS-48, KCS-48T & RC -1092 RC -1013 RC -496 RC -478B RC -601B RC -478A RC -502 RC -1055, RC -1055C RC -1055D KCS-47B KCS-47F KCS-47GF-2 KCS-47C KCS-47G, KCS-47GF, KCS-47GF-2 KCS-47C KCS-47G, KCS-47GF, KCS-47GF-2 KCS-47G KCS-47D KCS-48A, RC -1092 Alhambra I Alhambra 11 AR -1058 AR -742 AR -1059 AR -744 RC -1059, RC -1059A RC -1040C, RC -1040D RC -1059, RC -1059A RC -1040C RC -1069 RC -1069A RC -1069B RC -1069C RC -1037B RC -318 RC -320 RC -320A VII Vol. Page I- 60B I- 636 I - 64B I - 71B I - 77B II-- 8614B3 II- 81B IVI -- 7163C II - 62C IV- 18 IV - 18 II -107C II -111C II -118C II - 62C II - 76C IV - 11 IV - 14 I - 60B II -- 6846BB I - 64B VI -367 VI -367 VI 401 VI -367 VI -413 VI -413 II -122C I -113B I - 77B II -142C II -111C IV - 28 111C II -138C IV - 22 V 19 I -113B I - 77B VII - 99 VII - 99 VII - 99 VII - 99 VII - 99 VII - 99 VII - 99 VII - 99 VII - 99 VII -147 I - 64B I - 716 I -118B I - 75A I -103A I- 75A I - 65A I - 71A I - 67A I - 71A I - 75A I - 134B I - 134B IV- 37 IIVV-- 3473 IV - 46 IV - 33 IV - 33 IV - 33 IV - XI IV - 47 I - 113B I -139B II - 178C II -181C I I - 181C VIII COMPLETE INDEX OF MODELS (Continued) Chassis No. or Description Vol. Page 8M3 8M4 8PCS41 8QB, 8QBK 8Q1.15 -C, 8QU5-M 8Q1 8Q2 8Q4 8R71 8R72 8R74, 8R75 8R76 8T 8TC270 8TC271 8TK29 8TK320 8TR29 8TS30 8TV41 RC -321 RC -321A Projection Television Rec. RC -336 RC -443B RC -337 II -186C II -186C IV -365 II -206C II -196C II - 191C RC -443 RC -337A RC -1050 Change in Osc. Circuit RC -1060A RC -1060 RC -1060A II 196C II -201C IVV -- 4X9IV IV- 49 IV - 49 IV - 49 I -113B KCS-29A KCS-29A IV -513 IV -513 KCS-32A, KCS-32C, RK-135, RK-135A KCS-33A. RK-135A IV -467 IV -545 KKCCRSSK---321203.J5-KA1C. SK-C3S26-2,0RKK--2135,.IIVV -467 -271 KCS-25D, KCS-25E, RK-117A, RS -123A IV -207 8TV321 KCS-30. RC -616C, RC -616K IV -487 8TV323 KCS-30, RC -616B, RC -616J .IV -487 I - 139B 8T2 I -113B 8T10 I - 139B 8T11 . 8T241, 8T243, 8T244....KCS-28 8T270 KCS-29 IV -435 IV -513 I -139B 8U, 8U2 8V7 8V90 8V91 8V112 .8V151 8X53 8X71, 8X72 8X521 8X522 RC -615 RC -618, RC -618A RC -616A, RC -616H Alternate Speaker RC -616, RC -616F Alternate Speaker RK-121C & RS -123D RC -1064 RC -1070 Oscillation on FM RC -1066 RC -1066A IV - 57 IV - 59 IVV --5X9 VIVV --7X1 V IV- 81 IV- 97 IVV -- 9X9IV IV -105 IV - 105 8X541, 8X542, 8X544, 8X545, 8X546, 8X547.. RC -1065, RC -1065A to RC -1065D RC -1065F, RC -1065H IIVV--107 XI 8X681, 8X682 8-60 9BX5 9BX56 9EY3 9EYM3 9EY31, 9EY32 RC -1065. RC -1065A to RC -1065M RC -1061 Record Player RC -1059B, RC -1059C RC -1068 RS -132 RS -132 RA -79 V - 23 IV -109 I - 45A V - 27 V - 31 V - 35 V- 37 V - 39 9EY35. 9EY35U, 9EY36, 9EY36U 9JY 9JYM 9K 9K1 9K2 9K3 9K10 9M1 9M2 9PC41 9QK 9Q1 9Q4 9Q53 9SX-1 to 9SX-8 9T 9TC240 9TC245 9TC247, 9TC249 9TC272, 9TC275 9TW309 9TW333 9TW390 RS -132, RS -132A Record Player Record Player V 41 V - 43 V 45 I 167B I 172B I 179B I -172B I 1796 RC -357 RPCro-j3e5c7tAion Television Rec... II II V 217C -222C - 123 RC -444A RC -444 RC -478 RC -614 II -227C II -227C II -232C V - 47 II - 237C I - 179B KCS-28B KCS-34B KCS-34, KCS-34B KCS-29C KCS-41, RK-135C KCS-30, RC -616N KCS-31, RC -617A V - 143 V 161 V 161 V -235 V-267 V -287 V -309 Model 9TX-1 to 9TX-5 9TX-21, 9TX-22 9TX-23 9TX-31 9TX-32 9TX-33 9TX-50, 9TX-50M 2nd Prod. 9T57 9T77, 9T79 9T89 9T105 9T126, 9T128 9T147 9T240 9T246 9T256 9T270 9U. 9U2 9W51 9W78 9W101 9W102 9W103 9W105 9W106 9X 9X-1 to 9X-4 9X-6 9X-11 to 9X-14 9X561 9X562 9X571 9X572 9X641 9X642 9X651 9X652 9Y7 9Y51 9Y510 9Y511 +99--21 9-3 9-15 9-16 9-18 9-25 9-40 9-54 9-55 *9-56 10K 10K1 10K11 10Q1 10T 2nd Prod. 10T11 10X 10-35 10-50 10-51 10-69 10-70 11QK 11QU 11Q4 11X1 12AX, 12AX2 12QK 12QU 12Q4 12X Chassis Nb. or Description Vol. Page RC -401 Il 239C RC -403 RC -403A II 239C II -239C RC -405 RC -405A RC -405B RC -435 RC -454 KCS-49, KCS-49T KCS-49A, KCS-49AT Change in Parts List II 241C II -241C I I - 241C II -243C II -246C VI -437 VVIII--437 V KCS-60. KCS-60T, RC -1092 VI -455 KCS-49B, KCS-49BF, KCS-49BF-2 VII -169 KCS-49C, KCS-49CF, KCS-49CF-2 KCS-60A. RC -1092 KCS-28, KCS-28A KCS-28C, KCS-38 KCS-38C KCS-29 VII - 169 VII - 191 V -143 V - 171 V -217 V -235 I - 179B RC -1079D RC -1084A RC -618B RC -618D RC -618B V - 53 V - 57 V - 65 V- 75 V - 65 RC -618C RC -622 VV - 7695 Correction to Parts List...VII - V RC -350 RC -350 RC -350A RC -350A RC -1079B RC -1079C Alternate Speaker RC -1079, RC -1079E RC -1079A, RC -1079F Alternate Speaker RC -1080 RC -1080A RC -1085 RC -1085A RC -1057B RC -1077 RC -1077A, RC -1077C Alternate Speaker RC -1077B Florenza Borgia I I II -248C II -248C II -248C II -248C V - 89 VVI -- 89 XI V - 91 V - 91 VI - XI V - 95 V - 95 V - 97 V - 97 V - 101 V - 105 VVIII -- 67 V VI - 71 I - 103A I - 112A Borgia I I - 107A I -107A AR -745 AR -776 AR -1050 Borgia I - 71A I -180A I -112A I - 112A AR -775 AR -1055 AR -775A I 180A I - 112A I - 180A I - 196B I -201B I - 196B RC -337B II -286C I - 196B I -201B I - 196B RC -1001, RC -1001B II -291C I - 45A AZ -781 AZ -1071 AZ -773 AZ -1073 RC -335C RC -335E RC -335C RC -1001A RC -1001C RC -338 RC -338A RC -338 RC -1001B, RC -1022A 239A 46A 47A 48A II -302C II -302C II -302C II -291C II -291C II -313C II -313C II - 313C II -291C IX COMPLETE INDEX OF MODELS (Continued) Model Cl-assis No. or Description 12X2 412-1 12-2 12-15 12-25 13K 14AX, 14AX2 14BK 14BT-1 14BT-2 14X. 14X2 15BP-1, -2, -4, -6 15BP-3, -5 15BP-7 15BT 15-E; 15-E-1 15K 15U 15X (2nd Prod.) 15-1 1-16 16K 16T2 16T3 16T4 16T152 16X-1, 16X-2 16X-3 16X-4 16X-11 16X-13 16X-14 t17 17K RC -1001B Cromwell Tuscany AZ -774, AZ -1077 RC -1001E RC -525B RC -525 RC -525A RC -1001D RC -527 RC -527A RC -527C RC -526 RS -139A RC -462 RC -1011 Hyperion AR -924 RC -509C RC -509B, RC -509J RC -509A. RC -509H RC -509. RC -509F KCS-47E RC -462A RC -4626 RC -462C RC -1000 RC -1000A RC -1000B AR -927 RC -512 17T-150, 17T-151 17T-153, 17T-154, 17T-155, 17T-160 17T-162 17T-163 KCS-66C KCS-66 KCS-66A KCS-66C 17T-172. 17T-173, 17T-174 KCS-66A 17T -172K, 17T -173K, 17T -174K KCS-66D 17T-200, 17T-201, 17T-202, 17T-211, 17T-220 KCS-72 17T-250DE, 17T-261DE KCS-74 1-18 AR -936 1-18 D.C. AR -891 18T RC -511 19K RC -512A 1-20 AR -918 1-21 AR -1258 21T-159, 21T-165 21T-159DE, KCS-68E 21T-166DE, 21T-174DE, 21T-175DE, 21T-178DE, 21T-179DE KCS-68F 21T-176, 21T-177, 21T-178, 21T-179 .... KCS-68C 21T-197DE KCS-68H, RC -1111A, RS -141A 21T-207, 21T -207G, 21T-208, 21T-217, 21T-218, 21T-227, 21T-228, 21T-229 KCS-72A 21T-242 KCS-72D-1, RC -1117B 21T-244 KCS-72D-2, 1111B, RS -141C 1-22 t24 24BT- 1, -2 f25 t25 A.C. 25BK 25BP 25BT-2 25BT-3 25X AR -1265 AR -804 RC -1004F AR -919 AR -919, UP -971 RC -1004B RC -527D. RC -1020 RC -1004A RC -1004B RC -1003 Vol. Page II -291C I- 57A 1- 57A 1- 58A I- 59A I -225B 11-324C II -328C II 328C II -328C 11-324C II -333C II -333C II -333C II -335C VIII - 59 I -236B 1-241B II -337C II -341C II- 61512AA II -344C II -344C II -344C 11 -351C V11-204 11 337C II -337C 11 -355C II -357C 11-357C 11-357C I- 67A II -365C .VIII- 77 .VII - 227 VII -227 . VIII - 77 VII -227 VII -227 VIII -109 VIII - 141 1 - 71A 1- 74A II -372C II -377C I - 75A I - 92A VIII 173 VIII - 173 .VIII - 173 VIII -209 VIII -229 VIII -261 VIII -261 I - 92A I 98A 11-399C 1- 103A I -105A 11-404C 11- 83C 11-407C II -404C 11 - 1C Model t26 26BP 26X-1 26X-3 26X-4 27K 1-28 1-28 D.C. 28T 28X 28X-5 29K 29K2 t30 t30A t30A D.0 1-32 1-32 D.C. 1-33 1-33 D.C. 1-33 D.C. 34X 35X 36X 36X 40X-30 40X-31 40X-50 to -57 40X-52 (2nd Prod.) 40X-55 (2nd Prod.) 1-41 t41 D.C. 1-42 1'44 45-E Series 45-EY 45- EY- 1 45- EY-2 45- EY -3 45- EY-4 45- EY -15 45- EY-26 45-J 45-J-2 45-J-3 45-W-9 45-W-10 45X 45X-1, 45X-2 45X-3, 45X-4 45X-5, 45X-6 45X-11, 45X-12 45X-13 45X-16, 45X-17 45X-18 45X-111, 45X-112 45X-113 1-46 46 D.C. 46X-1, 46X-2 46X-3 46X-11, 46X-12 46X-13 46X-21 46X-23 46X-24 t47 1-48 1-50 t51 1-51 D.C. 54B-1 54B -1N 54B-2 54B-3 54B-5 54B-6 55F Chassis No. or Description Vol. Page RC -559 RC -1014 I - 98A II -414C II -416C RC -1014A RC -1014B 11 416C II -416C RC -567 AR -920, UP -972 11-421C I -112A AR -920, AR -969 RC -569 I -107A II -A25r, RC -1002 II -429C RC -1002A II -429C RC -570 II -434C RC -570C, RC -570D II -434C AR -921 I -122A AR -906, AR -926 I 124A AR -912 I - 12=',A AR -925 1- 131A AR -928 I -131A AR -784 I 143A (110 V.) 1- 147A (220 V.) I - 145A RC -1001E, RC -1022 II -324C RC -1001C, RC -1022A 11-291C RC -462A RC -1011 11-337C II -341C RC -405C RC -405D RC -436 RC -453 RC -453 AR -782 II- 243C II- 243C II- 243C II -246C II -246C 1-158A AIR -871 AR -594 RC -435A 1-161A I - 60A I -164A II -475C RS -132, RS -132A, RS-132F.VI - 73 RS -132F RS -138A, RS -138H VVII-- 7773 RS -138A, RS -138F, RS -138H VII- 23 RS -136, RS -136A, RS-136C.VI - 79 RS -136, RS -136A, RS -136C, RS -136E RS -140 VII - 25 VII- 29 RS -132H RS -138L. RS -138M VI - 73 VII - 31 Record Player VI - 81 Record Player Record Player VI - 83 VI - 84 RC -1095A RC -1096A, RC -1096C VVII-- 8895 RC -459L II -477C RC -457. RC -457A II -481C RC -457E 11-481C RC -457D II -484C RC -459, RC -459D, RC -459T . II -477C RC -459A, RC -459E RC -459M 11-477C II -486C RC -541C 11-489C RC -459J II -486C RC -459K II -486C AR -596 I - 164A AR -597 I -169A RC -459B, RC -459F II -491C RC -459C, RC -459H II -491C RC -456 II -494C RC -456A II -494C RC -461B 11-496C RC -461A II - 4C6C RC -461 AR -1147 II -496C I -171A 1- 60A AR -910 Similar to Rad. 17 AR -904 Similar to Rad. 18 1- 74A RC -589, RC -589U RC -589D IIIIII-- 2299 RC -589A, RC-589UA III - 29 RC -589B, RC-589UB III - 29 RC -1047 RC-589UE IIIIII --33 III RC -1004E III - 37 X COMPLETE INDEX OF MODELS (Continued) Model 55AU, 55U 55X 56X, 56X-2, 56X-3 56X-5 56X-10 56X-11 58AV, 58V 59AV-1, 59V-1 1'60 t61-1, 61-2, 61-3 1'61-5 t61-6, 61-7 1.61-8, 61-9 f61-10 1'62 1'62-1 63E, 63EM 1'64 64F-1, 64F-2 64F-3 65AU 65BR-9 65F 65U, 65U-1 65X-1, 65X-2 65X-8, 65X-9 t66 66BX 66E 66ED 66E-1 66X-1, 66X-2 66X-3, 66X-7, 66X-8, 66X-9 66X-11 66X-12 2nd Prod. 66X-13 t67 67AV-1 67M, 67M-1, 67M-2, 67M-3 67V-1 68R-1, 68R-2, 68R-3, 68R-4 75X-11 75X-12 75X-14 75X-15 75X-16, 75X-17, 75X-18, 75X-19 t75ZU 2nd Prod. t76ZX -11, 76ZX-12 77U 77V-1 77V-2 1.80 t82 84BT, 84BT-6 85BK, 85BT 85BT-6 85E 85K 85T 85T-1 85T-2 85T-5 85T-8 186 86BK 86BT 86E, 86K, 86K-7 86T, 86T-1 86T-2 86T-3 86T-4 86T-6 Chassis No. or Description RC -1017 RC -1003C RC -1011, RC -1011A, RC -1011B RC -1023 RC -1023B RC -1023A RC -604 RC -605 AR -954 RC -1011, RC -1011A, RC -1011B RC -1023 RC -594D RC -1034, RC -1064 RC -1023B, RC -1023C AR -982 RC -1017A RS -127 AR -894 RC -1037 RC -1037A RC -1017A, RC -1017B RC -1045 RC -1004E RC -1017A. RC -1017B RC -1034, RC -1064 RC -1034 AR -598 RC -1040, RC -1040A, RC -1040B RS -126 RS -126 RS -126 RC -1038 RC -1038A RC -1046A, RC -1046C RC -1046 RC -1046D RC -1046B, RC -1046E AR -1168 RC -606, RC -606C RC -606, RC -606C RC -608 RC -1050, RC -1050A, RC -1050B RC -1050. RC -1050A RC -1050A, RC -1050B RC -1050A RC -1050B RC -1063A RC -1063B RC -1058, RC -1058A RC -1057A RC615 RC -606C RC -316 RC- 315 RC -315B Vol. Page III - 39 II -520C III - 45 III 47 III 47 III 49 III 51 III 55 I -176A III- III III III- 63 III IIIII I- IV III III-I 176A Ill III 65 I -180A IIIIII-- 6677 III - 73 IIIIIIIII--- 776139 IIIIII- 7755 I -187A III - 7) IIIIII --03 IV III - 85 III 87 III 87 III IIIIII-- 8899 IV III - 89 I 191A III - 91 I -297B III - 91 III - 99 IV - 127 IV - 127 IV -127 IV 127 IV - XII IIVV--129XII IV 131 IV 133 IV 135 IV 137 215A 215A 315B 319B 323B 3269 330B 333B 330B 333B 336B 339B 215A 342B 3428 -346B 346B 351B 351B 354B -564C Model 86T-44 86X 86X-4 87EY 87K 87K-1, 87K-2 87T 87T-1 87T-2 87X, 87Y 88K 88U, 88U-2 94BK 94BK -1 94BK-2 94BP-4 Series 94BP-61, 94BP-62, 94BP-64, 94BP-66, 94BP-80, 94BP-81 94BT 94BT-1 94BT-2 94BT-6 94BT-61 94X 94X-1, 94X-2 95FT 95T, 95T-1 95T-5 95T-5 L.W. 95X 95XL 95X-L.W. 95X-1 95X-6 95X-11 96BK-6, 96BT-6 96E 96K 96K2 96K5, 96K6 96T 96T1 96T2 96T3 96T4, 96T5 96T6 96T7 96X-1 to 96X-4 96X-5 96X-11 to 96X-14 97E 97K 97KG 97K2 97T 97T2 97X 97Y 98EY 98K 98K2 98T 98T2 98X, 98YG 99K 99T 100 100 100-A 100-B 101 102 102 103 103 104 104 D.C. 105 Chassis No. or Description RC -319 RC -315A RC -319 RC -333 RC -333B RC -390 RC -410 RC -407, RC -407B RC -333 RC -333B RC -390 RC -333A RC -333C RC -332 RC -340 RC -315C RC -323 RC -348 RC -348F RC -345D RC -345E RC -345F RC -345C RC -381A RC -381 RC -392 RC -348C RC -351L RC -351 RC -351B RC -351L RC -348A RC -348D RC -351 RC -351B RC -399 RC -399A RC -351L RC -400 RC -490 RC -400A RC -351A RC -351F RC -351A RC -351K RC -351A RC -351K RC -349 RC -352A RC -352 RC -335A RC -386A RC -386A RC -352D RC -352 RC -335B RC -3351-i Loudspeaker UZ-915 Loudspeaker UZ-1076, UZ-1078 Loudspeaker UZ-783 Loudspeaker UZ-913 Loudspeaker UZ-749 Loudspeaker UZ-914 Loudspeaker Loudspeaker UZ-1082 Vol. Page I -354B I 358B I 361B I 364B I -346B I-3688 I -346B I -351B I -368B I 364B I 372B I -372B II -574C II 576C II -578C II -585C II -582C II 574C II 576C II -578C II -587C II -589C II -591C II -591C II - 50C II 595C II -597C II -601C II 603C II 603C II -608C II -605C II 603C II 605C II -610C II 597C II -614C II -619C II 627C II -614C II -597C II -597C II 619C II 627C II 632C II -632C II 614C II -635C II 637C II -635C II 627C II 619C II 627C II -614C II -627C II -614C II -638C II -640C II -640C II -644C II -409C II -409C II -649C II 640C II 644C II -644C I -405B I -228A I -228A I -228A I 405B I 419B I- 228A I -405B I -228A I 229A I 229A I -231A COMPLETE INDEX OF MODELS (Continued) XI Model Chassis No. or Description Vol. Page 106 110 110K, 110K-2 111 Loudspeaker UZ-642 RC -513 I 233A I -453B II -670C 1-453B 111K RC -513A II - 673C 112, 112-A I -457B 114 I 279B 115 I-4538 117 I-4628 118 1-465B 119 1-47113 120 I -292B 121, 122 124 I 474B I-292 125 I 484B 126-B 127 I 488B I -491B 128 I 497B 128-E 135-B 140 141, 141-E 142-B 143 I 504B I - 122B I -509B I -509B I-5178 I -520B 210 I 4530 211 I 465B 211K 214 220 221 222 223 224 RC -571 II 779C 1-462B I -530B I -474B I -530B I -533B I -497B 224-E 225 226 235-B 504B 1 1 484B I -497B 1-1228 236-B 240, 240-E 241-B 242, 243 2CO3 261 262, 263 280 281 300 301 310 320, 321 322 322-E 327 330, 331 340, 340-E 341, 342 380, 380 -HR 381 1500, 501 RC -464 t510 2nd & 3rd Prod. RC -459 RC -1003B, RC -1003D 1-511 2nd Prod. RC -464A RC -1003B f512, 513 RC -464B t515 2nd Prod. RC -1000C RC -1014A 1-516, 517 RC -1001C 1-520 t522 RC -1003D RC -1001C, RC -1022A t526. 527 RC -1001E 610V-1 RC -610C 610V-2 RC -610, RC -610C 612V-1, 612V-3, 612V-4 RK-121 & RS -123 621TS 630TCS 630TS KCS-21-1 KCS-20B-1, KCS-20D-2 KCS-20A-1, KCS-20C-2 . 1- 53713 1-509B 1-5178 I -620B I -378B 1-540B I - 550B 1-559B 1I--450754B8 I -453B I -4748 I -497B I -504B 1-491B I - 576B I - 5Q9B I -520B I -550B I -559B II -481C II-II -486C 1C II-II -486C 1C 11- 486C I I - 357C II -416C IIII --2911CC II -291C II -324C III - 145 II 1 - 145 111- 153 III - 199 III - 279 III -235 641TV KCS-25A-1, KCS-25C-2, RK-117A, RS -123A IV 207 648PTK 648PV Proj. Telev.-Radio Comb... IV 295 Proj. Telev.-Radio- Phono. Comb. IV 295 690 Rad. 82 with Aut. Record Changer 710V-2 RC -613A IV 177 Chassis No. or M Description Vol. Page 711V-1, 711V-2, 711V-3 RK-117, RS -123 IV- 1'3 721TCS KCS-26A-1. KCS-26A-2 IV -389 721TS 730TV-1 KCS-26-1, KCS-26-2 KCS-27-1. KCS-27-2, IV 389 RC -610A IV -417 730TV-2 KCS-27-1, KCS-27-2, RC -610B IV -417 741PCS Proj. Telev. Receiver IV -365 810K, 810K-1 I -581B 810T 810T-4 811K, 811T 812K 812X 813K 816K 910KG 911K 9606 9800 9820 9844 41918 1 -58113 I -585B I -589B 1-595B I -601B I -606B I -612B RC -335F I -444C RC -335 1-804C Beat Frequency Osc. 1-623B Automatic Record Changer..I -434B Automatic Record Changer..I -435B Automatic Record Changer.. I - 698C Victrola Junior I -572C 930409 Series Automatic Record Changer.VIII- 63 960001 Series 960015 Series Automatic Record Changer. I II - 169 Automatic Record Changer. I I I- 179 960260-1, -2, -3, -4 Automatic Record Changer.III- 187 960276 960282 Series Automatic Record Changer. IV - 195 Automatic Record Chang3r.VI- 129 960284-1, -2 Automatic Record Changer.VI- 145 960285-1 Automatic Record Changer.VI- 163 MISCELLANEOUS Ballast Tube Data Barkhausen Oscillation 1, VIVII--- XIV XIIXII Broadcast Interference-KRK-5 & KRK-7, R -F Units Cabinet Touchup Console Loop Antennas Corona Interference -19" Models Correcting Pix I -F Response Crystal Pickup Tabulation Defective 6F6G Tubes Deflection Yokes Dial Drive Cord Tabulation External Antenna Connection Fixed Composition Resistor Stock No. Code V, VI - XII IV - XVI IV- XVII VVVIIIII---XVIIXVI 1VI,I1III1--- VIXIIII XII VIVII --XVI V III - V IV - XVII VII - V Focus Coil Troubles Fuse Data High-pass Filter High Voltage Arcs at Kinescope V XI VI -XVIII 1,11 - XV VVIIII -- V V I -F Harmonic Interference I -F Transformers -Type 970441 Index to TV Circuit Description Ion Trap Magnets Matching Co -ax to Balanced Line Model vs. Record Changer Oscillator Switch Wafers VVI - XXVIII IV - XVI VVIVVVVVVIIIIII--------XVVIVXIIIVVXVIIII Phonograph Motors (Governor Type) II -703C Phonograph Motors (Induction Disc & Universal) 1-248A Phonograph Motors -Tabulation R -F Unit -Alignment Hints R -F Unit -Interchangeability R -F Unit -Oscillator Tracking R -F Unit-KRK-5. KRK-7, Prod. Changes.. Sales Name vs Model Number Socket Wrench for Pickup Styles Substitute 12" PM Speakers Television Calibrators Television Interference. Causes & Cures Television Receiver Cross-reference Vibrator Powered Receivers Wave Trap Data 60 cycle Buzz in Sound 60 to 50 cycle Phono. Conversion 1V,1I1-- VII - XIII VXIIIII VII - IX V, VI - XIII VII - XX IV - XVI VVI,VVIIVVIIIIIII-------XXXXXVVIIVVIIIIXIXII VIVI-- XVI XV XII INDEX TO CHASSIS NO'S Identification numbers beginning with R (RC, RS, etc.) are used with all radios and some television receivers. Identification numbers beginning with K (KCS, KRS, etc.) are used exclusively with television. Chassis No. RK-117 RK-117A RK-121 RK-121A RK-121C RK-135 RK-135A RK-135C RK-135D RC -3.15B RC -315C RC -318 RC -319 RC -319B RC -320 RC -320A RC -321 RC -321A RC -323 RC -325C RC -325D RC -331 RC -331A RC -331B RC -331C RC -332 RC -333 RC -333A RC -333B RC -333C RC -335 RC -335A RC -335B RC -335C RC -335D RC -335E RC -335F RC -335H RC -335K RC-335KR RC -336 RC -337 RC -337A RC -337B RC -338 RC -338A RC -339 RC -340 RC -341 RC -341C RC -345C RC -345D RC -345E RC -345F RC -345H RC -348 RC -348A RC -348C RC -348D RC -348E RC -348F RC -348H RC -348J RC -348L RC -349 RC -350 RC -350A RC -351 RC -351A RC -351B Model 711V1, 711V2, 711V3, R -FBI -F Chassis 641TV, 8TV41 Radio R -FBI -F Chassis 612-V1, 612V3, 612V4, R -FBI -F Chassis 648 PTK, 648PV Radio R -FBI -F Chassis 8V151, R -FBI -F Chassis 8TR29, 8TK29 Radio Section 8TR29, 8TK29, 8TK320 Radio Section 9TW309 Radio Section TA128, TA129, TA169 Radio Section 86T6 5Q1 8M 87K2, 87T2 U-106 8M1 8M2 8M3 8M4 95T, 95T1 5Q2 5Q2X HF-8, HF-8A HF-6 U-134, U -134A U-132 94X 94BK, 94BT 94BT6 94BT1, 94BK1 94BT61 911K 98K 99K 11Q4, 11QK U-126, U-128 11QU 910KG 99T U-129 U-30 8QB, 8QBK Tuner Unit 8Q1 Tuner Unit 8Q4 Tuner Unit 10Q1 Tuner Unit 12Q4, 12QK Tuner Unit 12QU Tuner Unit H F-1 94X-1, 94X-2 U-111 U-112 95X-1 95X 95XL 95XLW U-104 95T5 96T 96E 96T1 U-115 95T5LW U-123 (1 band) U-121 U -127E 97X 9X to 9X-4 9X6, 9X-11 to 9X-14 96K, 96T2 97E, 97KG, 97T 96K2, 96T3 RADIO CHASSIS Chassis No. RC -351C RC -351D RC -351E RC -351F RC -351K RC -351L RC -352 RC -352A RC -352B RC -352C RC -352D RC -354 RC -354A RC -354B RC -357 RC -357A RC -357J RC -357K RC -366 RC -381 RC -381A RC -386 RC -386A RC -386B RC -390 RC -392 RC -394 RC -396 RC -396B RC -3960 RC -396E RC -399 RC -399A RC -400 RC -400A RC -401 RC -403 RC -403A RC -404A RC -405 RC -405A RC -405B RC -405C RC -405D RC -406 RC -406A RC -407 RC -407B RC -408 RC -408A RC -408C RC -410 RC -414 RC -414A RC -414B RC -414C RC -415 RC -415A RC -415B RC -415C RC -415D RC -416 RC -416A RC -418 RC -418A RC -418B RC -421 RC -425 RC -425A RC -425D RC -427 RC -427A Model U-124 U -122E U-119 97K 97K2, 97T2 96E2, 96K5, 96)(6, 96T7 98EY, 98X, 98YG 97Y UY-122E UY-124 98T2 U 130 H F-4 H F-2 9M1 9M2 M-50 M-60 5Q4 95X-11 95X-6 U-125 98K2, 98T U-25, U-26 94BK2, 94BT2 96BK6, 96BT6 Tuner Unit M-70 Tuner Unit 5Q5, 5Q55, 5Q56 5Q8 5Q12 5Q12A 96T4, 96T5 96T6 96X-1 to 96X-4 96X-11 to 96X-14 9TX-1 to 9TX-5 9TX-21, 9TX-22 9TX-23 U-8 9TX-31 9TX-32 9TX-33 40X-30 40X-31 5X5 -W 5X5.1 94BP-1 Series (94BP61, -62, -64, -66, -80, -81) 94BP-1 (2nd Prod.) (94BP-61, -62, -64,-66 BT -40 BT -42 BK-42 94BP4, -B, -C, -R 6QU 6Q7 6Q8, 6QK8 U 50 K-60 K-80 K-60 (Loop), K-62 K-80 (Loop), K-81, K-82 K-80 (Loop) T-64, T-65 T-80 T-55, T -55-S, T-56 K-50 U-10 U-123 (2 bands) T-60 U-12 T-62 TRK-12 Radio Tuner Unit TRK-9 Radio Tuner Unit IChassis No. RC -427F RC -427G RC -429 RC -435 RC -435A RC -436 RC -440 RC -440A RC -441 RC -441A RC -442 RC -443 RC -443B RC -444 RC -444A RC -449 RC -453 RC -454 RC -455 RC -456 RC -456A RC -457 RC -467A RC -457D RC -457E RC -459 RC -459A RC -459B RC -459C RC -459D RC -459E RC -459F RC -459H RC -459J RC -459K RC -459L RC -459M RC -459T RC -461 RC -461A RC -461B RC -462 RC -462A RC -462B RC -462C RC -464 RC -464A RC -464B RC -465 RC -465A RC -472F RC -473A RC -474D RC -476 RC -477 RC -477A RC -477B RC -477C RC -478 RC -478A RC -478B RC -482B RC -482C RC -486B RC -486C RC -490 RC -496 RC -497 RC -498 Model TRK-120 Radio Tuner Unit TRK-90 Radio Tuner Unit TRK-5 Radio Tuner Unit 9TX-50, 9TX-50M 45E, 45E -M, 45E -W 40X-50 to 40X-57 4QB 4QB4 6Q1 6Q4 6Q4X 8Q2 8QU5-C, 8QU5-M 9Q1 9QK BK-41, BT -41 40X-52, 40X-55 (2nd Prod.) 9TX-50, 9TX-50M (2nd Prod.) BP -55, -56, -85 46X-11, 46X-12 46X-13 45X-1, 45X-2 45X-1, 45X-2 (2nd Prod.) 45X-5, 45X-6 45X-3, 45X-4 45X-11, 45X-12 45X-13 46X-1, 46X-2 46X-3 45X-11, 45X-12 (2nd Prod.) 45X-13 (2nd Prod.) 46X-1, 46X-2 (2nd Prod.) 46X-3 (2nd Prod.) 45X-111, 45X-112, Radiola 510 45X-113 45X 45X-16, 45X-17 45X-11, 45X-12 (3rd Prod.) 46X-24 46X-23 46X-21 15X 16X-1, 16X-2, 36X 16X-3 16X-4 Radiola 500, 501 Radiola 511 Radiola 512, 513 Radiola P-5 Radiola P-5 T-63 X-55 .X-60 K-105 5Q5 (2nd Prod.), Q18 5Q6 5Q8 (2nd Prod.) 5Q66 9Q4 7Q4 7QK4 U-9 U-9 (2nd Prod.) U-44 Tuner Unit U-45 Tuner Unit 96X-5 7QB, 7QBK Tuner Unit K-50 (2nd Prod.) U-20 Chassis No. RC -498A RC -498B RC -498E RC -498F RC -501 RC -501A RC -502 RC -507 RC -507A RC -507B RC -507C RC -507D RC -507F RC -507H RC -507J RC -507K RC -507L RC -507N RC -507U RC -508 RC -509 RC -509A RC -509B RC -509C RC -509F RC -509H RC -509J RC -511 RC -512 RC -512A RC -513 RC -513A RC -514 RC -517 RC -517C RC -517F RC -517H RC -517J RC -518 RC -518A RC -519 RC -521 RC -521B RC -522 RC -523 RC -524 RC -525 RC -525A RC -525B RC -526 RC -527 RC -527A RC -527C RC -527D RC -529 RC -529A RC -529D RC -529H RC -530 RC -531 RC -538B RC -538C RC -539 RC -539D RC -539E RC -540 RC -541C RC -544 RC -547 RC -547A RC -548 RC -551 RC -555 RC -559 RC -561 RC -561A RC -561C RC -563A RC -563B RC -563C XIII INDEX TO CHASSIS NO'S (Continued) RADIO CHASSIS (Continued) Model U-40 U-42 Tuner Unit U-43 K-61 U-46 Tuner Unit K-130 Tuner Unit 7Q4X Q22, Q22A, Q32, Q121 (EM) Q25 QK23 QU2C QU2M QU3C QU3M Q26 Q27 QU52C QU52M Q121 (PM) Q24 16T4 16T3 16T2 16K 16T4 (2nd Prod.) 16T3 (2nd Prod.) 16T2 (2nd Prod.) 18T 17K 19K 110K, 110K2 111K Q20, Q21 V-100 V-105 Radiola R -560P V-135 Radiola R -566P V-300 Tuner Unit V-301, V-302 Tuner Unit V-200 V-205 V-405 V-201 V-170 V-102 14BT-1 14BT-2 14BK 15BT 15BP-1, -2, -4, -6 15BP-3, -5 15BP-7 25BP QB2 QB1, QB11, QB12 Tuner Unit QB6 QB9 Tuner Unit QU5 Tuner Unit Q44 Q30 Q31 Q33 QB-3 Q34 V-101 45X18 BP -10 V H R-207 VHR-407 VHR-202 QU7, QU8 Tuner Unit VHR-307 Tuner Unit 26BP Q16 Q-17 Q -16E QB5, QB55 Q12 Q12 Chassis No. RC -563D RC -563E RC -563F RC -563K RC -564 RC -564A RC -5648 RC -566 RC -566A RC -566B RC -567 RC -568 RC -568A RC -568B RC -569 RC -570 RC -570C RC -570D RC -571 RC -572A RC -573 RC -573A RC -574 RC -582 RC -585 RC -589 RC -589A RC -589B RC -589D RC -589U RC-589UA RC-589UB RC-589UE RC -592 RC -594C RC -594D RC -601 RC -601A RC -601B RC -601D RC -601E RC -602 RC -602A RC -602B RC -604 RC -605 RC -606 RC -606C RC -607 RC608 RC -610 RC -610A RC -610B RC -610C RC -612 RC -613A RC -614 RC -614C RC -614D RC -615 RC -616 RC -616A RC -616B RC -616C RC -616F RC -616H RC -616J RC -616K RC -616N RC -617A RC -618 RC -618A RC -618B RC -618C RC -618D RC -620A Model Q12 Q11 Q11 QB55X V-215, V-221 V-219 V-225 Q14, Q15 QU56C, QU56M Q14E, Q15E 27K QU51C, QU51M QU55 QU61 28T 29K 29K2 29K2 (2nd Prod.) 211K V-140 V-209 V-210 VHR-212 V175 Q36 54B1 5462 54B3 54B1 -N 54B1 2nd Prod. 54132 2nd Prod. 54B3 2nd Prod. 54B6 Q23 Q10, Q10A, Q10.2, Q10A-2, Q10-3, Q110 Radiola 61-6, 61-7 Q122 (EM) Q122X (EM) 7QV5, QU68 Q122 (PM) Q122X (PM) Q109 Q109X QU62 58V, 58AV 59V1, 59AV1 67V1, 67AV1 67V1, 67AV1 2nd Prod., 77V2 QB60 68R1, 68R2, 68R3, 68 R4 610V1, 610V2 730TV1 Radio Section 730TV2 Radio Section 610V1. 610V2 2nd Prod. QB-13 Tuner Unit 710V2 9Q53 9QV5 R -FBI -F Chassis 9QV5 R -FBI -F Chassis 77V1, 8V7 8V112 8V91 8TV321 Radio Section 8TV323 Radio Section 8V112 2nd Prod. 8V91 2nd Prod. 8TV321 2nd Prod. Radio Section 8TV323 2nd Prod. Radio Section 9TW333 Radio Section 9TW390 Radio Chassis 8V90 8V90 2nd Prod. 9W101, 9W103 9W105 9W102 4QV8C R -FBI -F Chassis Chassis No. RC -620B RC -620C RC -620D RC -622 RC -1000 RC -1000A RC -1000B RC -1000C RC -1001 RC -1001A RC -1001B RC -1001B RC -1001C RC -1001D RC -1001E RC -1002 RC -1002A RC -1003 RC -1003A RC -1003B RC -1003C RC -1003D RC -1004A RC -1004B RC -1004D RC -1004E RC -1004F RC -1004H RC -1011 RC -1011A RC -1011B RC -1013 RC -1014 RC -1014A RC -1014B RC -1017 RC -1017A RC -1017B RC -1020 RC -1020B RC -1022 RC -1022A RC -1023 RC -1023A RC -1023B RC -1023C RC -1034 RC -1035 RC -1037 RC -1037A RC -1037B RC -1038 RC -1038A RC -1040 RC -1040A RC -1040B RC -1040C RC -1040D RC -1044 Model Q641 (50/60 cy.) Q641 (25 cy.) 4QV8C R -FBI -F Chassis 9W106, A106 16X11 16X13 16X14 Radiola 515 10X 11X1 12X, 12X2 10X (2nd Prod.) 12AX, 12A2, 35X, Radiola 516, 517, 522 14X, 14X2 14AX, 14AX2, 34X, Radiola 526, 527 28X 28X5 lx, 1X2, 25X 1AX, 1AX2 Radiola 510 (2nd Prod.), 511 (2nd Prod.) 55X Radiola 510 (3rd Prod.), 520 25BT2 25BK, 25BT3 Radiola B-52 55F, 65F 24BT1, 24BT2 Radiola B-50 15X (2nd Prod.), 36X (2nd Prod.) 56X2, 56X3, Radiola 61.1, 61-2, 61-3 56X, 56X2, 56X3, Radiola 61.1, 61-2, 61-3 2nd Prod. 56X, 56X2, 56X3, Radiola 61-1, 61.2, 61-3 3rd Prod. 6X2 26X1 26X3. Radiola 515 (2nd Prod.) 26X4 55U, 55AU 65U, 65AU, 65U-1, Radiola 62.1 65U, 65AU (50 cycle) 25BP (2nd Prod.) Radiola P-5 (2nd Prod.) 34X (2nd Prod.) 12X (2nd Prod.), 35X (2nd Prod.), Radiola 522 (2nd Prod.) 56X5, Radiola 615 56X11 56X10, Radiola 61-10, Postone (PX) 61.10 Radiola 61-10 2nd Prod. 65X1, 65X2, 65X8, 65X9, Radiola 61.8, 61-9 QU72, QU72A 64F1, 64F2 64F3 8F43 66X1, 66X2 66X3, 66X7, 66X8, 66X9 66BX (3Q4 output) 66BX (3V4 output) 66BX (Selenium rect.) 8BX6, 8BX65 8BX6 2nd Prod. Q103, Q103A, Q103-2, Q103A-2 XIV Chassis No. RC -1044A RC -1045 RC -1046 RC -1046A RC -1046B RC -1046C RC -1046D RC -1046E RC -1047 RC -1050 RC -1050A RC -1050B RC -1053 RC -1053A RC -1053B RC -1054 RC -1054A RC -1054B RC -1054C RC -1054D RC -1054E RC -1054F RC -1054G RC -1054J RC -1054K RC -1055 RC -1055C RC -1055D RC -1055H RC -1055J RC -1055K RC -1057A RC -1057B RC -1058 RC -1058A RC -1059 RC -1059A RC -1059B RC -1059C RC -1060 RC -1060A RC -1061 RC -1063A RC -1063B RC -1064 RC -1065 INDEX TO CHASSIS NO'S (Continued) RADIO CHASSIS (Continued) Model Q103X, Q103AX, Q103X-2, Q103AX-2 65BR9, Radiola R65BR9 66X12 66X11 66X13 66X11 2nd Prod. 66X12 2nd Prod. 66X13 2nd Prod. 54135 75X11, 75X12 75X11, 75X12 2nd Prod., 75X14, 75X15 75X11 3rd Prod., 75X14 2nd Prod., 75X16, 75X17, 75X18, 75X19 5Q21, 5Q22, 5Q27 5Q21 2nd Prod. (117 v.) 5Q1 2nd Prod. (234 v.) 5Q31 6Q33 6Q33X 6QU3 6QV3 5Q31X 6QU3Y Q531 QA531 35QU 7Q51 (PM 7Q51 (EM) 7Q51 X Q853 (117 v.-234 v. Q853 (85-260 v.) 0853 (117 v. 25 cy.) 77U 9Y7 Radiola 76ZX11, 76ZX12 Radiola 76ZX11, 76ZX12 2nd Prod. 8BX5, 8BX54, 8BX55 8BX5, 8BX54, 8BX55 2nd Prod. 9BX5 9BX5 2nd Prod. 8R71, 8R74, 8R75 8R72, 8R76 8X681, 8X682 Radiola 75ZU Radiola 75ZU 2nd Prod. 65X1, 65X2, Radiola 61-8, 61-9 2nd Prod., 8X53 8X541, 8X544, 8X545 Chassis No. RC -1065A RC -1065B RC -1065C RC -1065F RC -1065H RC -1065J RC -1065K RC -1065L RC -1065M RC -1066 RC -1066A RC -1067 RC -1067A RC -1068 RC -1069 RC -1069A RC -1069B RC -1069C RC -1070 RC -1070A RC -1071 RC -1071A RC -1071B RC -1072 RC -1077 RC -1077A RC -1077B RC -1077C RC -1079 RC -1079A RC -1079B RC -1079C RC -1079D RC -1079E RC -1079F RC -1079K RC -1079L RC -1080 RC -1080A RC -1080C RC -1080D RC -1082 RC -1082A RC -1084A RC -1085 RC -1085A RC -1085B RC -1087 RC -1088 RC -1088A RC -1088B RC -1088C RC -1089B RC -1089C Model 8X542, 8X546, 8X547 8X541, 8X544, 8X545 2nd Prod. 8X542, 8X546, 8X547 2nd Prod. 8X541, 8X544, 8X545 3rd Prod. 8X542, 8X546, 8X547 3rd Prod. 8X541 4th Prod. 8X542, 8X547 4th Prod. 8X541 5th Prod. 8X542, 8X547 5th Prod. 8X521 8X522 6QP3 QP63 9BX56 8B41 8B42 8B43 81346 8X71, 8X72 X711 4QB3 4QB3X QB431 5QA5 9Y51 9Y510 9Y511 9Y510 2nd Prod. 9X571 9X572 9X561 9X562 9W51 9X571 2nd Prod. 9X572 2nd Prod. 1X591 1X592 9X641 9X642 2-X-61 2-X-62 BX6 BX6 2nd Prod. 9W78, A78 9X651 9X652 2-X-621 A55 BX55 BX57 BX55 2nd Prod. BX57 2nd Prod. X551 X552 Chassis No. Model RC -1090 2T81, 4T141, 6T84 Radio Chassis RC -1092 6T86, 6T87, 9T89 7T143, 9T147 Radio Chassis RC -1094 RC -1095 A-82 A-91 RC -1095A 45-W-9 RC -1096 RC -1096A RC -1096B RC -1096C A-101, A-108 45-W-10 A-101, A-108 2nd Prod. 45-W-10 2nd Prod. RC -1098 RC -1098A RC -1100 RC -1-100A B-411 B-411 2nd Prod. Q520 (117V.) Q520 (234V.) RC -1101 QB421 RC -1102 1R81 RC -1102A 1R81 RC -1102B 1R81 RC -1102C 1R81 RC -1104 1X51 RC -1104-1 RC -1104A 1X51 1X52, 1X57 RC -1104A-1 RC -1104B RC -1104B-1 ...1X52, 1X57 1X53, 1X54, 1X55, 1X56 ....1X53, 1X54, 1X55, 1X56 RC -1104C RC -1104D 1X51 1X52, 1X57 RC -1104E 1X53, 1X54, 1X55, 1X56 RC -1110 RC -1111 PX600 2-S-10 RC -1111A 21 -T -197D E RC -1111B 21-T-244 RC -1114....2-B-400 Series RC -1115 2-BX-63 RC -1116 36QP (117 v.) RC -1116A 36QP (117v. -234v.) RC -1117A RC -1117B 2 -US -7 21-T-242 RC -1117C RC -1117D RC -1118 RC -1118A RC -1118B RC -1118C RC -1119 RC -1120 RC -1120A RC -1120B RC -1120C RC -1120D RC -1120E RC -1121 RC -1121A 2 -US -7 2-S-7 2-C-511 2-C-512 2-C-513 2-C-514 2-R-51, 2 -R -5,1A 2-R-52, 2 -R -52A 2-C-521 2-C-522, 2-C-527 2-C-521 2-C-522, 2-C-527 2-C-521 2-C-522, 2-C-527 2-X F-91 2-X F-931 Series Chassis No. RA -79 RS -77 RS -79B RS -83.1 RS -83.2 RS -83-3 RS -83A-1 RS -83A-2 RS -83A-3 RS -83C RS -83E RS -84 RS -85 RS -85A RS -86 Model 9EY31, 9EY32 R-98 CV -9 Electrifier PSU-8A PSU-8B PSU-8C PSU-10A PSU-10B PSU-10C CV -110 Electrifier TRK-9, TRK-12, TRK-90, TRK-120 Radio Power Unit R-91 PSU-8E PSU-10E R-89 AUDIO AMP. AND POWER UNITS Chassis No. RS -89 RS -89A RS -89B RS -90 RS -91A RS -91B RS -92 RS -94A RS -95 RS -98 RS -102A RS -102B RS -102C RS -102D RS -102E RS -110 Model CV -9X Electrifier TRK-5 Radio Power Unit U-42 Power Unit VA -21 0.50 R-60 M-70 Power Unit OSC-22 CV -111 Electrifier CV -40 Electrifier U-44 Power Unit U-46 Power Unit K-130 Power Unit U-45 Power Unit V-300, V-301, V-302 Power Unit QU5 Power Unit Chassis No. RS -111 RS -111A RS -112 RS -112A RS -114A RS -115 RS -115B RS -119 RS -123 RS -123A Model CV -112 Electrifier CV -112X Electrifier QU8 Power Unit QU7 Power Unit VHR-307 Power Unit QB1, QB11, QB12, QB13, 6V. Power Unit QB9 Power Unit R-56 612V1, 612V3, 612V4, 711V1, 711V2, 711V3 Audio Amp. & Power Supply 64TV, 649PTK, 8TV41 Audio Amp. & Power Supply Chassis No. RS -123B RS -123C RS -123D RS -126 RS -127 RS -130 RS -130A RS -132 RS -132A RS -132C xv INDEX TO CHASSIS NO'S (Continued) AUDIO AMP. AND POWER UNITS (Continued) Model 648PV Audio Amp. & Power Supply 741 PCS, 8PCS41, 9PC41 Audio Amp. & Power Supply 8V151 Audio Amp. & Power Supply 66E, 66ED, 66E-1 63E, 63EM 9QV5 Power Unit 4QV8C Power Unit 9EY3, 93Y3M, 9EY35, 9EY36, 45-EY 9EY35, 9EY36, 45-EY QEY3 Chassis No. RS -132F RS -132H RS -136 RS -136A RS -136B RS -136C RS -136D RS -136E RS -136F RS -138A RS -138B RS -138E RS -138F RS -138H RS -138L Model 45-EY, 45-EY-1 45-EY-15 45-EY-3 45-EY-3 QEY5 45-EY-3 QEY5 45-EY-3 QEY5 (Min. tubes) 45-EY-2 QEY4 QEY4 45-EY-2 45-EY-2 45-EY-26 Chassis No. RS -138M RS -138N RS -139A RS -140.. RS -140A RS -141 RS -141A RS -141C RS -142 RS -142A RS -1000 RS -1001 Model 45- EY-26 QEY4 (Min. tubes) .15-E, 15-E-1 45-EY-4 QEY6 2-S-10 21T197DE 21T244 2ES3, 2ES31, 2ES31 E, 2 ES38, 2 ES38 E 2ES31Q, 2ES38Q CV -42 Electrifier CV -45 Electrifier Chassis No. KC -3 KC -3A KC -3B KC -3C KC -4 KC -4A KC -4B KC -4C KC -4F KC -4H KC -4J KCS-20A KCS-20B KCS-20C KCS-20D KCS-20J KCS-20K KCS-21 KCS-24 KCS-24A KCS-24B KCS-24C KCS-24D KCS-25A KCS-25C KCS-25D KCS-25E KCS-26-1 KCS-26-2 KCS-26A-1 KCS-26A-2 KCS-27-1 KCS-27-2 KCS-28 KCS-28A KCS-28B KCS-28C KCS-29 KCS-29A KCS-29C KCS-30 KCS-31 Model TT -5 TRK-5 TV Chassis TT -5 (50 cy.) TRK-5 (50 cy.) TV Chassis TRK-12 TV Tuner TRK-9 TV Tuner TRK-12 (50 cy.) TV Tuner TRK-9 (50 cy.) TV Tuner TRK-120 TV Tuner TRK-90 TV Tuner TRK-120 (50 cy.) TV Tuner 630TS 630TCS 630TS (50 cy.) 630TCS (50 cy.) 8TS30 8TS30 (50 cy.) 621TS 648PTK TV R -FBI -F Chassis 648PV TV R -FBI -F Chassis 741 PCS, 8PCS41 R -FBI -F Chassis 8PCS41, 9PC41 R -FBI -F Chassis 9PC41 R-Fil-F Chassis 641TV TV Chassis 641TV (50 cy.) TV Chassis 8TV41 TV Chassis 8TV41 (50 cy.) TV Chassis 721TS 721TS (50 cy.) 721TCS 721TCS (50 cy.) 730TV1, 730TV2 TV Chassis 730TV1, 730TV2 (50 cy.) TV Chassis 8T241, 8T243, 8T244, 9T240 9T240 9TC240 9T246 8T270, 9T270 8TC270, 8TC271 9TC272, 9TC275 8TV321, 8TV323, 9TW333 TV Chassis S1000, 9TW390 TV Chassis TELEVISION CHASSIS Chassis No. Model KCS-32 KCS-32A KCS-32B KCS32C KCS-33A KCS-34 KCS-34B KCS-34C KCS-38 KCS-38C KCS-40 KCS-40A 8TR29 8TK29 8TR29 8TK29 8TK320 9TC247, 9TC249 TC124, TC125, TC127, 9TC245, 9TC247, 9TC249 T120, T121 T100, 97246 9T256 T164 TC165, TC166, TC167, TC168 KCS-40B 6T72 KCS-41 9TW309 KCS-41A TA129 KCS-42A TA128 KCS-43 TA169 KCS-45 2T51 KCS-45A 2T60 KCS-46 2T81 KCS-47 6T53, 6T54 KCS-47T 6T53, 6T54 KCS-47A 6T64, 6T65, 6T71, 6T74, 6T75, 6T76 KCS-47AT 6T64, 6T65, 6T71, 6T74, 6T75, 6T76 KCS-47B 7T103, 7T104 KCS-47C 7T112, 7T122, 7T123, 7T124 KCS-47D 77132 KCS-47E 16T152 KCS-47F 7T103B, 7T104B KCS-47G 7T112B, 7T122B, 7T123B, 7T125B KCS-47GF 7T112B, 7T122B, 7T123B, 7T125b KCS-47GF-2 ....7T111 B, 7T112B, KCS-47T KCS-48 7T122B, 7T123B 6T53, 6T54 6T84, 6T86, KCS-48A 6T87 7T143 KCS-48T KCS-49 KCS-49A KCS-49AT 6T84, 6T86, 6T87 9T57 9T77, 9T79 9T77, 9T79 KCS-49B 9T105 KCS-49BF 9T105 KCS-49BF-2 ....9T105 KCS-49C 9T126, 9T128 KCS-49CF 9T126, 9T128 KCS-49CF-2 ....9T126, 9T128 KCS-60 9T89 KCS-60A 9T147 KCS-60T 9T89 KCS-61 4T101 Chassis No. KCS-62 KCS-66 KCS-66A KCS-66C KCS-66D KCS-68C KCS-68E KCS-68F KCS-68H KCS-70 KCS-72 KCS-72-M1 KCS-72-M2 KCS-72A KCS-72D-1 KCS-72D-2 KCS-74 KCS-79 KCS-79A Model 4T141 17T153, 17T154, 177155, 17T160 17T162,17T172, 17T173, 17T174 17T150, 17T151, 17T163 17T172K, 17T173K, 17T174K 21T176, 21T177, 21T178, 21T179 21T159. 21T165 21T159DE, 21T166DE, 21T174DE,21T175DE, 21T178DE, 21T179DE 21T197DE U-70 117T200, 17T201, 17T202, 17T211, 17T220 21T207, 21T207G, 2T208, 21T217, 21T218, 21T227, 21T228, 21T229 21T242 21T244 17T250DE, 17T261DE U-2 U -2A KK-7 KK-7A KK-7D KK-7E KK-7F KK-7J KK-7H TRK-12 TV Powe,r Unit TRK-9 TV Power Unit TRK-12 (50-cy.) TV Power Unit TRK-9 (50 cy.) TV Power Unit TR K-120 TV. Power Unit TRK-90 TV Power Unit TRK-120 (50 cy.) TV Power Unit KRS-20 K RS -20A KRS-20B KRS-21 KRS-21A 648PTK, 648PV Horiz. Defl. Chassis 741PCS, 8PCS41 Horiz. Defl. Chassis 8PCS41, 9PC41 Horiz. Defl. Chassis 648PTK, 648PV TV Power Supply 741PCS, 8PCS41, 9PC41, TV Power Supply XV I SALES NAME vs. MODEL NUMBER Ainsworth Albury Ashley Ashton Bancroft Belg rove Bentley Benton Blaine Brandon Brantley Brett Bristol Brookfield Calhoun Carlisle Clarendon Colby Covington Crafton Crandall Crestwood Cumberland Donley Fairfax Fairfield Farmington Fenwick 17-T-261DE 17-T-220 A-91 17-T-211 21 -T -174D E 21-T-229 4-T-101 21 -T -175D E 1-X-51 21-T-228 45-W-10 17-T-250DE 17-T-153 21-T-217 17-T-173 A-108 21-T-179, 21 -T -179D E 17-T-150 17-T-172 17-T-163 21-T-207, 21 -T -207G 612V1, 8V151 2-T-60 21-T-177 6-T-84 6-T-71, 6-T-72, 7-T-122 21 -T -166D E 2-S-10 Forbes Gladwin Glenside Globetrotter Grayson Hadley Hampton Hartford Haywood Highland Hillsborough Hillsdale Kendall Kent Kentwood Kerby Lambert Lansford Lindale Lindsay Livingston Meredith Modern Newport Northampton Oakland 2-XF-91 1-X-591 17-T-151 66BX, 8BX6, BX-6, P IX -600, 2-BX-63 X-551 17-T-201 17-T-160 6-T-87 17 -T -111B 6-T-65, 7-T-112 A-101 9-T-126 17-T-174 6-T-54, 7-T-104 17-T-202 2-X-621 21-T-208 21-T-218 21-T-227 2-X-61 1-R-81 21-T-165 6-T-75, 7-T-124 6-T-53, 7-T-103 9-T-79 2-S-7 Penfield 21-T-244 Personal 54B1, 81341, B-411, 2-C-511, 2-R-51 Prentiss 8-X-541 Preston 17-T-155 Provincial 6-T-76, 7-T-125, 9-T-128 Randolph 9X561 Regency 6-T-74, 7-T-123 Reveler BX-57 Rockingham 21-T-178, 21-T-178DE Rutland 6-T-86, 7-T-143 Sedgwick 9-T-89, 9-T-147 Selfridge 21-T-159, 21-T-159DE Shelby 2-T-51 Shelley 17-T-200 Somervell 2-T-81, 4-T-141 Suffolk 21-T-176 Sunderland 21-T-197DE Super Personal 2-B-400 Talbot 16-T-152 Terre! A-82 Torrance 9-X-571 Townley 2-XF-931 Westland 21-T-242 Whitfield 17-T-154 Winston 7-T-132 York 9-T-57, 9-T-105 MODEL vs. RECORD CHANGER (1943 to 1952 incl.) Model A55 A78 A-82 A-91 A-101 A-106 A-108 Q EY4 Q EY5 Q EY6 QJY Q EY3 QU61 QU62 QU68 S1000 TA128 TA129 TA169 2 -ES -3 2- ES -31 2 -ES -31 E 2- ES -31Q 2 -ES -38 2 -ES -38E 2- ES -38Q 2-J S-1 2 -JS -1E 2-J S-1 Q 2-5-7 2-S-10 2T81 2 -US -7 4QV8C 4T141 6QU3 6QU3Y 6QV3 Record Changer RP 168 & 960282-1 RP 168 & 960282-1 RP 168 or RP 190-2 & 960282-4 or -5 RP 168 or RP 190-2 & 960284-1 or -2 RP 190-2 & 960282-4 or -5 or 960284-1 or -2 RP 168 & 960285-1 RP 168 or RP 190-2 & 960284-1 or -2 RP 190-5 RP 190-5 RP 190-5 RP 168 RP 168 960001-4 960001-4 960001-4 RP 168 & 960285-1 RP 168 & 960282-1 RP 168 & 960282-1 RP 168 & 960285-1 930409-5 930409-5 930409-5 930409-6 930409-5 930409-5 930409-6 930409-5 930409-5 930409-6 930409-5, -10 930409-5, -10 RP 168 or RP 190-2 & 960282-4 or -5 930409-5, -10, -11 RP 168 & 960282-2 RP 190-2 & 960282-4 or -5 RP 178-3 RP 168 RP 178-3 Model 6T84 6T86 6T87 7QV5 7T143 8TV41 8TV321 8TV323 8W 8V90 8V91 8V112 8V151 9EY3 9EY31 9EY32 9 EY35 9 EY35U 9EY36 9EY36U 9JY 9QV5 9T89 9T147 9TW309 9TW333 9TW390 9W51 9W78 9W101 9W102 9W103 9W105 9W106 9Y7 9Y51 9Y510 Record Changer RP 168 or RP 190-2 & 960282-4 or -5 or 960284-1 or -2 RP 168 or RP 190-2 & 960284-4 or -5 RP 168 or RP 190-2 & 960284-1 or -2 960001-4 RP 190-2 & 960284-1 or -2 RP 177A RP 178 RP 178 RP 178 RP 178 RP 178 RP 178 RP 177B RP 168 RP 168 RP 168 RP 168 RP 168 RP 168 RP 168 RP 168 RP 168 & 960282-2 RP 168 or RP 190-2 & 960284-1 or -2 RP 190-2 & 960284-1 or -2 RP 168 & RP 178 RP 168 & RP 178 RP 168 & RP 177B RP 168 RP 168 & RP 178 RP 168 RP 168 RP 168 RP 168 & RP 178 RP 168 & RP 178 RP 168 RP 168 RP 190-1 fodel 9Y511 15-E, 15-E-1 21T197DE 21T242 21T244 35QU 45- EY 45- EY-1 45- EY-2 45- EY-3 45- EY-4 45- EY-15 45- EY-26 ' 45-J 45-J-2 45-J-3 45-W-9 45-W-10 55U, 55AU 58V, 58AV 59V1, 59AV1 Rad. 62-1 65U, 65AU 65U-1 67V1, 67AV1 Rad. 75ZU 77U 77V1 77V2 610V1 610V2 612V1 612V3 612V4 641TV 648PV 710V2 730TV1 730TV2 711V1 711V2 711V3 Record Changer RP 168 RP 190A-1 & Manual turntable 930409-5, -10 930409-5, -10 930409-5, -10 930409-4, -6 RP 168 RP 168 RP 190 RP 190-1 or RP 190-3 RP 190-2 RP 168 RP 190A-2 RP 168 RP 190-1 RP 193 RP 190-2 RP 190-2 960015 960001-1 960001-2 960260-2 960260-2 960260-2 960260-1 RP178 or 960276 RP 178 960260-1 960260-1 960001-5 or -6 or RP 177 960001-5 or -6 or RP 177 RP 176A or RP 176B RP 176 or RP 176A RP 176 or RP 176A 960001-4 or -6 RP 176 RP 177 or RP 177A RP 177 or RP 177A RP 177 or RP 177A 960001-5 960001-5 960001-5 XVI I NOTES ON 17T150, 17T151, 17T153, 17T154, 17T155, 17T160, 17T162, 17T163, 17T172, 17T172K, 17T173, 17T173K, 17T174, 17T174K, 21T159, 21T165, 21T176, 21T177, 21T178 AND 21T179 TELEVISION RECEIVERS SEPARATION OF SOUND AND PICTURE IN WEAK SIG- NAL AREAS-Normally the picture carrier falls at 50% on the slope of the overall response curve as shown below. When receiving signals of less than 50 microvolts, on intercarrier receivers, it is common practice to adjust the fine tuning con- trol so as to move the picture carrier up the slope to improve the signal to noise ratio. The actual amount which the carrier is moved depends upon the signal strength. On extremely weak signals, the picture carrier may be moved as high as 80% to 90% on the slope of the curve. This may represent a change of as much as .75 megacycles of all frequencies being passed through the pix i-f amplifier. Under such con- ditions the sound may become weak and noisy even on inter - carrier receivers. The reason for this is shown in figure 1 below. RESPONSE OF A PIX CARRIER MAY BE ROLLED RECEIVER WITHOUT AS HIGH AS 85% (45.00 MC) AN ADJACENT WHEN RECEIVING VERY WEAK CHANNEL PIX SIGNALS. TRAP. NORMAL RESPONSE OF THE RECEIVER RESPONSE OF A RECEIVER WITH ADJ. CHANNEL PIX TRAP TUNED OVERALL I -F RESPONSE CURVE TO 39.00 MC. 41.25 MC FREQUENCY OF SOUND CARRIER WHEN FIX CARRIER IS AT 50%RESPONSE 40.50 MC FREQ OF SOUND CARRIER WHEN PIX CARRIER 13 ROLLED UP TO (15% RESPONSE WIFINE TUNING CONTROL FOR FRINGE AREA OPERATION. ENLARGED SECTION OF THE OVERALL RESPONSE CURVE FIX CARRIER AT 50% RESPONSE (45.75MC) FOR NORMAL CAERATION 39.75 MC ADJACENT CHANNEL PIE TRAP 39.75 MC 41.25MC Figure I -Details of Overall Response Curves When the picture carrier is rolled up the slope and lowered in frequency by .75 mc., the sound carrier is also lowered in frequency by .75 mc. to become 40.50 mc. As can be seen by the enlarged section of the response curve, the sound carrier begins to fall into the adjacent channel picture trap with a consequent reduction of sound output. Receiver designs which do not incorporate an adjacent channel picture trap may avoid this difficulty at the expense of adjacent channel picture rejection. It is possible to overcome the above described difficulty in many cases by a simple adjustment which can be made in the field without the aid of test equipment. When the picture carrier is rolled up the slope by .75 mc., the adjacent channel picture carrier is lowered in frequency to 39.00 mc. and no longer falls into the adjacent channel picture trap. If the trap is returned to 39.00 mc. it will permit the response at 40.50 mc. to rise somewhat and produce stronger sound and will produce greater adjacent channel picture rejection under the actual operating condition. If a strong signal is available on another channel and the fine tuning is adjusted to roll the picture carrier down the slope to the normal 50% point, the adjacent channel picture trap will appear mistuned. However, it is not likely that adjacent channel picture interference will be experienced on strong signals. In addition to the above adjustment, T107, normally peaked at 41.8 mc., may be lowered in frequency to provide improved sound gain. Care should be taken in making this adjustment not to lower its frequency any more than necessary as it reduces adjacent channel picture rejection somewhat and might cause difficulty from sound in the picture if a strong signal is available on another channel. The above adjustments may be made without removing the chassis from the cabinet. First, tune in the desired channel and adjust the fine tuning control for best picture. Then, since the adjacent channel picture trap is under the kinescope, disconnect the high voltage lead at the chassis to prevent getting a shock. Turn the T104 top core clockwise, approximately 1/2 turn if it is a threaded core type or approximately 11/2 turn clockwise if it employs a brass stud extending from the transformer shield. Restore the kinescope high voltage connection. Then, from the top of the chassis, adjust T107 clockwise 1/2 turn or less. If adjacent channel picture interference is a severe problem, it may be necessary to remove the chassis from the cabinet and adjust T104 top core while observing the picture for minimum interference. R -F AND I -F BIAS RATIOS-In medium field strength areas an occasional receiver may show some snow on signals in the 300 to 1000 microvolt signal range due to an improper ratio of r -f and i-f bias. If the r -f bias is high with respect to the i-f bias, the picture becomes snowy. If the i-f bias is too high with. respect to r -f bias, the receiver may overload on strong signals. To determine whether or not the biases are of the correct ratio, tune in a signal and measure the r -f bias, the i-f bias and the AGC amplifier plate voltage with a "VoltOhmyst". The signal must be steady during these measurements. Plot these points on the accompanying graph. The values should fall within the range of the dotted lines. 0 _41111111111111111111111111111111111111111111111111111 y 1111,_ 9 ,411111111111111111111111111111111111111111111111111 ir I'd IS A7111111111111111111111111111111111111111111111/111 4-A 1 11- 1111111111111111111111111111111111111111111111111 "I' ;'Immenemonnommoloommonolionimmumil e I k /6 I. is w1_ 16 1_ 15 .1111111111111111111111111111111111111111111111 k 1 ... 'gm 4 gigmmugummligummugginglign II te moque _13111111111111111111111111111111111111111111111 . 1 .i.4.4. -T _,N11111111111111111111111111111111111111111111 - No - 13 12 .4.4"/ 4 -, egglogggIggiliggiggiggggloggIggIginglIggub mmaigggee.;._ 11 10 111111111111111111111111111111111111 1 41:11/Al! WIWI: _:11111111111111111111111111111111 00". mgrigspoinseum 9 _711111111111111111111111111 11111111111111111111111 9 00k- ts&-c- p. - tad1USIO/11111111 mg "..OPELmi01111,111111111111 r 4"4 5111111111111111111111111111111111111111 .-- 6 2111121111211111111111 . 09.001 15 '.. AIIIPA111.3111111111111 ' 1111111111111pCP :" 9.0 - "I t 01 11Pd111Pd111,11111111111111 111111/1111K11115111111111111111 7 6 4 3 2 , 111,1:411111111111111111111111&11115111121111111111111111 . 01n11 O -i5ddlO-I1S1111-1151111-1201111-1251111-1310111-1315111-1410111-14151111-5101111-5151111610 0 AGC AMPLIF ER PLATE VOLTAGE Figure 2-Chart of R -F, I -F Bias Ratios According to the graph, when the AGC amplifier plate measures -45 volts, the i-f bias should be -8.2 volts. If the i-f bias actually measured -10 volts, it indicates that R143 or R145 is too low 8144 8150 is too high. If, however, the i-f bias actually measured -6 volts it indi- cates R143 or R145 is too high in value and/or R144 or R150 is too low. The resistors originally employed in production were 10% tolerance units. However, if R143 and R145 are at one limit of their tolerance and R144 and R150 are at the other limit of their tolerance, a considerable error in i-f bias is produced. Similarly at -45 volts AGC amplifier plate voltage the r -f bias should measure -6.8 volts. If the i-f bias should measure say -12 volts, it indicates that R128 or R129 is too low or R127 is too high or the R145 volt bus is too low. If the bias is too low, obviously the converse is true. In several instances, r -f or i-f bias difficulties have been traced to leaky electrolytic capacitors C124 or C138. In two known instances, one of these two capacitors was connected into the circuit in reversed 'polarity due to a reversal of the polarity markings on the capacitor. The above AGC bias circuit description is for the 17T153 series receivers. The 21T176 receivers are similar except for slight differences which cause the biases to occur at slightly different AGC plate voltages. AGC THRESHOLD CONTROL ADJUSTMENT-The AGC control is adjusted at the factory to provide maximum pos- sible gain without clipping sync for all signals above the receiver threshold up to 25000 microvolts. The adjustment of this control should not be touched in the field unless it is definitely known to be incorrect. If the control is misadjusted so as to increase the receiver gain, it may overload when a strong signal is received or when a weak signal temporarily increases in strength due to unusual propagation conditions. On the other hand, if the receiver gain is lowered by the AGC control, the sync noise immunity is reduced. In order to reduce the prominence of snow on weak signals it is important that the picture control not be operated at its maximum clockwise position. Such an adjustment will pro- vide a higher contrast picture but at the same time may produce an apparent poorer signal to noise ratio due to the fact that an excessive amount of signal on the kinescope grid causes the snow to bloom or defocus thus causing the flake particle to become larger and more prominent than normal. At the same time it is equally important that the receiver be focused to obtain the appearance of the least amount of XVI II NOTES ON 17T150, 17T151, 17T153, 17T154, 17T155, 17T160, 17T162, 17T163, 17T172, 17T172K, 17T173, 17T173K, 17T174, 17T174K, 21T159, 21T165, 21T176, 21T177, 21T178 AND 21T179 TELEVISION RECEIVERS snow in the picture. To do this, focus the receiver by the method directed in the Service Data. As a final adjustment, adjust the focus control for the appearance of minimum snow in the picture. Only under two conditions can it be considered permissible to adjust the AGC control. In an area where the signal is so weak that the snow practically obscures the picture after having taken all the above precautions, then the AGC control may be adjusted to give the best signal to noise ratio. It should be recognized however, that trouble from loss of sync noise immunity might be experienced. The other condition which would justify adjustment of the AGC control is where a signal of over 25,000 microvolts is received. Under this condition the AGC control should be adjusted until the receiver no longer overloads. NOTES ON GERMANIUM CRYSTAL DETECTOR CR101Several different types and makes of crystals are used, such as 1N60, 1N64 and CK706. These crystals have slightly dif- ferent characteristics and may not be directly interchangeable. In production, these differences are taken care of by varying the value of R154 which is located in T109. This resistor is normally 10K. However, to take care of different crystals, this resistor may vary from 5600 ohms to 10K ohms. If the crystal is to be replaced, it should be replaced by one of the same make and type. However, if desired, the entire T109 transformer and matching resistor may be installed. In any event, if T109 or CR101 is replaced,. the over-all response should be checked. If a crystal is replaced, care should be taken to get it connected in the proper polarity. Since germanium crystals are marked differently than selenium rectifiers, confusion may result. Seleniuni rectifiers are marked and - to show the polarity of the d -c output voltage. Germanium crystals are marked to show the polarity of voltage that must be applied to obtain maximum current flow. The cathode end of a germanium crystal may be coded with green paint or marked -. The anode end may not be coded or may be coded -I-. In schematic symbols, the anode is shown as an arrow (4) and the cathode as a flat bar. In T109, the anode (-I-) end is connected to terminal A and the cathode (-) end to terminal D. Care should also be taken not to overheat the crystal with the soldering iron as damage to the crystal may result. As a protection against damage to the crystal detector, a 220 ohm, 1/2 watt resistor has been added in series with the screen of ,V110, the 6AG7 video amplifier. This resistor is designated as R174 in both 17 and 21 inch receivers and is carried under stock number 503122. It is shown in the latest editions of the receiver Service Data. T104 FREQUENCY CHANGE-In late production receivers, the adjacent channel picture trap in T104 has been tuned to 39.25 mc. rather than 39.75 mc. This results in slightly more sound sensitivity when operating the receiver in fringe areas. It also provides slightly higher adjacent channel picture rejection when the fine tuning is adjusted so as to roll the picture carrier up on the slope of the i-f response as is done in receiving weak signals. This change, suggested as a field adjustment, was covered more fully in RPT Tip, Volume II, Issue 9, dated November 19, 1951. KRK11 OSCILLATOR INJECTION VOLTAGE-If low oscillator injection voltage is encountered in KRK11 r -f unit, it may be necessary to select a 6X8 tube which will give proper injection when the r -f unit is properly aligned. Recent changes in the circuit and parts makes it easier to obtain sufficient injection with average 6X8 tubes. R -F units in which these changes are made are marked Ml. The parts list of the 17 inch receiver Service Data lists parts for early and late production units. FUSE CHANGE-Early production receivers employed a 0.25 ampere fuse. This was later changed to a 0.20 ampere slow blow type. The latest production receivers have reverted to the regular type 0.25 ampere fuse, stock number 73600. If a fuse requires replacement, it is recommended that the regular type be employed. LEAD DRESS IN KRK11-In several early production units, difficulty has been reported due to the shield of the cable from T1 shorting against C28. When working on one of these units, take care not to disturb the dress of this cable so as to make this short more likely to happen in service. It may also be a worthwhile precaution to wrap the shield of the cable with several turns of tape at the point where it passes C28. In late production units, this lead has been dressed so that a short cannot occur. VERTICAL SYNC AND HOLD IN 17T153 SERIES-In a few cases it has been found that C172 has changed value with time and temperature requiring resetting the vertical hold control during initial warm-up and causing the control to be operated at the extreme clockwise position. If such a condition is encountered, replace C172 with another capacitor which will permit normal operation of the control. Several cases have been reported from the field that R191 was connected to the cathode side of R266 instead of the junction of R265 and R266. This results in 70 to 80 volts on the cathode pin 6 of V113 instead of the normal 100 volts, causing unstable vertical sync. KCS68 VERTICAL SYNC INSTABILITY DUE TO REFLEC- TIONS-In some cases, reflections may cause vertical sync to be unstable. The following changes to KCS68 chassis are suggested as a possible cure for this condition at a slight detrement of sync noise immunity on weak signals. 1. Change R185 to 1.0 meg, ±10%, I/2 watt, Stock No. 503510. 2. Change R186 to 3.9 meg, ±10%, 1/2 watt, Stock No. 503539. 3. Change R189 to 22K, +10%, 1/2 watt, Stock No. 503322. 4. Change C160 to .056 mfd, 400 volts, Stock No. 73791. 5. Add a 100 mmf capacitor, Stock No. 39628 from pin 4 of V113 to ground. The above changes apply only to KCS68 and are not applicable to KCS66 series chassis. SOCKET CONNECTIONS TO 1B3GT RECTIFIER (KCS66 SERIES)-In some KCS66 series chassis, the 1B3GT socket, terminal 5 has been used as a tie point. It has been found that. some brands of tubes have an internal connection in the tube between pins 5 and 7. Such tubes will not operate in KCS66 series chassis which are wired as noted above. When replacing the 1B3GT tube in the field, the serviceman may employ one of the three following methods to avoid difficulty. 1. Use a tube which does not employ a connection between pins 5 and 7. RCA tubes do not have this connection. 2. Rewire the 1B3GT tube socket so that terminal 4 is employed as the tie point instead of terminal 5. 3. If the tube has a connection between pins 5 and 7, clip pin 5 off of the tube base. DEFLECTION TROUBLE SYMPTOMS IN 21 -INCH RECEIVERS-Fold over or white bar in center of raster. This trouble may be caused by low screen voltage on the 6CD6 tube due to R253 or R235 being open. Low brilliance, change in pix size and linearity, etc. This may be caused by a defective L106. Poor interlace-To prevent coupling between the vertical and horizontal sweep circuits, thus causing poor interlace, dress the red lead from the yoke socket to the HV transformer under the lance on the side of the high voltage cage. To prevent parasitic oscillations in the horizontal sweep circuit, C185 should be connected from pin 2 of V116 to ground instead of from the nearby terminal board to ground. 17CP4, 21AP4 AND 17QP4 KINESCOPES-If certain kinescope "electron gun" parts become magnetized, "poor focus" may result. To demagnetize these tubes, connect a 630TS receiver EM focus coil to 110 volts a -c and pass the coil slowly over the kinescope neck, past the "gun" and slowly withdraw. R -F TUNERS The attached information lists the differences between the various types of KRK2, KRK5, KRK7 and KRK8 series r -f tuners. This information should be helpful in adapting one type of unit to another in event the correct type is not available. KRK2 SERIES TUNERS Receiver R -F Model Unit Detent Stock No. 621TS 630TS 630TCS 641TV 648PTK 648PV 721TS 721TCS 730TV1 & 2 741PCS 8TS30 8PCS41 8TV41 9PC41 KRK2 KRK2 KRK2 KRK2 KRK2A KRK2A KRK2B-1 KRK2B-1 KRK2B-1 KRK2A KRK2 KRK2A KRK2 KRK2A 71463 (Short) 71463 (Short) 71463 (Short) 71463 (Short) 71463 (Short) 71463 (Short) 72743 (Long) 72743 (Long) 72743 (Long) 71463 (Short) 72743 (Long) 71463 (Short) 71463 (Short) 71463 (Short) Converter Transformer Tap 3rd or 4th Turn Down 4th Turn Down 4th Turn Down 4th Turn Down 4th Turn Down 4th Turn Down 3rd Turn Down 3rd Turn Down 3rd Turn Down 4th Turn Down 4th Turn Down 4th Turn Down 4th Turn Down 4th Turn Down Cony. Trans. Cap. 62 mmf. 68 mmf. 68 mmf. 68 mmf. 68 mmf. 68 mmf. 62 mmf. 62 mmf. 62 mmf. 68 mmf. 68 mmf. 68 mmf. 68 mmf. 68 mmf. NOTE #1-Converter transformers using 62 mmf. capacitors are aligned on the primary side to 22.8 mcs. and are recognized by a painted dot on top. All others are aligned to 21.8 mcs. NOTE # 2-There is no difference between the KRK2 and the KRK2A, except that "2A" unit is used in the projection receivers. NOTE # 3-Using the 621TS (KRK2) r -f unit in the 630TS or 8TS30 without the modification indicated may result in i-f oscillation. Using the 630TS (KRK2) r -f unit in the 621TS without modification indicated may result in insufficient sound. NOTE # 4-The KRK2 unit can be changed to a KRK2B-1 by changing the detent, tap on converter transformer, and converter shunt capacitor as listed above. All other parts are identical. KRK5 AND KRK7 SERIES TUNERS Receiver Model 8T241 8TV321-3 8T270 8TK320 8TR29 1 8TK29 9T240 9TC240 9TC245-47-49 9T246 9T256 9T270 9TC272-5 9TW309 9TW333 9TW390 T100 T120 T121 TC124.5-7 TA128 TA129 T164 TC165-6-7-8 TA169 S1000 6T72 R -F Unit KRK5 KRK5 KRK5A KRK5A KRK5 KRK5 KRK5A KRK5 KRK7 KRK7 KRK5A KRK5 KRK5 KRK5A KRK7 KRK5 KRK5 KRK5 KRK5 KRK5 KRK5B KRKSB KRK5A KRKSB Front Plate 73436 73436 74166 74166 73436 Chan. Sel. Actuating Shaft Shaft 73437 73437 74168 74168 73437 73439 73439 74167 74167 73439 Shaft Length Short Short Long Long Short 73436 74166 73436 74572 74572 74166 73436 73436 74166 74572 73436 73436 73436 73436 73436 73436 73436 74166 73436 73437 74168 73437 74573 74573 74168 73437 73437 74168 74573 73437 73437 73437 73437 73437 73437 73437 74168 73437 74439 74167 73439 f 74574 174577 174574 1 74577 74167 73439 73439 74167 f 74574 1 74577 73439 73439 73439 73439 73439 73439 73439 74167 73439 Short Long Short - - Long Short Short Long Short Short Short Short Short Short Short Long Short NOTE #1-KRK5 units may replacement of the front bpelactoen, vfienrteedtutnoinKgRsKh5aAft,byatnhde channel selector shaft. (Parts No. are replaced by Parts No. 74166, 7743146376,a7n3d473471a6n8d.)73439 XIX NOTE # verted 2-KRK5, to KRK7 KRK5A and by discarding KthRe Kfo5lBlo'wuinngitspamrtasy: be con- Stock Number Description 73465 Belt, fine tuning 73441 Cam, fine tuning 73634 Nut, speed nut 73436 Front Plate and Bushing 73464. Pulley, fine tuning 14343 Retainer for chan. sel. shaft 73437 Shaft, channel sel. 73438 Shaft, fine tuning 73439 Shaft, actuating 73454 Shield for belt 73456 *14166 "74167 "74168 Spring, belt tension Front Plate and Bushing Shaft, actuating Shaft, channel selector and replace with the following Parts: Stock Number 74572 74573 74574 74577 Description Front Plate and Bushing Shaft-Channel Selector Shaft-Fine tuning and Cam Assembly Spring Washer *The KRK5B unit is the same as the KRK5, except the inside front corner of the tuner shield is cut off diagonally. **These parts used with KRK5A only. KRK8 SERIES TUNERS Receiver Model 2T51-60 2T81 4T101 4T141 6T53-54-6465-71-74-75-76 6T84.86-87 7T103 -103B104 -104B -111B112 -112B-122122B -123-123B124-125/3-132 7T143 9T57-77-79 9T89 9T105-126-128 9T147 16T152 17T200-20111:20 21T208-1718-27-28-29 R -F Unit KRK8 KRK8 Chan. Sel. Fine Tuning Shaft Shaft & Cam 75159 75160 75159 75160 Insulating Front Washer Plate - 73466 (Round) - 73466 (Round) KRK8C 76133 76134 73466 (Round) 76754 KRK8C 76133 76134 73466 (Round) 76754 KRK8B 75159 KRK8B 75159 75160 75607 (Hex) 76135 75160 76507 (Hex) 76135 KTK8B 75159 75160 75607 (Hex) 76135 KRK8B KTK8B KRK8B KRK8B KRK8B KRK8B 75159 75159 75159 75159 75159 75159 KRK8D 76519 KRK8D 76519 75160 75160 75160 75160 75160 75160 76134 76134 75607 (Hex) 75607 (Hex) 75607 (Hex) 75607 (Hex) 75607 (Hex) 75607 (Hex) 75607 (Hex) 75607 (Hex) 76153 76135 76135 76135 76135 76135 76518 76518 NOTE # 1-Any KRK8 series r -f tuner can be changed from a KRK8 to a KRK8B or 8C, or vice -versa, by installing the proper parts as listed above for each unit. All other parts are identical. NOTE # 2-Front plate No. 76135 is for can be used on the KRK8B tuner. the KRK11 tuner, but NOTE # 3-The KRK8D r -f unit differs from the other units both mechanically and electrically. A KRK8D unit can be mechanically converted so as to be used in place of a KRK8, 8B or 8C provided that R13 is shorted out. However, the KRK8D has a wide range fine tuning control which might cause the fine tuning adjustment to be critical on non intercarrier receivers. In general, electrical conversions are not recommended due to the nature and amount of work involved. OSCILLATOR SWITCH WAFERS Some switches have a wax treated wafer. Heat, due to soldering operations, melts the wax and loosens the switch terminal on which the inductances are mounted. Operation of the switch causes variations in inductance during switch- ing operations. Tuning will vary, depending on the direction of approach of the channel selector switch. This is the result of compression and expansion of the coils mounted on the loose switch contacts. Therefore, when repairing r -f units, take care not to overheat the oscillator switch wafer. If the wafer is thus damaged, tical solution. replacement of the wafer is the most prac- XX R -F UNIT OSCILLATOR TRACKING The frequency of the r -f unit oscillator is a function of the circuit inductance and capacity, and since the steps of inductance are fairly well fixed on Channels 7 to 12, inclusive, the only sizeable variables that are available are (1) the capacity and (2) Channel 13 inductance. OSC. TUBE La LI, L,0 L9 L9 13 12 11 elO 9 e 7 Figure 3 -Simplified Schematic of R -F Oscillator. On KRK2, "C" consists of stray capacity, fine tuning capacity and (in some units only a "gimmic", a piece of insulated wire about 1/4 inch long) between the plate pins on the tube socket. On KRK5, KRK7 and new KRK8, "C" is composed of stray capacity and a real adjustable capacitor. On KRK2, "C" becomes less with a counter -clockwise rotation of the fine tuning control. On KRK5, KRK7 and KRK8, a clockwise rotation of the fine tuning control gives less capacity. To properly track an r -f unit oscillator on the high channels, the following process may prove helpful: 1. Make sure that the adjustment screws for Channels 7 to 12, inclusive, are spaced about 1/32 of an inch (11/2 turns from full in position) away from the rivets holding the inductance strap. 2. Tune for correct Channel 13 oscillator frequency by using the readily available adjustments for the purpose (a capacity trimmer on the KRK8 and an inductance slug on the KRK5.) 3. Without moving the fine tuning control, turn the detent to Channel 7 position and note the oscillator frequency. 4. If the noted frequency is higher than it should be, the Channel 13 capacity should be increased and the Channel 13 inductance should be decreased. Go back to Channel 13 and make the necessary changes to give both the correct frequency and an approximation of tracking correction. See Chart below. 5. If, on the other hand, the Channel 7 oscillator frequency is lower than it should be, the Channel 13 capacity should be decreased and the inductance increased. See Chart below. KRK2 To Increase Channel 13 Capacity To Decrease Channel 13 Capacity 1. Pick oscillator tube to give lower frequency. 2. Add a "gimmic" between oscillator tube socket plate pins or move the existing "gimmic" closer. (Use a production sample for reference -some units already have a "gimmic".) 3. Check cross feed capacitors for correctness of value. 1. Pick oscillator tube to give higher frequency. 2. Move "gimmic" away from plate pins. 3. Check cross feed capacitors for value. To Increase Channel 13 Inductance To Decrease Channel 13 Inductance The Channel 13 slugs are brass and normally inserted through the coil. If the slug screws stick out about 34 of an inch, they are in their minimum inductance position and any tuning, either in or out, gives a change toward the maximum inductance position. 1. Move Channel 13 slug in it the stud protrudes 34 of an inch, or less. Move out if they protrude more than 34 of an inch. 1. Move Channel 13 slug out if the stud protrudes 3,4 of an inch, or less. Move in if they protrude more than 34 of an inch. KRK5 AND KRK7 To Increase Channel 13 Inductance To Decrease Channel 13 Inductance 1. Screw brass slug out of Ll 1. Screw brass slug into Ll and L2. and L2. These slugs are available from the bottom of the r -f unit chassis and are normally cemented lightly. KRK8 To Increase Channel 13 Inductance To Decrease Channel 13 Inductance 1. Screw brass slug out of coil. 1. Screw brass slug into coil. This slug is available from front of unit only. On the KRK5, KRK7 and KRK8, the Channel 13 capacity adjustment is fairly obvious. Screwing the stud out gives less capacity; in, gives more capacity. After the proper adjustments have been made to give oscillator tracking within 1.0 mc. or so from 13 to 7, each channel can be individually aligned by using the available screw trimmers. For field use in areas having two or more high channel stations, a slightly different approach may be taken: 1. If the highest high channel is aligned with the fine tuning centered and the lowest high channel calls for a clockwise rotation of the fine tuning control, Step 4 applies for KRK2 and Step 5 for all other units. 2. If the highest high channel is aligned with the fine tuning centered and the lowest high channel calls for a counterclockwise rotation of the fine tuning, Step 5 applies for KRK2 and Step 4 for other units. Step 4 means an increase of Channel 13 capacity and a decrease of inductance. Step 5 means a decrease of Channel 13, capacity and an increase of inductance. USE OF WR39A & WR39B TELEVISION CALIBRATORS In some instances it may be difficult to hear the heterodyne beat between the variable oscillator and the crystal standard in subject instruments, particularly at the high frequencies. If the audio system of the receiver under test is in good condition, it is suggested that an audio lead can be run from the head phone jack of the calibrator to the "high" side of the volume control of the television receiver, thus utilizing the additional audio amplification available in the television chassis. CORRECTING PIX I -F RESPONSE OF RECEIVERS USING KRK5, KRK7 or KRK8 R -F UNITS Curve "A" below illustrates a normal pix i-f response. Curves "B" and "C" below, illustrate results that are obtained in some cases due to abnormal conditions in the i-f system. "Correcting" Curve "B", by using the adjusting slugs, usually results in placing the pix carrier minus .75 mc. point at the top of the curve which, again, is not the proper alignment. "Correcting" Curve "C", usually results in very much reduced gain and an excessive amount of adjacent channel response. To correct Curve "B" with the minimum amount of bad effects, the turns of the second pix I -F trap (T-102) should be moved away from the primary of the same transformer. Moving the whole trap coil about two or three nicks up the coil form is usually sufficient. To correct Curve "C", the following must be checked: 1. Make sure that the cathode sound trap is not shorting. 2. Check the sound I -F alignment. 3. Check sweep and scope response by removing "blanking" on the sweep and checking for response overlap. (A defective scope cable or input can cause overshoot on this side of the response curve.) 4. If none of the above results in a satisfactory curve, then the sound take -off trap coil (T-103) should be moved up and away from T-103 primary. One notch on the coil form is usually sufficient. 21.851"C 24.75 mc 4.75 mC 2 mC 24.75 mC PIX PI PIX NORMAL OBJECTIVE OEFECTIV SOUND SOUND SOUND Figure 4 -Overall Response Curves HIGH PASS FILTER FOR REJECTION OF INTERFERING SIGNALS BELOW 50 MC. If interference is experienced due to the presence of strong signals below 50 mc. it can usually be eliminated by the use of a high pass filter. To be effective, the filter must be installed at the r -f units with as short leads as possible and the case of the filter connected to the r -f unit chassis. Figure 5 shows the method of attaching the antenna input connectors to the filter so that it can be "plugged" directly into the antenna matching units employed with KRK5, KRK7 and KRK8 r -f tuners. Figure 6 shows the method of mounting the filter on receivers employing KRK2 r -f units. XXI ADJUSTMENT OF THE AGC CONTROL ON 17T200 AND 21T208 SERIES RECEIVERS In setting the AGC control on these and other RCA receivers, care must be taken that the receiver is generating the maximum AGC voltage which will be required for that particular location of the receiver. If the AGC control is adjusted on a weak signal, the receiver may overload, bend on sync etc. when a stronger signal is received. One source of difficulty not likely to be suspected is the position of the fine tuning control. If the AGC control is adjusted with the fine tuning set so that the picture carrier is low on the slope of the i-f response curve, then the receiver may overload, bend on sync, etc. when the picture carrier is moved up the slope with the fine tuning control. The obvious cure is to set fine tuning so that the picture carrier is well up the slope (fine tuning ccw on KRK8) when making final adjustment of the AGC control. SOLDER GROUND WIRE NO.14 SOLID WIRE COVERED WITH SPAGHETTI TUBING MS305A STOCK NO. 39153 Figure 5-Filter for KRK5, KRK7 and KRK8 R -F Units HIGH VOLTAGE ARCS AT KINESCOPES During days of humid weather, difficulty may be experienced with arcing across the bell of metal cone picture tubes due to a collection of dust and moisture around this area. In the past, many remedies have been suggested, all of which have been helpful for a short period of time. The best field remedy found to date has been an application of "Car -Plate", mfd. by S. C. Johnson & Son, Racine, Wis. The following procedure should be employed: 1. Remove the entire coating on glass bell, using methanol or acetone. 2. Wash the glass bell thoroughly with a good detergent. 3. Dry the glass bell thoroughly. 4. Apply a good coating of Johnson's "Car -Plate". Allow to dry, then wipe off the white residue. Brush application is satisfactory. *14 SOLID WIRE COVERED WITH SPAGHETTI TUBING SOLDER TO CHASSIS Figure 6-Filter for KRK2 R -F Units FIXED COMPOSITION RESISTOR STOCK NO. CODE The RCA six digit stock number for fixed composition resistors. The first digit will always be 5. The second digit is to indicate the wattage. 0 =1/2 watt, 1=1 watt, 2=2 watt. The third digit is to indicate the resistor tolerance. 2 = 5%, 3=10%, 4=20%,. The fourth digit is for the number of zeros following the significant figures of the resistor value. The fifth and sixth digits are for the significant figures of the resistor value. Example 503268 is the stock number of a 1/2 watt, fixed composition resistor, 6800 ohms ±10%. A few resistors are still being listed in the Service Data under four or five digit stock numbers. This is because there are still some of these resistors in stock packaged under the old stock numbers. However, as these are depleted, the new stock will be carried under the six digit stock number system. Wire wound or other special resistors will continue to carry four or five digit stock numbers. XXI I TELEVISION RECEIVER MODELS AND CHASSIS Receiver Models TT5 (PRE WAR) TRK5 (PRE WAR) TRK9 (PRE WAR) TRK90 (PRE WAR) TRK12 (PRE WAR) TRK120 (PRE WAR) 621TS 630TS Television Chassis KC -3 or KC-3Bt KC -3A or KC-3Ct KC -4A or KC-4Ct KC -4H KC -4 or KC -413f KC -4F or KC -41t KCS21 KCS20A or KCS20C-2t 630TCS KCS20B or KCS20D-2t 641.TV KCS25A-1 or KCS25C-2t 648PTK KCS24-1* KRS20-1** KRK1-1*** 648PV KCS24A-1* KRS20-1** KRK1A*** 721TS KCS26-1 or KCS26-2t 721TCS KCS26A-1 or KCS26A-2t 730TV1 730TV2 741PCS KCS27-1 or KCS27-2t KCS24B-1* KRS20A-1** KRK1A-1*** 8PCS41 8PCS41B 8PCS41C KCS24B-1* KRS20A-1** KRK1A-1*** KCS24C-1* KRS20B-1** KRK4*** KCS24C-1* KRS20A-1** KRK1A-1*** 8TS30 KCS20J-1 or KCS20K-2t 8TV41 KCS25D-1 or KCS25E-2t 8T241, 8T243, 8T244 KCS28 8T270 8TC270, 8TC271 8TR29 8TK29 8TK320 8TV321 8TV323 9PC41(a) 9PC41(b), 9PC41(c) KCS29 KCS29A KCS32 or 32B KCS32A or 32C KCS33A-1 KCS30-1 KCS30-1 KCS24C-1* KRS20B-1** KRK4*** KCS24D* KRS20B-1** KRK4*** 9T240 9T240K 9TC240 KCS28 KCS28A KCS28B 9TC245, 9TC247, 9TC249 KCS34B or KCS34 in some 247 & 249 9T246 KCS28C or KCS38 9T256 9T270 9TC272, 9TC275 KCS38C KCS29 KCS29C 9TW309 KCS41-1 9TW333 KCS30-1 9TW390 KCS31-1 Radio - Chassis RC429 & RS89A RC427A & RS83E RC427G & RS83E RC427 & RS83E RC427F & RS83E RK117A RK121A RK121A RC610A RC610B RK117A . RK135 or 135A RK135 or 135A RK135A-1 RC616C or K RC616B or J . RK135C RC616N RC617A Record Changer 960001 (78 RPM) Kine- R -F scope Tuner 5BP4 5 channels 5BP4 5 channels 9AP4 5 channels 9AP4 5 channels 12AP4 5 channels 12AP4 5 channels 7DP4 KRK2 10BP4 KRK2 10BP4 KRK2 10BP4 KRK2 5TP4 KRK2A RP176 (78 RPM) RP177 RP177 5TP4 KRK2A 10BP4 KRK2B-1 10BP4 KRK2B-1 10BP4 KRK2B-1 10BP4 KRK2B-1 5TP4 KRK2A 5TP4 KRK2A 5TP4 KRK2A 5TP4 KRK2A RP177A (78 RPM) RP178 RP178 10BP4 KRK2 10BP4 KRK2 10BP4 KRK5 16AP4 KRKSA 16AP4 KRKSA 10BP4 KRK5 10BP4 KRK5 16AP4 KRK5A 10BP4 KRK5 10BP4 KRK5 5TP4 KRK2A 5TP4 KRK2A 10BP4 KRK5 10BP4 KRK5 10BP4 KRKSA 12LP4 KRK5 10BP4 KRK7 10BP4 KRK7 10BP4 KRK7 16AP4 KRKSA 16AP4 KRKSA RP178 (78 RPM) 12LP4 KRK5 RP168A-1(45RPM) RP178 (78 RPM) 10BP4 KRK5 RP168A-1(45RPM) RP177B (78 RPM) 16AP4 KRK5A RP168A-1(45RPM) Speaker Television Audio Size Power Supply Amplifier None 12" EM 12" EM 12" EM 12" EM 12" EM KK-7A or KK-7Et KK-7H KK-7 or KK-7Dt KK-7F or KK-7lf 4"x6" EM 5" EM 12" EM 12" EM 12" EM KRS21 RS123A RS123A 12" EM KRS21A-1 RS123B 4"x6" EM 12" EM 12" PM 12" PM 12" EM KRS21A-1 12" EM KRS21A-1 12" EM KRS21A-1 12" EM KRS21A-1 RS123C RS123C RS123C RS123C 5"x7" PM 12" EM 5"x7" PM 8" PM 8" PM 5"x7" PM 12" PM 12" PM 12" PM 12" PM 12" EM 103S21A-1 12" EM KRS21A-1 RS123A RS123A RS123A 5"x7" PM 5"x7" PM 12" PM 12" PM 5"x7" PM 5"x7" EM 5"x7" EM 8" PM 12" PM 12" PM 12" PM 12" PM t50 Cycle Chassis *R -F I -F, Video Chassis **Deflection & HV Chassis ***Optical Barrel TELEVISION RECEIVER MODELS AND CHASSIS Receiver Models T100 T120, T121 TC124, TC125, TC127 TA128 Television Chassis KCS38 KCS34C KCS34B KCS42A Radio Chassis RK135D TA129 KCS41A-1 RK135D T164 TC165, 166, 167, 168 TA169 KCS40 KCS40A KCS43 RK135D S1000 KCS31-1 RC617B 2T51 2T60 2T81 KCS45 KCS45A KCS46 RC1090 4T101 4T141 KCS61 KCS62 RC1090 6T72 6T53, 6T54 6T64, 65, 71, 74, 75, 76 6T84 6T86, 6T87 KCS40B KCS47 or 47T KCS47A or 47AT KCS48 or 48T RC1090 KCS48 or 48T RC1092 7T103, 7T104 7T103B, 7T104B 7T112, 122, 123, 124 7T112B, 122B, 123B, 125B 7T112B, 122B, 123B 7T111B 7T132 7T143 KCS47B KCS47F KCS47C KCS47G or GF KCS47GF-2 KCS47GF-2 KCS47D KCS48A RC1092 9T57 9T77, 9T79 9T89 KCS49 or 49T KCS49A or 49AT KCS60 or 60T RC1092 9T105 9T126, 9T128 9T147 KCS49B, 49BF or 49BF-2 KCS49C, 49CF or 49CF-2 KCS60A RC1092 16T152 17T150 17T151, 17T163 17T153, 154, 155, 160 17T162, 17T174 17T172, 17T173 17T172K, 17T173K 17T174K 17T200, 17T201, 17T202 17T211, 17T220 17T250DE 17T261DE 21T159 21T159DE 21T165 21T I66DE 21T176, 177, 178, 179 21T174DE, 178DE, 179DE 21T197DE 21T207, 21T207G 21T208, 21T217, 21T229 21T218, 21T227, 21T228 21T242 21T244 KCS47E KCS66C KCS66C KCS66 KCS66A KCS66A KCS66D KCS66D KCS72 KCS72 KCS74 KCS74 KCS68E KCS68F KCS68E KCS68F KCS68C KCS68F KCS68H KCS72A KCS72A KCS72A KCS72D-1 KCS72D-2 RC1111A RC1117B-1 RC1111B Record Changer Kine- R -F scope Tuner 10BP4 KRK7 12LP4 KRK5 960282 (33/78) RP168 (45 RPM) 12LP4 KRK5 12LP4 KRK5 960282 (33/78) 12LP4 KRK5 RP168C (45 RPM) 960285 (33/78) RP168C (45 RPM) 16GP4 KRK5B 16GP4 KRK5B 16GP4 KRK5B 960285 (33 /78) 16AP4 KRK5A RP168C (45 RPM) 960282 (33/78) RP168 (45 RPM) 12LP4 KRK8 12LP4 KRK8 12LP4 KRK8 14EP4 KRK8C 960282 (33 '78) 14EP4 KRK8C RP190-2 (45 RPM) 16GP4 KRK5B 960282 or 284 RP168 or 190 960282 or 284 RP168 or 190 16GP4 KRK8B 16GP4 KRK8B 16GP4 KRK8B 16GP4 KRK8B RP190 17CP4 KRK8B 17GP4 KRK8B 17GP4 KRK8B 17GP4 KRK8B 17GP4 KRK8B 17GP4 KRK8B 17CP4 KRK8B 960284 (33 /78) 17CP4 KRK8B RP190 (45 RPM) 960284 (33 /78) RP168 or 190 19AP4A KRK8B 19AP4A KRK8B 19AP4A KRK8B 19AP4A KRK8B Speaker Size 5"x7" EM 5"x7" PM 12" PM 12" PM 12" PM 8" PM 12" PM 12" PM 12" PM 5"x7" EM 12" PM 12" PM 5"x7" PM 12" PM 12" PM 8" PM 12" PM 12" PM 12" PM 8" PM 8" PM 12" PM 12" PM 12" PM 8" PM 12" PM 12" PM 8" PM 12" PM 12" PM 8" PM 19AP4A KRK8B 12" PM 960284 (33.'78) RP190 (45 RPM) 930409 930409 930409 19AP4A KRK8B 12" PM 16GP4 KRK8B 17QP4 KRK11 17QP4 KRK11 17GP4 KRK11 17GP4 KRK11 17GP4 KRK11 17CP4 KRK11 17CP4 KRK11 17QP4 KRK8D 17QP4 KRK8D 17QP4 KRK11A 17QP4 KRK11A 21AP4 KRK11 21AP4 KRK11A 21AP4 KRK11 21AP4 KRK11A 21AP4 KRK11 21AP4 KRK11A 21AP4 KRK11A i 21AP4 KRK8D 21AP4 KRK8D 21AP4 KRK8D 21AP4 KilK8D 21AP4 KRK8D 8" PM 4"x6" PM 8" PM 8" PM 8" PM 12" PM 12" PM 8" PM 5" PM 8" PM 8" PM 12" PM 8" PM 8" PM 12" PM 12" PM 12" PM 12" PM 12" PM 5" PM 8" PM 12" PM 12" PM 12" PM XX I I I Television Audio Power Supply Amplifier RS141A - RS141C RCA RENEWAL PRODUCTS RECEIVING TUBES AND KINESCOPES With RCA Receiving Tubes and Kinescopes, Top Quality Control makes the difference. The RCA brand on any tube is your best assurance of dependable performance in every AM, FM, television, and industrial application. ELECTRONIC COMPONENTS, AND SERVICE PARTS When you need one of the more than 40,000 exclusive RCA Service Parts or one of the versatile new RCA "Universal" type TV components, you can rely on RCA's unparalleled quality. A 'Dio EA 1i`' TEST EQUIPMENT RCA Blue Ribbon instruments-preferred by professionals in servicing, production, and research. Manufactured to exacting standards by professionals ... for professionals. BATTERIES Dealers and technicians who recommend RCA Radio Batteries help to ,build their own radio businesses. They sell a complete top -volume battery line of unsurpassed quality backed by the merchandising power of the famous RCA Monogram. Repeat business with satisfied customers is a valuable plus enjoyed by RCA Battery dealers. RCA RADIO -TV Service Information TUBE PICTUPE BOO,. ofuthoriothee Complete RCA VICTOR SERVICE DATA * Schematics * Alignment Procedures * Waveforms * Trouble -shooting Suggestions * Wiring Diagrams * Production Changes Accurate servicing information on all RCA Victor Radio, Phono, and TV sets ... data which can't be found elsewhere ... is at your fingertips with the famous Bound Volumes of RCA Victor Service Data. Here is detailed, authoritative information for the rapid, profitable servicing of any RCA Victor home instrument. Prepared by RCA servicing experts, RCA Victor Service Data will give you the information you need to know in the fastest possible time. Watch your job turn -over time on RCA Victor sets decrease once you use this authentic servicing aid. You'll save time and dollars by maintaining a complete file of these handsome, sturdily bound volumes of RCA Victor Service Data. See your local RCA Parts Distributor today. RCA's Comprehensive Literature Gives You The Servicing Information You Need. For Quick, Ready Answers To All Your Servicing Problems ... Get Authentic RCA Literature From Your RCA Distributor! UCTS Gee'Otifi RCA Distributor XXV I CRYSTAL CARTRIDGE DRAWING CODE "A" Top Needle Hole "B" Viacoloid Damper "C" Thick (5/16 -in.) Mtg. Hole "D" Thin (7/32 -in.) Mtg. Hole "E" Grounded Lug "F" Small Weight "G" Large Weight "H" Large "Cut" Weight ""KJ"" 5/8 -in. Needle Screw 11/16 -in. Needle Screw "L" 13/16 -in. Needle Screw "M" 15/16 -in. Needle Screw 1-1 FIG. I MS 1151 A FIG. 2 MS 1151 B RCA CRYSTAL PICKUP DATA FIG. 20 F IG . 28 GUABD TOMONALS 15-11-Tis FIG.12 MS 1151 7 MS 1151 K STYLUS CoARO OSMAN ST,. FIG.21 - TITO, NAL 1 FIG. 29 1411 a --M 0 0 ARM. STOP SCREWS 152 A FIG. 13 MOUNTING HOLES CABLE FIG.22 TERMINALS SANNIME GUARD 1 /S O0 SAPPHIRE. MS 1151 C STYLUS GUARD SCREW FIG. 14 etc tcmcao PICKUP BE NOLORTI MS 1151 D FIG. I5 FIG. 23 PRIAM TO NEEDLE GVARO TmooNALS SPOA.Ot POT SAMNPM Fig. 101 Fig. 102 FIG.24 ITININIALS U SAPPHIRE Fig. 103 OSMIUM Fig. 104 MS 1151 E FIG. 16 MS 1151 r FIG.17 MS 1151 G sAmeetwag FIG. 18 co.uc's FIG. 25 w 0 0 MS 1151 H MS 1151 1 FIG.I9 0 0 (,) RE FIG. 27 OR RI. ACK DOT Fig. 105 SAPPHIRE Fig. 1 07 OSMIUM Fig.108 OSMIUM Fig. 109 ° SPOmr.0( dig" Fig. 110 Fig. 111 Fig. 112 MODEL vs. PICKUP CARTRIDGE Model Record Cartridge Changer Stock No. A-55 A-78 A-82 A-91 A-101 A-106 A-108 0-50 QEY-3 QEY-4 RP -168 74625 960282-1 f 75044 RP -168 74625 960282-1 t 75044 RP -168 74625 RP -190-2 * 75575 960282-4 or -5 t 75475 RP -168 74625 RP -190-2 75575 960284-1 or -2 t 75475 RP -190-2 75575 960282-4 or -5 or I f 75475 960284-1 or -2 J RP -168 960285-1 RP -168 RP -190-2 960284-1 or -2 RP -168 RP -190-5 74625 I- 75044 74625 75575 t 75475 33217 74984 76297 QEY-5 QJY QJY-2 OU-2C OU-3C RP -190-5 RP -168 RP -190-5 76297 74984 76297 33905 33905 QU-5C OU-51C QU-52C QU-56C 01.1-61 QU-62 QU-68 OU-72 QU-72A R-56 R-60 R-89 R-91 R -93B R -93C RP -145E RP -145E RP -152S 960001-4 960001-4 960001-4 33905 35171 35171 33122 39851 39851 39851 39851 39851 39686 33122 31050 31050 31050 31050 R -93F R -94B R-98 R-100 R -103S R -560P R -566P S-1000 TA -128 TA -129 RP -162 RP -168 960285-1 RP -168 960282-1 RP -168 960282-1 33122 31050 31156 33122 33122 33122 38610 74625 t 75044 74625 f 75044 74625 t 75044 TA -169 U-8 U-9 U-10 U-12 U-20 U-25 U-26 U-30 U-40 U-42 U-43 U-44 U-45 U-46 RP -168 960285-1 RP -132M RP -132M RP -132M RP -139A RP -145 RP -145 RP -145 RP -139A RP -140 74625 t 75044 33122 33122 33122 33905 33905 31156 31156 31156 35171 35171 35171 35171 35171 33905 U-50 U-104 U-106 U-107 U-108 RP -129B (9820) RP -129A (9820) RP -129 (9820) 33217 31050 14820 14820 14820 U-109 U-111 U-112 U-115 U-119 RP -129 (9820) 14820 31050 31050 31050 31156 U-121 U -122E UY-122E U-123 U-124 RP -139B 31050 31156 31156 31156 31156 Model UY-124 U-125 U-126 U -127E U-128 U-129 U-130 U-132 U-134 V-100 V-101 V-102 V-105 V-135 V-140 V-170 V-175 V-200 V-201 V-205 V-209 V-210 V-215 V-219 V-221 V-225 V-300 V-301 V-302 V-405 VA -15 VA -20 VA -21 VA -22 VA -22A VA -24 VHR-202 VHR-207 VHR-212 VHR-307 VHR -407 2 -S7 -ED 2-T-81 4 -0V -8C 4-T-141 6-J 6-JM 6-0U 6-QU-3 6-QU-3Y 6-0V-3 6-T-84 6-T-86 6-T-87 7-0V-5 7-T-132 7-T-143 8-QU-5C 8 -TV -41 8 -TV -321 8 -TV -323 8-V-7 8:V-90 8-V-91 8-V-112 8-V-151 9-EY-3 9-EYM-3 9-EY-31 9-EY-32 Record Cartridge Changer Stock No. RP -132C RP -132 31156 31156 31156 31050 31156 RP -132F RP -132C RP -132B RP -132B 31156 31156 32632 32632 33122 RP -162 RP -162 33122 33905 33122 38610 38610 RP -152 RP -158 RP -152A RP -152A RP -152B 35171 38610 35171 35171 37158 RP -158 RP -158 RP -160 RP -160 RP -160 RP -151 Top RP -151 Bott. RP -152J RP -153 RP -153 RP -152J 38610 38610 138453 39550 f38453 39550 f38453 39550 38453 38598 37158 33905 33905 37158 RP -152 RP -139D RP -145C 35171 31050 33122 31156 33905 RP -145C RP -155 RP -155 RP -161 33905 37158 37158 38610 RP -155 RP -155 RP -168 RP -190-2 960282-4 or -5 RP -168 960282-2 37158 37158 73839 74625 75575 t 75475 S-5578 f S-5652 RP -190-2 960282-4 or -S RP -178-3 75575 t 75475 70338 70338 33122 72551 RP -168 RP -178-3 RP -168 RP -190-2 960282-4 or -S RP -168 RP -190-2 960284-1 or -2 RP -168 RP -190-2 960284-1 or -2 74984 72551 74625 75575 f 75475 74625 75575 t 75475 74625 75575 t 75475 960001-4 RP -190-2 RP -190-2 960284-1 or -2 RP -177A 39851 75575 75575 t 75475 34307 72551 RP -178 RP -178 RP -178 RP -178 RP -178 72551 72551 72551 72551 72551 RP -178 RP -177B RP -168 RP -168 RP -168 RP -168 72551 70339 74067 74067 74625 74625 Model 9-EY-35 9-EY-36 9-JY 9-JYM Record Cartridge Changer Stock No. RP -168 RP -168 RP -168 RP -168 74067 74067 74067 74067 9-0V-5 9-T-89 9-T-147 9-TW-309 9-TW-333 RP -168 960282-2 RP -168 RP -190-2 960284-1 or -2 RP -190-2 960284-1 or -2 RP -168 RP -178 RP -168 RP -177 S-5578 t S-5652 74625 75575 t 75475 75575 t 75475 74625 72551 74067 j 72551 9- TW-390 9-W-51 9-W-78 9- W-101 9-W-102 RP -168 RP -177 RP -168 RP -168 RP -178 RP -168 RP -168 74067 I 72551 74625 * 74625 I 72551 74067 74067 9-W-103 9-W-105 9-W-106 9-Y-7 9-Y-51 RP -168 RP -168 .RP -178 RP -168 RP -178 RP -1.68 RP -168 74067 74067 72551 74625 I. 72551 74067 74625 9-Y-510 9-Y-511 11-QU 12-0U 45-EY RP -190-1 or -4 RP -168 RP -132A RP -132A RP -168 45-EY-1 45-EY-2 45-EY-3 45-EY-15 RP -168 RP -190-1 or -4 RP -190-1 or -3 RP -168 45-J 45-J-2 45-J-2 45-J-3 45 -VV -9 RP -168 RP -190-1 or -4 RP -190-6 RP -193 RP -190-2 45 -VV -10 RP -190-2 55-U, 55 -AU 960015 58-V, 58 -AV 960001-1 59-1/-1 960001-2 59 -AV -1 960001-2 62-1 63-E 63 -EM 65-13 65 -AU 960260-2 960260-2 960260-2 65-110j-1 66-E 66 -ED 66-E-1 67 -V -I 960260-2 960260-1 175476 .76318 74625 31156 31156 J74067 74625 74067 f75476 76318 f75476 76318 74067 74067 175476 76318 74067 76257 75575 75575 J71173 70338 39851 70332 70332 70338 70338 70338 70338 70338 70338 70332 70332 70332 70338 67 -AV -1 75-ZU 77-V 77-V-1 77-V-2 960260-1 RP -178 or 960276 RP -178 960260-1 960260-1 70338 72551 70338 72551 70338 70338 610-V-1 610-11-2 612-17-1 612-V-3 612-11-4 960001-5or-6 or RP -177 960001-5 or -6 or RP -177 RP -176A or RP -176B RP -176 or RP -176B RP -176 or RP -176B 39851 72551 39851 72551 70339 70339 70339 641 -TV 648 -PV 710-V-2 711-V-1 711-V-2 960001-1 or -6 RP -176 RP -177 or RP -177A 960001-5 960001-5 39851 70339 72551 39851 39851 Model Record Cartridge Changer Stock No. 711-V-3 960001-5 730 -TV -1 RP -177 or RP -177A 730 -TV -2 RP -177 or RP -177A = 45 r.p.m. t =78/33 r.p.m. t=78 r.p.m. 39851 72551 72551 PICKUP CARTRIDGES WITH NEEDLE SCREW Stock No. 14820 30708' 31050 31156 32632' Fig. No. 1 2 3 4 4 33122' 5 332174 6 33905 7 34225 8 34307 9 34710 10 35171' 7 37158 11 39686' 12 71173 15 'Discontinued: 30708-.use 14820 32632-.use 31156 33122-.use 9890 33217 -.use 9890 33905-.use 37158 35171-.use 37158 39686-.use 9890 PICKUPS WITH REPLACEABLE STYLUS Pickup Stock Fig. No. No. 9890 16-ZN 38453' 17 -AL 38598 38610 39851' 18 13 19-ZN Stylus Stock Fig. No. No. 39863' 101 38449' 102 38449' 39564 103 39863 101 39550 17-ZN 38449' 102 39919 17 -AL 38449' 102 70332' 19 -AL 38449' 102 70338 14 -AL 72345 101 70339 14 -AL 70915 102 72551 14-ZN 72345 101 73839 20 73840 104 74067 21 74068 105 74625 21 74818 106 74984' 22 75044 23 75475 24 74985 107 750450 108 750461) 108 754960 109 75497® 109 75575 2S 75770 110 75976 16-ZN 39863' 101 76257 f26 763747, Ill 27 76323.!, 112 76297° 28 76318' 21 S-5652° 23 74985 107 75496 109 750450 108 75046® 108 PICKUPS WITH FIXED STYLUS Stock Fig. No. No. S-5578° 29 75476" 30 ZN= Zinc case, AL = Aluminum case °Ceramic type pickup 'Discontinued: 38449-.use 70915 38453-.use 39919 39851-,use 75976 39863-.use 73345 70332-.use 75976 74984-.use 76297 75476-use 74067 76318-.use 74067 0331/2 r.p.m.-RED 078 r.p.m.-PLAIN .vFor pickups marked 988370-1 For pickups marked 988370-2 S-5652 and S-5578 are available only thru RCA International Div. 2 B 400 Grey 2 B 403 Green 2 B 400 SERIES 2 B 401 Black 2 B 404 Tan 2 B 402 Ivory 2 B 405 Red RCAVI CTOR Battery Operated Personal Receiver 2 B 400 Series Chassis No. RC -1114 SERVICE DATA - 1952 No. 5 - PREPARED BY RCA SERVICE CO., INC FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. Tuning Range Intermediate Frequency Tube Complement: 1. RCA 1R5 2. RCA 1U4 3. RCA 1U5 4. RCA 3V4 Loudspeaker Size and type Voice coil impedance Weight (with batteries) Specifications 540-1600 kc 455 kc Converter IF. Amplifier Det. A.F.Amp. A.V.C. Output Batteries Required: Type of Battery "A"-1.5 volt (two)} RCA VS 236 "B"-67.5 volts RCA VS 216 Current Drain Normal Pos. Saver Pos. 0.25 amp. 0.20 amp. 8.45 ma. 5.45 ma. Battery life is approximately 100 hrs. intermittent service with battery -saver switch in "Normal" position. With switch in "Saver" position, battery life is increased approximately 30%. 2" x 3" P.M. 113/4 ohms at 1000 cycles approx. 33/4 lbs. Power Output: Undistorted Maximum Dimensions (over-all) 075 watt 0.10 watt approx. VA" x 51/4" x 21M6" MAX. POWER BATTERY LI FE SAVER EXTRA BATTERY LIFE OFF -ON VOLUME TUNING KNOB Case Back To remove-insert small coin in the slot at top rear of case and pry open. To replace-insert bottom edge into case and snap top edge in place. Cff-On Indicator A window in the case (just below edge of volume control knob) indicates whether set is turned ON or OFF. "ON" appears in window when set is turned ON and disappears when set is turned OFF. Battery -Life Saver Switch Maximum power is obtained when the slider button is pushed toward left (outer edge of case). Extra battery life with slight effect on performance is obtained with the slider button pushed to the right (toward center of case). Controls Battery Life 0 The life of the "A" and "B" batteries is approximately equal. For best performance all batteries should be replaced at the same time. 2 2B400 Alignment Procedure Output Meter.-Connect meter to voice coil terminals. Turn volume control to maximum position. Test-Oscillator.-For all alignment operations, connect the low side of the test -oscillator to the receiver chassis, and keep the oscillator output as low as possible to avoid a -v -c action. Note:-The ant. coil is supplied pre -adjusted and cemented to rod. This makes further adjustment unnecessary. However when replacing ant. assembly make certain that the coil end of the rod is fully entered in its rubber mounting grommet but does not extend through the grommet more than is required to permit the opposite end to fit inside the case. Steps Connect high side Tune test- Turn radio of test osc. to- osc. to- dial to- Adjust the following for max. output- 1 High side of ant. 2 coil (terminal lug on coil which is connected to Pin #6 of IRS tube) 3 455 kc Quiet point near 1600 kc Trimmers of 2nd I -F trans Trimmers of 1st I -F trans. Repeat steps 1 and 2 Replacement of Component Parts I. To Remove Back Cover a. Depress top of case midway between the handle supports, until the top end of the back separates from the main case. b. Pull the back cover back and up, thereby unhooking the retaining lugs in the bottom of the main case. 4 1400 kc Short wire placed 5 near ant. coil for radiated signal 600 kc 14 Rock gang Cl-IT (osc.) 60 Rock gang L2 (osc.) 6 Repeat steps 4 and 5 II. To Replace Batteries a. Remove back cover. b. Remove both "A" and "B" batteries. The "B" battery snap fasteners can best be removed by inserting a screwdriver under the snap fastener strip and prying upward. c. The "A" batteries can easily be removed by pulling up on the spring wire clips. Note: The "A" and "B" batteries have approximately equal life and therefore it is advisable to replace all batteries at one time. III. To Remove Chassis a. Remove dial knob by grasping with finger tips at two sides and pulling. b. Remove back cover. c. Remove batteries. d. Remove "A+" contacts by squeezing against case and sliding out of slots in case. e. Remove the four screws "A." f. Grasp the assembly by the speaker and Pull the bot- tom end down and outward to clear the volume control knob. VOLUME CONT. L SWITCH SCREWS A OSC. COIL 600 K C C1-1 TRIMMER OSC. 1400 KC ANT. ROD FLUSH WITH GROMMET FERRITE ROD ANTENNA BATTERY SAVER SWITCH SCREWS A IV. To Replace Chassis a. Observe the position of the battery save button extension in relation to the "battery -save" switch. This extension mu: engage with the center of the battery save switch. b. Replace in reverse order to that given for chassis removal. "B" BATTERY CONNECTOR 3 V4 OUTPUT 1U4 I.F. AMR -rotk" BATTERY CONNECTORS V. To Remove Handle a. Spread the square spring wire clips by pulling on one side of a clip. b. Allow the clip to return to its original shape but resting on the outside of the case. c. Pull the other side of the clip out of the case. VI. To Replace Battery Save Switch Button a. Remove chassis. b. Spread the open end of the spring clip retainer no more than necessary to permit removal of clip. c. Slide the clip clear of the slider button. d. Turn slider button one -quarter turn and pull out of case. e. Replace button in reverse order-do not use excessive force in replacing spring clip. 455 KC 2ND. I.F. TRANS. ANT. ROD FLUSH WITH GROMMET TUNING CONDENSER BATTERY CLIPS 1 U5 14141 ET/AF WWA 3V4 W4 Imk O 1ST. I. F. TRANS. 455 KC BATTERY SAVER SWITCH Tube and Trimmer Locations 2 VI 1 RS CONVERTER 6 CI -2 7.5-180_4 RI 100K 0 -MM 3 IL. V2 1 U4 I. F. TI 5 GRN. 6 II CS 3 R3 C6 4.7 MEG. r 11 RED 'uV3s DET.-A.F.-A.V.C. ICaz101 T2 -II 4 GRN. 6 1C0123 CO R5 47K 11C829 - R9 1 MEG. R7 4:7 ME A , L3 R2 15 K E D 1.0G14 "-FERRITE ROD [5C67 R4 3.3 CII R6 2 MEG. 2 .002 MEG. VOLUME CONTROL C8 R8 R12 10 MEG. 1000 3 2B400 V4 3V4 OUTPUT BLU T3 C12 .001 5 IC14 0 02 P.' g 3 RED.' P M. SPEAKER BATTERY SAVING SW ITCH 22,520 R10 3.3 MEG C15 10 ME S1 ON VOL. x 4 CONTR.- )03 "A" BATTERY 67/z V. "B" BATT. ALL RESISTANCE VALUES IN OHMS. K = 1000. ALL CAPACITANCE VALUES LESS THAN 1.0 IN MF. AND ABOVE 1.0 IN MME UNLESS OTHERWISE INDICATED. Schematic Diagram C 4 8 4 3 6 R13 390 R11 390 In some chassis the on -off switch terminals are not in the order shown in the wiring diagram. USE CONTINUITY CHECK when connecting replacement control. R3 T3 C6 -I R3 I RI1 4 2,i. to 52 1 ANTENNA I 11 LI TO SPEAKER TO"B" BATTERY INDICATES GROUND SOLDERED TO CHASSIS 2 co BLK C11 RED GRN VZ J _J al CI -1 T2 del BOTTOM VIEW 2 BLK S \ T1 BLK- III C8 C1-2 BRN CI -1 VI BRN- C2 To"A"BATTERY H RI 0-48797-0 Connection Diagram CRITICAL LEAD DRESS 1. Position Ferrite antenna rod as described above. 2. Dress all bus wires, pigtail leads and non -insulated com- ponents away from chassis base and away from each other. 3. Dress neutralizing capacitor C5 against front of chassis and with clearance under volume control knob. Utilize shielding effect of oscillator coil mounting bracket. 4. Dress all I -F transformer leads down to base. 3 4 2B400 Replacement Parts STOCK No. DESCRIPTION CHASSIS ASSEMBLIES RC 1114 76847 Antenna-Ferrite rod antenna (LI) 76846 Capacitor-Variable tuning capacitor (C1-1, C1-2) 57090 Capacitor-Ceramic, 3 mmf. (C5) 75784 Capacitor-Ceramic, 56 mmf. (C2, C7) 75785 Capacitor-Ceramic, 82 mmf. (C9, C10) 73960 Capacitor-Ceramic, 10,000 mmf. (C4) 73964 Capacitor-Electrolytic, 10 mfd., 70 volts (C15) 72792 Capacitor-Tubular, paper, .001 mfd., 200 volts (C12) 73750 73961 71928 73558 76852 75010 75774 Capacitor-Tubular, paper, .002 mfd., 200 volts (C11, C14) Capacitor-Tubular, paper, .003 mid., 200 volts (C6) Capacitor-Tubular, paper, .02 mfd., 200 volts (C13) Capacitor-Tubular, paper, .047 mfd., 200 volts (C8) Clip-"A" battery mounting clip (formed spring wire) (2 required) Clip-"C" clip and screw to mount output transformer Coil-Oscillator coil complete with adjustable core (L2, L3) 76854 Contact-"A" battery contact (2 required) 75773 Control-Volume control and power switch (R6, Si) 37396 Grommet-Rubber grommet for antenna rod (2 required) 76853 Insulator-Bakelite insulator for ferrite rod antenna 76851 Knob-Volume control and power switch knob-less set screw 76855 Lead-"B" battery lead complete with connector Resistor-Fixed, composition:- 503139 390 ohms, ±-10%. V2 watt (R11, R13) 504210 1000 ohms, -±20%, 1/2 watt (R12) 503315 15,000 ohms, JAM, 1/2 watt (R2) 504347 47,000 ohms, ±-20%, V2 watt (R5) 504410 100,000 ohms, :t20%, V2 watt (R1) 504510 1 megohm, ±20%, 1/2 watt (R9) 504533 3.3 megohm, -±-20%, V2 watt (R4, R10) 504547 4.7 megohm, ±-20%, I/2 watt (R3, R7) 504610 10 megohm, ±-20%, 1/2 watt (58) 70527 Screw-#6-32.x 3/16" socket head set screw for volume control knob 75780 Socket-Tube socket, 7 pin, miniature, saddle mounted 76848 Switch-Battery saver switch (S2) 76849 Transformer-First I.F. transformer (T1) 76850 Transformer-Second I.F. transformer (T2) 75777 Tansformer-Output transformer (T3) 76373 76841 77159 77160 77161 77162 SPEAKER ASSEMBLY 92523-W Speaker -2" x 3" P.M. speaker complete with cone and voice coil MISCELLANEOUS Back-Case back- GREY-for Model 2B400 Back-Case back-BLACK-for Model 2B401 Back-Case back-IVORY-for Model 2B402 Back-Case back---GREEN-for Model 2B403 Back-Case back-TAN-for Model 2B404 STOCK No. DESCRIPTION 77163 Back-Case back-RED--for Model 28405 76859 Button-Battery saver switch slider button-GREY-for Model 2B400 77164 Button-Battery saver switch slider button-BLACK-and spring clip for Model 2B401 77165 Button-Battery saver switch slider button-IVORY-and spring clip for Model 2B402 77166 Button-Battery saver switch slider button-GREEN--and spring clip for Model 2B403 77167 Button-Battery saver switch slider button-TAN--and spring clip for Model 2B404 77168 Button-Battery saver switch slider button-RED-and spring slip for Model 28405 76838 Case-Case assembly-GREY-less handle, links and back for Model 2B400 77154 Case-Case assembly-BLACK-less handle, links and back for Model 2B401 77155 Case-Case assembly--IVORY-less handle, links and back for Model 2B402 77156 Case-Case assembly-GREEN-less handle, links and 77157 Cabsaec-kCfaosreMaosdseelm2bBl4y0-3TAN-less handle, links and back 77158 Cafosre-MCoadseel 2aBss4e0m4 bly-RED-less handle, links and back for Model 2B405 76860 Clip-Retaining spring clip for battery saver switch slider 76842 77169 77170 77171 77172 77173 button Dial-Polystyrene dial scale-GREY-for Model 2B400 Dial-Polystyrene dial scale-BLACK-for Model 28401 Dial-Polystyre, a dial scale-IVORY-for Model 2B402 Dial-Polystyrene dial scale-GREEN-for Model 2B403 Dial-Polystyrene dial scale-TAN-for Model 2B404 Dial-Polystyrene dial scale-RED-for Model 2B405 75844 Emblem-"RCA Victor" emblem 71843 Grille-Metal grille-perforated-GREY-for Model 2B400 77179 Grille-Metal grille--perforated-GOLD-for Models 2B401 and 2B402 77180 Grille-Metal grille-perforated-GREEN-for Model 2B403 77181 Grille-Metal grille-perforated-TAN-for Model 2B404 77182 Grille-Metal grille-perforated-RED-for Model 28405 73839 Handle-Carrying handle-BLACK-for Models 2B400 and 77183 Ha2Bn4d0l1e-Carrying handle-BEIGE-for Model 2B402 77184 Handle-Carrying handle-GREEN-for Model 2B403 77185 Handle-Carrying handle- BROWN-for Model 28404 77186 Handle-Carrying handle-RED-for Model 2B405 75856 Knob-Tuning control knob-GREY-for Model 2B400 77174 Knob-Tuning control knob-BLACK-for Model 2B401 77175 Knob-Tuning control knb-IVORY- for Model 2B402 Knob-Tuning control knob-GREEN-for Model 2B403 77177 Knob Tuning control knob-TAN-for Model 2B404 77178 Knob-Tuning control knob-RED-for Model 2B405 7'840 Link-Carrying handle link (2 req'd) 71858 Ring-Bearing ring for tuning knob 7[857 Screw-#4-40 x Yu" cross recessed binder head machine screw for mounting chassis (4 req'd) 74734 Spring-Spring clip for tuning control knob APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS Incorrect Tube Location Label: A few receivers were shipped with an incorrect tube location label in which the designation of 3V4 and 1U5 tubes were transposed. These may be readily identified by the label color. The incorrect label is BLUE, the correct label is YELLOW. The correct tube locations are illustrated below. 2ND. I.F. TRANS. TUNING CONDENSER BATTERY CLIPS 1ST. I. F. TRANS. BATTERY SAVER SWITCH "A" Battery Lead: A rubber band is used for the purpose of holding the "A" battery lead in a position where it will not be accidentally torn loose when replacing the battery. When servicing one of these receivers, make sure that this rubber band is around the i-f transformer shield can and holding the "A" battery lead against the chassis. Correct Tonal Response: For correct tonal response it is necessary that the holes in the case, where the metal grille is attached, be closed. This is done at the factory by covering the tabs, on the inside of the case, with tape. Absence of this tape will adversely affect the tonal response of these receivers. 4 5 ©1' RCA VICTOR 0,00.-4-4100$1004"w"9"- AC -DC -Battery Portable Receiver MODEL 2BX63 Chassis No. RC -1 1 1 5 SERVICE DATA - 1952 No. 8 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. Specifications Tuning Range 540-1,600 kc Intermediate Frequency 455 kc Power Supply Rating Power Line Operation 115 volts, d. c. or 50 to 60 cycles a. c. 15 watts or Battery Operated using RCA VS 057W Battery (Average battery life -100 hrs. intermittent service) Battery current "A" 50 ma., "B" 13 ma. Tube Complement (1) RCA 1T4 R F Amplifier (2) RCA 1R5 Converter (3) RCA 1T4 (4) RCA 1U5 I.F.-Amplifier Det. - AVC - 1st A.F. (5) RCA 3V4 Output A selenium rectifier is used. To Remove Hinges Remove back from cabinet as described at right. Spread the hinge apart to remove it from the cabinet back. HINGE (WIRE) PLASTIC CABINET HOLE IN CABINET NOTE POSITION OF THUMB & FINGERS Weight (Approx.) Without battery . 4 lb. 10 oz. Power Output Undistorted Maximum Loudspeaker Voice Coil impedance Cabinet Dimensions Height .. 8 in. Width With battery 7 lb. 12 oz. 0.170 watt 0.320 watt 4 in. P.M. 3 2 ohms at 400 cycles 121/2 in. Depth ....5% in. To Remove Chassis: 1. Pull out battery and disconnect battery plug. 2. Unsolder the two loop antenna leads. 3. Remove the two large screws (under handle) in the to of the case. To Remove Cabinet Back With the back fully open, grip the cabinet as illustrated. Insert a screwdriver under one hinge and pry the center of the hinge out of the opening in the cabinet while maintaining pressure on the back with the fingers and on the cabinet with the thumb. Repeat this procedure with the other hinge. Pull the back straight to the rear using both hands. TUNING ON -OFF VOLUME \ HINGE (PART OF BACK) CABINET BACK (FULLY OPEN) .5 692 Removal of Cabinet Back LOOP ANT. 'How/ ft; 0 0" De, RCA BATTERY OR EQUIVALENT V5057W PLUG SOCKET R19 POWER CORD IN P051 T ION FOR BATTERY OPERATION Rear View With Back Removed 6 2BX63 Alignment Procedure Output Meter Alignment - If this method is used, connect the meter across the voice coil and turn the receiver volume control to maximum. 'Test Oscillator - For all alignment operations, connect the low side of the test oscillator to the receiver chassis and keep the oscillator output as low as possible to avoid AVC action. Battery operation of the receiver is preferable during alignment; on AC operation an isolation transformer (117v./117v.) may be necessary for the receiver if the test oscillator is also AC operated. Dial Pointer Position-With the tuning condenser fully meshed the center of the dial pointer should be in line with the score mark on the chassis. Connect High Sig. Dial Step Side of Sig. Gen. to - Gen. Pointer Output Setting Adjust for Max. Output Disconnect loop-remove chassis-remove bottom plate. 1 Pin #6 of 1T4 2nd I.F. Trans. I.F. Amplifier 2 thru .005 mf. Quiet point T2 Top & Bottom Pin #6 of 1R5 Converter thru 455 kc near 1600 kc 1st I.F. Trans. Ti Top & .005 mf. Bottom Replace bottom cover and install chassis in cabinet. 4 Re -connect loop. 1620 kc min. 1600 kc osc. 5 cap. trimmer C1 -3T 1400 kc 1400 kc 1400 kc r.f. & 6 Signal ant. trimmers* Short wire Connect a 22,000 ohm resistor in 7 placed near Parallel with r.f. tuning cond. Cl-2 8 loop for radiated signal 600 kc I 600 kc I L4 osc. core* while Signal rocking gang Remove the 22,000 ohm resistor 9 from r.f. tuning cond. C1-2. 600 kc I 600 kc I L3 r.f. core 10 I Signal I 11 Repeat Steps 5, 6, 7, 8, 9 and 10. * The position of the battery affects loop inductance. The battery should be in place during steps 5 to 11. Critical Lead Dress 1. Dress all filament leads next to chassis. 2. Use short pigtail leads on components to VI, Pin 6. 3. Dress gang leads direct to avoid excess lead length. 4. Dress loop leads away from gang tuning drum. 5. Dress capacitors C3, C4, C6 for RF shielding. 6. Use short pigtail lead on C21 to V3-2 and dress away from Pin 6. 7. Dress capacitors C13 and C17 direct and down to base. CAUTION.Do not remove any tubes from the chassis with the set operating and the plug connected to the power line. Damage to tubes may result. Dial -Indicator and Drive Mechanism DRUM TENSION SPRING TUNING KNOB SHAFT 3 /4. TURNS PULLEYS PULLEY INDICATOR SHOWN WITH DRUM IN EXTREME CLOCKWISE POSITION (CONDENSER CLOSED) L3 RF COIL 600 KC L4 OSC. COIL 600 KC POWER CORD SHOWN IN POSITION FOR BATTERY OPERATION OSC. 1620 KC ANT. 1400 KC TUNING CONTROL 1R CONY. T 1 1STe IF TRANS) 455 KC 0000000006000..000000000000000 C 16A A C 1 BB C 18C C 113D SELENIUM RECTIFIER (UNDER CHASSIS) II- 436M BATTERY CABLE S-1 LINE BATT. SW. VOLUME CONTROL L ON -OFF SW. R9 S-2 Tube and Trimmer Locations 2 L1 3.K. NTERNAL LOOP VI V2 V3 V4 1T4 1R5 1T4 1U5 R.F. CONY. I. F. DET.-AVC.-A.F. C2 R.F. COIL T 4gsitcre C1 -A 42.3 v6 ) C) 2. (nL3 6 2. L+90V. j ) .3, 171g a: ' T7e 1 't +1.6 V., a90 v. TI 2 3 a to 83 a g 2-17 8.5-299 3 t 2-10 7 +35V. ®I il 0 I CI -Et 43 +35 V. 22 C21 s 4 -0.3V. +90V /11 i7 +35V. +1.3V. otta1/, I 125 CI 7 +65V0022 )1 +20V. 221 ELK 6-202 C6 1.4347 -C8 R7 51. .0033 C10 .047 T. RIO In 68K 180 +3V. C3 .047 C4 047 R3 2700 R4 1000 1R005K ie --I8OUv.i51o4o00KKeg) - R6 R9 V C14 R16 I( .022 1M 1800 .047C9 1 MEG. VOL. CONT. )1 C.01/3 R12 10Met ACROSS RE)1 V5 3V4 OUTPUT +1.5 V. +87v 6 T3 EILU 4 cI3 7 .0039 O -I +90 V. O 8 SELENIUM RECT. C20 .047 12(271 RED 33 11" +136 V. CI8A1SOME R19 265 R2o 15K R22 3300 R1 443 MEG. R2 1.8 MEG. T".047 K.1000 ALL CAPACITOR. VALUES LESS THAN 1.0 ARE IN mr. 4 A5OVE 1.0 ARE IN MME. EXCEPT THOSE INDICATED. C7 54 8-98 -F..9.0%, 2-10 L5 05G. 3.8x COIL R8 3.3 MEG. C1I 0.1 1 COMMON WIRING (15) - 'CINHSAUSLSATISED FROM CHASSIS NPR% TAB hi oirii,N 0INDEX TAE 0 pi ,R,i COIL (REAR VIEW) 05C. COIL (REAR VIEW) TUBE CURRENTS (MA) BATTERY OPERATION PLATE S.GRID VI .52 .16 V2 .65 1.2 V3 1.07 .49 V4 .08 .013 V5 5.8 1.35 CURRENTS SLIGHTLY HIGHER ON A.C.OPERATION I R13 4.7 MEG. C16 .01 11 C1801 40 Mr R17 1500 atm& 160 I` Mr. I R14 27K MC410I8! 8 1X RED 51f RED J4ILINE BATT.. 11 E BL 3524 ON -OFF SW. C-48391 -I SIMPLIFIED FILAMENT CIRCUIT V3 V4 1T4 IU5 I7 I7 CIOI R6 V2 VI IRS 1T4 S7 57 C180 , C9 R3 3VV54 i 5 +0,446V,* . R17 R18 VOLTAGES MEASURED TO COMMON WIRING (-B) wiTH CHANALVST OR vOLTONmYST, AND SHOULD HOLD WITHIN *20% WITH RATED BATTERY SUPPLY. 5W ITCH St -ACTUATED BY LINE PLUG SATT.PLUq ('FIN VIEW) 0 BLUE + 8II "A 9V. 5 4 - 90v. BATT. SOCKET (10R oRFAcE MEW) "A" DRAIN - 50 MA. "B"DRAIN -13 MA. X if -- POLARIZED LINE CORD TO S1 OR 115 V. SUPPLY .=;t: LV Schematic Diagram -Chassis No. RC -1115 >4 8 2BX63 Replacement Parts STOCK No. DESCRIPTION CHASSIS ASSEMBLIES RC -1115 77054 Capacitor-Variable tuning capacitor complete with drive drum CIA, C1B, C1C 73153 Capacitor-Ceramic, 4 mmf. C21 39622 Capacitor-Mica, 56 mmf. C7 71514 Capacitor-Ceramic, 82 mmf. C2, C12 51416 Capacitor-Mica, 180 mmf. C15 76659 Capacitor-Electrolytic comprising 1 section of 50 mfd., 150 volts, 1 section of 40 mfd., 150 volts, 1 section of 160 mfd., 25 volts and 1 section of 40 mfd., 25 volts C18A, C18B, C18C, C18D 73595 Capacitor-Tubular, paper, .0022 mfd., 600 volts ..C17 73795 Capacitor-Tubular, paper, .0033 mfd., 600 volts ..C8 73796 Capacitor-Tubular, paper, .0039 mfd., 600 volts ..C19 73561 Capacitor-Tubular, paper, .01 mfd., 400 volts C13, C16 73562 Capacitor-Tubular, paper, .022 mfd., 400 volts ....C14 73558 Capacitor-Tubular, paper, .047 mfd., 200 volts C4, C5, C9, C10 73553 Capacitor-Tubular, paper, .047 mfd., 400 volts C3, C6 75071 Capacitor-Tubular, moulded paper, .047 mfd., 400 volts C20 73551 Capacitor-Tubular, paper, oil impregnated, 0.1 mfd., 400 volts CI 1 Clip-Mounting clip for I.F. transformer 73114 Coil-Oscillator coil complete with adjustable core L4, L5 74992 Coil-RF coil complete with adjustable core . L2, L3 71041 Connector -5 contact male connector or battery cable 72776 Connector-Single contact pin connector or output transformer leads (2 req'd) 75474 Connector-Single contact male connector for output transformer leads 74285 Control-Volume control and power switch ...R9, S2 72953 Cord -250' Drive Cord Reel (approx. 50" required) 70022 Cord-Power cord and plug 77051 Dial-Metal dial scale complete with (3) pulleys 74838 Grommet-Power cord strain relief (1 set) 72283 Grommet-Rubber grommet for mounting variable capacitor 18469 Plate-Bakelite mounting plate for electrolytic 77053 Pointer-Station selector pointer 72602 Pulley-Drive cord pulley 74322 Rectifier-Selenium rectifier 74319 Resistor-Wire wound, 2650 ohms, 7 watts R19 Resistor-Fixed, composition:- 514033 33 ohms, ±20%, 1 watt R21 504210 1000 ohms, ±20%, 1/2 watt R4 503215 1500 ohms, ±10%, 1/2 watt R17 503218 1800 ohms, ±10%, 1/2 watt R6, R18 503227 2700 ohms, ± 10%, 1/2 watt R3 STOCK No. DESCRIPTION 513233 504315 503327 504368 504410 503422 504510 503518 503533 504547 503556 503568 504610 73117 76368 71039 73129 75487 71047 33726 3300 ohms, ±-10%, 1 watt R22 15,000 ohms, ±20%, 1/2 watt R20 27,000 ohms, -±10%, 1/2 watt R14 68,000 ohms, ±20%, 1/2 watt R10 100,000 ohms, -±20%, 1/2 watt R5 220,000 ohms, ±-10%, 1/2 watt R15 1 megohm, ±20%, 1/2 watt R16 1.8 megohm, -±10%, 1/2 watt R2 3.3 megohm, ±-10%, 1/2 watt R8 4.7 megohm, ±20%, 1/2 watt R13 5.6 megohm, ± 10%, 1/2 watt R7 6.8 megohm, ± 10%, 1/2 watt R1 10 megohm, ±20%, 1/2 watt R12 Socket-Tube socket, 7 pin, miniature Spring-Drive cord spring Switch-"Line-Battery" switch Si Transformer-First I.F. transformer complete with ad - justable cores Ti Transformer-Second I.F. transformer complete with adjustable cores T2 Transformer-Output transformer T3 Washer-"C" washer for tuning knob shaft 77055 SPEAKER ASSEMBLIES 971495-7W RL-108B10 Speaker -4" P.M. speaker complete with cone and voice coil (3.2 ohms) MISCELLANEOUS 77068 Antenna-Antenna loop assembled to polystyrene frame and support LI 77060 Back - Cabinet back - polystyrene - complete with strikes 77061 Cap-Carrying handle cap and chassis support 77065 Case-Case front-less handle, handle support, caps, links and chassis mounting screw 77064 Emblem-"RCA Victor" emblem 77057 Eyelet-Metal eyelet for mounting loop assembly 77066 Grille-Metal grille 77056 Grommet-Rubber grommet for mounting loop assembly 77063 Handle --Carrying handle 74790 Hinge-Cabinet hinge (2 req'd) 77248 Knob-Control knob 77062 Link-Carrying handle link 77013 Nut-Speed nut for fastening "RCA Victor" emblem 76671 Screw-#6 x 1/2" cross recessed self -tapping round head screw for mounting loop 77058 Screw-#8-32 x 7/16" cross recessed pan head machine screw for mounting loop 74734 Spring-Spring clip for knobs 77467 Washer-Knob washer-felt 77067 Window-Clear vinylite dial window APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 4 9 RCA VICTOR A -C Operated Clock Radio Receiver 2-C-511 SERIES Chassis No. RC -1 1 1 8 SERVICE DATA - 1952 No. 12 - 2C511 Black & Gray 2C512 Ivory 2C513 Red 2C514 Two Tone Gray PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. SPECIFICATIONS Tuning Range 540-1600 kc Intermediate Frequency 455 kc Tube Complement: (1) RCA 12BE6 Converter (2) RCA 6BJ6 I.F. Amplifier (3) RCA 12AV6 Det.-AVC-A.F. Amp. (4) RCA 6AK6 Output RCA Stock No. 77292 Rectifier Power Supply Rating: 115 volts a.c., 60 cycles 20 watts CAUTION: DO NOT OPERATE ON D.C. Loudspeaker: Size and type Voice Coil impedance Power Output: Undistorted Maximum Tuning Drive Ratio Weight Dimensions (overall): Height ....6" Width.. 3 in. P.M. 32 ohms at 400 cycles 0 19 watts 0 35 watts 1 to 1 (Direct Drive) 41/2 lbs. 81/2" Depth. 4 1/2 - OPERATING INSTRUCTIONS This instrument contains a timer -type electric clock mechanism which may be used to automatically actuate the self-contained a.c. radio. The radio may also be operated independently of the clock mechanism. ON VOLUME CONTROL SWITCH TUNING 6 Clock Radio Controls MS ISM CLOCK -1. Plug instrument into 115 v. a.c. outlet. The clock will start to operate immediately. Set the correct time by turning clockwise, the "TIME" knob located at the center of the instrument back. To set the alarm, turn the "ALARM- knob clockwise until the desired time is indicated by the alarm pointer extension on the hour hand. Pull knob out for alarm buzzer operation. To turn off buzzer, push knob in. RADIO -1. To obtain radio operation independently of the clock, push the slide switch lever at the top of the cabinet to the left "ON" position. Adjust volume and tuning control knobs as required after approximately 30 second warm-up. To increase volume turn knob clockwise as viewed from volume control side panel. Push slide switch lever to the center "OFF- position when finished listening. 2. To automatically actuate the radio by the clock mechanism, make initial volume and station settings as described in section 1 above. Set the "ALARM" knob to the time desired. Push slide switch lever to the right "AUTO" position. If the alarm buzzer knob is pulled out, the alarm will sound approximately ten minutes after the radio starts operating. Push alarm knob in to turn off alarm. The radio will turn itself off after a period of approximately one hour if the slide switch remains in the "AUTO- position after start of playing. CAUTION-Keep slide switch "ON -OFF -AUTO" lever in "OFF" position when instrument is not in use. Locate instru- ment so that "TIME" and "ALARM- knobs have free movement. 10 2-C-511 Series ALIGNMENT PROCEDURE Output Meter Alignment-If this method is used, connect the meter across the voice coil and turn the receiver volume control to maximum. Test-Oscillator-For all alignment operations, connect the low side of the test -oscillator to the receiver chassis, and keep the oscillator output as low as possible to avoid AVC action. On a.c operation an isolation transformer (115 v./115 v.) may be necessary for the receiver if the test oscillator is also a.c. operated. ALIGNMENT TABULATION Connect the Step high side of test -otosc-illator Tune testto-o-sc. Turn radio dial to- Adjust the following for max. output 61316 I -F grid 1 through .01 mid. capacitor Stator of 455 kc 2 CI -A through .01 mfd. Quietpoint 1600 kc end of dial T2 (top and bottom) 2nd I -F trans. T1 (top and bottom) 1st I -F trans. 3 1620 kc Min. cap. osc. trimmer C I B -T 4 Short wire placed near 1400 kc 1400 kc ant. trimmer signal CIA -T loop to 5 radiate signal 600 kc 600 kc (rock) (osc. coil) Slug L3 6 Repeat steps 3, 4, and 5 metal panel and molded plastic boss. If any of the four foam rubber cushions on the bottom cover register in the clock face after assembly, push the excess length under the "Z" tabs of the bottom cover. CLOCK SERVICE-Disassembly-To service clock, remove chassis and bottom cover as described above. In addition, remove the three screws holding the speaker to the speaker mounting bracket. Remove the two hex nuts holding the clock to the chassis pan recess. Lift the clock out. Unsolder the clock leads at the clock terminals. Assembly-Proceed in the reverse order. Solder clock leads, and secure clock to chassis pan with two hex head nuts. Reassemble speaker to speaker mounting bracket. CRITICAL LEAD DRESS 1. Filament leads should be dressed away from secondary output lead, terminal #1, of 2nd I.F. Transformer and secondary output lead, terminal #1, of 1st I.F. transformer. 2. Connect the outside foil of capacitors as shown on schematic. 3. Dress electrolytic capacitor leads and filament transformer leads away from selenium rectifier. 4. Plate and grid leads of 12BE6 and 6B16 tubes should be kept as short and direct as possible. L3 ADJ. OSC. COIL RADIO CHASSIS AND CLOCK SERVICE TOOL REQUIREMENTS-A small #1 size cross -head screwdriver is required for disassembly of the radio into its major cabinet and chassis components. TUBE SERVICE-Disassembly-To make tubes accessible for testing, remove the volume and tuning control knobs by pulling off. Unscrew counterclockwise the alarm and time knobs from their shafts. Invert the cabinet and remove only the two cross -head screws along the back underside of the cabinet. Place the cabinet in its normal position. Using only firm hand pressure, press down alternately at front right and left sides of the cabinet top, midway between the "ON -OFF -AUTO" slide switch lever and the cabinet sides, forcing down and backward, to disengage the molded -in plastic catches. Then lift off the cabinet rear cover. Assembly-To reassemble, proceed in the reverse order, sliding the cabinet rear cover into its track on the cabinet base. Lilt the front corners up slightly to clear the two molded -in pads at each front corner of the cabinet base. Then press down and snap -in the upper front edge of the cabinet rear cover under the top rim of the cabinet base. Make sure the slide switch and switch lever are in corresponding center "OFF- positions. Reassemble clock and radio knobs, and the two screws securing the cabinet rear cover. RADIO CHASSIS SERVICE-Disassembly-To service chassis, open case as described above. In addition, remove the single cross -head screw remaining at the front underside of the cabinet and also the two cross -head screws located on the chassis near the tuning gang and the volume control. Lift out the chassis and remove the four self tapping cross -head screws holding the bottom cover to the chassis. Lift off the bottom cover. Assembly-Reassemble in the reverse order. Secure the bottom cover to the chassis with the four self -tapping screws. Next, insert the single self -tapping screw holding the chassis to the bottom of the cabinet base. Center the chassis mounting holes so that they line up with the holes in the cabinet and replace the two cross -head machine screws. Tighten just sufficiently to hold the chassis firmly. Do not turn the screws to the possible limit of travel unless this is necessary to hold the chassis firmly. The average receiver may have a 142" clearance between the chassis L I FERRITE CORE. ANT. COIL CLOCK C. 4a 46 7 FILAMENT TRANS. T4 Tube and Trimmer Locations POWER. CORD 2 C1 -A 11-283 LI LOOP V1 12BE6 CON V. 2-14 r3 I t L1400T T1 1 1 c>14 EIloo 1 1 rik7 C2 47 V2 6BJ6 I. F. T2 tf 1250 L4 R5 47I< V3 12AV6 DET.-A.F.-A.V.C. C7 I I470 1 -1 2 2510251 g1 C9 .0015 R9 an t< R8 - 330K V4 6AK6 OUTPUT T3 BLO. CIO .0056 a RED 7 1;23190 OSO R11 COIL 100 C-) A. E (I' L3 C1-13 L2 C. 9-11T6.r1 C11 2-14 Cj 4.7T R4 3.3 MEG. W1 390 -= VOL. GONT. 3 R6 500K. C8 .01 AVC IC4 W2 R7 4.7 MEG. .0471 INSULATED CAM S2 CLOCK 135 V. MOTOR 0 cr a AUTOM. SW. CLOCK DRIVEN TIME SLOT yst RECT. CR1 R2 R3 1500 102 V. VOLTAGES MEASURED TO COMMON WIRING WITH VOLTOHMYST AND SHOULD HOLD WITHIN t 20 Vo WITH RATED POWER SUPPLY. K= 1000 AAELXRLCECEIPNATPMAAFCS.I,TIANABDNOICCVEAETVEA1D.L0U. AERSELEINSSMTMHFA.N 1.0 C-48461 115 V. 60"-, SUPPLY 1 23 4 FUNCTION SW. S1 POS. FUNCTION 21 -- MOAFNFUAL ( ON ) 3 - AUTOMATIC 31 T4 C5A C3 50MF.T V4 V2 VI V3 6AK6 6BJ6 1213E6 12AV6 w. oc C5B so.047 -1 co YE -.3 4 3 4 3 4 3 4 HEATER CONNECTIONS C6 0.1 GND. (OR -B) ISOLATED FROM CHASSIS CHASSIS /7777 Schematic Circuit Diagram-Chassis No, RC1118 12 2-C-511 Series REPLACEMENT PARTS STOCK NO. DESCRIPTION STOCK NO. DESCRIPTION CHASSIS ASSEMBLIES RC 1118-Model 2C511 RC 1118A-Model 20512 RC 1118B-Model 2C513 RC 1118C-Model 20514 77410 Antenna-Ferrite rod antenna complete with windings LI 77408 Capacitor-Variable tuning capacitor...C1A, C1B 77471 Capacitor-Ceramic, 4.7 mmf. C11 75609 Capacitor-Ceramic, 47 mmf. C2 75641 Capacitor-Ceramic, 390 mmf. C12 75198 Capacitor-Ceramic, 470 mmf. C7 77427 Capacitor-Electrolytic comprising 1 section of 50 mfd., 150 volts and 1 section of 30 mfd., 150 volts C5A, C5B 77425 Capacitor-Tubular, paper, .0015 mfd., 200 volts C9 77488 Capacitor-Tubular, paper, .0056 mfd., 400 volts 010 77424 Capacitor-Tubular, paper, .01 mfd., 200 volts...08 77422 Capacitor-Tubular, paper, .047 mfd., 400 volts..C4 75071 Capacitor-Tubular, moulded, .047 mfd., 400 volts C3 77423 Capacitor-Tubular, paper, 0.1 mfd., 400 volts 06 77421 Clip-"C" clip for mounting speaker 75010 Clip-"C" clip for mounting output transformer 73935 Clip-Mounting clip for I.F. transformer 77411 Coil-Oscillator coil complete with adjustable core L2, L3 77409 Control-Volume control R6 70392 Cord-Power cord and plug 77404 Cover-Chassis bottom cover 77419 Cushion-Foam rubber cushion for speaker rim or bottom cover 74838 Grommet-Power cord strain relief (1 set) 77418 Grommet-Rubber grommet for mounting ferrite rod antenna 77405 Insulator-Bakelite insulator for variable tuning capacitor 77406 Insulator-Ferrite rod antenna mounting insulator -L. H. 77407 Insulator-Ferrite rod antenna mounting insulator -R.H. 77292 Rectifier-Selenium rectifier CR1 Resistor-Fixed, composition:- 503022 22 ohms, ±10%, 1/2 watt R2 503110 100 ohms, -±-10%, 1/2 watt R11 503139 390 ohms, -±-10%, 1/2 watt R10 532215 1500 ohms, ±10%, 2 watts R3 503333 33,000 ohms, ±-10%, 1/2 watt RI 503347 47,000 ohms, ±-10%, 1/2 watt R5 503433 330,000 ohms, ±-10%, 1/2 watt R8 503482 820,000 ohms, -±-10%, 1/2 watt R9 503533 3.3 megohm, ±10%, Vz watt R4 503547 4.7 megohm, -±-10%, 1/2 watt R7 75780 Socket-Tube socket, 7 pin. miniature, saddle mounted 77415 Switch-Function switch SI 77413 Transformer-Filament transformer 117 volts A.C. input T4 77414 77416 77417 77420 Transformer-Output transformer T3 Transformer -1st. I.F. transformer complete with adjustable cores T1 Transformer -2nd. I.F. transformer complete with adjustable cores T2 Washer-Shoulder washer (nylon) for variable tuning capacitor mounting (3 req'd) SPEAKER ASSEMBLIES 971920-1 77428 Speaker -3" P.M. speaker complete with cone and voice coil (3.2 ohms) MISCELLANEOUS 77430 Back-Polystyrene cabinet back-gray tan-for Model 20511 77505 Back-Polystyrene cabinet back-ivory-for Model 20512 77507 BOck-Polystyrene cabinet back-red-for Model 77509 77433 77429 77504 20513 Back-Polystyrene cabinet back-gray-for Model 20514 Button-Slide button for function switch less clip Case-Polystyrene case front -black -completewith window less back for Model 20511 Case - Polystyrene case front - ivory - complete with window less back for Model 20512 77506 Case-Polystyrene case front-red-complete with window less back for Model 20513 77508 Case - Polystyrene case front - gray - complete with window less back for Model 2C514 77434 Clip-Spring clip for function switch slide button 77431 Dial-Dial knob-gray tan-for Model 20511 77498 Dial-Dial knob-ivory-for Model 20512 77499 Dial-Dial knob-red-for Model 20513 77500 Dial-Dial knob-gray-for Model 20514 77432 Knob-Volume control knob-gray tan-for Model 2C511 77501 Knob-Volume control knob-ivory-for Model 20512 77502 Knob-Volume control knob-red-for Model 20513 77503 Knob-Volume control knob-gray-for Model 20514 77412 77437 77436 77435 74734 77467 Knob-Timer knob Screw-#6 x Xs" cross recessed truss head tapping screw for mounting chassis Screw-#6-32 x 316" cross recessed truss head machine screw for mounting chassis to case Screw-#6-32 x 3i'6" cross recessed truss head machine screw for fastening case assembly Spring-Spring clip for dial knob or volume control knob Washer-Knob Washer-felt CLOCK ASSEMBLY * * * Clock-If clock mechanism repair becomes necessary, remove the clock from the radio. The RCA Victor Distributor in your area will advise you of the address of the nearest authorized service station for clock mechanisms. Repair facilities and replacement parts are available at these authorized service stations. APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 4 13 2C521 Maroon 2C522 Ivory Val' RCA VICTOR A -C Operated Clock Radio Receiver 2-C-521 SERIES Chassis Nos. RC -1120, RC -1120A, RC -1120B, RC -1120C, RC -1120D, RC -1120E SERVICE DATA - 1952 No. 10 - 2C527 White PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. Specifications Tuning Range 540-1600 kc Intermediate Frequency 455 kc Tube Complement: (1) RCA 12BE6 (2) RCA 12BA6 Converter I.F. Amplifier (3) RCA 12AV6 (4) RCA 5005 (5) RCA 35W4 Det.-AVC-A.F. Amp. Output Rectifier Power Supply Rating: 115 volts a.c., 60 cycles 30 watts CAUTION:-DO NOT OPERATE ON D.C. Appliance Rating 115 volts, 15 a. Loudspeaker: Size and type Voice Coil impedance 4 in. P.M. 3 2 ohms at 400 cycles Power Output: Undistorted Maximum Tuning Drive Ratio Weight . 1 2 watts 1 6 watts 10 to 1 (5 turns of knob) 51/2 lbs. Cabinet Dimensions: Height 6'/e Width...113/4 Depth .51/2 - Operating Instructions This instrument can be used in any one of several ways. It may be used as a clock with alarm alone, radio, phonograph amplifier, or clock -controlled radio or appliance outlet. Instructions for the various uses follow: Clock-Plug instrument into a.c. outlet. The clock will start to operate immediately. Set the correct time with the "TIME -SET" knob on the back panel of the instrument. To set the alarm, pull out the "ALARM" knob and turn counter -clockwise until the desired time is indicated by the alarm pointer. Leave knob out for alarm buzzer operation. Push knob in to turn off buzzer. Radio -1. Push "RADIO" slide switch lever to the right, as view,ed from the back. Turn "RADIO" knob on clock from "OFF" to "ON" position. Adjust volume and tuning knobs as required after 30 second warm-up. Turn clock "RADIO" knob to "OFF" position when finished listening. 2. To have radio turn itself off after a period of up to 60 minutes, set "SLEEP" knob to desired playing time. Turn clock "RADIO" knob "OFF." 3. To have radio turn itself on, turn tuning and volume knobs to desired position, and then set the alarm as explained above. Turn clock "RADIO" knob to "AUTO" position. 4. To have the radio turn itself off during any time within a 60 minute period and then turn itself on, after an off period of up to twelve hours, set the "SLEEP" and "ALARM" knobs, and volume and tuning controls as explained previously. Turn clock "RADIO" knob to "AUTO" position. Appliances -1. To use appliance outlet, plug appliance into rear receptacle, and turn clock "RADIO" knob to "ON" position. If operation of the radio is not desired at the same time, push radio slide -switch lever on the back panel to the off position (lever pushed to the left). 2. To start appliance automatically, proceed as above, except that the "ALARM" knob should be set to the desired starting time, and the clock "RADIO" knob set to the "AUTO" position. To turn off appliance, turn clock "RADIO" knob to "OFF" position, or remove appliance plug if radio operation is desired. 3. To operate appliance for any time within a 60 minute period, have appliance plugged in, with clock "RADIO" knob turned to "OFF" position. Set "SLEEP" knob for desired operating period. Appliance will be turned off automatically at the end of this period. Phonograph -1. Make sure radio slide switch is on (lever pushed to the right). Plug phonograph attachment audio plug into jack provided. Turn clock "RADIO" knob to "ON" position. If a spare a.c. receptacle is not available for the record changer, the appliance outlet may be used to provide power. CAUTION:-Keep clock "RADIO" knob "OFF" when instrument is not in use. 14 2-C-521 Series DIAL CORD DRUM SHOWN IN MAX. CAP. POSITION. 3 1/2 TURNS Dial Cord Drive Chassis RC -1120, RC -1120A, B, C RADIO CHASSIS AND CLOCK SERVICE Tube Service-To make tubes accessible for testing, remove the hex head screw at the lower right hand corner and the hex head screw at the left side of the appliance outlet on the back panel. The loop antenna and antenna trimmer are located on this back panel. Radio Chassis Service-Proceed as above, removing the volume and tuning control knobs by pulling off, and also removing the three hex head screws and washers on the underside of the cabinet. Do Not remove the clock from the cabinet unless this is necessary for service. Lift off the shield on the underside of the chassis. Clock Service-Proceed as above. Remove the three clock control knobs from the front of the cabinet by pulling off, taking care not to damage the clock control shafts. Using a small screwdriver or a small pry tool, remove the five sheet metal clips holding the clock to the cabinet. The clips will be found embedded in the plastic. The seal between the plastic and the metal teeth on the clips should be broken by lifting the metal edges till the teeth clear the plastic. To prevent scratching the plastic dial faces of the radio and clock, place the instrument face down on a thick soft cloth. When removing the clock, take care not to damage the molded -in plastic rim for mounting the clock. In remounting the clock, new sheet metal clips should be used. These should be heated until hot enough to soften the plastic slightly upon contact. Place the clock in its mounting rim and push the heated clips on tightly, using a pair of pliers or other holding tool. Attachment of Record Player The audio output cable of the record player should be terminated with a pin plug. Plug the cable into the receptacle which is accessible from the back of the cabinet. Insertiokr of the cable plug into the receptacle removes radio signal from the volume control. The record player cable must be removed from the receptacle to permit radio operation. APPLIANCE OUTLET J1 PHONO INPUT RADIO ON -OFF SWITCH A.C. POWEF, CORD DRIVE CORO SCHEMATIC SHOWN WITH VARIABLE CAPACITOR IN MAO. CCW POSITION ( CLOSED I Dial Cord Drive- Chassis RC -1120D, E Alignment Procedure Connect the Step high side of test -otosc-illator Tune testto-o-sc. Turn radio dial to- Adjust the following for max. output 12BA6 I -F grid 1 through .1 mfd. capacitor 455 kc. Stator of 2 Cl-B through .1 mfd. Quietpoint 1600 kc end of dial T2 (top and bottom) 2nd I -F trans. T1 (top and bottom) 1st I -F trans. 3 1620 kc Min. cap. osc. trimmer 4 Short wire placed near 1400 kc 1400 kc signal ant. trimmer loop to .5 radiate signal 600 kc 600 kc signal osc. coil LI,L2 (rock gang) 6 Repeat steps 3, 4, and 5. *Necessary only on receivers having RC -1120D, E chassis Test-Oscillator-For all alignment operations, connect the low side of the test -oscillator to the receiver chassis, and keep the oscillator output as low as possible to avoid a -v -c action. On a.c. operation an isolation transformer (115 v./115 v.) may be necessary for the receiver if the test oscillator is also a.c. operated. ALARM R AUTO A D OFF , . gr4 ,:,..,, sb Q ON ,.....4, , SLEEP TUNING VOLUME Clock Radio Controls T3 OUTPUT TRANSFORMER APPLIANCE OUTLET -, .11 PHONO INPUT RADIO ON -OFF SWITCH A. C. POWER CORD I T13 OUTPUT TRANS. 11. 314(ER ." ... ILI VOLUME .. TUNING Chassis RC -I120, RC -1120A LI VOLUME Tube and Trimmer Locations 2 TUNING Chassis RC -1120B, C, D, E LOOP Cl-B VI 12BE6 CONVERTER V2 12BA6 I. F. V3 12AV6 DET.-A.F-A.V.C. I0IV. 101 V. 61 V. T1 Ta C2 R1 39K 6 10IV.I 1 f t 1 1-1 .F0-7' 14 1 31 too 1 c5 I 1 0.9 V. 11 I t 100 1.6 15 Ca I 6 2 LI sow' R2. 100 cGcN (7>2c3_1I 1255 I 1 C3 56 250K 50V04 5 OUTPUT PC -1 C9B .005 a )1 5 * C9A C9CI R4B 500K 120 V. BLUE T3 cio 027 1- P M. O SPEAKER z R6 1200 A 101V. L1 ccL;2g C B C1-A OSC. COIL VOLTAGES MEASURED TO COMMON WIRING WITH VOLTOHMYST AND SHOULD HOLD WITHIN 1:20 % . K= 1000 ALELLSCSATPHAACNITO1.R0 VAARLEUEINS MF., ABOVE 1.0 ARE IN MMF. EXCEPT AS INDICATED. C13 6 -T .0C4147 CLOCK INSULATED CAM S2 AUTOM, SW L_OCK DRIVEN I TIME SLOT "V\Ar- R7 3.3 MEG. C4171 e, CLOCK 1-4D MOTOR - R3 (47K PHONO JACK 0tA J1 *C9A 4 C9C RED TOTAL 250 MMF. C 188 80 MF. R9 1 10 MEG. 2 R.8 1 MEG. VOL. CONTROL C15 .01 V5 35W4 RECTIFIER V3 V1 Va V4 12AV6 12BE6 12BA6 5005 -44 3 3 HEATER CONNECTIONS 115V. A.G. C17 .047 ,..128 V. 7 T GRN A_ CiBA 50 MF. R11 33 POWER N INPUT U Lead Dress APOPULTIALNECTE- GREEN BLACK S1 ON CHASSIS REAR APRON C-48455 1. Dress all capacitors down against chassis. WHITE 2. C-15 must be located so that connection to Pin #1 of 12AV6 is short as possible and condenser butts against rim of volume control. 3. Connect outside foil of all condensers as indicated in schematic diagram. 4. Dress Filament, B+ and B- leads down against chassis. 5. Dress R2, 12BA6 cathode resistor, down against tube center post with leads to Pin 2 and Pin 7 as short as possible. 6. Dress R3 above and away from R7. Orolh BLUE I1) A OSC. COIL TERM. VIEW OSC. COIL BOTTOM VIEW FOR CHASSIS RC -1120B RC -1120C C11 IS OMITTED RIO IS OMITTED FOR CHASSIS RC -1120D, RC -1120E AS ABOVE, ALSO OSC COIL (LI, L2) HAS ADJUSTABLE CORE. RC -1120, RC -1120A, B, C RC -1120D, E Schematic Circuit Diagram-Chassis No. RC -1120 Series 16 2-C-521 Series REPLACEMENT PARTS STOCK NO. DESCRIPTION CHASSIS ASSEMBLIES RC -1120, RC -1120B -Model 2-C-521 RC -1120A, RC -1120C -Models 2-C-522, 2-C-527 77357 Capacitor -Variable tuning capacitor complete with drive drum ....CIA, C1A-T, C1B 77364 Capacitor -Ceramic, 6 mmf. C13 76348 Capacitor -Ceramic, 47 mmf. C11 77116 Capacitor -Ceramic, 56 mmf. C3 73520 Capacitor -Electrolytic comprising 1 section of 80 mfd., 150 volts and 1 section of 50 mfd., 150 volts, C18A, C18B 73561 Capacitor -Tubular, paper, .01 mfd., 400 volts..C15 73554 Capacitor -Tubular, paper, .027 mfd., 400 volts . .C10 73553 Capacitor -Tubular, paper, .047 mfd., 400 volts C14, C17 73551 Capacitor -Tubular, paper, 0.1 mfd., 400 volts..C16 73935 Clip -Mounting clip for I.F. transformer 77356 Coil -Oscillator coil Ll, L2 78586 Coil -Oscillator coil complete with adjustable core (Ll, L2) RC -1120D, E only 75482 Connector-Phono input connector 11 52131 Connector -2 contact feniale connector for appliance outlet (RC -1120, RC -1120A, D, E) 77901 Connector -2 contact female connector for appliance outlet (RC -1120B, RC -1120C) 77359 Control -Volume control R8 72953 Cord -250' Drive Cord Reel (approx. 26" required) 70392 Cord -Power cord and plug 28451 Cover -Insulating cover for electrolytic 77360 Grommet -Rubber grommet for mounting tuning capacitor 73693 Grommet -Power cord strain relief (1 set) 28452 Plate -Bakelite mounting plate for electrolytic 77355 Plate -Dial back plate complete with pointed escutcheon (RC -1120, RC -1120A) 77900 PlateDial back plate (RC -1120B, RC -1120C) 77354 Pointer -Station selector pointer 77365 Printed Circuit . PC1 (C9A, C9B, C9C, R4A, R4B) 77363 Pulley -Drive cord idler pulley Resistor -Fixed, composition: - 513033 33 ohms, ±-10%, 1 watt R11 503110 100 ohms, -1-10%, 1/2 watt R2 503115 150 ohms, ±-10%, 1/2 watt R5 513212 1200 ohms, ±10%, 1 watt R6 503339 39,000 ohms, ±-10%, 1/2 watt RI 503347 47,000 ohms, -±10%, 1/2 watt R3 503422 220,000 ohms, -±-10%, 1/2 watt RIO 503533 3.3 megohm, ±-10%, 1/2 watt R7 503610 10 megohm, ± 10%, 1/2 watt R9 77358 Shaft -Tuning knob shaft (RC -1120, RC -1120A) 77909 Shaft -Tuning knob shaft (RC -1120B, C, D, E) 76870 Shield -Tube shield 77115 Socket -Tube socket, 7 pin, miniature, moulded 51955 Socket -Tube socket, 7 pin, miniature, moulded, saddle -mounted 75780 Socket -Tube, 7 pin min., molded, saddle -mounted, for VI, V4, V5 (RC -1120D, E only) 77306 Socket -Tube, 7 pin min., molded, saddle -mounted, for V2, V3 (RC -1120D, E only) 77361 Spring -Drive cord spring (RC -1120, RC -1120A) 77902 Spring -Drive cord spring (RC -1120B, RC -1120C) 31418 Spring -Drive cord spring (RC -1120D, RC -1120E) 32875 Switch -Radio power switch SI 75486 Transformer -First I.F. transformer, complete with adjustable cores T1, C4, C5 75487 Transformer -Second I.F. transformer, complete with adjustable cores T2, C6, C7, C8 77362 Transformer -Output transformer (RC -1120, RC -1120A) T3 STOCK NO. DESCRIPTION 77903 Transformer -Output transformer (RC -1120B, Cs, D, E) 33726 WWaasher -"C" washer for tuning knob shaft SPEAKER ASSEMBLIES B12A512 RL108E7 77226 Speaker -4" P.M. speaker complete with cone and voice coil (3.2 ohms) MISCELLANEOUS 77367 77904 77368 77905 77367 77904 77368 77905 X3304 X3305 Y2463 Y2464 Y2465 77372 77033 77369 77370 77371 77373 77374 77375 77013 77491 Antenna -Antenna loop complete with back cover -maroon-for Model 2C521 (RC -1120, RC -1120A) Includes C2 Antenna -Antenna loop complete with back cover -maroon-for Model 2C521 (RC -1120B, C, D, E) Antenna -Antenna loop complete with back cover -ivory-for Models 2C522, and 2C527 (RC -1120, RC -1120A) Includes C2 Antenna -Antenna loop complete with back cover -ivory-for Models 2C522, 2C527 (RC -1120B, C, D, E) Back -Cabinet back -maroon -and antenna loop for Model 2C521 (RC -1120, RC -1120A), Includes C2 Back -Cabinet back complete with antenna loop - maroon -for Model 2C51 (RC -1120B, C, D, E) Back -Cabinet back -ivory -and antenna loop for Models 2C522 and 2C527 (RC -1120, RC -1120A), Includes C2 Back -Cabinet back complete with antenna loop - ivory -for Models 2C522, 2C527 (RC -1120B, C, D, E) Baffle -Baffle board and grille cloth for Model 2C521 Baffle -Baffle board and grille cloth for Models 2C522 and 2C527 Cabinet -Plastic cabinet -maroon -complete with crystals (2) for Model 2C521 Cabinet -Plastic cabinet -ivory -complete with crystals for Model 2C522 Cabinet -Plastic cabinet -white -complete with crystals for Model 2C527 Clip -Spring clip for mounting timer assembly (5 req'd) Emblem -"RCA Victor" emblem Knob -Timer control knob -maroon -for Model 2C521 Knob -Timer control knob -ivory -for Model 2C522 Knob-Timer control knob-white -for Model 2C527 Knob -Tuning control or volume control knob - maroon -for Model 2C521 Knob -Tuning control or volume control knob - ivory -for Model 2C522 Knob -Tuning control or volume control knob - white -for Model 2C527 Nut -Speed nut to fasten "RCA Victor" emblem to cabinet Window -Polystyrene window for radio or timer dials CLOCK ASSEMBLY Clock -If clock mechanism repair becomes necessary, remove the clock from the radio. The RCA Victor Distributor in your area will advise you of the address of the nearest authorized service station for clock mechanisms. Repair facilities and replacement parts are available at these authorized service stations. APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 4 17 RCA VICTOR Automatic Record Player Models 2 ES 3, 2 ES 38 Chassis No. RS -142 Record Changer 930409-5 SERVICE DATA - 1952 No. 4 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. SPECIFICATIONS Tube Complement 1. RCA 12SQ7 2. RCA 50L6-GT 3. RCA 35W4 Power Supply Rating 115 volts, 60 cycles A.0 Loudspeaker Model 2 ES 3 Model 2 ES 38 Voice coil impedence Power Output Undistorted . 1.2 watts A.F. Amplifier Output Rectifier 50 watts 4" x 6" PM 8" PM 3 2 ohms at 400 cycles Maximum .. 1.5 watts Dimensions (overall) Model 2 ES 3 Model 2 ES 38 Height 10'/4" 9 Vs " Width 137/e" 161/2" Deptl 131/2" 19" Weight Model 2 ES 3 Model 2 ES 38 15 lbs. 24 lbs. Record Changer (930409-5) Turntable speed 331/3, 45 or 78 r.p.m. Record capacity Up to fourteen 7 inch RCA type or twelve 10 inch. or ten 12 inch. or ten 10 in. and 12 in. intermixed. Pickup (Stock No. 75475) . . Crystal with replaceable styli. REPLACEMENT PARTS STOCK No. DESCRIPTION 75980 73595 73920 73561 73554 73553 75562 76885 70392 73693 74838 72314 519033 503115 503215 503410 503427 503518 504547 70827 73117 75939 76886 75024 74664 AMPLIFIER ASSEMBLIES RS 142 Capacitor-Electrolytic comprising I section of 50 mfd., 150 volts and Ca1p50acitvoorl-tTs ubular, paper, 1 section of 80 mfd., .0022 mid., 600 volts C8A, C4 C8B Capacitor-Tubular, paper, .0047 mid., 600 volts C3 CCaappcaictiotro-rT-Tubuublualra,rp, appaepre,r.,02.701 mfd., 400 volts mfd., 400 volts C2, C7 C6 Capacitor-Tubular, paper, .047 mfd., 400 volts C1, CS CCoonnttrrooll--TVoonleumceocnotrnoltrol R4 RI Cord-Power cord and plug Grommet-Output transformer leads strain relief Gr(o1msemt)et-Power cord strain relief (1 set) Resistor-Wire wound, 120 ohms, 5 watts R10 Resistors-Fixed, composition: 33 ohms, ±20%, 1 watt R9 150 ohms, ±10%, 1/2 watt R7 1500 ohms, +10%, 1/2 watt R8 100,000 ohms, ±10%, 1/2 watt R2 270,000 ohms, I-10%, 1/2 watt 1.8 megohm, ±10%, 1/2 watt R.5, R6, R12 R11 4.7 megohm, T-20%, 1/2 watt R3 Socket-Tube socket, octal, wafer, for 12SQ7 and 50L6GT tubes Socket-Tube socket, 7 pin, miniature, wafer for 35W4 tube Transformer-Output transformer T1 SPEAKER ASSEMBLIES FOR MODEL 2ES3 922258-6 W RL 100 C7 Speaker -4" x 6" P.M. speaker complete with cone and voice coil (3.2 ohms) SPEAKER ASSEMBLIES FOR MODEL 2ES38 92586-9 W RL 105C4 Cone-Cone and voice coil (3.2 ohms) Speaker -8" P.M. speaker complete with cone and voice coil (3.2 ohms) STOCK No. DESCRIPTION Note: If stamping on speaker in instruments does not agree with above speaker number, order replacement parts by referring to model number of instrument, number stamped on speaker and full description of part required. X1756 77139 76895 73634 76887 74734 MISCELLANEOUS FOR MODEL 2ES3 Cloth-Grille cloth Knob-Control Knob. Foot-Rubber foot (4 required) Nut-Speed nut for No. 8 screw for speaker bracket mounting screws Screw-No. machine 10-32 screw x 11/2- complete round head with fibre wacrsohsesr recessed and No. 10-32 hex nut for mounting changer (2 required) Spring-Spring clip for knobs 77128 76890 74273 74809 77126 77059 76891 76555 76889 75945 76520 76894 73634 77127 75902 14270 76892 76893 77125 MISCELLANEOUS FOR MODEL 2ES38 Button-Plug button and ventilating screen (3 required) Catch-Cabinet catch and lock (2 required) Decal-"Victrola" decal Emblem-"RCA Victor" emblem Escutcheon-Knob well escutcheon Fastener-No. 2 x 11/16" wood screw and stud for fasten - :ng pickup arm hold-down strap Foot-Cabinet foot and glide (8 required) Handle-Carrying handle only Hinge-Cabinet lid hinge (2 required) Knob-Control knob-maroon Loop-Carrying handle loop and plate (2 required) Nut-No. 10-32 spring nut for changer mounting stud Nut-Speednut for speaker mounting screws (4 required) Plate-Background plate (perforated) for knobs Spring-Cable suspension spring (coil) Spring-Retaining spring for knob Strap-Hold down strap for pickup arm Stud-No. 10-32 x 1 1/4' special stud for mounting changer (2 required) Support-Lid support APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 18 2ES 3, 2ES 38 BLACK Y EL. RI1 I.8MEG. 1C1 MUTING SWITCH PICKUP RECORD CHANGER 1rP-rfirs MOTOR BLACK 12VSIQ7 AMPL. 6 62 V. C2 01 R1 1 MEG. VOL. CONT. R3 4.7 MEG. C4 .0022 R4 2 MEG. TONE CONT. 3 2 ON MOTOR I S1 BOARD / 115 V. AC. 41) SUPPLY BROWN z > - VOLTAGES MEASURED TO COMMON WIRING WITH "VOLTOHMYST." SHOULD HOLD WITHIN *20 % . -05 gi047 C6 .027 R5 270K V2 50 L6-GT OUTPUT 3 110 V. 4 115V. R6 270 K 8.4V R7 150 BLUE 1 C -.017 BRN. R8 1500 cc TI E*1 PM SPEAKER V3 35W4 RECT. 5 z C8A -c.> 50MF C8B 80 MF -a 7 125V i"Ae R9 33 I COMMON GROUND -B I CHASSIS /7177 GROUND K 1000 RIO 120 S-456,4 V2 V1 50 L6-GT 12507 77 CATHODE CURRENTS 12507 .0.2 MA 50L6-GT___5 2.0 MA 35 W4 ____ 52.2 MA 115V.A.C. INPUT SPEAKER AUDIO INPUT FROM RECORD CHANGER TONE CONTROL Schematic Diagram CRITICAL LEAD DRESS 1. Dress R3 down next to chassis. 2. Dress all leads away from R9 and R103. Dress power cord and other A.C. leads down next to chassis. 4. Connect C2 and C4 with short leads. 5. Dress electrolytic capacitor leads away from audio input circuit. POWER e. SWITCH LEADS TO RECORD CHANGER 43.1123 Amplifier Top View VOLUME CONTROI FOR RECORD CHANGER SERVICE INFORMATION REFER TO 930409 SERIES SERVICE DATA CONTROLS The record changer has a dual control on the motor board and a stylus selector control on the pickup arm. The inner control (circular knob) is the OFF -ON -REJECT control. Turning this knob to the center position energizes the motor and starts the turntable, when turned to the right (clockwise) it starts the mechanism into complete automatic operation. The mechanism will shut off automatically after the last record has been played but can be shut off manually by turning this knob to the left (counter -clockwise). The outer control (double ended lever) is the speed control. It has three positions; "33", "45", "78", to select the turntable speed desired. The stylus control has two normal positions (right and left) and one shipping position (lever pointing up). When playing 331/3 or 45 r.p.m. records the lever is turned so that "33-45" is visible on the TOP of the lever; likewise for 78 r.p.m. records "78" should be visible on the TOP. The removable centerpost is for use with 45 r.p.m. records having the large centerhole. It must be placed over the center spindle with the "RCA" trademark monogram FACING to the FRONT. When not in use it is placed in a well at the front of the motorboard. 45 RPM CENTERPOST PLACED OVER CENTER SPINDLE Record Changer Controls 19 RCA VICTOR Automatic Record Player Model 2 ES 31 Chassis No. RS -142 Record Changer 930409-5 SERVICE DATA - 1952 No. 7 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. Tube Complement 1. RCA 12SQ7 2. RCA 50L6-GT 3. RCA 35W4 Power Supply Rating 115 volts, 60 cycles A.0 Loudspeaker Size and type Voice coil impedance Power Output Undistorted . 1.2 watts SPECIFICATIONS A F Amplifier Output Rectifier 50 watts 4" x 6" PM 3 2 ohms at 400 cycles Maximum . 1.5 watts Dimensions (overall) Height 103/4" Width 13 Vs" Depth 13'/2" Weight Net weight 15 lbs. Record Changer (930409-5) Turntable speed . 331/3, 45 or 78 r.p.m. Record capacity Up to fourteen 7 inch RCA type or twelve 10 inch. or ten 12 inch. or ten 10 in. and 12 in. intermixed. Pickup (Stock No. 75475). Crystal with replaceable styli. STOCK No. 75980 73595 73920 73561 73554 73553 75562 76885 70392 73693 74838 72314 514033 503115 503215 503410 503427 503518 504547 70827 REPLACEMENT PARTS DESCRIPTION AMPLIFIER ASSEMBLIES RS -142 Ca5p0amciitdo.r,-E1le5c0trvoollyttsicancdom1prsiseicntgion1ofsec8t0iomn ido.,f 150 volts CCaappaacciittoorr--TTuubbuulalar,r,ppapaepre,r.,00.020247mmidid.,.,660000vvoollttss Capacitor-Tubular, paper, .01 mid., 400 yolts Capacitor-Tubular, paper, .027 mid., 400 volts Capacitor-Tubular, paper, Control-Tone control .047 mid., 400 volts Control-Volume control Cord-Power cord and plug C8A, C8B C4 C3 C2, C7 C6 C1, C5 R4 RI Grommet-Output transformer leads strain relief (1 set) Grommet-Power cord Resistor-Wire wound, strain relief 120 ohms, 5 w(1attsset) Resistors-Fixed, composition: RIO 33 ohms, ±20%, 150 ohms, ±10%, 1 watt 1/2 watt 1500 ohms, ±10%, Vz watt 100,000 ohms, ±10%, V: watt R9 R7 1,18 112 270,000 ohms, -1-10%, 1/2 watt 1.8 megohm, ±10%, Va watt 4.7 megohm, ±20%, /a watt 115, R6, R12 1111 R3 Socket-Tube socket, octal, wafer, for 125Q7 and 50L6GT tubes STOCK No. 73117 75939 DESCRIPTION Socket-Tube socket, 7 pin, miniature, for 35W4 tube Transformer-Output transformer wafer Ti SPEAKER ASSEMBLY 922258-6 W RL 100 C7 76886 Speaker -4" x 6" P.M. speaker complete with cone and voice coil (3.2 ohms) Note: If agree wsittahmapbionvgeosnpesapkeearkneur minbeirn, sotrrduemrernetpsladcoeems nenott parts by referring to model number of instrument, num- ber stamped on speaker and full description of part required. Y2400 X1756 76888 76787 77139 73634 76894 74734 76893 MISCELLANEOUS Cabinet-Plastic cabinet-maroon Cloth-Grille cloth Cover-Cabinet bottom cover less rubber feet Foot-Rubber foot (4 req'd) Knob-Control knob Nut-Speed nut for #8 screw for speaker bracket mount - ing screws Nut-#10-32 spring nut for changer mounting stud Spring-Spring clip for knobs Stud-#10-32 3e 11/4" special stud for mounting changer (2 req'd) APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 20 2 ES 31 BLACK EL. R11 I.8M EG 104C7I MUTING SWITCH PICKUP RECORD CHANGER 151.\-11Iir MOTOR BLACK BROWN 115 V. AC. SUPPLY VOLTAGES MEASURED TO COMMON WIRING WITH "VOLTOHMYST: SHOULD HOLD WITHIN + 20 % v 12 SQ7 AMPL. 6 62V. C4 - .0022 R4 2 MEG. TONE CONT. 3 2 1 ON MOTOR\ S1 BOARD / a cc V2 C6 50 L6-GT .027 OUTPUT BLUE R5 270K V3 35W4 RECT. 5 -LC7 .01 cc C8A - 50MF lc -co co_L BRN. ,R8aLa 1500 cc a La C8B rc MF lc to' _ PM SPEAKER ± COMMON ._ GROUND -B I CHASSIS gin GROUND 7 125V WV R9 33 K 1000 r-i00457 RIO 120 /21-4361 V2 V1 50 L6- GT 12SQ7 77 CATHODE CURRENTS 12SQ7 _0.2 MA 50L6-GT___5 2.0 M A 35 W4 ____ 52.2 MA 115V.A.C. INPUT SPEAKER LEADS AUDIO INPUT FROM RECORD CHANGER Schematic Diagram CRITICAL LEAD DRESS 1. Dress R3 down next to chassis. 2. Dress all leads away from R9 and Rio. 3. Dress power cord and other A.C. leads down next to chassis. 4. Connect C2 and C4 with short leads. 5. Dress electrolytic capacitor leads away from audio input circuit. POWER 4 SWITCH LEADS TO RECORD CHANGER Amplifier Top View VOLUME CONTROL FOR RECORD CHANGER SERVICE INFORMATION REFER TO 930409 SERIES SERVICE DATA CONTROLS The record changer has a dual control on the motor board and a stylus selector control on the pickup arm. The inner control (circular knob) is the OFF -ON -REJECT control. Turning this knob to the center position energizes the motor and starts the turntable, when turned to the right (clockwise) it starts the mechanism into complete automatic operation. The mechanism will shut off automatically after the last record has been played but can be shut off manually by turning this knob to the left (counter -clockwise). The outer control (double ended lever) is the speed control. It has three positions; "33", "45", "78", to select the turntable speed desired. The stylus control has two normal positions (right and left) and one shipping position (lever pointing up). When playing 331/3 or 45 r.p.m. records the lever is turned so that "33-45" is visible on the TOP of the lever; likewise for 78 r.p.m. records -78" should be visible on the TOP. The removable centerpost is for use with 45 r.p.m. records having the large centerhole. It must be placed over the center spindle with the "RCA" trademark monogram FACING to the FRONT. When not in use it is placed in a well at the front of the motorboard. STYLUS CONTROL FOR 331/3 OR 45 RPM RECORDS Record Changer Controls 21 RCA VICTOR Record Changer Attachment MODEL 2 JS 1 SERVICE DATA - 1952 No. 2 - SPECIFICATIONS Record Changer (930409-5) Turntable speed 331/3, 45 or 78 r.p.m. Record capacity Up to fourteen 7 inch RCA type or twelve 10 inch. or ten 12 inch. or ten 10 in. and 12 in. intermixed. Pickup (Stock No. 75475) ...Crystal with replaceable styli. Power Supply Rating 115 volts, 60 cycles A.C. 15 watts Dimensions (overall) Height 83/8" Width 131/2" Depth 13'/4" FOR RECORD CHANGER SERVICE INFORMATIONREFER TO 930409 SERIES SERVICE DATA 45 RPM CENTERPOST PLACED OVER CENTER SPINDLE STYLUS CONTROL FOR 331/3 OR 45 RPM RECORDS - FOR 78RPM RECORDS WELL FOR 45 RPM CENTERPOST Controls PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. CRYSTAL PICKUP MOTOR RED BLACK WHITE CE OUTPUT CABLE ON -OFF SW. 0 /7777 MOTOR BOARD MUTING SWITCH 115 V. A.C. POWER SUPPLY Schematic Diagram CONTROLS The record changer has a dual control on the motor board and a stylus selector control on the pickup arm. The inner control (circular knob) is the OFF -ON -REJECT control. Turning this knob to the center position energizes the motor and starts the turntable, when turned to the right (clockwise) it starts the mechanism into complete automatic operation. The mechanism will shut off automatically after the last record has been played but can be shut off manually by turning this knob to the left (counter -clockwise). The outer control (double ended lever) is the speed control. It has three positions; "33", "45", "78", to select the turntable speed desired. The stylus control has two normal positions (right and left) and one shipping position (lever pointing up). When playing 331/3 or 45 r.p.m. records the lever is turned so that "33-45" is visible on the TOP of the lever; likewise for 78 r.p.m. records "78" should be visible on the TOP. The removable centerpost is for use with 45 r.p.m. records having the large centerhole. It must be placed over the center spindle with the "RCA" trademark monogram FACING to the FRONT. When not in use it is placed in a well at the front of the moiorboard. REPLACEMENT PARTS STOCK No. DESCRIPTION 70392 77192 31048 Cord-Power cord and plug Foot-Rubber foot (4 required) Plug-Pin plug for audio output cable APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS. 22 2 IS I Connecting Record Changer Attachment to Radio or Television Receivers In general, the Record Changer Attachment must be used with receivers having at least two stages of high -gain audio amplification. The output of the Record Changer Attachment should be connected to the input of the first audio tube, and at the same time the output of the detector portion of the receiver should be shorted or opened, to prevent radio signals being heard while the Record Changer Attachment is in operation. RCA Radios or Television Receivers with Phono Jack Plug male connector on the end of the "Phono" lead into the female connector on the receiver chassis. If set is provided with a phono switch, push or turn the "Phono" switch to "Phono" position, and operate the Record Changer Attachment according to instructions. If no switch is provided, use minimum setting of receiver volume control which will give acceptable volume, and tune receiver off frequency from any very strong station. In some instances the radio volume control will have the effect of a tone control. Radios Without Phono Jack Methods of connecting the Record Changer Attachment to various types of audio systems are given in the accompanying text and illustrations. The data given requires that an RCA Type No. 240X1 (Formerly Stock No. 240) Radio-Phono switch be used for switching from radio to phonograph, as desired. For ease in connecting the "Phono" lead to the switch, the male plug on the end of the lead matches the phono jack on the switch. Note: If connected to a radio or television receiver as shown in Figures A or B, it will probably be necessary to add a volume control (1 to 2 megohm) to the Record Changer Attachment, since most receivers do not have a volume control following the first audio tube. Installation of Switch Fasten the bracket to the cabinet in such a position that the switch may be easily reached. For wooden cabinets, a suggested place is the upper rear edge of the cabinet. If the radio has a plastic cabinet, the bracket may be fastened to the chassis by self -tapping screws or soldering. In the case of a.c.-d.c. sets, the bracket should not be fastened to the chassis. In such cases, a wooden block may be fastened to the chassis and the bracket screwed to the wooden block, care being exercised that there is no metallic path from the bracket to the chassis. S S RADIO" 4 240 dSWITCH PHONO' PHONO_ JACK SCHAIEBLLDEED M5342 Connect the braided shield extension to the radio chassis by either soldering or placing the spade lug under a mounting screw. On a.c.-d.c. sets it is necessary to isolate the cable shield from the chassis. This is best done by connecting the shield to the chassis through a .1 mf. 400 -volt condenser. Care should be taken that the shield braiding and switch bracket do not come in contact with the chassis. If the common -negative wiring in the a.c.-d.c. set is isolated from the set chassis, connect the cable shield, through a .1 mid. capacitor, to the common -negative wiring, and not to the chassis. BLACK- GROWN Smit ExT. FIRST AUCiE TUBE ADAPTOR PLUG For receivers in which grid cap-see Fig. A: the 1st -audio tube has a top 1. Disconnect the grid lead from the first audio tube. 2. Connect the cap on the black lead to the clip on the grid lead, as shown above. 3. Connect the clip on the black -brown lead to the grid cap at the top of the 1st -audio tube, bending the terminal if necessary to proper size for a metal tube cap. 4. Insert the plug on the end of the record player lead into the jack on the bracket. 5. Secure or position the connection cable assembly so that the cap and clip terminals are well separated from each other and other metal parts. For receivers in which the 1st -audio tube is type 6SQ1, 6SR7, 12S07 or 12SR7-see Fig. 13: 1. Use adaptor plug RCA Stock No. 37798. 2. Remove the 1st -audio tube. 3. Solder the switch leads to the adaptor plug terminals- black to bottom lug-black-brown to top lug. 4. Tape terminals to prevent short circuits when installed in set. 5. Insert the adaptor into the 1st -audio tube socket. 6. Insert the 1st -audio tube into the adaptor. 7. Insert the plug on the end of the record player lead into the jack on the bracket. CABLE FROM 240 SW. 1 BLACK. BRCNJEI SHIELD I Ex T. BLACK BIAS AUDIO AMPL REMOVE SPLICE RADIO INPUT FROM 2ND. DET. MS For other radio receivers in which the 1st -audio tube does not have a grid cap ; connection to volume control input-see Fig. C: 1. Unsolder the lead from the volume control lug indicated in Fig. C. It is usually necessary to remove the chassis from the cabinet to do this. 2. Solder the black -brown lead (remove clip) to the lug or pin disconnected in Step 1. 3. Solder the black lead (remove plug) to the lead disconnected in Step 1. Tape the joint to prevent short circuits. 4. Insert the plug on the end of the record player lead into the jack on the bracket. Radio -Phonograph Combinations RCA Type 202-W-1 Record Player Selector Switch may be used to select the output of two record changers for connection to one phono input jack. A choice of two types of input jacks and output cable plugs are provided. Most radio -phonograph combinations use resistors and/or capacitors in their phono input circuit for tone compensation purposes. This may result in unsatisfactory reproduction from Model 2JS 1 when connected to the phono jack of such instruments. In such cases it is suggested that Model 2 J S1 be connected as indicated tor instruments not having a phono jack. 23 , RCA VICTOR A -C Operated Radio Receiver Models 2-R-51, 2-R-52, 2 -R -51A, 2 -R -52A Chassis No. RC -1119 SERVICE DATA -1952 No. 13- 2R51 Black & Gray 2R52 Tan & Ivory PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. SPECIFICATIONS Tuning Range Intermediate Frequency 540-1600 kc 455 kc Tube Complement: (1) RCA 12BE6 (2) RCA 6BJ6 (3) RCA 12AV6 (4) RCA 6AK6 RCA Stock No. 77292 Converter I.F. Amplifier Det.-AVC-A.F. Amp. Output Rectifier Dial Lamp (1) Type No. 51, 6-8 volts, 0.2 amp. Power Supply Rating: 115 volts a.c., 60 cycles 18 watts CAUTION:-DO NOT OPERATE ON D.C Loudspeaker: Size and type Voice Coil impedance Power Output: Undistorted Maximum Tuning Drive Ratio Weight Cabinet Dimensions: Height...53/8- Width 4 x 6 in. P.M. 3.2 ohms at 400 cycles 0 30 watts 0.45 watts 1 to 1 (Direct Drive) 4 lbs. 83/8- Depth. 35/8" CI -A 11-2133 1 12BE6 CON V. S T1 6 7.__ 1 1 I 1 11. 11= 1 00 rs1001 041.73 1_4 RI 35K C2 47 OSC. CO L R11 100 3 Lad 3 CI -13 9 133.2- *f 14 .- VC .0C4471 lij=1 OSC. COIL VOLTAGES MEASURED TO COMMON WHOIRLIDNGWWITITHHINV2O2L0T'/O. HWMITYHSTRAANTDEDSHPOOUWLDER SUPPLY. 11.1000 AAELRXLCECEINPAPTA1A4CSFIT.I,NAADNBICCOEAVVTEEA1DL.U0. EASRLEEISNSMTMHFA.N 1.0 C,111.475 V2 6BJ6 I. F. 7 2 VS 12AV6 DET.- A.F. -AV.C. C71 52°1 T2 [3.__ .tt...? b :S. ,2,1 2 12wai L2* RS 47K C1,.0022. V4 6AK6 OUTPUT 5 51,L 1311-4 -- >R10 =470 IBLU. 11'1 P1110 PM SPKR. R4 3.3 MEG. VIII; COST.1 7 a. CIS 120 Z81:41 C11 1.027 CS .01 4.7 MEG. 47 V. 115 V. SU0 .s PPLY I SI ON VOLUME CONTROL RECT. CR1 R222 03 eso0 /114111 -.re 1.=17 le;i C3 in® .047 V4 V2 GSA 5014F.T VI V3 .:. 0H GANG 61346 121326 12A1/6 °7 V. CSB 3014F. EL _3 4 3 4 3 1 3 1 HEATER CONNECTIONS C6 0.1 GND.1430-13) - ISOLATED FROM CHASSIS Schematic Diagram Models 2 -R -51A and 2.R -52A differ from Models 2-R-51 and 2-R-52 only in the type of resistor used for R2. In 2-R-51 and 2-R-52 the resistor is a fixed composition type. In 2 -R -51A and 2 -R -52A it is a fuse type wire wound resistor. The fuse type resistor (Stock No. 77571) should be used for replacement in all models. CHASSIS 24 2-R-51, 2-R-52 Top View OFF -ON VOLUME CONT. 4. The output plate by pass condenser should be dressed against the side of the chassis and away from the 1st audio grid condenser and the diode filter resistor. 5. Output transformer primary leads should be dressed away from the selenium rectifier. 6. The loop antenna should be accurately centered in its position on the fishpaper cover. The ends must not project beyond the fishpaper. SPEAKER C113 -T CIA -T Tube and Trimmer Locations FILAMENT TRANS T4 PILOT LAMP ALIGNMENT PROCEDURE Test-Oscillator-For all alignment operations, connect the low side of the test -oscillator to the receiver chassis, and keep the oscillator output as low as possible to avoid a -v -c action. On a.c. operation an isolation transformer (115 v./115 v.) may be necessary for the receiver if the test oscillator is also a.c. operated. Output Meter-Connect meter across speaker voice coil. Turn volume control to maximum. 6AK6 12AV6 Bottom View A.C. POWER CORD 14 CRITICAL LEAD DRESS 1. Oscillator coil should be centered in space provided and have at least 1/4 inch between winding and chassis. 2. The filament wiring should be dressed down on chassis and away from audio leads and audio coupling condensers. 3. The I.F. plate and grid leads, including the 2nd 1.F. diode lead should be as short as practical. Connect the 1 high side of Tune I Turn radio Adjust the Step test -otosc-illator testto-o-sc. dial to- following for max. output 61316 I -F grid 1 through .01 mfd. capacitor Stator of 2 CIA through .01 mfd. -3 Short wire placed near 4 loop to radiate signal 5 455 kc 1620 kc 1400 kc Quietpoint 1600 kc end of dial Min. cap. 1400 kc T2 (top and bottom) 2nd I -F. trans T1 (top and bottom 1st I -F trans. osc. trimmer Cl B -T ant. trimmer CIA -T Repeat steps 3 and 4 REPLACEMENT PARTS STOCK NO. DESCRIPTION CHASSIS ASSEMBLIES RC 1119 77438 Antenna-Ferrite rod antenna complete with windings .. Ll 77440 Capacitor-Variable tuning capacitor 77471 Capacitor-Ceramic, 4.7 mmf CIA, CIB ...... C13 75609 Capacitor-Ceramic, 47 mmf. C2 76347 Capacitor-Ceramic, 120 =If. C12 75611 Capacitor-Ceramic, 220 mmf. C7 77443 Capacitor-Electrolytic comprising 1 section of 50 mfd., 150 volts and 1 section of 30 mfd., 150 volts CSA, C5B 77446 Capacitor-Tubular, paper, .0022 mfd., 400 volts C9 77447 Capacitor-Tubular, paper, .0033 mfd., 400 volts CIO 77424 Capacitor-Tubular, paper, .01 mfd., 200 volts C8 77448 Capacitor-Tubular, paper, .027 mfd., 200 volts. .. C11 77422 Capacitor-Tubular, paper, .047 mfd., 400 volts... C4 75071 Capacitor-Tubular, moulded paper, .047 mfd., 400 volts C3 77423 Capacitor-Tubular, paper, 0.1 mfd., 400 volts. C6 73935 Clip-Mounting clip for I.F. transformer 77450 Coil-Oscillator coil L2, L3 77442 Control-Volume control and power switch. R6, SI 70392 Cord-Power cord and plug 77439 Cover-Insulating cover for chassis 74838 Grommet-Power cord strain relief (I set) 77405 Insulator-Bakelite insulator for variable tuning capacitor 77444 Nut-Speed nut for output transformer mounting screws 28452 Plate-Bakelite mounting plate for electrolytic 77292 Rectifier-Selenium rectifier . .CR1 77571 Resistor-Wire wound, fuse type, 22 ohms, 0.4 amps R2 Resistor-Fixed, composition:- 503110 100 ohms, ±10%, I/2 watt RI I 503147 470 ohms, ±10%, I/2 watt R10 523215 1500 ohms, ±10%, 2 watts R3 503268 6800 ohms, ±10%, 1/2 watt. 503333 33,000 ohms, ±10%, 1/2 watt 503347 47,000 ohms, ±10%, Ih watt R12 ........R..R5I 503433 330,000 ohms, ±10%, V2 watt. . R8 503482 820,000 ohms, ±10%, I/2 watt .. R9 503533 3 3 megohm, ±10%, t/2 watt. ....R4 STOCK NO. DESCRIPTION 503547 4.7 megohm, ±10%, V2 watt R7 76723 Socket-Lamp socket 75780 Socket-Tube socket, 7 pin, miniature saddle -mounted 77441 Transformer-Filament transformer 117 volts AC T9 77445 Transformer-Output transformer. T3 77416 Transformer -1st I.F. transformer complete with adjustable cores T1 77417 Transformer -2nd I.F. transformer complete with adjustable cores T2 77420 Washer-Shoulder washer (nylon) for mounting variable tuning capacitor SPEAKER ASSEMBLIES 922258-7 77451 Speaker -4'. x 6" P.M. speaker complete with cone and voice coil (3.2 ohms) MISCELLANEOUS 77457 Case-Polystyrene case-black & beige-complete with speaker baffle and screen assemblies less bottom cover for Model 2R51 77465 Case-Polystyrene case-tan 6. ivory-complete with speaker baffle and screen assemblies less bottom cover for Model 2R52 77456 Clip-Spring clip to mount station selector pointer 77458 Cover-Bottom cover-beige-for Model 2R5I 77466 Cover-Bottom cover-ivory-for Model 2R52 77453 Dial-Dial knob-black & gold-for Model 2851 77464 Dial-Dial knob-tan & gold-for Model 2R52 77452 Knob-Volume control and power switch knob-black & gold -for Model 2R51 77463 Knob-Volume control and power switch knob-tan & gold - for Model 2R52 11765 Lamp-Pilot lamp-Mazda 51 77455 Pointer-Station selector pointer 77454 Screw-#8-32 x 3/8" cross recessed truss head machine screw for fastening bottom cover 76783 Shield-Pilot lamp shield 74734 Spring-Spring clip for volume control knob or dial knob APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 25 FOR RECORD CHANGER SERVICE INFORMATION-REFER TO 930409 SERIES SERVICE DATA. '11/1 RCA VICTOR Radio Phonograph Combination Model 2-S-7 Chassis No. RC -1 1 1 7D SERVICE DATA -1 9 5 3 No. 1 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. SPECIFICATIONS Tuning Range 540 - 1600 kc. Intermediate Frequency 455 kc. Tube Complement 1. RCA 12BE6 Converter 2. RCA 12BA6 I.F. Amplifier 3. RCA 6AQ6 Detector-A.F. Amplifier 4. RCA 6AQ6 Phase Inverter 5. RCA 35C5 6. RCA 35C5 } Push Pull Output A selenium rectifier Stock #76871 is used. Power Supply Rating 115 volts A.C., 60 cycles 45 watts Dial Lamps (2) Mazda type 51, 6-8 volts, 0.2 amp. Loudspeaker Size and type Voice coil impedance 8" P.M. 3 2 ohms at 400 cycles Power Output At 10% distortion Maximum 2 0 watts 2 9 watts Cabinet Dimensions Height 321/4" Width 281/2" Depth 191/a" Tuning Drive Ratio 141/4 :1 (71/4 turns of knob) Record Changer (930409-5, or -10) Turntable speed 331/2, 45 or 78 r.p.m. Record capacity up to fourteen 7 inch RCA type or twelve 10 inch or ten 12 inch or ten 10 in. and 12 in. intermixed. Pickup (Stock No. 75475) Crystal with replaceable styli. Weight 66 lbs. net STABILIZER ARM 45 RPM CENTERPOST PLACED OVER CENTER SPINDLE FOR 78RPM P'CORDS WELL FOR 45 RPM CENTERPOST Record Changer Controls PICK UP ARM REST AD, OFF ON CONTROL .55 SPEED ONTROL RECORD CHANGER CONTROLS The record changer has a dual control on the motor board and a stylus selector control on the pickup arm. The inner control (circular knob) is the OFF -ON -REJECT control. Turning this knob to the center position energizes the motor and starts the turntable, when turned to the right (clockwise) it starts the mechanism into complete automatic operation. The mechanism will shut off automatically after the last record has been played but can be shut off manually by turning this knob to the left (counter -clockwise). The outer control (double ended lever) is the speed control. It has three normal positions, "33", "45", "78" to select the turntable speed desired and a neutral position (midway between "45" and "78"). The control should be turned to this neutral position if the changer is not expected to be in use for an extended period of time. The stylus control has two normal positions (right and left) and one shipping position (lever pointing up). When playing 331/3 or 45 r.p.m. records the lever is turned so that "33-45" is visible on the TOP of the lever; likewise for 78 r.p.m. records "78" should be visible on the TOP. The removable centerpost is for use with 45 r.p.m. records having the large centerhole. It must be placed over the center spindle with the "RCA" trademark monogram FACING to the FRONT. When not in use it is placed in a well at the front of the motorboard. To load or remove records, the record stabilizer is lifted and turned off -side. After loading it is turned to the center where it rests on top of the stack of records. 26 2-S-7 Radio Controls Critical Lead Dress 1. Dress all leads away from R22. 2. Dress all filament leads down to chassis. 3. Dress output plate leads down to chassis. 4. Dress R12 close to chassis. I NDICATOR PULLEY L__ CORD PULLEY TUNING KNOB SHAFT DRUM Dial Cord Layout Alignment Procedure Output Meter.-Connect meter across speaker voice coil. Turn volume control to maximum. Test Oscillator.-Connect low side of test oscillator to common wiring in series with a .1 mf. capacitor. If the test oscillator is a.c. operated it may be necessary to use an isolation transformer for the receiver during alignment and the low side of the test oscillator connected directly to common wiring at the electrolytic capacitor. Keep the oscillator output low to prevent a -v -c action. Connect the Stepshteisgth-otossci-dilelaotofr Tune testto-o-sc. Turn radtioo -dial Adjust the fol- lowing for max. output I.F. grid, in 1 series with Pri. & Sec. 2nd I.F. .1 mid. Quiet point transformer 2 Converter grid 455 kc in series with 1,600 kc end of dial Pri. & Sec. 1st I.F. .1 mfd. transformer NOTE.-ANTENNA LOOP MUST BE IN CABINET FOR THE FOLLOWING Extreme 3 Short wire 1,620 kc R. H. end C22 (osc.) (gang open) placed near 4 loop for 1,400 kc 1,400 kc C5 (ant.) radiated 5 signal 600 kc 600 kc Signal L3 (Rock Gang) 6 Repeat steps 3, Dial Pointer Adjustment.-Rotate tuning condenser fully counterclockwise (plates fully meshed). Adjust indicator pointer so that it is 315/111.' from the left hand edge of the dial back plate. - TUNING CONTROL 4.51 PI LOT LAMP RADIO , PHONO & TONE SELECTOR VOLUME 6 051 PILOT LAMP AC. CORD PHONO. POWER 0000000000000000000000000000 SELENIUM I RECT. OUTPUT 35C 5 P. M. SPEAKER PHASE INV. 6A0,6 OUTPUT 3 5C 5 600 KC -L3 ADJ T3 OUTPUT CI B TRANS. CIA CONV. 12BE6 C48464 1ST I -F T1 k I -F AMP. 12BA6 DET. AVC AUDIO 6AQ6 2ND CIBT I -F T2 U 1/4- 0 C5 PHONO INPUT SOCKET Tube and Trimmer Locations 2 VI T1 LI LOOP T e5 e I 12BE 6 15T. I -F TRANS. CONVERTER ri -ffe113111 5 100v. I 1 1 "" 1.5n. C1I2A- --7.1.--.f-(3_30 4-32 ,,,,,. -10V 66 -=. 107 GI El. I L2 I2A_ _ 4__I 12 VB2A6 2ND. 1-F T2 TRANS ii I -F r- I 3 15.n. 1 1 , , 588V. I 24 I II31,= .:=, an 1.0 , a., -c,5, c.a., 10G I 7 4* Ell I_- - 15n. 2 51 55_11 INDEX TAB O RED DOT © R2 < -LC4 039K tt CD: 56 3 05C. COIL CDC113,/ e6g1286-7.- C22 OSC COIL CD -ER L3© 6.5.n. V R6 270 1..7 MEG c2 .047 _- 22R01 K R7 120K 0-1 C3 7,- .047 V3 6A0.6 OET -AvC - AF 44V 5 R 10 012- MEG..0033 BLK. PI- M J1 -F PIN VIEW 3 PEAR VlF.W S MUTING SW. SHILD al 0_ wsis GND ON MOTOR BOARD 2 C 6 R3 I .047 3 330K C7 .0022 R4 47K PICKUP 3 SPEED CHANGER ==I-ir== 0.1-1' MOTOR P2-14 P2 F C8 .0018 Re 390K C21 .01 SI REAR R9 1.5 MEG C9 56 R10 56K ° C10 .00471 -- C 1 1 .022 R II 2 MEG VOLUME CONTROL C14 .005G R 13(-1 C13 220K I120 C15 .022 V4 6A0.6 PHASE INV. vs 35C5 OUTPUT C19 .01 1 R16 4.70K R8129 R t7 12K 6.4V - R18 470K 7 120V. V6 35C5 OUTPUT to0V T3 303/1 ,c) TOTAL 0. C 20 .01 P M 9P102 I(-1 R20 R21 125V. 88 V 1800 1200 V3 V4 EAQ6 GAGE C I7A 10 MF. T VI V2 I2BE6 12BA6 C17 CI7C 30 MF T 80'T' __L M F _ V5 V6 35C5 35C5 34 34 4 3 43 34 34 R22 66 RED SR I SELENIUM RECT. DIAL LAMPS = 018 . 047 R23 95.n. a 38°C. 13.5.0. iv 104 C. Schematic Diagram-Chassis RC -1117C o-48660 117 V. 60 ni SUPPLY 28 2-S-7 REPLACEMENT PARTS STOCK No. PART DESCRIPTION CHASSIS ASSEMBLIES RC1117D 76876 Antenna-Antenna loop and back cover, LI 76867 Capacitor-Variable tuning capacitor, CIA, C1B 76872 Capacitor-Adjustable trimmer, 2.5-30 mmf., C5, C22 77116 Capacitor-Fixed, ceramic, insulated, temp. coef.-3300, 56 mmf., ±20%, 500 volts DC, C4 Capacitor-Fixed, ceramic, insulated, high K type93603 56 mmf., ±10%, 500 volts, C9 76347 120 mmf., ±20%, 500 volts, C13 73013 Capacitor-Electrolytic: comprising 1 section of 80 mfd., 150 volts, 1 section of 30 mfd., 150 volts and 1 section of 10 mfd., 150 volts, C17A, C17B, C17C Capacitor-Fixed, tubular, paper: 73851 .0018 mfd., 1600 volts, C8, C21 73595 .0022 mfd., 600 volts, C7 73795 .0033 mfd., 400 volts, C12 73920 .0047 mfd., 400 volts, C10 73788 .0056 mfd., 400 volts, C14 73561 .01 mfd., 400 volts, C16, C19, C20 73562 .022 mfd., 400 volts, Cll, C15 73553 .047 mfd., 400 volts, C2, C3, C6 75071 Capacitor-Fixed, tubular, moulded paper: .047 mfd., 400 volts, C18 73935 Clip-Mounting clip for I.F. transformer 78586 Coil-Oscillathr coil complete with adjustable core L2. L3 36422 Connector-Phono input connector, J1 77114 Connector-Single contact male connector for loop lead 75174 Connector-Single contact male connector for speaker cable 30868 Connector -2 contact female connector for motor cable, P2 76874 Control-Volume control, R11 72953 Cord -250' Drive Cord Reel (approx. 54" overall req'd) 73690 Cord-Power cord and plug 74838 Grommet-Power cord strain relief (1 set) 72283 Grommet-Rubber grommet for mounting variable capacitor 11765 Lamp-Dial lamp-Mazda 51 28452 Plate-Bakelite mounting plate for electrolytic 77926 Plate-Dial back plate complete less dial 77378 Pointer-Station selector pointer 76871 Rectifier-Selenium rectifier, SRI 73072 Resistor-Normal value 95 ohms, @ 38°C with nega- tive temperature coefficient, R23 77379 Resistor-Wire wound, 66 ohms, 5 watts, R22 Resistors-Fixed, composition: 503082 82 ohms, ±10%, 1/2 watt, R19 503127 270 ohms, ±10%, 1/2 watt, R6 513212 1200 ohms, ±10%, 1 watt, R21 503218 1800 ohms, ±10%, 1/2 watt, R20 503312 12,000 ohms, ±10%, 1/2 watt, R17 503339 39,000 ohms, ±10%, 1/2 watt, R2 503347 47,000 ohms, ±10%, 1/2 watt, R4 503356 56,000 ohms, ±10%, 1/2 watt, 'R10 503412 120,000 ohms, ±10%, 1/2 watt, R7 503422 220,000 ohms, +10%, '/2 watt, R1, R13, R14 503433 330,000 ohms, ±10%, 1/2 watt, R3 503439 390,000 ohms, ±10%, 1/2 watt, R8 503447 470,000 ohms, -±-10%, 1/2 watt, R16, R18 503515 1.5 megohm, +10%, 1/2 watt, R9 503533 3.3 megohm, ±10%, 1/2 watt, R5 503610 10 megohm, ±10%, 1/2 watt, R12, R15 76869 Shaft-Tuning knob shaft 76870 Shield-Tube shield STOCK No. PART DESCRIPTION 74697 77115 51955 76368 76873 77122 74918 73037 33726 Socket-Dial lamp socket Socket-Tube socket, 7 pin, miniature, moulded Socket-Tube socket, 7 pin, miniature, moulded sad - dle-mounted Spring-Drive cord spring Switch-Function switch less volume control, SI Transformer-Output transformer, T3 Transformer-First I.F. transformer complete with adjustable cores, Tl Transformer-Second I.F. transformer complete with adjustable cores, T2 Washer-"C" washer for tuning knob shaft 75024 74664 SPEAKER ASSEMBLIES 92586-4W RL10504 RMA-274 Cone-Cone and voice coil (3.2 ohms) Speaker -8" P.M. speaker complete with cone and voice coil (3.2 ohms) MISCELLANEOUS 71892 Catch-Bullet catch and strike 70142 Clamp-Dial clamp (1 set) X3351 Cloth-Grille cloth for blonde mahogany instruments X3350 Cloth-Grille cloth for mahogany or walnut instru- ments 30870 Connector -2 contact male connector for motor cable, P2 74192 Connector -3 contact male connector for pickup cable, P1 77898 Decal-Control function decal for blonde mahogany instruments 77897 Decal-Control function decal for mahogany or walnut instruments 74273 Decal-"Victrola" decal 77889 Dial-Glass dial scale 74205 Escutcheon-Dial scale escutcheon less dial 74838 Grommet-Power cord strain relief (1 set) 77402 Handle-Pullout handle for record changer mech- anism 74308 Hinge-Door hinge (1 set) 77892 Knob-Function switch knob-beige-for blonde ma - hogany instruments (outer) 77891 Knob-Function switch knob-maroon-for mahog- any or walnut instruments (outer) 77382 Knob-Tuning control knob-beige-for blonde ma - hogany instruments (inner) 77386 Knob-Tuning control knob-beige-for blonde ma- hogany instruments (outer) 75945 Knob-Tuning control knob-maroon-for mahog- any or walnut instruments (inner) 77385 Knob-Tuning control knob-maroon-for mahog- any or walnut instruments (outer) 75464 Knob-Volume control knob -beige for blonde ma - hogany instruments (inner) 74963 Knob-Volume control knob-maroon-for mahog- any or walnut instruments (inner) 77894 Pan-Record changer mounting pan-beige-for blonde mahogany instruments 77893 Pan-Record changer mounting pan-plum-for mahogany or walnut instruments 76421 Pin-Slide mechanism stop pin 77896 Pull-Door pull 74113 Screw-#8-32 x 1" trimit head screw for door pull 77895 Slide-Mounting pan slide mechanism 76422 Spring-Retaining spring for slide mechanism stop pin 30330 Spring-Retaining spring for knobs 74963 and 75464 76837 Spring-Retaining spring for knobs 75945, 77382, 77385, 77386, 77891, 77892 72936 Stop-Door stop APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 4 29 RCA VICTOR AM -FM Radio -Phonograph Combination MODEL 2-5-10 Radio Chassis RC1111 Audio Amplifier R5141 Record Changer 930409-5, or -10 SERVICE DATA - 1952 No. 14 - FOR RECORD CHANGER SERVICE INFORMATION-REFER TO 930409 SERIES SERVICE DATA. PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. Specifications Tuning Range Standard Broadcast (AM) Frequency Modulation (FM) Intermediate Frequency (AM) Intermediate Frequency (FM) Tube Complement Tube Used 540-1600 kc. 88-108 mc. 455 kc. ...10.7 mc. Function (1) RCA 6CB6 (2) RCA 6J6 (3) RCA 6BA6 (4) RCA 6AU6 (5) RCA 6AL5 (6) RCA 6AV6. (1) RCA 6C4 (2) RCA 6V6GT. (3) RCA 6V6GT. (4) RCA 5Y3GT. Lamps Dial (2).. Jewel (1) R -F Amplifier Mixer and Oscillator I -F Amplifier F -M Driver Ratio Detector AM Det.-AVC-A-F Amplifier Audio Chassis RS141 Phase Inverter Audio Output Audio Output Rectifier #51, 6-8 volts, 0.2 amp. #51, 6-8 volts, 0.2 amp. Power Supply Rating 11S volts, 60 cycles, 100 watts Audio Power Output Rating Radio Phonograph undistorted 8 watts, maximum 9 watts undistorted 10 watts, maximum 12 watts Loudspeaker (92569-12W) Size and Type Voice Coil Impedance 12 inch P.M. 3 2 ohms at 400 cycles Tuning Drive Ratio 9.1 (41/2 turns of knob) Net Weight 96 lbs. Dimensions (overall) Height . . .351/2 in. Width 35 in. Depth . . .23 in. Record Changer (930409-5, or -10) Turntable Speed Record Capacity 331/2, 45 or 78 r.p.m. Up to fourteen 7 inch RCA type or twelve 10 inch or ten 12 inch or ten 10 inch and 12 inch into -mixed Pickup (Stock No. 75475) .. . Crystal with replaceable styli General Description This instrument is a Victrola combination having nine tubes, plus one rectifier. It has a modern style cabinet in either walnut, mahogany, or limed oak finish. The entire receiver (with the exception of the power supply and speaker) is built as a unit with the automatic record changer for "pull-out" operation. The three speed record changer is nested over the radio chassis on a plastic case. Record storage space is provided for both large and small diameter records. For standard broadcast reception, a loop antenna is mounted on the roll -out unit back. A folded dipole is mounted inside the cabinet for use on the FM band. Provision is made for connecting an external antenna for either the broadcast or FM bands. By rotating the function switch, the 2S10 can be operated as: 1. Phonograph sound channel for the three speed record changer. 2. Standard broadcast "A" band receiver (540-1600 kc). 3. Broadcast "FM" band receiver (88-108 mc). The function switch controls the internal connections for: A. RF-IF stage AVC voltages from AM or FM detector. B. Audio amplifier input from any one of three channels. C. B-1- voltage application to RF-IF circuits. D. Audio output tube bias voltage. In phonograph operation, R2 is disconnected from R107, increasing available power output for phonograph operation. E. Selection of tuned circuits for AM or FM operation. A horizontal tilted slide rule type dial is located along the top front face of the plastic roll -out case. The dial is edge -lighted at both ends by dial lamps. An amber jewel lamp, visible at the bottom front, glows whenever the set is in operation. Ex, A m FM AN, ANT 6CB6 R -F AMPL. cs 100 R.F COIL 6VJ26 MIXER e OSC. _/_/) FM ANT FOIL -C:g 7-C2IF5 LI _ LOOP CI -E 13-456 T 27 CI.0 7-28 X;r1 c 0 1470, 03 39 --COUPLED A -M OSC. COIL Cl2 C II 5 R6 680 R12 390 14700 150 R5 8V2V00 A -M RECOIL 3 51.0 2R2I FRONT MEG 12 I 0 3 220 8 7 51-0 2R.E1AR IC 9 St C FRONT 2 t 7 SI-C REAR 12 51- B FRONT SI-B REAR R2 1000 128 2.2 MEG. `SA& 7.5-22.5 4700 .047 v3 6BA6 I -F AMPL. V4 6AU6 DRIVER 6 T3 10_7 MC. C33 005 C32 4700 33DJ 2 R2 31 Ts RATIO OET. TRANS. 10.7 MC. vs 6AL5 RATIO DEM c 5 - 2 613 I FI 7 A I R34. 100 L81 038 1200 C37 _1- 330.c0m0,5- 2 mc 3E9 330 + R35 3300 _- 3R93K7 1 0;5V 47R03K8 4,0tfuc; T4- 455 KC C24 4700 I 51-A REAR SI-A w2 FRONT 12 ii i25,025 2 R25 R26 680 56K C25 .0033 C31 ISO R29 <t 2 MEG. H -F TONE I2 CNT. 6AV6 . C0300 47 DET.-H.v0 -Fw4 _ C35 14700 C29 .01 3 R19 t 1.5 MEG VOL CONT. 5028 .IC28 R39 270KTI50 MEG. RI6 2 MEG L -E TONE CONTROL P102 J2 AUDIO OUTPUT FUNCTION SWITCH 51 VIEWED FROM FRONT AND SHOWN IN POSITION 1. ( MAX. COUNTER CLOCKWISE) P05. 1 - PHONO. 33(3.45.78 R PM. 2 - A-14 RADIO. 43--ET-1V4. RADIO. POWER SWITCHES 53 AND 54 (MOUNTED ON FUNCTION SW.) SHOWN IN FUNCTION SWITCH POSITIONS 1 , 2 AND 3. RESISTANCES IN OHMS. Ks 1000 CAPACITANCES LESS THAN 1 IN MP AND ABOVE 1 IN MMF. UNLESS OTHERWISE NOTED. 22 MEG. SE ON -OFF 5W. (ON VOL.CONT1 PIN VIEW P101 -F REAR VIEW (ERN. GRN. P 131.1( V4 VS V2 VI V3 VG LAMPS A.C. POWER 5Y3-GT T101 RECT 6VC1042 PHASE 1" V 103 6V6-GT OUTPUT C 105 .0068 -2tv R104 4701, R101 2200 2 C1014 6 3o ME. g 0 C1018 30 MF. 7 15 +1200 C 102 .022 (1'2 =0 R105 t 17106 68K 470K TO AUDIO HEATERS C 10IC 40 MF 6-47934 RI07 270 3 298V V104 6V6-GT OUTPUT C104 .001 7102 P SPEAKER C103 .001 Complete Schematic Diagram-Chassis RC1111 and RS141 Alignment Procedure CORRECT ALIGNMENT OF THE AM R.F. STAGES REQUIRES THAT THE FM R.F. STAGES BE ALIGNED FIRST Alignment Indicators: An RCA VoltOhmyst or equivalent meter is necessary for measuring developed d -c voltage during FM alignment. Con- mndueecrtitenirogniFssMaalrseRoasntpieeoccDiefseiesteadcrtiyonrttoahleiingadnlmiigceanntmet.emCntoinntainmbeucultmatthioaeuno.duAitopnutoomuuttepptuuettr across the speaker voice coil. The RCA VoltOhmyst can also be used as ment indicator, either to measure audio output an or tAoMmeaalsiugrne- a -v -c voltage. When audio output is being measured the volume control should be turned to maximum. Adjust tone controls for maximum highs and lows during alignment. Signal Generator: For all alignment operations connect the low side of the signal generator to the receiver chassis. The output should be adjusted to provide accurate resonance indication at all times. If output measurement is used the signal generator should for be AM kept aalsiglnomwenat sthpeososuitbpluet of to avoid a -v -c action. AM Alignment ® RANGE SWITCH IN AM POSITION Connect high Steps side of sig. gen. to - Sig. gen. output Turn radio dial to- Adjust for peak output Pin No. 1 1 of V3 in series with .01 mfd. 2 To stator of Cl-E 455 kc. (mod.) Quiet point at low freq. end T4 bottomt core (sec.). T4 top core (pri.). T2 topt core (sec.). T2 bottom core (pri.). © PERFORM FM ALIGNMENT BEFORE PROCEEDING 3 1620 kc. (mod.) 1620 kc. C1B-T (osc.). 4 Short wire 1400 kc. (mod.) 1400kc. C1D-T (ant.). CIE -T (rf.). placed near loop for 5 radiated LS (osc.) with 10,000 ohm resistor from signal 600 kc. (mod.) 600 kc. RF stator to gnd. (rocking gang) 6 L7 (RF) with the 10,000 ohms removed. 7 Repeat steps 4, 5 and 6 until no improvement in sensitivity is obtained. Os®cil©latoenr cfrirecqlueednlceyttiesrsabinodviecasitgenraelcformeqmueenncdyedonalbigonthmAenMt and FM. sequence. FM Alignment FUNCTION SWITCH IN FM POSITION -VOLUME CONTROL MAXIMUM Steps Connect high side of sig. gen. to - Sig. gen. Turn radio output dial to- Adjust for max. output Connect the d -c probe of a VoltOhmyst to the negative lead of the 1 2 mfd. capacitor C39 and the common lead to chassis. Adjust sig. gen. output to provide approx. -4 v. indication during alignment. 2 Pin #1 of 6AU6 (V4) in series with .01 mf. 10.7 mc AM modulated 3 4 Repeat steps 2 and 3 Thru 470 ohms to CI -F. Connect grid. end 5 of cable close 10.7 mc to V2 cathode ground on r -f shelf - 88 mc Top of driver trails. T5 for max. d -c voltage tBottom of driver trans. T5 for min. audio output * Top (sec.) & bottom (pri.) cores of T3 *Top (sec.) & bottom (pri.) cores of T1 6 To FM antenna 7 terminals thru 120 ohms in each side of line 90 mc 106 mc 90 mc 106 mc Signal L8 (osc.) C I -F trimmer (ant.) and Cl-C trimmer (r. f.) 8 90 mc 9 Repeat steps 6, 7 and 8 90 mc Signal LI (ant.) and L2 (r. f.) Connect a sweep generator to the antenna terminals thru 120 10 ohms in each side of line. Connect an oscilloscope to junction of R33 and C35 to check response and linearity of FM band. Peak to peak separation should not be less than 180 kc. tTwo or more points may be found which lower the audio output. At the correct point the minimum audio output approached rapidly and is much lower than at any incorrect point. *Use a 680 ohm resistor to load the plate winding while the grid winding of the same trans. is being peaked. Then the grid winding is loaded with the 680 ohm resistor while the plate winding is being peaked. When windings are loaded, it is necessary to increase the 10.7 mc input to maintain the -4 volts indication. L8, LI and L2 are adjustable by increasing or decreasing the spacing between turns. Oscillator signal tracks above signal frequency. The proper adjustment of the I.F. cores can be determined by starting the core all the way out. The first peak obtained is the correct one. Tube Socket Voltages Tube Type and Function VI 6CB6 R -F Amp. V2 616 Osc. and Mixer V3 6BA6 I -F Amp. V4 6AU6 Driver VS GALS Ratio Det. V6 6AV6 Audio Amp. 6C4 Phase Inverter Tube Element Plate Screen Cathode Grid Plate Grid Plate Grid Plate Screen Cathode Grid Plate Screen Cathode --Grid Plate Grid Plate Cathode Grid Pin No. AM FM Phono 5 215 180 6 74 62 2 1 -00..84 0.4 0.4 2 55 58 5 -1.2 -1.3 1 6 -24.03 46 -1.2 5 210 210 6 126 115 7 1 -00..89 -00..27 5 216 216 6 150 150 7 1.5 1.5 --1 --0 --0 ------------------ 7 1 -08.78 -0.878 -010.84 5 7 6 87.5 --1116 88 -11 -16 -11230 -19 6V6GT Audio Output Plate Screen Cathode Grid 3 300 300 298 4 224 224 292 8 5 -170 -1, 70 0 -21 5Y3GT Rectifier Fil. 8 305 305 307 Voltages measured with VoltOhmyst and should hold within ±20% with rated line voltage. Tuning condenser closed -no signal input. Critical Lead Dress 1. The 1st F.M. I.F. plate lead should be dressed the R.F. plate. away from 2. Dress the 1st A.M. the A.M. R.F. coil. I.F. plate lead to S-2 wafer away from 3. The ground strap between the R.F. Shelf and the main chassis should be well soldered and kept as short as practicable but yet allow some flexibility for the R.F. Shelf. 4. Dress A.C. power switch wires away from all audio components. 5. Dress C-26 down toward base between terminal board and side apron. 6..0-18 bypass should ground as close to the R.F. Shelf ground strap as practicable. 7. Dress C-25 away from arm of volume control. 8. All leads, from the R.F. shelf, leaving through the shields must be kept as short as possible so as to minimize F.M. oscillator radiation. 9. Dress A.C. leads in the RS141 chassis away from audio input leads and components. 10. Dress all leads away from RI in the RS141 chassis. 11. All leads for F.M. should be kept short especially on the R.F. shelf. iii FM ANT COIL o.- CI F 7-25 f.7 VI 6C 86 CS R -F AMPL 100 180 V. 11 1 625. c 2 7-28 IS $14 .?14C700 F.54 RECOIL L2 L R II 120 K .( 68860 6JV26 MIXERS OSC 46V 1.2 V. 72A - COUPLED 18 VC IR13 COIL C C IS 68 C16 6.8 F5.1 COIL -IC14 15 CI -A 7.5-22 5 8 a_ .11 A C II 14700 RS 8200 C9 14700 CI8 C19 4700 .047 51-13 REAR It tl R2 ?I000 P 9 L R7 2.2 MEG. 1-C/ 14700 1(41 5 SHIELD 2.2 MEG. R IS 120 K C 20 4700 1124 15011 V3 6BA6 I -F AMPL. S .210 v. Itsv. 7 0.7v. R21 68 v4 VS 6AU6 DRIVER 5 2 Os/. TS RATIO DEL TRANS. 10.7 MC. 6AL5 RATIO DET. I -E --- a iSov .61 sie--...\ 5238 1200 a 1 2 7 1. 0 EC - 3I 3 - --1;- C37 1.3 10.7 MC. 030 C33 120 T.005 I4V02 .<,4 tir1 o 1 7 I I -I,:3.3c0005.--c2+3,z, t a35 3300 _- R3937K ± 33 -En-. LB 2R2K3I 1 1 .J vvv834 loo f irt3, 47 C 23 4700 R22 22K -EC3 4 '4.700pgZ I... -ii 2so=f}: I 1 1 C24 4700 T -±- f R25 680 ws SI-A REAR IRlT SI-A w2 FRONT 3 10 5 R' R29 2 MEG C25 .0033 ) 3 1.1-F TONE CONT. V6 , ' 6AV6 030 OET.-AC .0047 T ,,,., . .FA:APt C26 2 83 0,0 R IS 2.0212 1.5 MEG VOL CON TR 5 500K 250K R20 10 MEG Rf7 18K R 18 27 C21 C22 T.018 t .0,, I RIG 2 MEG. L -F TONE CONTROL C29 .01 TI R28 _LC28 270K T190 -1- -C437050 J2 AUDIO OUTPUT FUNCTION SWITCH SI VIEWED FROM FRONT AND SHOWN IN POSITON 1. (MAX. COUNTER CLOCKWISE) POS. 1 - PRONC5 33IA ,A5.78 R Pm. 23--AFM-MRRAADD1IO0 4 - T V POWER SWITCHES S9 AND 54 (MOUNTED ON FUNCTION SW.)5140811 IN FUNCTION SWITCH POSITIONS , 2 AND 3. RESISTANCES IN OHMS. Km 1000 CAPACITANCES LESS THAN 1 IN MP. AND ABOVE 1 IN MMF. UNLESS OTHERWISE NOTED. Ph - V4 VS V2 3I 14 O _ LDALt-, ;$ 7 MEG.22 5 2 0N-orF SW. (ON VOL. CONT.) J1-1.1 PIN VIEW P101- F REAR VIEW 81,4 MK+. A.0 POWER C40 4700 T101 a,a, 5Y3-GT RECT. v3 6V6-GT OUTPUT -CIOS 3 .0068 6C4 5102 -17 V. PHASE INV f4R7100K4 8101 2200 2 C 10IA o 30 MX 7 U C1018 = 30 RIO R103 100 82N RIDSt 8106 68K Ir. 470K TO AUDIO HEATERS E-47940 C104 .001 IF 7102 ma. SPE'AMNER. C 103 .001 I F1 Simplified Schematic Diagram-"FM" Position v, 6C B6 R -F AMPL. 6 J 6 MIXER g 05C r7AV * 2 54 .i. 150K CA .4700 v R13 INK R14 0 100 R3 39 I R II 120 K :21 7 C II R6 C 13 ..... LOOP 680 1 C9 14/00 SI-C FRONT 2it It 390 A -NE RECOIL 1r4700 ISO CI2-1T 7 FRONTB'. a T2- 455 KC r3 1 16 4700 .047 76 51-D REAR R2 ),.1000 E3 3 4 5 C6 70 76 SI-C :EAR, 2 ,c, IC41 5 T 9 IR12 io ,o 8 6 51-13 REAR 12 ,. ,, 9 5 7 3 ,s 6 RB 2.2 MEG V3 6BA6 I -F AMPL. Cathode Currents (Ma.) 5 210 V. Tube Term. Phono A.M. VI 6CB6 2 6 7 .o.9V R21 68 V2 616 V3 6BA6 V4 6AU6 V5 6AL5 7 7 7 1 & 5 ----7 3 13.7 -10.3 R22 22K T4- 455 KC V6 6AV6 2 V7 6C4 7 V8 6V6GT 8 0.7 0.5 2.2 L7 35.5 20.6 2so-S V9 6V6GT 8 C24 REAR470027 R25 6 E10 VIO 5Y3GT 2 FM. ET. AUDIO OUTPUT WS 2- c3, R29 2 MEC, N -F TONE CONT. VG C25 I 6AV6 SINA W2 FRONT .0033 C30 .0047 T. DET.-.4 C AMPL tv C29 .01 3 C26 2 z nw3 _ozv. 5 R19 1.5 MEG VOL. CONTR 5 - 0I 01 SOO K FED 250K R17 4 18 K 1 528 1C28 270KI150 35.5 20.6 74 76 .12 AUDIO OUTPUT F.M. 6 3 13.5 -10.6 0.5 17.1 21.1 21.1 77.5 FUNCTION SWITCH SI VIEWED FROM FRONT AND SHOWN IN POSITION I (MAX. COUNTER . CLOCKWISE) POS. I - PHONO ,45,78 RPM. 2- A-6, RADIO. 3 -F -M RADIO POWER SWITCHES S3 AND S4 (MOUNTED ON FUNCTION SW.)5140.16 IN FUNCTION SWITCH POSITIONS 1,2 AND 3. RESISTANCES IN OHMS. Km 1000 CAPACITANCES LESS THAN 1 IN 61F. AND ABOVE I IN MMF. UNLESS OTHERWISE NOTED. PI -F 52 ON -OFF sw. I ON VOL. CONT.) PIN VIEW V4 VS V2 VI V3 V6 P101.F REAR VIEW SRN. SRN. P 131. C40 4700 6-11-1 1",o1 V101 5Y3-GT RECT. V103 6V6-GT OUTPUT 16105 3 vlo2 6C4 PRASE INV .00-I68 5 R104 470K 8101 2200 O C1014 R M F. i 0 C101630 7= 3XF). 7 0103 82K 8108 100 .;;ZO1 C104 .00f IFS SPEAKER C 103 .001 -CIO -- C2 C27- TO AUDIO 47 4700 HEATERS T4700 POWER E-47539 - I L>) 0 Simplified Schematic Diagram-"AM" Position 34 2-S-10 Record Changer 45 RPM CENTERPOST PLACED OVER CENTER SPINDLE STAMBIMLIZER PICK UP ARM REST OFFON REJECT CONTROL FOR 78RPM RECORDS WELL FOR 45 RPM CENTERPOST 9 SPEED ONTROL Controls Record Changer Controls The record changer has a dual control on the motor board and a stylus selector control on the pickup arm. The inner control (circular knob) is the OFF -ON -REJECT control. Turning this knob to the center position energizes the motor and starts the turntable, when turned to the right (clockwise) it starts the mechanism into complete automatic operation. The mechanism will shut off automatically after the last record has been played but can be shut off manually by turning this knob to the left (counter -clockwise). The outer control (double ended lever) is the speed control. It has three normal positions, "33", "45", "78" to select the turntable speed desired and a neutral position (midway between "45" and "78"). The control should be turned to this neutral position if the changer is not expected to be in use for an extended period of time. The stylus control has two normal positions (right and left) and one shipping position (lever pointing up). When playing 331/2 or 45 r.p.m. records the lever is turned so that "33-45" is visible on the TOP of the lever; likewise for 78 r.p.m. records "78" should be visible on the TOP. The removable centerpost is for use with 45 r.p.m. records having the large centerhole. It must be placed over the center spindle with the "RCA" trademark monogram FACING to the FRONT. When not in use it is placed in a well at the front of the motorboard. To load or remove records, the record stabilizer is lifted and turned off -side. After loading it is turned to the center where it rests on top of the stack of records. Record Changer Adjustments Landing Adjustment Only one landing adjustment is necessary. The landing position of the stylus is adjusted by means of the eccentric stud (20A), mounted on the pickup arm support bracket. When adjusted for correct landing on one side of record, the landing position for other sizes of records is automatically corrected. Pickup Arm Height Adjustment The pickup arm height during cycle is adjusted by means of the hex head screw (17), located in the pickup arm. Turn control knob to "REP' and rotate turntable by hand until arm has risen to its maximum height. Adjust screw so that stylus is 13/8" above turntable. Stylus Force Adjustment Stylus force should be 71/2 to 91/2 grams. Loosen screw (14), and move slide until the correct force is obtained. 14 STYLUS FORCE 17 ADJUSTMENT HEIGHT ADJUSTMENT '104Ovs9lt IP 20A LANDING ADJUSTMENT MS -1300 Adjustments Tripping The tripping method used in this mechanism is a velocity method. Velocity tripping is effective between 43/4" and 31/4" diameters, when the stylus moves inward 1/8" or more per revolution of the turntable. No adjustment is required. Radio Operating Instructions Roll -Out Mechanism RADIO-Turn extreme right hand FUNCTION knob to "AM" or "FM" radio position as desired. Turn OFF -VOLUME Knob "ON" and advance to mid -position for medium volume. Allow approximately 20 seconds for tube warm-up. With TUNING knob, select desired station indicated by dial pointer. Set tone controls for most pleasing reception. Turn BASS control counter -clockwise and TREBLE control clockwise for full tone. Adjust volume level as desired. PHONOGRAPH-Turn extreme right hand FUNCTION knob to "PH" position. Turn OFF -VOLUME knob "ON" and advance to mid -position for medium volume. Set tone controls as indicated above for best tone. Refer to RECORD CHANGER section for operational information. OFF -VOLUME * BASS TREBLE TUNING PH -AM -FM Radio Controls Record Changer Mounting The record -changer is mounted in a roll -out carriage. The changer mechanism is mounted on springs and should be free floating. Roll -out Carriage Removal Roll -out carriage has two stop pins, (one at the back end of each slide) held in place by retaining spring. To remove roll -out carriage, it is first necessary to pull the retaining springs out of the slides with a pair of long nose pliers, the stop pins are then easily removed. The roll -out carriage may then be removed from the front of the cabinet after disconnecting its connecting cables. Roll -out Carriage Travel The roll -out carriage has a normal movement limitation of approximately 10 inches. If it does not have this amount of movement, it may be due to an obstruction or from slippage or creeping of the balls of the slide mechanism. Travel restriction due to slippage or creeping of balls in the slide mechanism can be corrected by exerting slightly greater pull until the normal travel limitation is reached. The carriage should then operate to its full travel with normal pull. 6 POWER SUPPLY SOCKET PHONO POWER AUDIO OUTPUT AKLOOP PHONO ANT. INPUT A.G. POWER POWER CORD TO RADIO CHASSIS 35 2-S-10 NOTE L2 - FMRF COIL AND LB- FM OSC. COIL ARE LOCATED UNDERSIDE OF CHASSIS. 455 KC. (TOP AND BOTTOM) CIO -T 1400 KC 455 KC. (TOP AND BOTTOM) T4 CIC-T 4 106 MC. INT I. F 4 15 AM -05C TRAN CI B -T I ISTI F TI F,1620 A. TRANS] 2.R I. e TRANS. F.M. 10.7 MC F.M. 10.7 MC. TOP. RE SoNANCE BOTTOM -CENTERING JEWEL LAMP LEADS RS141-Audio Amplifier Chassis OFF- ON 4 VOLUME BASS TONE cza TREBLE TONE TUNING BAND SWITCH PHONO -A.M.-F. M. RC1111 Chassis -Tube and Trimmer Locations Replacement Parts Dial Cord Drive STOCK NO. PART DESCRIPTION 77308 75613 77352 39044 76348 75612 39396 75614 75611 39640 39644 73473 73747 77468 73795 73920 72490 73561 73797 77469 73562 73558 73935 77313 71942 75569 CHASSIS ASSEMBLIES RC 1111 Capacitor -Variable tuning capacitor (C1 -A, C I -B, Cl-C, Cl-D, Cl-E, Cl-F) Capacitor -Ceramic, 5 mmf. (C12, C41) Capacitor -Ceramic, 6.8 mmf. (C16) Capacitor -Ceramic, 15 mmf. (C14) Capacitor -Ceramic, 47 mmf. (C10) Capacitor -Ceramic, 68 mmf. (C15, C17) Capacitor -Ceramic, 100 mmf. (C5) Capacitor -Ceramic, 150 mmf. (C13, C28, C31) Capacitor -Ceramic, 220 mmf. (C3) Capacitor -Mica, 330 mmf. (C36, C37) Capacitor -Mica, 470 mmf. (C6) Capacitor -Ceramic, 4700 mmf. (C2, C4, C7, C9, C11, C18, C20, C23, C24, C27, C32, C34, C35, C40) Capacitor -Electrolytic 2 mfd., 50 volts (C39) Capacitor -Tubular, paper, .0018 mfd., 600 volts (C8) Capacitor -Tubular, paper, .0038 mfd., 600 volts (C25) Capacitor -Tubular, paper, .0047 mfd., 600 volts (C30) Capacitor -Tubular, paper, .005 mfd., 200 volts (C33, C38) Capacitor -Tubular, paper, .01 mfd., 400 volts (C29) Capacitor -Tubular, paper, .015 mfd., 600 volts (C22) Capacitor -Tubular, paper, .018 mfd., 200 volts (C21) Capacitor -Tubular, paper, .022 mfd., 400 volts (C26) Capacitor -Tubular, paper, .047 mfd., 200 volts (C19) Clip -Mounting clip for I.F. transformer for 75558 & 76328 Coil -Antenna coil -FM (L1) Coil -Filament choke coil (L9, L10) Coil -Oscillator coil -AM -complete with adjust- able core (L3, L4, L5) STOCK NO. PART DESCRIPTION 77315 77305 77314 75543 74879 75062 35787 33742 75562 75561 75537 72953 75564 74839 16058 75548 11765 77311 77486 76421 72602 35641 503039 503068 503110 503112 503139 503168 503210 502212 502233 Coil -Oscillator coil -FM (L8) Coil-R.F. coil -AM -complete with adjustable core (L6, L7) Coil-R.F. coil -FM (L2) Connector -2 contact female connector for phono power cable (P1) Connector -2 contact female connector for an - tenna leads Connector -9 contact male connector for power input (J1) Connector -Single contact female connector for audio cable (J2) Connector -Single contact female connector for phono cable (J3) Control -Tone control-H.F. (R29) Control -Tone control-L.H. (R16) Control -Volume control and power switch (R19, S2) Cord -250' Drive Cord Reel (approx. 57" overall req'd) Coupling -Spring coupling for function switch extension shaft Fastener -Push fastener to fasten RF shelf (4 req'd) Grommet -Rubber grommet for mounting RF shelf (4 req'd) Grommet -Rubber grommet for mounting slides (4 req'd) Lamp -Dial lamp -Mazda 51 Latch -Bottom cover latch Nut -Speed nut for latch adjustment screw Pin -Slide mechanism stop pin Pulley -Drive cord pulley Pulley -Drive cord pulley -13/8" dia. Resistor -Fixed, composition: - 39 ohms, ±10%, 1/2 watt (R3) 68 ohms, ±10%, 1/2 watt (R21) 100 ohms, ±10%, 1/2 watt (R14, R34) 120 ohms, ±10%, 1/2 watt (R30) 390 ohms, ±10%, 1/2 watt (R12) 680 ohms, +10%, 1/2 watt (R6, R25, R32) 1000 ohms, ±10%, 1/2 watt (R2) 1200 ohms, ±5%, 1/2 watt (R36) 3300 ohms, +5%, 1/2 watt (R35) 7 36 2-S-10 Replacement Parts (Continued) STOCK NO. PART DESCRIPTION 503282 503315 503318 503322 503327 503339 503356 503412 503415 503422 503427 503447 503510 503515 503522 503610 504622 77303 75540 73584 75192 77310 31364 74179 73117 77306 77312 76332 75563 76422 77304 77307 75559 75558 76328 75560 73743 33726 77319 77318 77320 77321 77317 77316 77322 8200 ohms, ±10%, I/2 watt (B5) 15,000 ohms, ±10%, I/2 watt (R33) 18,000 ohms, ±10%, I/2 watt (R13, R17) 22,000 ohms, ±10%, 1/2 watt (R22, R31) 27,000 ohms, ±10%, 1/2 watt (R9, R18) 39,000 ohms, ±10%, 1/2 watt (R37) 56,000 ohms, ±10%, 1/2 watt (R26) 120,000 ohms, ±10%, I/2 watt (R11, R15) 150,000 ohms, ±10%, 1/2 watt (R4, 524) 220,000 ohms, ±10%, I/2 watt (R23) 270,000 ohms, ±10%, I/2 watt (R28) 470,000 ohms, ±10%, I/2 watt (R38) 1 megohm, ±10%, 1/2 watt (R39) 1.5 megohm, ±10%, I/2 watt (R10) 2.2 megohm, ±10%, 1/2 watt (51, R7, R8) 10 megohm, ±10%, I/2 watt (R20) 22 megohm, ±20%, I/2 watt (R27) Shaft -Extension shaft for function switch Shaft -Tuning knob shaft Shield -Tube shield for VI, V6 Shield -Tube shield for V2 Slide -Slide mechanism (2 req'd) Socket -Dial lamp socket Socket -Tube socket, 7 contact, miniature, wafer for VI, V3, V4, V5 Socket -Tube socket, 7 contact, miniature, wafer for V6 Socket -Tube socket, 7 pin, moulded, saddlemounted for V2 Spring -Actuating spring for bottom cover latch Spring -Drive cord spring Spring -Retaining spring for function switch extension shaft Spring -Retaining spring for slide mechanism stop pin Support -Polystyrene support for FM oscillator coil complete with mounting bracket Switch -Function switch (S1) Transformer-lst. I.F. transformer -FM -complete with adjustable cores (T1) Transformer -1st. I.F. transformer -AM -complete with adjustable cores (T2) Transformer -2nd. I.F. transformer -AM -cornplete with adjustable cores (T4) Transformer -2nd. I.F. transformer -FM -cornplete with adjustable cores (T3) Transformer -Ratio detector transformer complete with adjustable core (T5) Washer -"C" washer for tuning knob shaft or drive cord pulley ROLLOUT MECHANISM ASSEMBLIES Bracket -Dial lamp socket bracket-L.H. Bracket -Dial lamp socket bracket-R.H. Dial -Polystyrene dial scale Escutcheon -Dial scale escutcheon less dial Frame -Plastic mounting frame -light brown -for chassis and record changer for blonde ma- hogany instruments Frame -Plastic mounting frame -maroon -for chas- sis and record changer for mahogany or walnut instruments Pointer -Station selector pointer 77324 75643 73789 73562 72583 75064 AMPLIFIER ASSEMBLIES RS 141 Capacitor -Electrolytic comprising 1 section of 30 mfd., 450 volts, 1 section of 30 mfd., 350 volts and 1 section of 40 mfd., 25 volts (C101A, C101B, CIOIC) Capacitor -Tubular, paper, oil impregnated, .001 mfd., 1000 volts (C103, C104) Capacitor -Tubular, paper, .0068 mfd., 400 volts (C105) Capacitor -Tubular, paper, .022 mfd., 400 volts (C102) Cable -Shielded audio cable complete with pin plug (Includes P102) Connector -9 contact female connector for power input cable (P101) STOCK NO. PART DESCRIPTION 73690 74838 72776 73637 503110 522127 502233 503368 503382 503447 31364 31251 73117 77323 75566 Cord -Power cord and plug Grommet -Power cord strain relief (1 set) Pin -Contact pin for speaker lead (2 req'd) Resistor -Wire wound, 2200 ohms, 5 watts (R101) Resistor -Fixed, .composition:- 100 ohms, ±10%, I/2 watt (R108) , 270 ohms, ±5%, 2 watts (R107) 3300 ohms, ±5%, I/2 watt (R102) 68,000 ohms, ±10%, I/2 watt (R105) 82,000 ohms, ±10%, 1/2 watt (R103) 470,000 ohms, ±10%, 1/2 watt (R104, R106) Socket -Pilot lamp socket Socket -Tube socket, octal, wafer Socket -Tube socket, 7 pin, miniature, wafer Transformer -Output transformer (T102) Transformer -Power transformer, 117 volt, 60 cycle (T101) 75682 76093 SPEAKER ASSEMBLIES 92569-12W RMA-274 Cone -Cone and voice coil (3.2 ohms) Speaker -12" P.M. speaker complete with cone and voice coil (3.2 ohms) NOTE: If stamping on speaker in instruments does not agree with above speaker number, order replacement parts by referring to model number of instrument, number stamped on speaker and full description of part required. 77332 74649 77327 77326 77325 75707 71599 72437 13103 71892 X3222 X3130 30870 74882 74752 71984 74273 37396 74308 77330 77331 77328 77329 11765 73634 77335 77334 77333 75623 74113 74734 75902 72936 MISCELLANEOUS Antenna -Antenna loop -less cable Antenna-F.M. antenna Back -Back -light brown -for chassis and changer rollout assembly for blonde mahogany instruments Back -Back -maroon -for chassis and changer rollout assembly for mahogany or walnut instruments Back -Cabinet back Board -Antenna terminal board Bracket -Pilot lamp bracket Cable -Shielded pickup cable complete with pin plug Cap -Pilot lamp cap (Jewel) Catch -Bullet catch and strike for cabinet doors Cloth -Grille cloth for blonde mahogany instruments Cloth -Grille cloth for mahogany or walnut instruments Connector -2 contact male connector for record changer power cable Connector -2 contact male connector for antenna loop cable Connector -2 contact male connector for antenna lead Decal -"RCA Victor" decal Decal-"Victrola" decal Grommet -Rubber grommet for speaker mounting Hinge -Cabinet door hinge (1 set) Knob -Function switch knob -maroon Knob -Function switch knob -tan Knob -Tuning control, tone control or volume control and power switch knob -maroon Knob -Tuning control, tone control or volume control and power switch knob -tan Lamp -Pilot lamp -Mazda 51 Nut -Speed nut for speaker mounting screws Plate -Back plate for lower door pull (2 req'd) Pull -Cabinet door pull -lower (2 req'd) Pull -Cabinet door pull -upper -(4 req'd) Screw -#8-32 x 5/8' trimit head screw for upper door pull Screw -#8-32 a 1" trimit head screw for lower door pull Spring -Spring clip for knobs Spring -Suspension spring for main cable Stop -Cabinet door stop APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 8 37 FOR RECORD CHANGER SERVICE INFORMATION-REFER TO 930409 SERIES SERVICE DATA. RCA VICTOR Radio Phonograph Combination Model 2US7 Chassis No. RC -1 1 1 7A, RC -1 1 1 7C SERVICE DATA -1 9 5 2 No. 3 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. SPECIFICATIONS Tuning Range 540 - 1600 kc. Intermediate Frequency 455 kc. Tube Complement 1. RCA 12BE6 2. RCA 12BA6 3. RCA 6AQ6 4. RCA 6AQ6 5. RCA 35C5 6. RCA 35C5 Converter I.F. Amplifier Detector-A.F. Amplifier Phase Inverter } Push Pull Output A selenium rectifier Stock #76871 is used. Power Supply Rating 1. 115 volts A.C., 60 cycles (uses 930409-5 or -10 Changer) 2. 115 volts A.C., 50 cycles (uses 930409-11 Changer) 45 waits 45 watts Dial Lamps (2) Mazda type 51, 6-8 volts, 0.2 amp. Loudspeaker Size and type Voice coil impedance Power Output 5" x 7" P.M. 3 2 ohms at 400 cycles Undistorted Maximum Cabinet Dimensions 2 0 watts 2 4 watts Height 10" Width 161/4" Depth 203/4" Tuning Drive Ratio 141/4:1 (71/4 turns of knob) Record Changer (930409-5, -10 or -11) Turntable speed 331/2, 45 or 78 r.p.m. Record capacity ....up to fourteen 7 inch RCA type or twelve 10 inch or ten 12 inch or ten 10 in. and 12 in. intermixed. Pickup (Stock No. 75475) ..Crystal with replaceable Weight 26 lbs. net 45 RPM CENTERPOST PLACED OVER CENTER SPINDLE STABILIZER ARM FOR 78RPM RECORDS WELL FOR 45 RPM CENTERPOST Record Changer Controls PICK UP ARM REST OFF ON CROENTCERCT1' SPEED ONTROL RECORD CHANGER CONTROLS The record changer has a dual control on the motor board and a stylus selector control on the pickup arm. The inner control (circular knob) is the OFF -ON -REJECT control. Turning this knob to the center position energizes the motor and starts the turntable, when turned to the right (clockwise) it starts the mechanism into complete automatic operation. The mechanism will shut off automatically after the last record has been played but can be shut off manually by turning this knob to the left (counter -clockwise). The outer control (double ended lever) is the speed control. It has three normal positions, "33", "45", "78" to select the turntable speed desired and a neutral position (midway between "45" and "78"). The control should be turned to this neutral position if the changer is not expected to be in use for an extended period of time. The stylus control has two normal positions (right and left) and one shipping position (lever pointing up). When playing 33'/3 or 45 r.p.m. records the lever is turned so that "33-45" is visible on the TOP of the lever; likewise for 78 r.p.m. records "78" should be visible on the TOP. The removable centerpost is for use with 45 r.p.m. records having the large centerhole. It must be placed over the center spindle with the "RCA" trademark monogram FACING to the FRONT. When not in use it is placed in a well at the front of the motorboard. To load or remove records, the record stabilizer is lifted and turned off -side. After loading it is turned to the center where it rests on top of the stack of records. 38 2 US 7 FULL LOW HIGH SOFT Radio Controls Service Hints All tubes, except the 12BE6, are accessible for testing by lifting up one side of the cabinet and removing the tubes from the rear chassis apron. To service the 12BE6 tube and the pilot lights, remove the four wood screws holding the sloping panel at the front of the record changer compartment. This panel also holds the loop antenna. To remove the radio chassis for service, first remove the. push -on type knobs. Secure the record changer pickup arm to the center post and rest the cabinet on its side. Remove loop antenna connections, and pickup arm audio plug. Hook -on connectors are used to connect a.c. power from the radio chassis to the phono motor. These connectors are covered by taped -over black insulating sleeves located in one corner of the cabinet. Push back sleeves and unhook. Remove the four flat -head wood screws holding the chassis mounting board to the bottom of the cabinet. Slide chassis out of cabinet, then remove the three 1/4 inch hex head self -tapping screws holding the chassis to the panel. TUNING KNOB SHAFT Dial Cord Layout TUNING CONTROL 51 PI LOT LAMP Alignment Procedure Output Meter.-Connect meter across speaker voice coil. Turn volume control to maximum. Test Oscillator.-Connect low side of test oscillator to common wiring in series with a .1 mf. capacitor. If the test oscillator is a.c. operated it may be necessary to. use an isolation transformer for the receiver during alignment and the low side of the test oscillator connected directly to common wiring at the electrolytic capacitor. Keep the oscillator output low to prevent a -v -c action. Connect the Stepshteigsth-otossci-dilelaotofr Tune testto-o-sc. Turn radtioo -dial Adjust the fol- lowing for max. output I.F. grid, in 1 series with .1 mfd. Pri. & Sec. 2nd I.F. Quiet point transformer 2 Converter grid 455 kc in series with 1,600 kc end of dial Pri. & Sec. 1st I.F. .1 mfd. transformer NOTE.-ANTENNA LOOP AND RECORD CHANGER MUST BE IN CABINET FOR THE FOLLOWING Extreme 3 Short wire 1,620 kc R. H. end C1B-T (osc.) (gang open) placed near 4 loop for 1,400 kc 1,400 kc C5 (ant.) radiated 5 signal 600 kc 600 kc Signal L3 (Rock Gang) 6 Repeat steps 3, 4 & 5 if necessary Critical Lead Dress 1. Dress C15 (.022 mfd. at grid of phase inverter) over tube socket away from filament leads. 2. Keep all filament leads close to chassis. 3. Keep leads of R26 (270 ohms at I -F amplifier cath- ode) short as possible. 4. Connect outside foil of all capacitors as indicated in schematic diagram. 5. Dress output plate bypasses, C19 and C20, as near chassis as possible. Dial Pointer Adjustment.-Rotate tuning condenser fully counterclockwise (plates fully meshed). Adjust indicator pointer so that it is 315/16" from the left hand edge of the dial back plate. RADIO, PHONO 8 TONE SELECTOR /VOLUME 051 PI LOT LAMP AC. CORD PHONO. POWER 0000000000000000000000000000 8'8)&8888 SELENIUM RECT. OUTPUT 35C5 P. M. SPEAKER PHASE INV. 6AQ6 OUTPUT 35C5 600 KC -L3 ADJ (RC 1117C T3 ONLY OUTPUT 0 C1B TRANS. CIA CONV. 12BE6 1ST I -F T1 1/4 2ND I -F T2 I t-3 DET. I -F AVC AMP. AUDIO -V- 12BA6 6AQ6 CIBT ott 0 C5 0 PHONO INPUT SOCKET Tube and Trimmer Locations 2 LI LOOP 1.5.n. CIA 12- 432 OSC.COIL T1 12 BE G 1 ST.iit TRANS. CONVERTERff 3 I C5 3-30 5 loov. vz Tz 12 BA6 2ND. I -F TRA S. I -F 3 I 88V. 1131 g I# ei 15N.rIL I 106 L4 7 51 15(711 1.7 V. V3 6A0.6 DET.-Avc -AF 44 V. C ia. .0056 R 13F -41C 13 220K 1120 C15 .022 R2 0 39K OSC. T I 1,* ®45:C64 , C' C 1 13_,L.g COIL 4::.C. c:. 116 -7* -1' c:. E. ©III I-3 © 6.54 R6 270 3.3R5 MEG. R 12 10 C 12 - MEG. .0033 R14 10 MEG. IRISC16 220K .01 50V 7 v5 35C5 C19 OUTPUT .01 7 120 V. R16 470K R8129 - R17 12K 6.4V. R18 470K 7 120V. T3 300.n. TOTAL 00, -111D C 20 .01 PM 5RK.R C2 - RI .047 220K 0-1 C3 .047 * L3 VARIABLE ON RC I117C R7 120K I 2 SI 1 0 a 3A FRONT PI- M J1 -F PIN VIEW REAR BLK VIEW S2 MUTING SW. EMI* nieM11. SieL0 2 111111-111WAI GND.ON MOTOR C6 R3 I.04.7 330K BOARD C7 .0022 R4 47K C8 8 .0018 7 Re 390K C2I -)1 4A R9 1.5 MEG C9 56 4 RIO 0 56K '0t CII .022 R11 2 MEG. VOLUME CONTROL 6440.6 PHASE INV. 88V. v6 35C5 OUTPUT 100y. R20 1800 R2I 125V. 1200 V3 6AQ6 34 V4 GAGS 34 C 17A 10 MF. -4- VI V2 I2BE6 12BA6 43 43 - C17 30 5 ME TC1870C T MF _L- ÷ RED V5 VG 35C5 35C5 SRI SELENIUM RECT. 3 4 34 R22 66 DIAL LAMPS PICKUP 3 SPEED ===11=== CHANGER irtilyZyr MOTOR P2 -M -t P2- F .0018 51 REAR C10 .00471 , C.01487 R23 95.110 38* C. 13.5n 8104'C. Schematic niaRram-Chassis RC 1117C D-48798-3 I I7V. 60,v SUPPLY PI -M C21 BLK. .01 PIN VIEW REAR VIEW S2 MUTING SW. 514 LD MM.111.11111M 110_11111. G1.113.0N MOTOR C6 R3 I.047 330K BOARD PICKUP C7 .0022 R4 47K Re 390K Partial Schematic Diagram RC -1117A SI REAR CB .0018 I f - R9 1.5 MEG RIO - C11 .022 R11 2 MEG. VOLUME CONTROL CIO .00471 FUNCTION SW. 51 VIEWED FROM FRONT, AND SHOWN IN POSITION NO.1 (MAX. COUNTER CLOCKWISE). P05. I - OFF. 423--- RADIO 0 » - MIN. HIGHS NORMAL MAX. HIGHS 7-56--PHO» NO--NMOINR. MHIAGLHS » - MA X. HIGHS L INDICATES CHASSIS GROUND. K = 1000 RESISTANCES IN OHMS CAPACITANCES LESS THAN I IN MF. AND ABOVE I IN MmF: UNLESS OTHERWISE NOTED. I INDICATES COMMON WIRING INSULATED FROM CHASSIS. 40 2 US 7 REPLACEMENT PARTS STOCK No. DESCRIPTION CHASSIS ASSEMBLIES RC1117A, RC1117C 76867 Capacitor-Variable tuning capacitor complete with drive drum, CIA, C1B 93603 Capacitor-Ceramic, 56 mmf., C9. 77116 Capacitor-Ceramic, 56 mmf., C4 76347 Capacitor-Ceramic, 120 mmf., C13 76872 Capacitor-Adjustable trimmer, 2.5-30 mmf., C5 73013 Capacitor-Electrolytic comprising 1 section of 80 mfd., 150 volts, 1 section of 30 mfd., 150 volts and 1 section of 10 mfd., 150 volts, C17A, C17B, C17C 73851 Capacitor-Tubular, paper, .0018 mfd., 1600 volts, C8. C21 (RC1117C only) 73595 Capacitor-Tubular, paper, .0022 mfd., 600 volts, C7 73795 Capacitor-Tubular, paper, .0033 mfd., 400 volts, C12 73920 Capacitor-Tubular, paper, .0047 mfd., 600 volts, CIO 73788 Capacitor-Tubular, paper, .0056 mfd., 400 volts, C14 73561 Capacitor-Tubular, paper, .01 mfd., 400 volts, C16, C19, C20 73562 Capacitor-Tubular, paper, .022 mfd., 400 volts, C11, C15 73553 Capacitor-Tubular, paper, .047 mfd., 400 volts, C2, C3, C6 75071 Capacitor-Tubular, moulded paper, .047 mfd., 400 volts, C18 76866 Coil-Oscillator coil without adjustable core L2, L3 78586 Coil-Oscillator coil with adjustable core L2, L3 74192 Connector -3 contact male connector for shielded pickup cable, P1 77114 Connector-Single contact male connector for loop lead 76874 Control-Volume control, R11 72953 Cord -250' Drive Cord Reel (approx. 54" required) 70392 Cord-Power cord and plug 74838 Grommet-Power cord strain relief (1 set) 72283 Grommet-Rubber grommet to mount variable tuning capacitor (3 req'd) 11765 Lamp-Dial lamp-Mazda 51 28452 Plate-Bakelite mounting plate for electrolytic 76865 Plate-Dial back plate complete with three (3) pulleys less dial 76868 Pointer-Station selector pointer 76871 Rectifier-Selenium rectifier, SRI 73038 Resistor-Wire wound, 66 ohms, 5 watts, R22 73072 Resistor-Normal value, 95 ohms, @ 38°C with negative temperature coefficient R23 Resistor-Fixed, composition: 503082 82 ohms, ±10%, 1/2 watt, R19 503127 270 ohms, =-1--10%, 1/2 watt, R6 503218 503312 503339 503347 1800 ohms, ±10%, 1/2 watt, R20 12,000 ohms, ±10%, 1/2 watt, R17 39,000 ohms, ±10%, 1/2 watt, R2 47,000 ohms, ±-10%, 1/2 watt, R4 STOCK No. DESCRIPTION 503356 503412 504422 503433 503439 503447 504447 503515 504533 504610 76869 76870 74697 51955 77115 76368 76873 77113 74918 73037 77122 33726 56,000 ohms, ±10%, 1/2 watt, R10 120,000 ohms, ±-10%, 1/2 watt, R7 220,000 ohms, ±20%, 1/2 watt, RI, R13, R14 330,000 ohms, ±-10%, 1/2 watt, R3 390,000 ohms, ±10%, 1/2 watt, R8 470,000 ohms, ±10%, 1/2 watt, R16 470,000 ohms, ±20%, 1/2 watt, R18 1.5 megohm, :1-10%, 1/2 watt, R9 3.3 megohm, ±20%, 1/2 watt, R5 10 megohm, ±20%, 1/2 watt, R12, R15 Shaft-Tuning knob shaft Shield-Tube shield for VI, V2, V3 Socket-Dial lamp socket Socket-Tube socket, 7 pin, miniature, moulded, saddle -mounted Socket-Tube socket, 7 pin, miniature, moulded Spring-Drive cord spring Switch-Function switch less volume control, Si Terminal-Phono lead assembly terminal (knife) disconnect type) Transformer-First I.F. transformer complete with adjustable cores, Ti Transformer-Second I.F. transformer complete with adjustable cores, T2 Transformer-Output transformer, T3 Washer-"C" washer for tuning knob shaft (2 req'd) SPEAKER ASSEMBLIES 76875 Speaker -5" x 7" P.M. speaker complete with cone and voice coil (3.2 ohms) MISCELLANEOUS 76876 77350 74273 76877 76588 Back-Cabinet back and antenna loop assembly (LI) Cable-Cable and Capacitor assembly (includes C21) (For RC1117A only) Decal-"Victrola" decal Dial-Polystyrene dial scale Emblem-"RCA Victor" emblem 74225 76878 76879 76895 72692 76882 76881 76883 76880 71095 72765 76894 Escutcheon-Dial escutcheon less dial Escutcheon-Function switch escutcheon Escutcheon-Tuning control escutcheon Foot-Rubber foot (4 req'd) Hinge-Cabinet lid hinge Knob-Function switch knob-light gray Knob-Tuning control knob-(inner) light gray Knob-Tuning control knob (outer)-light gray Knob-Volume control knob-light gray Nut-Speed nut to fasten dial escutcheon Nut-Speed nut to fasten function switch or tuning control escutcheon Nut-#10-32 spring nut for mounting stud 30330 Spring-Retaining spring for volume control knob 14270 Spring-Retaining spring for tuning control or function switch knobs 76893 Stud-#10-32 x 11/4" special stud to mount changer in cabinet (2 req'd) 71824 Stud-Stud and screw (1 set) for cabinet lid hinge 77221 Support-Lid Support APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT TARTS 4 41 RCA VICTOR AC -DC Radio Receiver Models 2X61, 2X62 Chassis No. RC -1080C RC -1080D SERVICE DATA - 1952 No. 9 - Model 2X61 Maroon Model 2X62 Ivory PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. SPECIFICATIONS Tuning Range Intermediate Frequency 540-1600 kc 455 kc Tube Complement (1) RCA 12SK7 (2) RCA 12SA7 (3) RCA 12SK7 (4) RCA 12SQ7 (5) RCA 35L6GT (6) RCA 35Z5GT R.F. Amplifier Converter I F. Amplifier Det.-A.V.C.-A.F. Amp. Output Rectifier Power Supply Rating 115 volts d. c. or 50 to 60 cycles a. c. 35 watts Dial Lamp 2 Mazda type 1490, 3.2 volts, 0.15 amp. Loudspeaker Size and type Voice coil impedance 4 -in. P.M. 3.2 ohms at 400 cycles Power Output Undistorted Maximum 0.85 watt 1.15 watts Tuning Drive Ratio 8.5 to 1 (41/4 turns of knob) Weight 8 lbs. Cabinet Dimensions Height ....85/e" Width 111/4" Depth ....71/2" STOCK No. DESCRIPTION REPLACEMENT PARTS STOCK No. DESCRIPTION 77143 77144 77143 77144 77145 39042 71924 73501 73473 74662 73595 73797 73562 73553 73551 73794 73935 74693 73677 35787 75474 38410 72953 70392 73693 72283 77142 72602 514033 CHASSIS ASSEMBLIES RC 1080C-Model 2X61 Antenna-Antenna loop and bRaCck108c0oDv-Merodaesls2eXm6b2ly- Amntaerononna--fAornMteondnela2lXo6o1p and back cover assembly- Baivcokr-yC-faobrinMeotdbealc2kXc6o2ver and antenna loop assembly Ba-mcka-rCooanb-ifnoertMbaocdkelc2oXv6e1r and antenna loop assembly -ivory-for Model 2X62 Capacitor-Variable tuning capacitor complete with drive drum, Cl, C2, C3, C4, C5, C6 Capacitor-Ceramic, 47 mmf., C8 Capacitor-Ceramic, 56 mmf., C9 Capacitor-Ceramic, 150 mmf., C12, C13 Capacitor-Ceramic, 4700 mmf., C20 Capacitor-Electrolytic comprising 1 section of 80 mfd., 150 volts and 1 section of 50 mfd., 150 volts, C19A, CaCp1a9Bcitor-Tubular, paper, .0022 mid., 600 volts, C14 Capacitor-Tubular, paper, .015 mid., 600 volts, C16 Capacitor-Tubular, paper, .022 mid., 400 volts, Cl5 Capacitor-Tubular, paper, .047 mid., 400 volts, C17, C18 Capacitor-Tubular, paper, 0.1 mid., 400 volts, C10, C11 Capacitor-Tubular, paper, 0.22 mfd., 400 volts, C21 Clip-Mounting clip for I.F. transformer Coil-Oscillator coil complete with adjustable cores, L3, L4 Coil-R.F. coil complete with adjustable cores, LI, L2 Connector-Phono input connector Connector-Single contact male connector for output transformer leads (2 req'd) Control-Volume control and power switch, R14, Sl Cord-Drive cord (approx. 50" overall) Cord-Power cord and plug GGrroommmmeett--PRouwbberercogrrdomstrmaient rfeolriemf o(1unsetitn)g tuning cape- Pociintotrer-Station selector pointer Pulley-Drive cord pulley Resistor-Fixed, composition:- 33 ohms, ±20%, I watt, R13 503112 503118 503127 513212 503312 503322 503356 503410 503422 503447 503522 503547 74691 74697 54414 76368 33634 73036 73037 73976 35969 76391 Y2445 Y2446 77146 77241 74931 72645 71116 74301 30900 120 ohms, ±10%, 1/2 watt, R4, R11 180 ohms, ±10%, 1/2 watt, RI 270 ohms, +10%, Vs watt, Rl5 1200 ohms, +10%, 1 watt, R12 12,000 ohms, -1-10%, 1/2 watt, R2 22,000 ohms, ±10%, 1/2 watt, R3 56,000 ohms, ±10%, 1/2 watt, R7 100,000 ohms, +10%, Va watt, R16 220,000 ohms, ±10%, 1/2 watt, R5, R6 470,000 ohms, ±10%, 1/2 watt, RIO 2.2 megohm, ±10%, 1/2 watt, R8 4.7 megohm, +10%, 1/2 watt, R9 Shaft-Tuning knob shaft Socket-Dial lamp socket Socket-Tube socket Spring-Drive cord spring Switch-"Radio-Phono" Transformer-First I.F. stwraitncshf,oSrm2 er complete with ad- Trjaunsstafoblremceorr-eSse,cTo1nd I.F. transformer complete with ad - justable cores, T2 Transformer-Output transformer, T3 Washer-"C" washer for tuning knob shaft SPEAKER ASSEMBLIES 971495-3 Speaker -4" P.M. speaker complete with cone and voice coil (3.2 ohms) MISCELLANEOUS Cabinet-Plastic cabinet-maroon-complete with dial Ceasbciuntecht-ePolnafsotircMcoadbeiln2eXt 6-1ivory - complete with dial escutcheon for Model 2X62 Dial-Polystyrene dial scale Escutcheon-Dial escutcheon Knob-Control knob-maroon-for Model 2X61 Knob-Control knob-ivory-for Model 2X62 LSacmrepw-D-#ia8l lxamVs" Mbianzddaer14h9e0ad screw (cross recessed) Spforirnmg-oRuenttaiinngindgiaslpring for knobs 1' Stock No. 72953 is a reel containing 250 feet of cord. APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 42 2X61, 2X62 NOTE.-If reception is not obtained on d. c. operation, reverse plug in outlet receptacle. On a. c. operation this may reduce hum. The position of the speaker is adjustable; the correct position is indicated on the illustration "Tube and Trimmer Locations." ALIGNMENT PROCEDURE Cathode Ray Alignment is the preferable method. Connections for the oscilloscope are shown on the schematic diagram. Output Meter Alignment.-If this method is used, connect the meter across the voice coil and turn the receiver volume control to maximum. Test Oscillator.-Connect low side of test oscillator to common wiring in series with a .1 mf. capacitor. If the test oscillator is a. c. operated it may be necessary to use an isolation transformer for the receiver during alignment and the low side of the test oscillator connected directly to common wiring at the electrolytic capacitor. Keep the oscillator output low to prevent a -v -c action. Connect high Step side of sig. gen. to- Sig. gen. Turn radio output dial to- Adjust for peak output 1 Pin No. 4 of 12SK7 (V3 I.F.) Top and bottom 455 kc Quiet point cores of T2 2 Pin No. 8 of near 600 kc 12SA7 (V2 cony.) Top and bottom cores of T1 3 1620 kc Gang open C6 Osc. 4 1400 kc 1400 kc C5 R.F. signal C4 Ant. "External Antenna" Shunt C5 with 22,000 ohm resistor 5 terminal through 100 mmf. 600 kc 600 kc L4 Osc. capacitor (Rock gang) 6 Remove 22,000 ohm resistor from C5 600 kc 600 kc L2 R.F. 7 Repeat steps 4, 5 and 6 DIAL CORD DRUM SHOWN IN MAX. CAP. POSITION. Dial Indicator and Drive Mechanism LOOP ANTENNA VOL CONT. PAR. SW Tube and Trimmer Locations TUNING The position of the loop antenna in relation to the chassis affects adjustment of C4. The correct position is indicated on the illustration "Tube and Trimmer Locations." A C20 .0047 LOOP CI 12-398,_ 1/1 RF 125K7 83V 52 21( V2 CONV. 125A7 83 V. Cr R P .1.1 KAELE RI 180 t4 2-17 L2 ,LI .1- 2 1q p/t/ti 4 8, 4 t 2 lA ce, 3 47 11 1 I ca 10-2.36 R3 22K -I0V.6000C T2V.1400,4C C5 2-10 V3 IF 125K7 830. V4 DET.-AVC-AF 12SQ7 590. VS OUTPUT 35L6-T Hi V. TI 4-1 - 3 1 tt- 3 ,_ ... 86 '170 -., 72 ii: c,t c. '... ,..-.. 106 131: : ,..-) ...Km II 2 5 I c*l;o 55 le,' 2200 554 n717 1 3 13 C21 0.221 T15C103 .0C-01422 R6 220K CIS 015 27 47 7.100K in RIO '41.1 nln .2. 83V. BLUT3 GRN SA REDadA 115. BLK P.M. SPEAKER RID 1200 mat 03C. - 36 0)COIL.1.L4T 10 B cr'SA 2,10 C B = C3 7.2 98 RB 2.9 SEX. 92 R. PM. P MONO INPUT C198 50MF. T150 OSCILLOSCOPE CONNECTIONS VERTICAL 'HI' TO THIS POINT VERTICAL -Cr TO CHASSIS , 514 900K VOL. CNTL. 1.0C4I77 CI5022 R9 4.7 560. VS RECT. 35Z 5-GT CARA I BO MF. r/COLOR CODED 20 ® 50 04 30 TERN. 25 ON T2 ONLY. LF. TRANSFORMER BOTTOM VIEW I INDICATES COMMON WIRING - INSULATED FROM CHASSIS K .1000 INDICATES CHASSIS 17777 GROUND CATHODE CURRENTS VI 12507 ma MA. V2 125A7 9.1 V9 12507 10.2 .. V4 12507 0.11 V5 35L6-GT 38.5 vEl 3515-GT 68.3 ALL CAPACITOR VALUES LESS THAN 1.0 ARE IN ME. AND ABOVE 1.0 ARE IN M341.. EXCEPT THOSE INDICATED IN SF. VOLTAGES MEASURED TO COMMON WIRING WITH VOLTOHMYST, SHOULD HOLD WITHIN 220% WITH RATED POWER SUPPLY. V4 V2 VI V3 VS I2SQ7 125.47 1251(7 1251(7 35L6.GT 87 72 27 7272 R15 270 81 (ON VOL. CONTROL 33 C IN 200. .047 DIAL LAMPS 41490 115 V. A.C.-D.C. POWER SUPPLY Schematic Diagram 43 RCAVICTOR AC -DC Radio Receiver MODEL 2-X-621 Chassis No. RC -1085B SERVICE DATA - 1952 No. 11 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. Specifications Tuning Ranges Standard Broadcast ("A" Band) Short Wave ("C" Band) 540-1600 kc 5.8-18.0 me Intermediate Frequency 455 kc Tube Complement (1) RCA 12BA6 (2) RCA 12BE6 (3) RCA 12BA6 (4) RCA 12SQ7 (5) RCA 35L6GT (6) RCA 35Z5 R F Amplifier Converter I F Amplifier Det. - A.F. - A.V.C. Output Rectifier Dial Lamp 2 Type 1490, 3.2 volts, 0.15 amp. Power Supply Rating 115 volts, D.C. or 50 to 60 cycles, A.C. 35 watts Loudspeaker Type 971495-9W V. C. Impedance 4 in. P.M. 3 2 ohms at 400 cycles Power Output Undistorted Maximum Weight 0.85 watts 1.2 watts 8 lbs. Cabinet Dimensions Height...8% in. Width ...11Y4 in. Depth...7% in. Tuning Drive Ratio 11:1 (5% turns of knob) NOTE: If reception is not obtained on DC, reverse plug in outlet receptacle. This may also reduce hum on AC operation. Operating Instructions Radio-Turn power on with POWER -VOLUME control and set about half -way for volume. Set the FUNCTION Control for the type of program desired and allow 30 to 40 second warm-up period when the dial will be fully illuminated. Tune in desired station with TUNING Control making slow and careful setting in conjunction with volume control for Short Wave reception. Make final setting of VOLUME control to suit requirements. Phonograph Operation-Plug in record changer attachment to phono socket on lower chassis apron. Set FUNCTION switch to "PH" (phono) position. Adjust VOLUME control for listening requirements. EXTERNAL AM ANTENNA TERMINAL SCREWS SHORT WAVE HANK ANTENNA TO BAND SWITCH TO "C" BAND ANTENNA COIL TO GROUND LUG ON VICTROLA JACK TO FRAME OF TUNING CAPACITOR Loop Antenna Leads MS1160 PHONO SOCKET -W. POWER CORD POWER -VOLUME FUNCTION Radio Controls TUNING 44 2-X-621 455 KC TOP & BOT 4--PHONO CI3X. OSC. TRIMMER 1630 KC ,...,5-455 KC WAVE TRAP aw f. E 4 r la S DET. A F AMP OUTPUT I.F AMP. L6 X OSC. eg, CORE 600K.7 1L L OSC. I CORE 6.1 MEG. RECT. 2;4 ANT. TRIMMER 1500 KC. TUNING GANG MAX CAPACITY DIAL CORD DRUM SHOWN IN MAX CAP. POSITION VOLCONT. ON OFF SW RANGE SWITCH C12-VOSC TRIMMER 16.2 MEG Tube and Trimmer Locations 32C ANT. TRIMMER 15.2 MEG. Li.G.ANT CORE 6.1 MEG TUNING 2j TURNS Dial Indicator and Drive Mechanism ALIGNMENT PROCEDURE Steps 1 2 3 4 5 6 7 8 9 10 11 Connect the High Side of The Test Osc. to- Pin No. 1 of 12BA6 I.F. amp. tube in series with 0.1 mfd. Pin No. 7 of 12BE6 Converter tube in series with 0.1 mfd. Pin No. 1 of 12BA6 R.F. tube in series with 0.1 mfd. (Radiated signal) short piece of wire placed near ant. Repeat steps 4, S and 6. Tune Ttoes-t Osc. 455 kc. 1620 kc. 1400 kc. 600 kc. Range Switch to"A " Center terminal on loop antenna Term. board through 47 mfd. Low side to loop primary terminal 18.2 mc. 15.2 mc. 6.1 mc. Repeat steps 8, 9, and 10 as necessary. Turn Rtaod-io Dial Quiet Point near 1600 kc. 1620 kc. (Cap. min.) 1400 kc. 600 kc. 18.2 mc. (Min. cap.) 15.2 mc. 6.1 mc. Adjust for maximum output Top and bottom T2 2nd I.F. Trans. *Top and bottom T1 1st I.F. Trans. L2 wave trap for minimum output. C-13 "A" Osc. C-2 "A" ant. L6 "A" Osc. Rocking gang. **C-12 "C" Osc. ***tC-3 "C" Ant. ttLL--15 ""CC""AOnst.c. *Use 18K resistor across primary when aligning secondary, across secondary when aligning primary. **Two peaks should be found, use one having lowest capacity. ***Two peaks should be found, use one having highest capacity. Note: Check for image frequences. tRadio dial tuned to 15.2 mc. as in step 9, tune test osc. to 16.11 mc. where a weaker signal should be heard. ttRadio dial tuned to 6.1 mc. as in step 10, tune test osc. to 7.01 mc. where a weaker signal should be heard. Test Oscillator-Connect low side of test oscillator to common wiring in series with a .1 mf. capacitor. If the test oscillator is a. c. operated it may be necessary to use an isolation transformer for the receiver during alignment and the low side of the test oscillator connected directly to common wiring at the electrolytic capacitor. Keep the oscillator output low to prevent a -v -c action. Output Meter Alignment-If this method is used, con- nect the meter across the voice coil and turn the receiver volume control to maximum. 49m 6.5 9 7 1 8 2 5 in 13 1419M 16 16M 55 60 70 .80 .100 120 14d 160 firfLULkicul_ MAX. CAP. Dial Scale Actual Size 2 CRMCAL LEAD DRESS 1. Dress all heater leads and pilot light leads down to chassis and away from all audio grid and plate wiring. 2. Dress all exposed leads away from each other and away from chassis to prevent short circuits. 3. Leads to loop antenna are long and draped to permit tube servicing by lowering loop back. They should be evenly spaced to maintain low capacity and dressed 4. tAolpl rRev.Fen. tletoaudcshtiong cgoanilgs pslhaoteusl.d be short and direct. Dress other leads and components away from coils. cal .0047 LOOP ANT. fiCM1 AFNONOT 3 ri 0 two I T P35 07 .047 OS .0471 21 O PHONO. INPUT C1 13-465 C2 2-17 V-1 122A6 2 1.75,-. 7 RI2 ER 5 702. R1 toms 19Ik 6 -1 Rill 1MEG It CIO 150 La Q 2 1-044 V-2 CONVERTER 12BE6 REV. 1000 OI T6 V. Ri7 1000 CS 3600 C4 13-465 V-3 V-4 V -S LE 12BA6 5 115v. TI T2 560.- 12$Q7 6s OUTPUT 35L6-GT T3 CIA 150 3 "\5"6. Y.01C5ie I OLV 6 3 ifc;;oii 105 4 ISO DES C24 55 SOK T '55 0.22 C15 .002 R9 22015 R2I 1001S 2 A°, }4710 -7,- 7' 0.14 k BRN 12001 BLK. 0 BILE - RED 27511. BRN.- RED PM. SPEAKER C23 RIO all 4.7MEG. Cao .022 a WI RIO 500/5 VOLUME CONTROL ci7A- 3014E1 0170 ISOME VOLTAGES MEASURED TO COMMON WIRING WITH "voLTOHMYST" AND SHOULD HOLD WITHIN ±207. V-6 RECTIFIER 3525-GT INDICATES CHASSIS GROUND 2200. RI17777 G INDICATES COMMON WIRING INSULATED FROM CHASSIS 12SC17 128E6 1213A6 12846 8 7 43 4 3 3 4 HEATER CONNECTIONS 35L6'GT 72 SE ON VOLUME CONTROL R20 270 ISO Y. RI5 93 CIS 2 .047 DIAL LAMPS 111490 1190. 142. POWER SUPPLY FRONT AND REAR SECTION OF 51-1 VIEWED FROM FRONT WITH THE CONTROL SHAFT IN EXTREME C/CLOCKWISE POSITION1(PHONO.) 51-1 SEQUENCE P05, FUNCTION PKONO. 2 BAND 3 "C' BAND Ls 'c' osc L I .C ANT L 'A 0SC A1000 ALL CAPACITANCE VALUES LESS THAN 1.0 ARE IN ME AND ABOVE 1.0 ARE IN MMF. EXCEPT THOSE INDICATED. Schematic Diagram-Chassis RC1085B 46 2X621 Replacement Parts STOCK NO. DESCRIPTION CHASSIS ASSEMBLIES RC -1085B 77217 Antenna-Antenna loop and back cover-maroon 77217 Back-Cabinet back cover and antenna loop assembly -maroon 71042 Button-Plug button for trimmer adjustment hole 77216 Capacitor-Variable tuning capacitor complete with drive drum Cl, C2, C4 74924 Capacitor-Mica trimmer, dual 3-35 mmf. C3, C12 74923 Capacitor-Mica trimmer, 4-70 mmf. C13 71924 Capacitor-Ceramic, 56 mmf. C9, C11 73501 Capacitor-Ceramic, 150 mmf. C10, C14, C23 38831 Capacitor-Mica, 620 mmf. C6 39665 Capacitor-Mica, 3600 mmf. C5 73473 Capacitor-Ceramic, 4700 mmf. C21 72312 Capacitor-Electrolytic comprising 1 section of 30 mfd., 150 volts and 1 section of 80 mfd., 150 volts C17A, C17B 73595 Capacitor-Tubular, paper, .0022 mfd., 600 volts...C15 73561 Capacitor-Tubular, paper, .01 mid., 400 volts C22 73797 Capacitor-Tubular, paper, .015 mfd., 600 volts. .C16 73562 Capacitor-Tubular, paper, .022 mfd., 400 volts... C20 73553 Capacitor-Tubular, paper, .047 mfd., 400 volts C7, C8, CI9 73551 Capacitor-Tubular, paper, 0.1 mfd., 400 volts. ...C18 73794 Capacitor-Tubular, paper, 0.22 mfd., 400 volts... C24 73935 Clip-Mounting clip for I.F. transformer 74927 Coil-Antenna coil-"C" band LI 74925 Coil-Oscillator coil-"A" band-complete with adjust- able core L6 74926 Coil-Oscillator coil-"C" band-complete with adjust - able core L5 74930 Coil-Peaking coil (12 muh.) L3, RI 72618 Coil-Peaking coil (20 muh.) L4, R18 74928 Coil-Series wavetrap coil (455 KC) complete with ad- justable core L2 35787 Connector-Phono input connector II 75474 Connector-Single contact male connector for output transformer leads (2 req'd.) 38410 Control-Volume control and power switch. R19, S2 72953 Cord -250' Drive Cord Reel (approx. 50" req'd.) 70392 Cord-Power cord and plug 74838 Grommet-Power cord strain relief (1 set) 33139 Grommet-Rubber grommet for chassis base 16058 Grommet-Rubber grommet for mounting tuning ca- pacitor 70980 Lead-Antenna lead-"C" band 77142 Pointer-Station selector pointer STOCK NO. DESCRIPTION Resistor-Fixed, composition:- 514033 33 ohms, ±20%, 1 watt R15 503082 82 ohms, -1-10°/e, '/2 watt R12 503112 120 ohms, ±10%, 1/2 watt R14 503118 180 ohms, ±10%,'/2 watt R7 503127 270 ohms, ±10%, 1/2 watt R20 503156 560 ohms, ±10%, '/2 watt R6 503210 1000 ohms, -1-10%, 1/2 watt R2, R17 513212 1200 ohms, ±10%, 1 watt R13 503333 33,000 ohms, ±10%, '/2 watt R4 503356 56,000 ohms, ±10%, 1/2 watt R8 503410 100,000 ohms, ±10%, '/2 watt R21 503422 220,000 ohms, ±10%, 1/2 watt R3, R9, R16 503447 470,000 ohms, ±10%, '/2 watt R10 504522 2.2 megohm, ±20%, 1/2 watt R5 504547 4.7 megohm, ±20%, '/2 watt R11 74922 Shaft-Tuning knob shaft 74697 Socket-Dial lamp socket 73117 Socket-Tube socket, 7 pin, miniature for VI, V2, V3 54414 Socket-Tube socket, octal, saddle -mounted for V4, V5, V6 76368 Spring-Drive cord spring 74921 Switch-Selector switch Si 74918 Transformer-First I.F. transformer complete with ad - justable cores T1 73037 Transformer-Second I.F. transformer complete with adjustable cores T2 73976 Transformer-Output transformer T3 35969 Washer-"C" washer for tuning knob shaft 77218 - SPEAKER ASSEMBLIES 971495-9W Speaker -4" P.M. speaker complete with cone and voice coil (3.2 ohms) MISCELLANEOUS Y2447 Cabinet-Plastic cabinet-maroon--complete with dial escutcheon 77220 Dial-Polystyrene dial scale 77241 Escutcheon-Dial escutcheon 75761 Grommet-Rubber grommet for mounting speaker (4 req'd.) 77219 Knob-Selector switch knob-maroon 74931 Knob-Tuning control or volume control and power switch knob-maroon 71116 Lamp-Dial lamp-Mazda 1490 74301 Screw-#8 x 3/s" cross recessed binder head screw for mounting dial 30900 Spring-Retaining spring for knobs APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 4 47 RCAVICTOR Model 2-XF-91 "Forbes" Maroon AM -FM Radio Receiver MODEL 2-XF-91 Chassis No. RC1121 SERVICE DATA - 1952 No. 16 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. TUNING RANGE Standard Broadcast (AM) Frequency Modulation (FM) Intermediate Frequency (AM) Intermediate Frequency (FM) TUBE COMPLEMENT (1) RCA 016 (2) RCA 19X8 (3) RCA 12BA6 (4) RCA 12AU6 (5) RCA 12AU6 (6) RCA 12AL5 (7) RCA 12AV6 (8) RCA 35C5 RCA Stock No. 77519 SPECIFICATIONS 540-1600 kc 88-108 mc 455 kc 10.7 mc POWER SUPPLY RATING 115 volts, 50-60 cycles, or 115 volts d.c LOUDSPEAKER Size and Type Voice Coil Impedance 35 watts 51/4" P.M. 3 2 ohms R F. Amplifier Mixer -Oscillator I.F. Amplifier FM I.F. Amplifier FM I.F. Amplifier F M Detector AM Det.-AVC-Audio Audio Output Selenium Rectifier AUDIO POWER OUTPUT Undistorted Maximum TUNING DRIVE RATIO NET WEIGHT DIMENSIONS (Overall) Height 81/2" Width 1 0 watt 1 3 watts 9.1 (41/2 turns of knob) 8 lbs. 139'16" Depth 73/4" CIRCUIT DESCRIPTION This instrument, an AM -FM table radio, has eight tubes, plus selenium rectifier. Individual dials are provided for AM and FM bands. RF circuits, contained on a two tube sub -chassis, include RF amplification for both bands and a combination mixer oscillator circuit. The input circuit to the FM RF stage is broad banded, and is tuned to the approximate FM band center at 100 mc. The mixer is pentode connected for AM operation; triode connected for FM operation. AM IF circuits use an IF amplifier and conventional diode detector with AVC. FM IF circuits include three IF amplifier stages and a discriminator detector. The two tube audio amplifier has an adjustable tone control circuit with combination bass and treble compensation. A hum -bucking circuit uses the tapped -winding output transformer. An inbuilt AM loop antenna, and line cord FM antenna, allow reception without the use of external antennas. A phono jack at the instrument rear permits the use of a record player attachment. OFF -VOLUME TONE NORMAL SOFT OFF LOUD BASS 11 TREBLE FUNCTION AM PH FM TUNING 0 Radio Controls OPERATING INSTRUCTIONS RADIO - Turn OFF -VOLUME control about half -way in a clockwise direction to turn receiver ON and provide for medium VOLUME. Allow a short warm-up period. Set FUNCTION control at desired service - AM or FM. Rotate TUNING control to move the pointers to the desired AM or FM frequency. Do not touch the pointers themselves. Adjust VOLUME and TONE controls as desired. PHONOGRAPH - Connect attachment to PHONO jack at instrument rear. Switch the FUNCTION control to "PH" position. Turn on receiver and adjust VOLUME and TONE controls as riocirari 70 \\\ ----- Tril 10o0o000o10004i0600000000000000000000000OoI0:6`1e0o0°000° '\\\ 141 LOCI" 0000 0 0 0 6.-.--L1IME CORO FM ANT -00000000 ^"' GPM TIL:t1Z. 14-,74 / fol II It 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Rear View 48 om r, VOLUME Corer TONECONTROL SELECTOR SW ITCH MM.:IMO-AM-FM TUNING DIAGRAM 2O1! /UV& r'1..gC.E'LgVE POSITIONATIO (PLATES CLOSED) Tube and Trimmer Locations Dial and Drive Cord Drive ALIGNMENT PROCEDURE ALIGNMENT INDICATORS: An RCA VoltOhmyst or equivalent meter is necessary for measuring developed d -c voltage during FM alignment. Connections are specified in the alignment tabulation. An output meter is also necessary to indicate maximum audio output during AM alignment. Connect the output meter across the speaker voice coil. The RCA VoltOhmyst can also be used as an AM alignment indicator, either to measure audio Output or to measure AVC voltage. When audio output is being measured, the volume control should be turned to maximum. Adjust tone control to mid -position. SIGNAL GENERATOR: For all alignment operations, connect the low side of the signal generator to the receiver chassis. If output measurement is used for AM alignment, the output of the signal generator should be kept as low as possible to avoid AVC action. If an FM sweep generator is used for FM alignment, adjust for 10.7 mc, 0.4 mc sweep. Connect oscilloscope across C26, adjusting discriminator T6 top core for 10.7 mc crossover, and T6 bottom core for balanced peaks. Peak separation should be approximately 330 kc. When aligning the other FM tuned circuits, connect oscilloscope lead through a 220K resistor to pin 1 of V5. Follow alignment table sequence, adjusting for maximum gain and symmetrical curves. Tube Socket Voltages Tube Type and Function Tube E lement Pin No. AM FM Phono VI 6B16 R.F. Amp. V2 19X8 Mixer Plate Screen Cathode Grid Plate Screen Cathode Grid 5 94 92 92 6 94 92 92 2 0.7 0.9 0.5 1 -0.5 0 -0.6 9 75 80 80 8 75 80 80 6 0 0 0 7 -1.6 -2.3 -2.3 Osc. V3 12BA6 I.F. Amp. V4 12AU6 2nd I.F. Amp. (F.M.) V5 12AU6 3rd I.F. Amp. (F.M.) V6 12AL5 F.M. Det. V7 12AV6 A.M. Det. Audio Amp. V8 35C5 Audio Output Plate Grid Plate Screen Cathode Grid Plate Screen Cathode Grid Plate Screen Cathode Grid Plate Cathode Plate Cathode Plate Grid Plate (Diode) Plate Screen Cathode Grid 3 85 85.6 74 2 -3.3 -3 -0.3 5 94 92 90 6 94 92.3 90 7 0.8 0.9 0.8 1 -0.4 -0.2 -0.2 5 95 93.5 92 6 95 94.1 92 7 0.8 0.8 0.8 1 0 0 0 5 74 73 72 6 74 73 72 7 0.3 0.3 0.4 1 2 5 7 1 -0.2 -0.4 -0.2 ---- -- ---- --- 7 58 57 57 1 -0.8 -0.8 -0.8 5 -0.5 -0.3 -0.3 7 130 130 130 6 1 2-5 -96 5.1 -94.5 5.0 -94.5 5.0 Rectifier output should be approximately 139 volts, 70 ma. AM Alignment FUNCTION SWITCH IN AM POSITION Connect high Steps side of sig. gen. to-- SSiig. gen. output Turn radio dial to- Adjust for peak output Pin No. 1 of V3 1 in series with .01 mfd. 2 Tap lug 4 on AM RF coil 455 kc. (mod.) Quiet point at high freq. end T4 bottom core (sec.) T4 top core (pri.) T2 bottom core (sec.) T2 top core (pri.) 3 1620 kc. (mod.) 1620 kc. C1A-T (osc.) 4 Short wire placed near loop for 5 radiated signal 6 1400 kc. (mod.) 600 kc. (mod.) 1400 kc. 600 kc. C37 (ant.) C1C-T (rf.) L6 (osc.) with 10,000 ohm resistor from C1C RF stator to gnd. (rocking gang) L4 (RF) with the 10,000 ohms removed Repeat steps 4, 5 and 6 unti maximum 7 gain s obtained FM Alignment FUNCTION SWITCH IN FM POSITION -VOLUME CONTROL MINIMUM -TONE CONTROL CENTER Connect high Steps side of sig. gen. to - Sig. gen. output Turn radio dial to- Adjust for max. output Pin No. 1 of 1 V5-12AU6 2 Pin No. 1 of V4-12AU6 10.7 mc. Pin No. 1 of 3 V3-12BA6 Quiet point at low frequency end T6 top core for zero d.c. (across C26) T6 bottom core for maximum d.c. (junction of R24 and R25) tT5 top core T3 top core t *T3 bottom core 4 CID Stator T1 top core t *T1 bottom core 5 90 mc. 90 mc. 1 -FM osc. 6 FM Ant. 7 terminals thru 270 ohm resistor 8 106 mc. 106 mc. tFM R.F.C1D-T 90 mc. 90 mc. tFM R.F. L2 Repeat steps 6 and 7 until maximum gain is obtained 9 100 mc. 100 mc. tFM Ant.coil L5 If necessary for accurate peaking, the winding in the same transformer not being peaked should be loaded with a 680 ohm resistor. tConnect VoltOhmyst to pin 1 of V5 through a 220K isolating resistor with I/4 inch maximum exposed lead at grid terminal end. Output adjusted for 1 volt d.c. Dress VoltOhmyst lead away from input circuits. Oscillator frequency is above signal frequency on both AM and FM 2 1. All FM IF Transformer grid and plate leads should be short and direct as possible and kept low, near chassis. 2. C26 leads should be kept as short as possible. 3. C32 leads should be kept as short as possible. 4. R24 and R25 leads should be kept as short as possible on T6 terminal 6 side. 5. C27 should ground in hole near terminal 5 of V6 with short leads. 6. AM oscillator coil should not be tilted over toward function switch when wrapping short bus leads to switch. 7. Keep leads V5 pin 5, to T6 term 1, as short as possible and low near chassis. CRITICAL LEAD DRESS 8. Dress C28 down on chassis and against terminal board. Run filament lead between V5 and V6 on side of V6 socket opposite C28. 9. All ceramic button 4700 uuf condensers should have leads as short as possible. 10. Green lead from AM oscillator stator gang terminal to AM oscillator coil should be dressed against front of shield box and up above filament choke. 11. RF plate choke LI, should be dressed at least 1/8" away from AM R.F. coil L4 and at least Vs" from shield. 12. Mixer grid condenser C7 should be dressed away from FM oscillator gang stator terminal and away from leads connecting to terminals 8 and 9 of V2 socket. 13. Filament chokes L10 and L11 should be raised a minimum of 1/16" above chassis. 14. Use varnished tubing only on choke and coupling cond. leads coming through shield partition slot. 15. Condenser C2 should have lead on antenna terminal end not more than 3/16" long to prevent possible contact of lead or body to "Hot- chassis. 16. Condensers C3 and C35 should use varnished tubing, not vinyl, to prevent breakthrough crossing chassis edge. 17. Oscillator grid condenser C17 should have short leads and be dressed away from filament choke L10. 18. Leads from loop terminal to chassis terminal board should have a minimum of three twists. A IA LOOP 6BJ6 RE AMP +92V 5 R sHELF sHIELD C6 v2 19X8 NMER-oSC 800. , 3. 12AU6 Fm IF MAP 472V. 6 12AL5 FM GET. c37 3 30 C1 -E 14.5234.S 3 RSO 68 4700 0200 L4 214 HEN NG WHEN USING OUTSIDE ANT. EN ANAL F M. A C3 O. C2 470 5.6 LS F61 ANT COIL SS I RI 220 L_. RONT H OSC CCHL 11 -a 2700 I " La CIS FR M. COIL SI-13 REAR V7 12AV6 A IA OET.11 AUDIO , 35C5 OUTPUT C 1 0 7 57V. 130V. -0.B V RT T CS 330 C12 - .0047 OfaT 94.5 .01 SOOK VOLUME CONTROL WOK TAP RS 4, MEG ION RR 2 MEG (1410.1 ONE CONTROL 2 01( 4 14%N C2I3 .0047 RIS 1200 R26 100K PM SPEAKER CII . 022 SEE PRINTED NOTE V7 12AV6 VG 12AL5 VS 12AU6 Era4n3 12AU6 va 1215A6 V2 191(8 68.16 3 5 C 5 V40 f;;:o I°7° Al C 33A T SOME -tit 0335 427 14 CRI I C32 C38 14)00 INTEALOcK 0 52 ON VOL CONTROL NOTES: FRONT AND REAR SECTIONS OF FUNCTION SWITCH 51-0 AND SI-E1 ARE viEwE0 FROM FRONT WITH THE SWITCH SHAFT IN EXTREME COUNTER -CLOCKWISE POSITION 1 (PM 00) 1.091TION F uNc,oN PHONO 3 A.M. IF COIL A B A. M. OSCCO,L Ny10 00 ALL RESISTANCE VALuES OHS NO ALL CAPACITANCE vALUES LESS THAN 1.0 IN IHF. AND ABOVE 1.0 IN MMI. UNLESS OTHERWISE NOTED. Acceptable value of R9 may be 2 to 50 megohms. Schematic Circuit Diagram -Chassis No. RC1121 ER 471332-1 TO F.M. ANT. TERM. BOARD A M LOOP .7 CI -E a ao 14.5234.S VI 6BJ6 I R.E. AMP .9A V. 00 030 R.F. SHELF SHIELD C7 120 - V2 19X8 mixER-05C 155V. 10 .7 MEG I° 07 TA. A At OSC COIL SI- FRONBT A Z7e0e0 I Le IC IS 111. 08, COIL 7 SI-B REAR 10 CO 470 S REAR NOTES: FRONT AND REAR SECTIONS or FUNCTION SWITCH SI-A AND SI-9 ARE VIEWED FROM FRONT WITH TOE SWITCH SHAFT IN EXTREME COUNTER -CLOCKWISE POSITION 1 0.1.10740) POSITION FUNCTION PHONO 3 128A6 AMP. A MUM 71 F.M. 10.714C T3 FM. 10.700 T2 AM. 455170 RI5 IDOK CI R16 C21 4700 C20 1.022 C39 4700 31:g 2 -3 1 ff -Z50 0, - _J .250 ; ,20 L_4 C22 - T4 AM 45514C 47001 ll 220 V7 12AV6 AM OETI-127.DIO 6 35C5 To CI3 07UTPU4T130 V. ,.1 g .0047 -C9 C12- %V. F ----01P M SPEAKER T330 .0047 R7 SOON VOLUME CONTROL 1000 TAP RE 4.7 MEG. 10K RS 2 MEG. (MIN.) 2201 470X RI2 ISO TONE CONTROL -4- 3 Al C35A CII I 021 SEE PRINTED NOTE I SOME V7 12AV6 VG I2AL5 VS 12AU6 V4 12AU6 VS 108A6 V2 1908 VI 6BJ6 000 jiodi trovi za 4700 C30 4700 -T7 I C31 4 "0 VA 35C5 ELL C330 R27 14 CRI 0013z71- IVot INTERLOCK ° 0712VOL fCONTROL A 15 A.M. 01.. COIL 11.1000 ALL RESISTANCE VALVES IN OHMS AND ALL CAPACITANCE VALUES LESS THAN 1.0 IN MI. AND ABOVE 1.0 IN IMAMS UNLESS OTHERWISE NOTED. Simplified Schematic-"AM" Position FEATESS - I TO A.M. LOOP 6BJ6 R F AMP 152 R.F. SHELF SHIELD CS C7 12 220 v2 19X8 mixER-OSC. SO V. -1 GA DISCONNECT WHEN USING OUTSIDE ANT ETERNAL F M. ANT. r"-C3 =C2 S.G LS FM. ANT. COIL A741°.DIT. OSC. COIL SI-A FRONT SI-13 REAR NOTES: FRONT AND REAR SECTIONS OF FuNCTION SWITCH 51-A AN0 S1-5 ARE VIEWED FROM FRONT wITH THE SWITCH SHAFT IN EXTREME COUNTER -CLOCKWISE POSITION EI (1.14050) POSITION FuNCTION MONO TI F.M 10.7440. ASO T2 A.M. 4550C. YES R15 100II 014 10K 3 12BA6 I.F AMP -A. MIEN 192 V. 54-'7 47.0 I I T3 F.M. 10.705 AO-. ft .1." 8 `; I I 1250 0 T33 4-° -j -1 L_ TO AM. 455NC. C20 C39 12AU6 2,2,4 !I. AMP 493.57. 12AU6 33.2 FM. i.F AMP 73, TS GM 10.1MC r E -0.49 I( 3:1I 120 -HC23 4701 p I L 2323I IR22 >ICON J 5.14 10.7MC T§ DISC ft 33 q RZO 220 R23 ION VS 12AL5 F M. GET. C27 .001 R7 SOON VOLUME CONTROL RE 100A TAP 10K CII .022 12AV6 A.M. DET,IITAUDIO , 157V. - CS 330 Cl2 .0047 2 MEG. TONE CONTROL CI3 .0047 SEE PRINTED NOTE 35C5s' OL/TPUT 7 5 S, 75 V. C25 .0047 REE 100N P M SPEAKER cd( 1213 1200 Al033A I SOME VT VG VS WI VS V2 v1 v. ,,)2_2(\..t. 1 t 12AV6 12AL5 12AU6 12AU6 125A6 19%8 65.16 0101\e.zlyws ) L 1 1 4 3 50 zrs..00 35C 5 n4 3 029 C30 - C31 1,4700 1, 47. I 470 MI C335 R27 4 CRI gi -- INTI3NLOCK C58 14700 i oryOL. CONTROL A. M. RE COIL A 5 A.M. O.C. COIL 1000 ALL RESISTANCE VALUES IN OHMS AND ALL CAPACITANCE vALUES LESS THAN 1.0 IN MP AND ABOVE 1.0 IN NONE UNLESS OTHERWISE NOTED. ET 47935 - I TO F.M. ANT. TERM. BOARD Simplified Schematic-"FM" Position 04 52 2-XF-91 REPLACEMENT PARTS STOCK No. PART DESCRIPTION 77520 77522 70997 77530 33380 77531 77532 39636 75792 76992 39644 73473 73520 77533 73920 73561 73594 73562 73558 75071 73551 73935 77538 77534 77535 77526 77537 77525 77536 77528 75474 77529 77516 77515 72953 77523 16058 77521 72602 77510 CHASSIS ASSEMBLIES RC1121 Bushing Laminated bushing (5/8" long with shoulder) for station selector pointer pulley and shaft assembly. Capacitor -Variable tuning capacitor (CIA, CIB, C1C, C1D, C1E, C1A-T, C1C-T, C1D-T) Capacitor -Fixed, ceramic, non -insulated, 5.6 mmf., +1 mmf., 500 volts D.C. Temp. coef. -= 0 (C2) Capacitor -Fixed, ceramic, non -insulated, 7 mmf., +.5 mmf., 500 volts D.C. Temp. coef. -= 80 (C15) Capacitor -Fixed, ceramic, non -insulated, 12 mmf., ±5%, 500 volts D.C. Temp. coef. -.= 0 (C6) Capacitor -Fixed, ceramic, non -insulated, 47 mmf., +10%, 500 volts D.C. Temp. coef. = 0 (C17) Capacitor -Fixed, ceramic, non -insulated, 130 mmf., +21/2%, 500 volts D.C. Temp. coef. = -750 (C18) Capacitor -Fixed, mica, 220 mmf., 500 volts D.C. (C7) Capacitor -Fixed, ceramic, insulated, 330 mmf., ±20%, 500 volts D.C. High K (C9) Capacitor -Fixed, mica, 470 mmf., 300 volts D.C. (C26, C31) Capacitor -Fixed, mica, 470 mmf., 500 volts D.C. (C3) Capacitor -Fixed, ceramic, 4700 mmf., +100%, -0%, 500 volts D.C. High K disc (C5, C8, C19, C21, C22, C23, C24, C25, C29, C30, C36, C38, C39) Capacitor -Electrolytic comprising 1 section of 80 mfd., 150 volts and 1 section of 50 mfd., 150 volts (C33A, C33B) Capacitor -Fixed, miniature, tubular, paper, .001 mfd., 200 volts D.C. (C27) Capacitor -Fixed, tubular, paper, .0047 mfd., 600 volts (C12, C13, C28) Capacitor -Fixed, tubular, paper, .01 mfd., 400 volts (C10) Capacitor -Fixed, tubular, paper, .01 mfd., 600 volts (C14) Capacitor -Fixed, tubular, paper, .022 mfd., 400 volts (C11) Capacitor -Fixed, tubular, paper, .047 mfd., 200 volts (C4) Capacitor -Fixed, tubular, moulded, .047 mfd., 400 volts (C32) Capacitor -Fixed, tubular, paper, 0.1 mfd., 400 volts (C35) Clip -Mounting clip for I.F. transformers Coil -Antenna coil-F.M. (L5) Coil -Choke coil (LI) Coil -Choke coil (L9, LIO, L11) Coil -Oscillator coil-A.M.-complete with adjust- able core (L6, L7) Coil -Oscillator coil-F.M. (L8) Coil-RF coil-A.M.-complete with adjustable core (L3, L4) Coil-RF coil-F.M. (L2) Connector -Combination phono input connector and antenna terminal board (J1) Connector -Single contact male connector for speaker lead Connector -Two (2) contact male connector for power cord Control -Tone control (119) Control -Volume control and power switch (117, S2) 250' Dial Cord Reel -Dial cord (approx. 49" overall required) Drive cord (approx. 11" overall required) Drum -Variable tuning capacitor drive drum and hub Grommet -Rubber grommet for mounting RF shelf (4 required) Nut-Speednut for station selector pointer pulley and shaft bushing Pulley -Idler pulley for indicator cord (2 required) Pulley -Pulley and shaft (split) for station selector pointers STOCK No. PART DESCRIPTION 77519 76346 503022 503068 503112 503115 503122 503227 503282 503310 503318 503347 502410 503410 503422 503447 503522 503539 503547 77527 75192 76331 77087 76336 73117 31970 31418 77524 77517 77511 76335 77514 76328 77513 77512 33726 34373 Rectifier -Selenium rectifier, 100 MA (CR1) Resistor -Wire wound, 1200 ohms, 4 watts (R13) Resistor -Fixed, composition: 22 ohms, +10%, 1/2 watt (R27) 68 ohms, +10%, 1/2 watt (R16, 1130) 120 ohms, +10%, 1/2 watt (R19,1121) 150 ohms, ±10%, 1/2 watt (R12) 220 ohms, ±10%, 1/2 watt (111, R17,1120) 2700 ohms, +10%, 1/2 watt (R4) 8200 ohms, 4-10%, 1/2 watt (1131) 10,000 ohms, +10%, 1/2 watt (116, 1114, R23) 18,000 ohms, +10%, 1/2 watt (113) 47,000 ohms, +10%, 1/2 watt (R18) 100,000 ohms, ±5%, 1/2 watt (R24, 1125) 100,000 ohms, +10%, 1/2 watt (R15, R22,1126) 220,000 ohms, +10%, 1/2 watt (1110) 470,000 ohms, +10%, 1/2 watt (1111) 2.2 megohm, +10%, 1/2 watt (115) 3.9 megohm, +10%, 1/2 watt (R2) 4.7 megohm, +10%, 1/2 watt (118) Shaft -Tuning knob shaft Shield -Tube shield for VI Shield -Tube shield for V2 Socket -Tube socket,' 7 pin, miniature, moulded, saddle mounted for VI Socket -Tube socket, 9 pin, miniature, moulded, saddle mounted for V2 Socket -Tube socket, 7 pin, miniature, wafer for V3, V4, V5, V6, V7, V8 Spring -Dial cord spring Spring -Drive cord spring Switch -Function switch (Si) Transformer -Output transformer (T7) Transformer -Ratio detector transformer - complete with adjustable cores (T6) Transformer -First I.F. transformer-A.M.-complete with adjustable cores (T2) Transformer -First I.F. transformer-F.M.-complete with adjustable cores (Ti) Transformer -Second I.F. transformer-A.M.-com- plete with adjustable cores (T4) Transformer -Second I.F. transformer-F.M.--com- plete with adjustable cores (T3) Transformer -Third I.F. transformer-F.M.-complete with adjustable cores (T5) Washer -"C" washer for station selector pointer pulley and shaft or tuning knob shaft Washer -"C" washer to fasten idler pulleys 77539 SPEAKER ASSEMBLIES 971933-1 Speaker -51/4" P.M. speaker complete with cone and voice coil (3.2 ohms) 77543 77543 Y2467 77544 77545 77542 77033 77548 77547 73203 77541 77540 73992 76837 MISCELLANEOUS Antenna -Antenna loop and back assembly corn plete with power cord (includes C37) Back -Cabinet back complete with loop, capacitor and power cord (includes C37) Cabinet -Maroon plastic cabinet less "RCA Victor" emblem and function decal Capacitor -Adjustable, mica trimmer, 3-30 mmf. (C37) Cord -Power cord and plugs Decal -Control function decal Emblem -"RCA Victor" emblem Knob -Function switch knob Knob -Tuning control, tone control or volume con - trol and power switch knob Nut-Speednut to fasten "RCA Victor" emblem to cabinet. Pointer -Station selector pointer-A.M. Pointer -Station selector pointer-F.M. Retainer -Knob retainer (knob to cabinet) Spring -Retaining spring for knobs (knob to shaft) APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 6 53 RCAVICTOR AM -FM Radio Receiver 81 13 1130 140 .. 2-XF-931 SERIES Chassis No. RC1121A E SERVICE DATA - 1952 No. 17 - 2-XF-931 Maroon The "Townley" 2-XF-932 Ivory 2-XF-934 Red 2-XF-935 Beige 2-XF-933 Green PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. TUNING RANGE Standard Broadcast (AM) Frequency Modulation (FM) Intermediate Frequency (AM) Intermediate Frequency (FM) TUBE COMPLEMENT (1) RCA 6BJ6 (2) RCA 19X8 (3) RCA 12BA6 . (4) RCA 12AU6 (5) RCA 12AU6 (6) RCA 12AL5 (7) RCA 12AV6 (8) RCA 35C5 RCA Stock No. 77519 SPECIFICATIONS 540-1600 kc 88-108 mc 455 kc 10.7 mc R F. Amplifier Mixer -Oscillator I.F. Amplifier FM I.F. Amplifier FM I.F. Amplifier F M Detector AM Det.-AVC-Audio Audio Output Selenium Rectifier POWER SUPPLY RATING 115 volts, 50-60 cycles 35 watts CAUTION: DO NOT OPERATE ON D.C. DIAL LAMPS 2 No. 47, 6-8 volts, 0.15 amp. LOUDSPEAKER Size and Type Voice Coil Impedance 51/4" P.M. 3 2 ohms AUDIO POWER OUTPUT Undistorted Maximum TUNING DRIVE RATIO NET WEIGHT 1 0 watt 1 3 watts 9.1 (41/2 turns of knob) 8 lbs. DIMENSIONS (Overall) Height 81/4" Width 139ia" Depth 73/4" CIRCUIT DESCRIPTION This instrument, an AM -FM table radio, has eight tubes, plus selenium rectifier. Individual dials are provided for AM and FM bands. RF circuits, contained on a two tube sub -chassis, include RF amplification for both bands and a combination mixer oscillator circuit. The input circuit to the FM RF stage is broad banded, and is tuned to the approximate FM band center at 100 mc. The mixer is pentode connected for AM operation; triode connected for FM operation. AM IF circuits use an IF amplifier and conventional diode detector with AVC. FM IF circuits include three IF amplifier stages and a discriminator detector. The two tube audio amplifier has an adjustable tone control circuit with combination bass and treble compensation. A hum -bucking circuit uses the tapped -winding output transformer. An inbuilt AM loop antenna, and line cord FM antenna, allow reception without the use of external antennas. A phono jack at the instrument rear permits the use of a record player attachment. OFF -VOLUME TONE NORMAL SOFT OF/ LOUD BASS TREBLE FUNCTION AM en FM TUNING 0 OPERATING INSTRUCTIONS RADIO - Turn OFF -VOLUME control about half -way in a clockwise direction to turn receiver ON and provide for medium VOLUME. Allow a short warm-up period. Set FUNCTION control at desired service - AM or FM. Rotate TUNING control to move the pointers to the desired AM or FM frequency. Adjust VOLUME and TONE controls as desired. PHONOGRAPH - Connect attachment to PHONO jack at instrument rear. Switch the FUNCTION control to "PH" position. Turn on receiver and adjust VOLUME and TONE controls as desired. o 1 \ -17:17 , ,,-000-07005_01_0190.10,1.0;10o_00000000000000000000000&00-100406..0+0--01-0-005-,\ \ \ , \ r -F---1 \ .-,1-1-:------ ....; 4,-- -In ---1 , 1 \ r. -e-h, 1C..O.T.... L7!.., WOMACK re \,..... .... ..'-',1..... , re 1 0 0 0 6 0 0 0 0 '11 ' ,L1 A OA 1.001 L'--- 1. CORD 1,61 00000000..^.7.' ---- I: 1 i i-c,-,4t- 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ...... Radio Controls Rear View 54 2-XF-931 Series c. INTERLOCK TERM. 1:1 Ls RECTIFIER ON - OFF IL VOLUME CONT. TONE CONTROL SELECTOR SWITCH POCONO. A M: FM. TUNING DIAGRAM OF DIAL CORD WITH PANG IN EXTREME COUNTER -CLOCKWISE POSITION (PLATES CLOSED) Tube and Trimmer Locations Dial and Drive Cord Drive ALIGNMENT PROCEDURE ALIGNMENT INDICATORS: An RCA VoltOhmyst or equivalent meter is necessary for measuring developed d -c voltage during FM alignment. Connections are specified in the alignment tabulation. An output meter is also necessary to indicate maximum audio output during AM alignment. Connect the output meter across the speaker voice coil. The RCA VoltOhmyst can also be used as an AM alignment indicator, either to measure audio output or to measure AVC voltage. When audio output is being measured, the volume control should be turned to maximum. Adjust tone control to mid -position. SIGNAL GENERATOR: For all alignment operations, connect the low side of the signal generator to the receiver chassis. If output measurement is used for AM alignment, the output of the signal generator should be kept as low as possible to avoid AVC action. If an FM sweep generator is used for FM alignment, adjust for 10.7 mc, 0.4 mc sweep. Connect oscilloscope across C26, adjusting discriminator T6 top core for 10.7 mc crossover, and T6 bottom core for balanced peaks. Peak separation should be approximately 330 kc. When aligning the other FM tuned circuits, connect oscilloscope lead through a 220K resistor to pin 1 of V5. Follow alignment table sequence, adjusting for maximum gain and symmetrical curves. Tube Socket Voltages Tube Type and Function VI 6B16 R.F. Amp. V2 19X8 Mixer Tube Element Pin No. AM FM Phono Plate 5 Screen 6 Cathode 2 Grid ' 1 Plate 9 Screen 8 Cathode 6 Grid 7 94 92 92 94 92 92 0.7 0.9 0.5 -0.5 0 -0.6 75 80 80 75 80 80 0 0 0 -1.6 -2.3 -2.3 Osc. Plate Grid 3 2 85 85.6 74 -3.3 -3 -0.3 V3 12BA6 I.F. Amp. Plate Screen Cathode Grid 5 94 92 90 6 94 92.3 90 7 0.8 0.9 0.8 1 -0.4 -0.2 -0.2 V4 12AU6 Plate 5 2nd I.F. Screen 6 Cathode 7 Amp. (F.M.) Grid 1 95 93.5 92 95 94.1 92 0.8 0.8 0.8 0 0 0 V5 12AU6 3rd I.F. Amp. (F.M.) V6 12AL5 F.M. Det. Plate Screen Cathode Grid Plate Cathode Plate Cathode 5 74 73 72 6 74 73 72 7 0.3 0.3 0.4 1 2 5 7 1 -0----.2 -0----.4 -0----.2 V7 12AV6 A.M. Det. Audio Amp. Plate Grid Plate (Diode) 7 58 57 57 1 -0.8 -0.8 -0.8 5 -0.5 -0.3 -0.3 V8 35C5 Audio Output Plate Screen Cathode Grid 7 130 130 130 6 1 2-5 -96 5.1 -94.5 5.0 -94.5 5.0 Rectifier output should be approximately 139 volts, 70 ma. Steps 1 2 3 4 5 6 7 AM Alignment FUNCTION SWITCH IN AM POSITION Connect high side of sig. gen. to - Sig. gen. output Turn radio dial to- Adjust for peak output Pin No. 1 of V3 in series with .01 mfd. Tap lug 4 on AM RF coil 455 kc. (mod.) Quiet point at high freq. end T4 bottom core (sec.) T4 top core (pri.) T2 bottom core (sec.) T2 top core (pri.) 1620 kc. (mod.) 1620 kc. C1A-T (osc.) Short wire placed near loop for signal 1400 kc. (mod.) 600 kc. (mod.) 1403 kc. 600 kc. C37 (ant.) C1C-T (rf.) L6 (osc.) with 10,000 ohm resistor from C1C RF stator to gnd. (rocking gang) L4 (RF) with the 10,000 ohms removed Repeat steps 4, 5 and 6 until maximum gain is obtained FM Alignment FUNCTION SWITCH IN FM POSITION -VOLUME CONTROL MINIMUM -TONE CONTROL CENTER Connect high Steps side of sig. gen. to - Sig. gen. output Pin No. 1 of 1 V5-12AU6 Pin No. 1 of 2 V4-12AU6 10.7 mc. Pin No. 1 of 3 V3-12BA6 Turn radio dial to- Quiet point at low frequency end Adjust for max. output T6 top core for zero d.c. (across C26) T6 bottom core for maximum d.c. (junction of R24 and R25) 115 top core T3 top core t*T3 bottom core 4 CID Stator Ti top core t*T1 bottom core 5 90 mc. 90 mc. irM osc. 6 FM Ant. 7 terminals thru 270 ohm resistor 8 106 mc. 106 mc. tFM A.F.C1D-T 90 mc. 90 mc. }FM R.F. L2 Repeat steps 6 and 7 until maximum gain is obtained 9 100 mc. 100 mc. tFM Ant. coil L5 If necessary for accurate peaking, the winding in the same transormer not being peaked should be loaded with a 680 ohm resistor. tConnect VoltOhmyst to pin 1 of V5 through a 220K isolating resistor with I/4 inch maximum exposed lead at grid terminal end. Output adjusted for 1 volt d.c. Dress VoltOhmyst lead away from input circuits. Oscillator frequency is above signal frequency on both AM and FM 2 CRITICAL LEAD DRESS 1. All FM IF Transformer grid and plate leads should be short and direct as possible and kept low, near chassis. 2. C26 leads should be kept as short as possible. 3. C32 leads should be kept as short as possible. 4. R24 and R25 leads should be kept as short as T6 terminal 6 side. possible on 5. C27 should ground in hole near terminal S of V6 with short leads. 6. AM oscillator coil should not be tilted over toward function switch when wrapping short bus leads to switch. 7. Keep leads V5 pin 5, to T6 term 1, as short as possible and low near chassis. 8. Dress C28 down on chassis and against terminal board. Run filament lead between V5 and V6 on side of V6 socket opposite C28. 9. All ceramic button 4700 uuf condensers should have leads as short as possible. 10. Green lead from AM oscillator stator gang terminal to AM oscillator coil should be dressed against front of shield box and up above filament choke. 11. RF plate from AM choke LI, should be dressed at least Vs" R.F. coil L4 and at least Ve" from shield. away 12. Mixer grid condenser C7 should be dressed away from FM oscillator gang stator terminal and away from leads connecting to terminals 8 and 9 of V2 socket. VI 7 6BJ6 R F AMP R.F. SHELF SHIELD 131(8 Lox. OSC .V A.M.LOOP LI C6 AF CO, C37 CI -E 3 30 14.3- 2345 010 0.5V. R30 1751 8200 2 v%e L 14 413 C4 1047 "° I RI CI-C 12-2321 13. Filament chokes L10 and L11 should be raised a minimum of 1/16" above chassis. 14. Use varnished tubing only on choke and coupling cond. leads coming through shield partition slot. 15. Condenser C2 should have lead on antenna terminal end not more than 3/16" long to prevent possible contact of lead or body to "Hot" chassis. 16. Condensers C3 and C35 should use varnished tubing, not vinyl, to prevent breakthrough crossing chassis edge. 17. Oscillator grid condenser C17 should have short leads and be dressed away from filament choke L10. 18. Leads from loop terminal to chassis terminal board should have a minimum of three twists. 12 A.U6 272FM IFANIF 1320. TS FM v5 12AU6 3513 F M. AMP 72V. R1S I20 CON 4700 Lp - C24 I"00 n"113.11ACOff 100K J IR22 RZI 120 12AGL5 F M. UT R20 220 DISCONNECT WHEN 05100 OUTSIDE ANT. STERNAL C3 -1-"° =C2 SA LS ;;; COIL 71. J 1 PROMO INPUT C35 I 0.1 JARSRS St -11 FRONT 51-13 REAR op_ Le FAL 0Sc COIL R4 2700 CIS 130 4540 REAR REAR I2VX 6 A A. P.-11., AUDIO C 10 7 8V o.5v -C9 Cl2 .0047 V 35C5 OUTPUT C13301 V A9A5V. 2.1 .01 COO .0047 T7 R7 330 .0047 SV SOON VOLUME Re C10O0N1T1ROLTP F4It4. EG ION R9 214E6. ( MINA R7il 0K150412 1200 TONE CONTROL C11 .022 SEE PRINTED NOTE Al 0338 R27 50MF 22 111- C3313 I8014F. C3 12~1 cse 047 14700 V7 VG 12AV6 12AL5 4 32( VS I2AU6 101 12 AU6 V3 1213A6 v2 1958 1A3__.1.448 8 .14A 029 - C30 T.4700 T4700 65.16 VG 35C5 CSI 470 CR1 INAL L4AM7PS .226 100K P M SPEAKER INTERLOCK SS .. O ON VOL. CONTROL FRONT AND REAR SECTIONS OF FUNCTION SWITCH SI-A AND SI-B ARE VIEWED FROM FRONT WM. TOE SWITCH SHAFT IN EXTREME COUNTER -CLOCKWISE POSITION. 1 (MON) POSITION FUNCTION MONO F. Al 4 A M. R.F. COIL A II A.M. OfC. COIL K -1000 LL RESISTANCE VALVES IN OHMS ANO ALL CAPACITANCE VALUES LESS THAN 1.0 IN MK ANO ABOVE 1.0 IN MMI OTHERWISE NOTED. Acceptable value of R9 may be 2 to 50 megohms. Schematic Circuit Diagram -Chassis No. RC1121A 2E47931- A M LOOP c37 COE 4 30 M.52345 VI 6BJ6 RF AMP I 40.7V. 030 031 /3100 R.F. ...ALF SHIELD C7 220 19X8 AIMER-05C. +vs, CIS SSVT 4 CIT EN. Al L CS I CI -C 12.236 I RI 220 L _ _ _ 2.2 MEG M. 050 COIL 1'33.7 0, LA A ff SI-13 FRONT 115. LE F m,s51.3C. a. 2700 CID ISO PROM F. M. OCT. AL/010 OUTPUT SI-21 REAR 10 .51 SI-A REAR FRONT AND REAR SECTIONS OF FUNCTION SWITCH 51-A AND 51-9 ARE VIEWED FROM FRONT WITH THE SWITCH SHAFT IN CENTER POSITION .2 A.M. POSITION FUNCTION 1 P14050 3 TI F.M 107111C. I- A. ttg =11 g 33 33 IIsm 330 it4 L4 T2 Am. 4SSNC RIS 10011 I .1-C111 14700 V3 12BA6 F AMP -A.125,4 94 s R16 T3 FM 10.714C 1 ti 4700 I I _J if111 1-3 s 230 E 250 C22 4,001 C39 14700 T4 A NI SSIIC 217 R13 220 WE ON CI T.022 C 1 0 R7 SOOK VOLUME CONTROL 100K TAP 12AV6 DE7.-IL AUDIO 0.5V -CS 330 CI1 - .0047 R9 2 MEG. (3.4131.1 TONE CONTROL CI3 .0047 220 35C5' OUTPUT 7 3130V 9GV. 43 R12 30 CI4I .01 * T7 Soo PM SPEAKER 3 SEE PRATED NOTE R27 22 11/.... C3313 I1301.1F. C 33A ISOME 032 1 COS .047 41L3 41(\ 4 1/7 12AV6 VG 12ALS VS 12AU6 I2AU6 v3 12BA6 v2 19X8 v 613J6 L9 4 LIO 4Lil ve 35C5 3 - Cs, yet T;g, 470 CRI DIAL LAMPS 547 INTERLOCKL3 TS 110 52 ON vOL. °STOOL 5 A.M. RF COIL U II A. M. OSC. COIL .1000 ALL RESISTANCE VALUES IN OHMS AND ALL CAPKITANCE VALUES LESS THAN 1.0 IN IMF. AND ASOvE 1.0 IN m3.413 UNLESS OTHERWISE NOTED. Simplified Schematic-"AM" Position ES 471136 TO .14 LOOP VI 6BJ6 R F Amp 1 92 V. R SHELF SHIELD C6 C7 220 V t 19X8 ITER-0SC SO V TI EM 10.7MC V3 12BA6 F AMP -A 1.16FM 1 F92 V. 416 68 HIC21 4700 12AU6 FM.IF AMP V R19 V 20 FO CD) 4700 12AU6 3EEFM. I.F AMP +73V EM10.714C .4V. FIA. 10.7 DISC_ VG 12AL5 F M 0E7 DISCONNECT POEN USING OUTSIDE WT. EXTERNAL F m ANT. C3 =C2 470 9.6 LW LS FM ANT COIL A M. OSC COIL I -A FRONT SEAR REAR FRONT AND REAR SECTIONS OF FUNCTION SWITCH 51-A AND 51-8 ARC VIEWED FROM FRONT WITH THE SWITCH SHAFT IN SETRIENIE COUNTER -CLOCKWISE POSITION I (PHONO) PC/51710N FUNCTION POONO 7i. R7 SOON VOLUME 100K TAP v7 12AV6 Drt-le AUDIO T 57 0.6, C12 -.- 0 33CS .0047 R9 2 MIES. ( MIN.) TONI CONTROL II_ 013 .0047 V8 305,C0,5 .130, SS C26 .0047 T7 313 1700 3 SEE PRINTED NOTE Z7 .1. C 33A I 5111/, C3313 .-11 1101.1r .047 0917 1'700 V7 12AV6 V6 12AL5 VS 12AU6 V9 12AU6 VS 12BA6 V2 1908 3 10.444 ][.= i;4«, 66.16 vs 35C5 C31 I 4/0 DIAL LA4M7PS R26 1001 P.M.SPEAKER TIFIL OC 0 5vO j_CON7RoN OL 5A B A.M. R.F. CO, A.M. 03C. CO, K41000 ALL RESISTANCE VALUES IN OHMS AND ALL CAPACITANCE VALUES LESS THAN 1.0 IN Mr. AND ABOVE 1.0 FAME. UNLESS OTHERWISE NOTED. EE 47937-1 Simplified Schematic-"FM" Position 58 2-XF-931 Series REPLACEMENT PARTS STOCK No. PART DESCRIPTION STOCK No. PART DESCRIPTION 77520 77522 70997 77530 33380 77531 77532 39636 75792 76992 39644 73473 73520 77533 73920 73561 73594 73562 73558 75071 73551 73935 77538 77534 77535 77526 77537 77525 77536 77528 75474 77529 77516 77515 72953 77523 16058 31480 77521 72602 77510 77519 76346 503022 503068 503112 503115 503122 503227 503282 503310 503318 503347 502410 503410 503422 503447 503522 503539 503547 CHASSIS ASSEMBLIES RC -1121A Bushing -Laminated bushing (1/2" long with shoutder) for station selector pointer pulley and shaft assembly. Capacitor -Variable tuning capacitor (CIA, CIB, C1C, C1D, C1E, C1A-T, C1C-T, CID -T) Capacitor -Fixed, ceramic, non -insulated, 5.6 mmf., ±1 mint., 500 volts D.C. Temp. coef. ---= 0 (C2) Capacitor -Fixed, ceramic, non -insulated, 7 mmf., +.5 mmf., 500 volts D.C. Temp. coef. = 80 (C15) Capacitor -Fixed, ceramic, non -insulated, 12 mmf., ±5%, 500 volts D.C. Temp. coef. = 0 (C6) Capacitor -Fixed, ceramic, non -insulated, 47 mmf., +10%, 500 volts D.C. Temp. coef. .=--..0 (C17) Capacitor -Fixed, ceramic, non -insulated, 130 mini., +21/2%, 500 volts D.C. Temp. coef. = -750 (C18) Capacitor -Fixed. mica, 220 mmf., 500 volts D.C. (C7) Capacitor -Fixed, ceramic, insulated, 330 mmf., ±20%, 500 volts D.C. High K (C9) Capacitor -Fixed, mica, 470 mmf., 300 volts D.C. (C26, C31) Capacitor -Fixed, mica, 470 mmf., 500 volts D.C. (C3) Capacitor -Fixed, ceramic, 4700 mint., +100%, -0%, 500 volts D.C. High K disc (C5, C8, C19, C21, C22, C23, C24, C25, C29, C30, C36, C38, C39) Capacitor -Electrolytic comprising 1 section of 80 mid., 150 volts and 1 section of 50 mfd., 150 volts (C33A, C33B) Capacitor -Fixed, miniature, tubular, paper, .001 mfd., 200 volts D.C. (C27) Capacitor -Fixed, tubular, paper, .0047 mfd., 600 volts (C12, C13, C28) Capacitor -Fixed, tubular, paper, .01 mfd., 400 volts (C10) Capacitor -Fixed, tubular, paper, .01 mfd., 600 volts (C14) Capacitor -Fixed, tubular, paper, .022 mfd., 400 volts (C11) Capacitor -Fixed, tubular, paper, .047 mid., 200 volts (C4) Capacitor -Fixed, tubular, moulded, .047 mid., 400 volts (C32) Capacitor -Fixed, tubular, paper, 0.1 mid., 400 volts (C35) Clip -Mounting clip for I.F. transformers Coil -Antenna coil-F.M. (L5) Coil -Choke coil (LI) Coil -Choke coil (L9, LIO, L11) Coil -Oscillator coil-A.M.-complete with adjust- able core (L6, L7) Coil -Oscillator coil-F.M. (L8) Coil-RF coil-A.M.-complete with adjustable core (L3, L4) Coil-RF coil-F.M. (L2) Connector -Combination phono input connector and antenna terminal board (J1) Connector -Single contact male connector for speaker lead Connector -Two (2) contact male connector for power cord Control -Tone control (R9) Control -Volume control and power switch (R7, S2) 250' Dial Cord Reel -Dial cord (approx. 49" overall required) Drive cord (approx. 11" overall required) Drum -Variable tuning capacitor drive drum and hub Grommet -Rubber grommet for mounting RF shelf (4 required) Lamp -Dial lamp (Mazda 47) Nut-Speednut for station selector pointer pulley and shaft bushing Pulley -Idler pulley for indicator cord (2 required) Pulley -Pulley and shaft (split) for station selector pointers Rectifier -Selenium rectifier, 100 MA (CR1) Resistor -Wire wound, 1200 ohms, 4 watts (R13) Resistor -Fixed, composition: 22 ohms, +10%, 1/2 watt (R27) 68 ohms, -±10%, Vz watt (516, R30) 120 ohms, +10%, 1/2 watt (R19, R21) 150 ohms, ±10%, V2 watt (512) 220 ohms, ±10%, V2 watt (51, R17, 520) 2700 ohms, +10%, 1/2 watt (54) 8200 ohms, +10%, th watt (R31) 10,000 ohms, ± 10%, 1/2 watt (56, R14, R23) 18,000 ohms, +10%, 1/2 watt (53) 47,000 ohms, 4-10%, Vz watt (R18) 100,000 ohms, ±5%, 1/2 watt (R24, R25) 100,000 ohms, +10%, V2 watt (515, R22, R26) 220,000 ohms, +10%, 1/2 watt (R10) 470,000 ohms, ±-10%, 1/2 watt (511) 2.2 megohm, ±10%, 1/2 watt (R5) 3.9 megohm, ±10%, V2 watt (52) 4.7 megohm, :I.:10%, 1/2 watt (1:18) 77527 75192 76331 77566 77087 76336 73117 31970 31418 77524 77666 77517 77511 76335 77514 76328 17513 77512 33726 34373 Shaft -Tuning knob shaft Shield -Tube shield for VI Shield -Tube shield for V2 Socket -Dial lamp socket Socket -Tube socket, 7 pin, miniature, moulded, saddle mounted for VI Socket -Tube socket, 9 pin, miniature, moulded, saddle mounted for V2 Socket -Tube socket, 7 pin, miniature, wafer for V3, V4, V5, V6, V7, V8 Spring -Dial cord spring Spring -Drive cord spring Switch -Function switch (Si) Transformer -Filament transformer, 117 volt A.C. input Transformer -Output transformer (T7) Transformer -Ratio detector transformer -complete with adjustable cores (T6) Transformer -First I.F. transformer-A.M.-complete with adjustable cores (T2) Transformer -First I.F. transformer-F.M.-complete with adjustable cores (TI) Transformer -Second IF. transformer-A.M.-complete with adjustable cores (T4) Transformer -Second I.F. transf ormer-F.M.-complete with adjustable cores (T3) Transformer -Third I.F. transformer-F.M.-complete with adjustable cores (T5) Washer -"C" washer for station selector pointer pulley and shaft or tuning knob shaft Washer -"C" washer to fasten idler pulleys 77539 SPEAKER ASSEMBLIES 971933-1 Speaker -51/4" P.M. speaker complete with cone and voice coil (3.2 ohms) 77543 77543 Y2468 Y2469 Y2470 Y2471 Y2472 77559 77558 77544 77545 77542 77033 77560 77548 77550 77552 77556 77554 77547 77549 77551 77555 77553 73203 77563 77557 73992 76837 77561 77562 MISCELLANEOUS Antenna -Antenna loop and back cover complete with power cord (includes C37) Back -Cabinet back complete with loop, capacitor and power cord (includes C37) Cabinet -Maroon plastic cabinet less "RCA Victor" emblem and function decal for Model 2-XF-931 Cabinet -Ivory plastic cabinet less "RCA Victor" emblem and function decal for Model 2-XF-932 Cabinet -Green plastic cabinet less "RCA Victor" emblem and function decal for Model 2-XF-933 Cabinet -Red plastic cabinet less "RCA Victor" emblem and function decal for Model 2-XF-934 Cabinet -Beige plastic cabinet less "RCA Victor" emblem and function decal for Model 2-XF-935 Cap -Station selector pointer cap-A.M. Cap -Station selector pointer cap-F.M. Capacitor -Adjustable, mica trimmer, 3-30 mmf. (C37) Cord -Power cord and plugs Decal -Control function decal Emblem -"RCA Victor" emblem Grille -Metal grille Knob -Function switch knob -maroon -for Model 2-XF-931 Knob -Function switch knob - ivory - for Model 2-XF-932 Knob -Function switch knob - green - for Model 2-XF-933 Knob -Function switch knob - red - f or Model 2-XF-934 Knob -Function control knob - beige - for Model 2-XF-935 Knob -Tuning control, tone control or volume con trol and power switch knob -maroon -for Model 2-XF-931 Knob --Tuning control, tone control or volume con trol and power switch knob -ivory -for Model 2-XF-932 Knob -Tuning control, tone control or volume con trol and power switch knob -green -for Model 2-XF-933 Knob -Tuning control, tone control or volume con trol and power switch knob -red -for Model 2-XF-934 Knob -Tuning control, tone control or volume con trol and power switch knob -beige -for Model 2-XF-935 Nut -Speed nut to fasten "RCA Victor" emblem to cabinet Pad -Cork and rubber pad (1/32" x 3/16" x 3/16") for mounting metal grille to cabinet Pointer -Station selector pointer Retainer -Knob retainer (knob to cabinet) Spring -Retaining spring for knobs (knob to shaft) Window -Polystyrene window for L.H. side of cabinet Window -Polystyrene window for R.H. side of cabinet APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 6 59 RCA VICTOR Record Demonstrator MODELS 15-E, 15 -El Chassis No. RS -139A, Record Changer RP -190A-1 and Two Speed Manual Turntable SERVICE DATA - 1951 No. 7 - PREPARED BY RCA SERVICE CO., INC FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. Specifications Tube Complement 1. RCA 6SQ7 A.F. Amplifier 2. RCA 6SQ7 Ph. Inverter 3. RCA 6V6GT Output 4. RCA 6V6GT .Output 5. RCA 5Y3GT Rectifier Power Supply Rating 115 volts, 60 cycles 80 watts Power Output Undistorted 10 watts Maximum 11 watts Loudspeaker Size and type .... 12 inch P.M. Voice coil impedance 3 2 ohms 400 cycles Pilot Lamp Mazda #51, 6-8 volts, .2 amp. Weight Cabinet Dimensions (overall) Height 177/3- Width Record Players Automatic (RP -190A-1) Record capacity Type of records Pickup (Stock No. 75770) Turntable speed . Manual Record capacity Type of records Pickup (Stock No. 75475) Turntable speed 211/2- 43 lbs. net Depth 197/8" up to 14 records RCA "45" crystal 45 r.p.m. 1 record up to 12 inch diameter dual stylus crystal 331/3 or 78 r.p.m. RP -190A-1 Record Changer: The record changer will play up to fourteen 45 r.p.m. records having a 1'/2 inch center hole It is identical to RP 190 -2a record changer except for the omission of the power switch. FOR RECORD CHANGER SERVICE DATAREFER TO RP -190 SERIES SERVICE DATA. Manual Turntable: The manual turntable will play one 33'13 or 78 r.p.m. record up to twelve inches in diameter. The speed is controlled by a knob on the motorboard. The correct stylus is selected by a lever knob on the end of the pickup arm. VOLUME CONTROL STOP This instrument is provided with a volume control stop to provide a pre -determined "maximum" volume level and yet allow normal volume control operation up to the predetermined -maximum." Adjusting "Maximum" Volume Level: With the :nstrument operating, remove the volume con- trol knob. Note the extending ends of two coil springs (one light and one heavy) on the volume control shaft. TO INCREASE Turn control fully clockwise and then, with end of a pencil or similar item, press counterclockwise on the end of the LIGHT spring. Rotate control shaft clockwise until desired level is reached. Release pressure on the spring and replace knob. TO DECREASE Turn control fully clockwise and then, with the end of a pencil or similar item, press clockwise on the end of the HEAVY spring. Rotate control counterclockwise to a very low level. Increase volume to desired level as described above. TO INCREASE PRESS C/CLOCKWISE ON LIGHT SPRING TURN SHAFT CLOCKWISE TO DECREASE SHAFT PRE SS CLOCKWISE ON HEAVY SPRING C/CLOCKWISE on. Mass 60 15-E, 15-E-1 IDLER WHEEL *76750 IDLER TENSION SPRING *76745 GROMMET *76751 DRIVE PULLEYS MOUNTING PLATE CONNECTOR *30870 r aw= 7. I I MOTOR UMW -ea DETENT SPRING #76755 MS -1181 Manual Motorboard - Motor Assembly ADJUST LINK BY THIS SCREW TO PROVIDE APPROX. I/64"HOLD WHEN SWITCH AND SPEED LEVER IS IN NOMINAL "33" POSITION. *13 xI/4' S.T. SCREW LOCK WASHER BETWEEN LINKS MOTOR DRIVE ASSEMBLY LINK LINK :111% SPEED SHIFT LEVER "713" STOP LANCE WHEN SWITCH IS IN NOMINAL POSITION AT EITHER "78"OR "33" LOCATION, SWITCH LEVER SHOULD BE APPROX 1/32" MAX FROM STOP LANCES. TIGHTEN CLAMP SCREWS SECURELY SWITCH SHAFT SWITCH SHOWN IN "33 POSITION SWITCH LEVER CLAMP SCREW TENSION SPRING SPEED SELECTOR SWITCH MS. ills Speed Control Lever Assembly TURNTABLE RIM GROMMETS *76751 ID*L7E6R 7W5H°E-E7L10. ft W*7A6S7H4E3R"- SPRING *76744 SPRING *76745 SLEEVE *76749 SPEED SHIFT LEVER MOUNTING PLATE AND PULLEY ASSBY. *76768 99-1178 "78" PULLEY *76746 15332 3 PULLEY *76748 Controls MS 131-1 L.F. TONE CONTROL RIO & POWER SWITCH SI H.F. TONE CONTROL R9 VOLUME CONTROL R3 C-48399 Chassis Top View AUDIO INPUT JI 77977 ARM (SHELL) 76947 BEARING 77970 BRACKET 76734 BRACK 711087 WASHER 76668 NUT 75357 PIVOT 76733 POST _70666 SLEEVE 76736 RING 10941 BALL 77962 GROMMET 77961 WASHER FIBRE WASHER 779 79 POST 77983 C WASHER 75876 WASHER 77964 HOUSING 77000 SHAFT 11.1416 I5 -E Pickup Arm Mounting - Manual Motorboard 15 -E -I 2 MANUAL MOTORBOARD SERVICE HINTS (a) Stylus force of pickup arm should be 8 to 10 grams. Insufficient force resulting from use of incorrect spring or pickup may allow stylus to jump grooves. Excessive force may cause distortion and record wear. (b) Pickup arm pivots should be adjusted to provide a minimum of side play - yet al- lowing free vertical movement. Binding may cause stylus to jump groove. (c) Inner surface of turntable rim must be clean and smooth. Idler wheel and drive pulleys must have no rough spots and be free of oil and grease. Roughness may cause rumble - oil may cause wow. (d) Lubricate idler wheel and drive pulleys with a good quality light oil - one or two drops for each is sufficient. (e) The pickup arm pivot shaft may be lubricated with a film of light oil. The pivot post rubber mounting should not be excessively compressed. The bearing nut should be tightened only enough to elevate the pivot shaft 1/32" above the post with the steel ball in place. This ball must be in place to permit free lateral pickup arm movement. CRITICAL, LEAD DRESS 1. Dress all filament leads next to chassis. 2. Dress power cord lead, from strain relief grommet to on -off switch, along side apron. 3. Dress A.C. leads at ON -OFF switch away from all audio components. 4. Dress output tube plate leads next to chassis. 5. Dress C8 next to chassis and wire with as short leads as practical. 6. Dress lead from arm of low frequency tone control to grid of V-3 away from A.C. leads at ON -OFF switch. MODIFICATION Although designed and assembled for 3 -speed operation, provision is made for modification of this instrument for 33 and 45 rpm performance only. To eliminate the use of the 78 SPEED control and 78 stylus, proceed as follows: To alter SPEED SELECTOR control Tie both pickup arms to their rests and place the instru- ment on its left side (not on control knobs) on a table. Through the opening in the bottom of the cabinet, disconnect the black power plug and the phono plug from its chassis connection. While supporting the top panel, remove the hex head screw and washer, centrally located beneath the top panel at the back of the cabinet. Place cabinet upright, move SPEED SELECTOR to 45 position, then lift off top panel assembly. From the back, the switch can be viewed from beneath the top panel and conversion effected as shown below. Bend the 33 stop to the vertical position of the adjacent 78 stop. The speed change lever (on left) should now halt against the vertical 33 stop, eliminating the 78 speed position. 15-E, 15-E-1 61 Replace top panel ( rubber supporting grommets must be in place) and the hex head screw and washer. NOTE: It is important that screw be tightened panel can be lifted approximately 1/16 inch until only. top The board should float freely on its mounts; there must be no restriction of movement. Reconnect the black power plug and insert phono plug in the chassis socket. Place the instrument in the upright position and untie pickup arms. To adapt STYLUS CONTROL LEVER - With lever in 33 position, loosen left holding screw just enough to turn lug to the position shown below and tighten screw. This will prevent the 78 stylus from being turned for use. STYLUS CONTROL LEVER SPEED CHANGE LEVER LINK LUG PICKUP 78" STOP LANCE MOUNTING SCREW 33" STOP LANCE SHOWN IN MODIFIED POSITION (VERTICAL) SPEED SELECTOR SWITCH Before Operation Remove SPEED SELECTOR knob and turn over the CIRCULAR PLATE which will now show only 33 OFF 45 positions. Replace knob on shaft. Reverse the left INSTRUCTIONS PLATE to read for 33 operation only. JI PHONO C12 .0022 P103 R101 R102 1.5 MEG. MUTING SWITCH R103 ZR104 113K S 1.0 MEG. icK up 'tfir-Cirr 45 RPM (RP190) D101 C4 .022 6$GC7 A. F. 115 V. I C5 .0033 4 R4 10 MEG. R 270I< IC6 .01189 R9 1 MEG. H.F. TONE CONT. 270 l< R10 2 MEG. L.F.TONE CONT. R12 4701< C8 5101-1 FRONT 44 SWITCH POS. FUNCTION t_-78 PHONO 2 --33JSPHONO 3 --OFF 45 PHONO RP -190) V2 6SINV.Q7 PH. 15V. R8 10 MEG R13 8200 .0C292 R6 2701< V3 6V6GT OUTPUT 325 V. n-1.0C01102 4 294 V. 7004 T2 TOTAL V4 6V6GT OUTPUT 3 C P.M. SPKR. 1.00C1II2 I R14 470K ',21AV 3. 5102 "ON" IN POS. 1 4 2 S103 'ON. IN POS. 4 CATHODE CURRENTS VVVVV2I453__-_--_--_-.--_--_--633..7B373MA P1 WHITE P104 Si ON RIO TONE CONT. +IA 3C0IEMS F I R5 VS 6800 5Y3GT RECT. L. -0111N. YEL. o RED-GRN. TOTAALL RED-VAL 335V. +1. ICIA 20MF FRONT 4 REAR SECT ION OF SWITCH S101-1 ARE VIEWED FROM FRONT WITH THE. CONTROL SHAFT IN EXTREME C/CLOCKWISE POSITION 1. 115 V. RED BRN.- BLK. J_ .4R1764 R17 .47 4-1- 4,..." 6V. A.C. TO HEATERS 4 JEWEL LIGHT WHITE K=1000 AVLALLUREESSILSETSASNCTEHAVNAL1U.0ESARINEOINHMMSF. .A, LALNCDAAPBAOCVITEA1N.0CEARE IN MMF. EXCEPT THOSE INDICATED. VOLTAGES MEASURED TO COMMON WIRING WITH CHANALYST OR VOLTOHMYST , AND SHOULD HOLD WITHIN *20% WITH RATED POWER LINE SUPPLY. PWR. SUPPLY 1 N MODEL I 5E CI 2 MAY BE OMITTED. C6 MAY BE 0.01 M FD. R104 MAY BE 1.5 MEG. Schematic Diagram 3 62 15-E, 15-E-1 Replacement Parts STOCK No. DESCRIPTION TWO SPEED MANUAL TURNTABLE Pickup Arm Assembly 15-E 76731 Arm-Pickup arm shell-less cartridge, mount, and cable 76739 Brapcinkeatn-Pdiccokuunptearrbmalmanocuenstipnrginbgracket complete with pivot 76737 Cable -3 wire pickup arm cable complete with connectors 76738 Knob-Stylus selector knob complete with screw 76732 Mount-Pickup mount and swivel assembly 74230 Nut-#00-112 nut and washer to mount stylus 75475 Pictkwuop-sDtyuluasl stylus pickup crystal cartridge complete with 75366 Pin-Pivot pin for counterbalance spring 75357 Pivot-Pickup arm pivot (2 req'd) 76733 Post-Pickup arm pivot post and stop pin 76736 Ring-Retaining ring for pickup arm mounting bracket 71097 Screw-#4 x swivel (4 1re/4q-'d)self tapping screw for pickup mount and 76735 Spring-Ccunterbalance spring 75497 Stylus-Osmium tip stylus for 78 RPM (not coded) 75496 Stylus-Osmium tip stylus for 331/2 RPM (coded red) Pickup & Arm Assemblies 15-E-1 77977 Arm-Pickup arm shell (plastic) 76947 Bearing-Pickup arm mounting bracket pivot bearing 77978 Bracket-Pickup arm mounting bracket 75810 Bracket-Pickup arm weight adjustment bracket (slide) 78227 Cable-Three wire cable complete with connectors 77982 Grommet-Rubber grommet for pickup arm post 76738 Knob-Stylus selector knob 74230 Nut-#00-112 nut and washer to mount stylus 77779 Pickup-Crystal pickup complete with two (2) styli 77979 Post-Pickup arm pivot post 76898 Screw-#2-56 x 3/16" headless set screw for stylus selector knob 76899 Screw-#6-32 x 1/4" round head screw for pickup arm weight adjustment bracket 76998 Screw-Pickup arm mounting bracket pivot screw 77980 Shaft-Pickup arm pivot shaft 75809 Spring-Pickup arm counterbalance spring 75497 Stylus-Osmium tip stylus (.003 r. uncoded) for 78 r.p.m. 77899 Stylus-Sapphire r.p.m. tip stylus (.001 r. coded red) for 331/2 77976 Swivel-Pickup cartridge mount and swivel assembly 77.983 Washer-"C" washer for lower end of pickup arm pivot shaft 75876 Waasnhdesrh-"aCft" washer for upper end of pickup arm post 77981 Washer-Metal washer for pickup arm post and shaft Motor and Turntable Assembly 30870 Connector -2 contact male connector for motor leads 76751 Grommet-Rubber grommet to mount motor (3 req'd) 76753 Motor -117 volt 60 cycle complete with mounting plate- less #76768 plate and idler wheel 76768 Plate-Speed control pulley mounting plate complete with pulleys 76746 Pulley -78 RPM pulley 76748 Pulley -331/2 RPM pulley 76749 Sleeve-Spring sleeve for motor shaft 76755 Spring-Detent spring (below motor mounting plate) 76744 Spring-Hairpin spring to retain idler wheel 76745 Spring-Idler wheel tension spring (above motor mounting plate) 76752 Turntable-Finished turntable (9" dia.) 76743 Washer-Flat fibre washer for idler wheel 35969 Washer-"C" washer to retain turntable on shaft 76750 Wheel-Idler wheel 95 R.P.M. AUTOMATIC RECORD CHANGER RP 190A-1 Same as listed for RP 190-2a in RP 190 Series Service Data except for the omission of the on -off switch and switch housing AMPLIFIER ASSEMBLIES RS139A 76685 Capacitor-Ceramic, 560 mmf. C7 71976 Capacitor-Electrolytic comprising 1 section of 20 mid., 450 volts, 1 section of 30 mid., 350 volts and 1 section of 20 mfd., 25 volts C1A, C1B, CIC 73850 Capacitor-Tubular, paper, oil impregnated, .0012 mfd., 1000 volts C10, C11 73595 Capacitor-Tubular, paper, .0022 mid., 600 volts C12 73795 Capacitor-Tubular, paper, .0033 mfd., 600 volts C5 73796 Capacitor-Tubular, paper, .0039 mid., 600 volts C6 73561 Capacitor-Tubular, paper, .01 mid., 900 volts C2, C8 STOCK No. DESCRIPTION 73797 73562 35787 72776 30868 38405 38402 71980 74838 76684 523127 523268 503282 503315 503327 503427 503447 504610 31364 54414 71979 76695 75566 72437 74850 75643 30868 30870 76693 503318 503356 503510 503515 76699 75023 76296 76389 13867 75682 76093 X3240 10941 71599 13103 72113 75697 72856 77984 74979 72118 11765 76692 76691 76688 73634 76689 76686 14270 30900 76690 76687 Capacitor-Tubular, paper, .015 mid., 600 volts C3 Capacitor-Tubular, paper, .022 mfd., 400 volts .. .C4, C9 Connector-Phono input connector (socket) Con(2nercetqo'rd-)Single contact male connector for speaker leads Connector -2 contact female connector for motor power. PI Control-H.F. tone control Control-L.F. tone control and power switch Control-Volume control-less stop Grommet-Power cord strain relief (1 set) R9 RIO, SI R3 Resistor-Wire wound, 0.47 ohms, Resistors-Fixed, composition: -1 watt R16, R17 270 chms, +10%, 2 watts R15 6800 ohms, +10%, 2 watts R5 8200 ohms, +10%, V: watt R13 15,000 ohms, +10%, 1/2 watt RI 27,000 ohms, ±10%, 1/2 watt R2 270,000 ohms, +10%, 1/2 watt RE, R7, R11 470,000 ohms, +10%, '/ watt 10 megohm, ±20%, 1/2 watt Socket-pilot lamp socket R12, R14 R9, R8 Socket-Tube socket Stop-Volume control adjustable stop (two springs) Transformer-Output transformer T2 Transformer-Power transformer, 117 volt 60 cycle Ti FUNCTION SWITCH ASSEMBLY Cab(slwe-iStchhietoldaemd pliafuiedri)o cable complete with pin plug P103 Capacitor-Ceramic, 1800 mmf. C102 Capacitor-Tubular, paper, .001 mf., 1000 volts C101 Connector-Two contact female connector for motor cables PIOIA, P102A Connector-Two contact male connector for motor power cable P104 Lever-Speed change lever (mounted on switch shaft) Resistors-Fixed composition: 18,000 ohms, ±10%, Va watt R103 56,000 ohms, +10%, 1/2 watt RIO1 1.0 megohm, ±10%, 1/2 watt 8109 1.5 megohm, ±10%, V2 watt R102 Switch-Function switch-less speed change lever 5101, 5102, 5103 SPEAKER ASSEMBLIES 971494-2W RLII1B1 RMA274 Cap-Dust cap Cone-Cone and voice coil (3.2 ohms) Speaker -12" P.M. speaker complete with cone and voice coil ohms) SPEAKER ASSEMBLIES 92569-12W RL111A1 RMA 274 Cap-Dust cap Cone-Cone and voice coil (3.2 ohms) Speaker -12" P.M. speaker complete with cone and voice coil NOTE:-If stamping on speaker instrument does not agree with above speaker number, order replacement parts by referring to model number stamped on speaker and full description of part required. MISCELLANEOUS Baffle-Baffle board and grille cloth Ball-Steel ball (Vs" dia.) for pickup arm mounting Bracket-Pilot lamp bracket Cap-Pilot lamp cap Foot-Rubber foot (4 req'd) Grommet-Rubber grommet for mounting 45 RPM changer (3 req'd) Grommet-Rubber grommet for motor board (4 req'd) Housing-Pickup arm pivot shaft housing (15-E-1 only) Knob-Selector switch knob-tan Knob-Tone control or volume control knob-brown Lamp-Pilot lamp-Mazda 51 Link-Motor speed change link (bent -end section only) Link-Motor speed change link (slotted section only) Nut-Pickup arm pivot shaft bearing nut (15-E only) Nut-Speed nut for speaker mounting screws (4 req'd) Rest-Pickup arm rest (for 331/3-78 RPM arm) Sleeve-Rubber sleeve (39/64 O.D. x 7/16" I.D. x 11/32") for pickup arm pivot post (15-E only) Spring-Retaining spring for knob 74057 Spring-Retaining spring for knob 72118 Spring-Speed change link and lever tension spring Washer-Rubber washer (13/16" O.D. x 7/16" I.D. x 1/4") for pickup arm pivot post (2 req'd) APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 4 63 RCAVICTOR 930409 SERIES Automatic Record Changer Noe SPECIFICATIONS Turntable speed Record capacity 331/3, 45 or 78 r.p.m. Up to 14 seven-inch or 12 ten -inch or 10 twelve -inch or 10 ten- and twelve -inch intermixed 930409-3 115 v. 60 cycle motor convertible to 50 cycles. Ceramic pickup Stock No. S-5652. 930409-4 115 v. 25 cycle motor. Ceramic pickup Stock No. 162A001. Used in Model 35QU. 930409-5 930409-6 930409-9 930409-10 930409-11 115 v. 60 cycle motor. Crystal pickup Stock No. 75475 or 77779. Used in Models 2ES3, 2ES31, 2ES38, 2ES38E, 21S1, 2JS1E, 2S7, 2S10, 2US7, 21T197DE, 21T242 and 21T244. 115 v. 60 cycle motor convertible to 50 cycles. Ceramic pickup Stock No. 162A001. Used in Models 2ES31Q, 2ES38Q, 2JS1Q and 35QU. 230 v. 50 cycle motor convertible to 60 cycles. Crystal pickup Stock No. 75044. Same as 930409-5 except light color. Used in Models 2S7, 2510, 2US7 and 21T242. 115 v. 50 cycle motor convertible to 60 cycles. Crystal pickup Stock No. 75475 or 77779. Used in Model 2US7. SERVICE DATA - 1952 No. 6 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. INDEX Lubrication Stylus Replacement. Record Stabilizer Arm 50/60 Cycle Conversion Adjustments Cycle of Operation Exploded View of Mechanism Replacement Parts 2 2 2 2 3 to 7 8 9 to 14 CONTROLS The record changer has a dual control on the motor board and a stylus selector control on the pickup arm. The inner control (circular knob) is the OFF -ON -REJECT control. Turning this knob to the center position energizes the motor and starts the turntable, when turned to the right (clockwise) it starts the mechanism into complete automatic operation. The mechanism will shut off automatically after the last record has been played but can be shut off manually by turning this knob to the left (counter -clockwise). The outer control (double ended lever) is the speed control. It has three normal positions, "33", "45", "78" to select the turntable speed desired and a neutral position (midway between "45" and "78"). The control should be turned to this neutral position if the changer is not expected to be in use for an extended period of time. The stylus control has two normal positions (right and left) and one shipping position (lever pointing up). When playing 33 or 45 r.p.m. records the lever is turned so that "33-45" is visible on the TOP of the lever; likewise for 78 r.p.m. records "78" should be visible on the TOP. The removable centerpost is for use with 45 r.p.m. records having the large centerhole. It must be placed over the center spindle with the "RCA" trademark monogram FACING to the FRONT. When not in use it is placed in a well at the front of the motorboard. To load or remove records, the record stabilizer is lifted and turned off -side. After loading it is turned to the center where it rests on top of the stack of records. STABILIZER ARM tray,..ot 45 RPM CENTERPOST PLACED OVER CENTER SPINDLE\ FOR 78RPM RECORDS WELL FOR 45 RPM CENTERPOST Controls PICK UP ARM REST '2) OFFON REJECT CONTROL SPEED ONTROL 64 930409 Series STOP ARM 56 LIFT ARM 100 CYCLING GEAR 130 CYCLING SLIDE 141 REJECT ROD 52 STOP LEVER 115 MUTING SWITCH 94 PICKUP ARM LEVER 124 REJECT LEVER 109 TRIP SLIDE 139 POWER SWITCH 110 Figure 1-Bottom View LUBRICATION The mechanism is properly lubricated when it leaves the factory, additional lubrication should not be necessary for a long period of time. If the mechanism has unusual use or high operating temperatures, it may be necessary to lubricate more frequently. It is suggested to use Lubriplate or STA-PUT No. 512 on: 1. Pickup arm pivot. 2. Points of sliding contact with cycling slide, including: a. elevating rod b. lift arm c. roller on cycling cam d. pickup arm return lever e. pickup arm lever 3. End of selector lever contacting tab on cycling gear. 4. Turntable thrust bearing. 5. Sparingly on a trip slide. 6. All points of sliding contact. Apply a small quantity of light machine oil to: 1. Trip pawl pivot. 2. Cycling engagement pawl pivot. 3. Bearing of record stabilizer. 4. Elevating rod. 5. Bearing of lift arm. 6. Bearing of reject lever. 7. Bearing of stop lever. 8. Bearing of cycling gear. 9. Motor bearings. NOTE: Keep oil or grease away from all rubber parts. 2 Stylus Replacement PICKUPS NO. 75044 and S-5652 The styli are held in position by small thumb nuts (one for each stylus). Loosen the nut to remove stylus. PICKUP NO. 75475 The styli are held in position by small hex nuts (one for each stylus). Remove the nut and push threaded end of stylus through the cartridge. PICKUP NO. 162A001 The styli are held in position by pressure fit. To remove stylus, grip with tweezers and pull straight to the front of pickup. CAUTION: The internal element of the pickups can be fractured by use of excessive force. It is advisable to grip stylus with pliers instead of holding pickup case while removing nuts. Although the 78 and the 45-33Y3 styli are mechanically interchangeable, they should be replaced in such manner that the stylus which is coded red will contact the record when "33-45" on the stylus selector knob is visible from the top. Record Stabilizer Arm Two types of stabilizer arms are in use. Type "A" when raised and moved outward will remain protected beyond the edge of the motorboard. Use Stock Number 76941 (plum) or Stock Number 76942 (beige) record stabilizer housing. Type "B" when raised and moved outward will return to within the edge of the motorboard. Use Stock Number 77256 (plum) record stabilizer housing, and Stock Number 77257 record stabilizer return spring. The replacement stabilizer arm (plum) Stock Number 77255 can be used with either Type "A" or Type "B". 50/60 Cycle Conversion Models 930409-3 and 930409-6 are made for 60 cycle operation but may be converted to 50 cycle operation. Models 930409-9 and 930409-11 are made for 50 cycle operation but may be converted to 60 cycle operation. To convert the above listed models it is necessary to remove the original spring sleeve from the motor shaft and install the alternate spring sleeve (in envelope attached to record changer). This is easily accomplished by holding the rotor of the motor while removing or installing the spring sleeve with a twisting motion. 65 930409 Series 17 HEIGHT ADJUSTMENT ij STYLUS FORCE ADUSTMENT 20A LANDING ADJUSTMENT 4 - MS 1290 Figure 2-Adjustments ADJUSTMENTS LANDING ADJUSTMENT Only one landing adjustment is necessary. The landing position of the stylus is adjusted by means of the eccentric stud (20A), mounted on the pickup arm support bracket. When adjusted for correct landing on one size of record, the landing position for other sizes of records is automatically corrected. PICKUP ARM HEIGHT ADJUSTMENT The pickup arm height during cycle is adjusted by means of the hex head screw (17), located in the pickup arm. Turn control knob to "REJ" and rotate turntable by hand until arm has risen to its maximum height. Adjust screw so that stylus is Ph" above turntable. STYLUS FORCE ADJUSTMENT Stylus force should be 71/2 to 9'/z grams. Loosen screw (14), and move slide until the correct force is obtained. TRIPPING The tripping method used in this mechanism is a combina- tion of velocity and fixed diameter. Velocity tripping is effective between 434w and TA" diameters, when the stylus moves inward 1/8" or more per revolution of the turntable. No adjustment is required. r89 TWELVE INCH. INDEXING LEVER CENTER POST Figure 3- Slide Assembly (Complete) CYCLING GEAR 130 S TOP LEVER 115 SELECTOR LEVER 103 PICKUP ARM RETURN LEVER SPRING -118 REJECT LEVER 109 LIFT ARM 100 PICKUP ARM RETURN LEVER 120 PH 706 CYCLING SLIDE ESCAPE LEVER 141 SPRING -140 MUTING SWITCH 94 STOP LEVER 115 SELECTOR LEVER 103 TRIP PAWL 131 Figure 4- Slide Assembly (View with Slide Removed) PICKUP ARM LEVER 124 133 3 66 930409 Series CYCLE OF OPERATION TURN ON -OFF -REJECT CONTROL KNOB TO REJECT POSITION & RELEASE 1. The on -off -reject control knob, through the linkage of the function control lever (54), reject rod (52), and reject lever (109) actuates the power switch and the trip slide (139). 2. The closing of the power switch energizes the motor and starts the turntable rotating. TRIP SLIDE 139 FUNCTION CONTROL KNOB 40 REJECT ROD52 FUNCTION CONTROL LEVER 54 REJECT LEVER 109 436110 POWER SWITCH Figure 5 CYCLING STARTS 1. The trip slide (139) in its movement contacts the lower trip pawl (131) and moves both the lower and the upper trip pawls which are linked together. The movement of the upper trip pawl (129) actuates the cycling engagement pawl (130A) sufficiently to cause it to engage with the projection on the hub of the rotating turntable. 2. The contact between the cycling engagement pawl (130A) and the projection on the turntable hub gives the necessary push for the teeth in the cycling gear (130) to engage the teeth in the shaft of the turntable and thus start the change cycle. PROJECTION ON TURNTABLE SHAFT ENGAGEMENT PAWL 130A UPPER TRIP PAWL 129 CYCLING GEAR 130 LOWER TRIP PAWL 131 TRIP SLIDE 139 Figure 6 PICKUP ARM RISES & MOVES OUTWARD 1. As the cycling gear rotates, the stud (130B) mounted on the underside of the gear, rides inside a slot cut in the cycling slide (141). The rotation of the cycling gear pushes the cycling slide back, and later, allows it to return. 2. As the slide moves away from the center post, an incline formed on the end of the slide causes the elevating rod (123) to rise and lift the pickup arm. 3. At the same time that the elevating rod is pushed upward, the pickup arm lever (124) is also pushed up by the force transferred through the spring (125). The raising of the pickup arm lever causes the two formed dimples in the pickup arm lever to engage the two holes in the pickup arm return lever (120), and couple them together. This directs the movement of the pickup arm during change cycle. 4. The cycling slide continues to move away from the center post until the formed end of the slide pushes against the pickup arm return lever. This relieves the force of pickup arm return lever against stop lever (115). This permits the stop lever return spring (114) to return the stop lever to the normal (raised) position. 5. The end (115A) of stop lever (115) pushes trip slide back ready for the next change cycle. CYCLING SLIDE 141 ms 075 ELEVATING ROD 123 SPRING 114 END OF STOP LEVER 115 FORMED END OF CYCLING SLIDE 4 CYCLING GEAR 130 Figure 7 STUD 1308 PICKUP ARM RETURN LEVER 115A 120 PICKUP ARM LEVER 124 Figure 8 SPRING 125 CYCLE OF OPERATION (Cont.) 67 930409 Series RECORD DROPS TO TURNTABLE 1. After the cycling slide has raised the pickup arm an i is moving it outward, the lift arm (100) is actuated by the cycling slide. 2. The lift arm pushes up on the shaft extending from the bottom end of the center post. This shaft actuates the push -off mechanism inside the center post, and the record drops to the turntable. SELECTION OF LANDING POSITION 1. During rotation of the cycling gear the riveted tab (130C) near the center of the gear, pushes down on one end of the selector lever (103) (which is pivoted in the center) thereby raising the other end causing i. to latch on the end (89A) of the twelve -inch inde:ang lever (89). 2. The mechanism is thus automatically indexed to Land on a ten inch record unless the selector lever (139) is disengaged from the end of the twelve -inch inde:ring lever. 7 Inch Indexing: The ten -inch indexing lever (133) is pivoted in the center and one end (133A) is held (by tensior of spring) against the top surface of the cycling gear. A hole in the gear will permit the end of the indexing lever to lower and thus raise the opposite end of the lever. A projection (133B) on the lever will at the same time lift the selector lever, permitting it to engage the top step of the pickup arm return lever (120) This position allows the pickup arm to land on the edge of the seven-inch record. CYCLING SLIDE 141 CENTER POST 84 LIFT ARM 100 CENTER POST SHAFT Figure 9 ,-/S 2 76 INDEXING LEVER 89 END 59A Figure 10 TAB 10 Inch Indexing: The ten -inch indexing lever will lift the selector laver unless a record on the turntable contacts the rubbe- tip of the ten -inch indexing lever (133), and prevents it from rising. When the lever is prevented from ruing, the selector lever will remain in position to engage the middle step of the pickup arm return lever. 12 Inch Indexing: When a twelve -inch record drops to the turntable, it strikes the twelve -inch indexing lever (89) and forces it backward. This disengages the end of the selector Lever 11110-40.- ws '277 SELECTOR LEVER 103 (103) from the edge of the indexing lever and permits the selector lever to drop down into the recess (89B) at the end of the indexing lever. This position of the selector lever causes it to engage the bottom step of the pickup arm return lever (120) and will push the pickup arm to land on the edge of a twelve -inch record. 133 A SPRING 134 10' INDEXING LEVER 133 HOLE IN GEAR RUBBER TIP 032) STRIKES 10" RECORD PREVENTING INDEXING LEVER (133) FROM LIFTING SELECTOR LEVER (103) 12 INCH INDEXING LEVER Be BOTTOM STEP OF PICKUP ARM RETURN LEVER 120 RECESS 89B PROJECTION 133 B TOP STEP OF PICKUP ARM RETURN LEVER 120 "sI291 7" RECORD POSITION 10' I ,IDEXING LEVE:R 133 MIDDLE STEP OF PICKUP ARM RETURN LEVER 120 10" RECORD POSITION SELECTOR LEVER 103 12- RECORD POSITION Figure 11 Figure 12 5 Figure 13 68 930409 Series CYCLE OF OPERATION (Cont.) SEL ECTOR LEVER 103 PICKUP MOVES IN FOR LANDING 1. As the cycling slide returns, the formed end (141A) on the slide moves back, permitting the pickup arm return lever spring (118) to expand. This causes the pickup arm return lever (120) to move the pickup inward until the pickup arm return lever comes against the selector lever (103). The pickup is now directly above the point of landing. PICKUP ARM RETURN LEVER 120 FORMED END .41 A OF CYCLING SLIDE SPRING 118 PICKUP LANDS ON RECORD 1. The elevating rod (123) slides down the incline on the slide permitting the pickup to land on the start of the record. 2. A cut -away portion (130D) of the teeth of the cycling gear stops the return movement of the slide before completion of cycle. The stud (130B) in the cycling gear rests in the first indentation (offset from center) of the slide to stabilize it in this position. 3. Just before the cycling gear completes cycle, a small tab (141C) on cycling slide makes contact with lower trip pawl (131) thereby moving upper trip pawl and cycling engagement pawl back. This prevents the re engagement with the projection on the turntable hub which would start a new change cycle. 4. On the next revolution the projection on the hub of the turntable engages with a formed lug (130E) on the outer edge of the cycling gear. The cycling gear will then rotate until the second cut -away portion (130F) of the teeth again stops the movement of the slide, this time at completion of the cycle. The stud on the cycling gear rests in the second indentation (center) of the slide to stabilize it in this position. The purpose of this pause in the cycle is to allow the pickup to enter the starting groove of the record before the full effect of the feed -in spring is applied to the pickup arm. Figure 14 ELEVATING ROD 23 INCLINE ON CYCLING SLIDE Figure 15 /11.1219 UPPER TRIP PAWL 129 PICKUP ARM RETURN LEVER 120 PICKUP ARM LEVER 124 END OF ELEVATING ROD ENGAGEMENT PAWL 130A -%444116.. CONTACT TAB 141C Figure 16 1/5-11.82 CYCLING SLIDE 141 RECORD PLAYS 1. As the record plays, the pickup moves in toward the center of the record carrying the trip slide along. This is due to the contact made with the pickup arm lever which turns with the pickup arm pivot. 2. The trip slide contacts the lower trip pawl, causing both (lower and upper) trip pawls and the cycling engagement pawl to move slightly with each revolution of the record. This slight movement of the pawls is reversed each time the projection on the turntable hub comes in contact with the cycling engagement pawl. The back movement is taken up in the friction connection between the upper and lower trip pawls. TRIPPING This slight movement of the pawls continues as long as the pickup moves in at a constant rate of speed. When the stylus leaves the recorded section of the record, the rapid acceleration results in rapid movement of the cycling engagement pawl. The cycling engagement pawl assumes a position in which the projection on the turntable hub makes a positive contact and the cycling cam is pushed sufficiently for engagement between the teeth of the cycling gear and the teeth on the turntable hub. This starts change cycle. STUD 130 S ON OTHER SIDE OF CYCLING GEAR 130E FORMED LUG 130 F 130D PROJECTION ' STUD 1308 IN FIRST INDENTATIO1 2 ND INDENTATION Figure 17 ENGAGEMENT PAWL 130A UPPER TRIP PAWL 129 PICKUP ARM LEVER 124 LOWER TRIP PAWL 131 TRIP SLIDE 139 MS.265 CYCLE OF OPERATION (Cont.) 69 930409 Series MECHANISM STOPS AFTER PLAYING OF LAST RECORD After the mechanism has been tripped it again follows the preceding sequence of cycling and playing the records until the last record of the stack has been played. 1. As the last record of the stack drops to the turntable the record stabilizer drops and actuates the stop arm (115). This stop arm in turn applies force to stop lever (115) through spring (115B) and connecting wire (137). At this moment the cycling slide is in the outermost position (away from centerpost) and the end (115B) of stop lever is forced against escape lever (141B) which prevents it from lowering any further. 2. As the cycling slide returns to the out of cycle position the end (115B) of stop lever slides off the escape lever permitting the end to extend down through the slot in the cycling slide. At this time the pickup arm return lever has rotated too far to be blocked by the other end (115C) of the stop lever and the pickup is permitted to land on the record. 3. After the last selection has been played the mechanism again goes into change cycle, and the cycling slide moves into its outermost position. At this moment the force which has been applied to the stop lever from the record stabilizer causes the end (115B) to lower, thus extending further through the cycling slide. The other end (115C) of stop lever raises and blocks the pickup arm return lever which at this moment is held back by the cycling slide. 4. As the cycling slide moves back, it carries the raised trip slide along until finally the formed end (139A) of the trip slide pushes reject lever which in turn actuates the power switch (110). This removes the power from the drive motor and mechanism stops. 5. The elevating rod (124) lowers the pickup arm to the rest. 45 R.P.M. CENTERPOST For playing of 45 r.p.m. records which have a 11/2 inch center hole, the 45 r.p.m. centerpost is placed over the 1/4 inch centerpost. The push -off finger (84A), which is part of the inch centerpost actuates the slide (24), this slide actuates the separator knives (25A & 25B) and separator shelves (26A & 26B) of the 45 r.p.m. centerpost. As the push -off finger moves up it engages a finger (24B) of the slide (24) in the 45 r.p.m. centerpost; and, as it moves horizontally, it pushes the slide against the tension of the slide return spring (27). A projecting pin (24C) on the bottom of the slide engages both shelves and both knives and forces them to turn on their pivots. The shelves are pivoted near their center and are caused to retract as the slide is forced to move by the push -off finger. The knives are pivoted at their ends and are forced outward at the same time that the shelves are retracted. A formed spring (28) returns the shelves to the extended position. STABILIZING ARM 1 STOP ARM 56A 137 .11149 Figure 19 STOP LEVER 115 120 PICKUP ARM RETURN LEVER 115C STOP LEVER 115 115B STOP LEVER SLIDING OFF ESCAPE LEVER 141A REJECT LEVER 109 / POWER / SWITCH 110 Figure 20 FORMED END 139A 115A PICKUP ARM RETURN LEVER 120 STRIP SLIDE 139 115C 1158 Figure 21 CYCLING SLIDE 141 SPRING Figure 23 SEPARATOR SHELF PIVOT 7 SEPARATOR SHELF Figure 24 21 TO 34 SEE FIG. 26 5 TO 20 SEE FIG. 32 MOTOR SEE FIGS. 29,30,31 E47912 84 TO 148 SEE FIG. 27 Fig. 25-Exploded View of Mechanism 8 ILL. STOCK NO. NO. REPLACEMENT PARTS DESCRIPTION 7) 930409 Series 1 76913 Stabilizer-Record stabilizer-plum-complete with plastic cap for 930409-3, -4, -5, -6, -9 and -11 1 76914 Stabilizer-Record stabilizer-beige-complete with plastic cap for 930409-10 1A 75804 Cap-Plastic cap-maroon-for record stabilizer for 930409-3, -4, -5, -6, -9 and -11 IA 75805 Cap-Plastic cap-beige-for record stabilizer for 930409-10 2 77118 Turntable-Turntable and hub assembly-maroon flock. 2 77119 Turntable-Turntable and hub assembly-tan flock-for 930409- 10 3 4 - -- 76905 Nut -1/4-28 hex nut (jam) for pickup arm bracket Loacrkmwasshhaefrt- 1/4 external type lockwcuiher for pickup 35 76941 Housing-Record stabilizer housing-plum-Type "A" (see Paget) for 930409-3, -4, -5, -6, -9 and -11 35 77256 Housing-Record stabilizer housing-plum-Type "B" (see Page 2) 35A 77257 Spring-Record stabilizer return spring for use with Type "B" record stabilizer housing 35 36 ---76942 Housing-Record stabilizer housing--beige-for 930409-10 Motorboard -Motorboaxd -complete 37 38 ---74782 Emblem-"RCA Victor" emblem Screw-#10-24 x 34" binding head machine screw and internal lockwasher 39 75829 Housing-Pickup arm pivot shaft housing-plum -for 930409-3, -4, -5, -6, -9 and -11 39 75873 Housing-Pickup arm pivot shaft housing-beige- for 930409-10 40 76915 Knob-Reject control knob and shaft-maroon- for 930409-3, -4, -5, -6, -9 and -11 40 76916 Knob-Reject control knob and shaft-beige-for 930409-10 41 75827 Rest-Pickup arm rest (maroon) for 930409-3, -4, -5, -6, -9 and -11 41 75828 Rest-Pickup arm rest (beige) for 930409-10 42 43 ---76937 Knob-Motor speed control knob and shaft Screw-#6-32 x 1/4" hex head screw 44 45 46 ------75385 Washer-"C" washer to mount record stabilizer Clamp-Cable clamp Screw-Screw for mounting cable clamp 47 75830 Screw- # 10 x 1/2 cross recessed pan head screw to 48 --- mount pickup arm rest Screw- # 6-32 x 1/4" hex head screw 49 76920 Rod-Motor speed control rod 50 77229 Grommet-Rubber grommet for motor speed control rod 51 76918 Lever-Motor speed control lever 52 76919 Rod-"On-Off"-"Reject" rod 53 75825 Washer-"C" washer for motor speed control knob and shaft 54 76917 Lever-Switch control lever 55 77227 Nut-Pal nut for reject control knob and shaft 56 76927 Arm-Stop arm assembly 57 58 ---76926 Spring-Return spring (coil type) for stop arm (t/8" I.D. x 19/32) Screw -6-32 x 5/16" cross recessed round head screw 77 75876 Washer-"C" washer to mount motor 78 76925 Spring-Spring for 45 r.p.m. centerpost housing hinge pin 79 76922 Lid -45 r.p.m.centerpost housing lid-maroon-for 930409-3, -4, -5, -6, -9 and, -11 79 76923 Lid -4S r.p.m. centerpost housing lid-beige-for 930409-10 80 81 ---76921 Housing -45 r.p.m. centerpost housing well-less lid and rubber bumper Screw- # 10-32 x 3/16" cross recess pan head screw to mount 45 r.p.m. centerpost housing 82 76924 Pin-Hinge pin for 45 r.p.m. centerpost housing lid 83 147 ---76940 Bumper -45 r.p.m. centerpost housing rubber bumper Screw- # 10-24 x 34" binding head machine screw and internal lockwasher n- 45 RPM CENTERPOST ASSEMBLY 76945 Centerpost-45 r.p.m. centerpost complete 76928 Cap-Nose cap 22 76930 Spring-Nose spring (formed) 23 76909 Screw- # 4-40 x 1/4" cross recessed binding head screw for nose spring 24 76933 Plate-Slider plate assembly complete with springs 24A 25 76932 Knife-Record separator knife (1 set) 26 76931 Shelf-Record support shelf (1 set) 27 76934 Spring-Slider return spring (coil type -2 in 1) 28 29 ---76935 Spring-Shelf return spring (formed) Body-Spindle body assembly 30 31 ---76936 Screw-#4-40 x 7/s" fillister head screw for nose cap Rotor-Die-cast rotor 32 33 ---76954 Spring-Rotor lift spring (coil) (1.168" O.D. x 1"4-5 turns) Lift-Rotor lift 34 76929 Bearing-Bottom bearing 9 Fig, 26-45 rp.m. Centerpost Assembly 72 930409 Series D 0 0 in Jon ;Iwo 0 -04 0 0 0 C S C) II C 115 135 C D-48806 Refer to Fig. 28 on page 11 for changes in late production: Item 85 Frame 119 Washer 120 Lever 121 Retainer moo C;10 147 Fig. 27-Slide Assembly 10 REPLACEMENT PARTS (Cont.) 73 930409 Series Late production record changers use a revised frame (Item 85) and pickup arm lever (Item 120). These items are not directly interchangeable but may be interchanged in a group as listed below. Item No. 85 119 120 121 Early Part 76910 75848 75849 75850 Late Part 78635 Not used 78636 78637 Description Frame Washer Lever Retainer Frames may be identified by a number which is cast into the frame (see Fig. 28 below). Early frame is identified by number "2525". Late frame is identified by number "6425". Levers may be identified by having or not having a bearing collar staked to the lever (see Fig. 28 below). Early lever does not have staked collar. Late lever does have staked collar. Retainers may be identified by size. Early retainer is .312" I. D. Late retainer is .390" I. D. STOCK NO. 76 910 STOCK NO. 78635 STOCK NO. '18630 STOCK NO. 1 5849 MS 1522 Fig. 28-Alternate Slide Plate Frame ILL. STOCK NO. NO. DESCRIPTION SLIDE ASSEMBLIES 84 76904 Certterpost-331/2-78 r.p.m. centerpost complete with bearing 85 76910 Frame-Main frame-(die-cast) 86 75373 Washer-"C" washer for mounting cycling gear 87 75845 Washer-Fibre washer for mounting cycling gear 88 75397 Washer-"C" washer for 12" indexing lever 89 75844 Lever -12' record indexing lever 90 76309 Spring -12" record indexing lever spring 91 76903 Washer-Pickup thrust washer (fibre) 92 75841 Nut-Speed nut for 12" indexing lever return spring 93 94 95 75842 Spring -12" indexing lever return spring (formed) --- Bracket-Muting switch bracket --- Screw- # 4-40 x 1/4" hex head (indented) thread cutting screw to mount muting switch assembly 96 97 ---77191 Switch-Muting switch-less mounting bracket Terminal- # 4 locking terminal for muting switch 98 --- assembly Screw- # 3-48 x 13/32" binding head machine screw 99 --- for muting switch Nut -1/2-20 pal nut for mounting 331/2-78 r.p.m. spindle 100 101 102 ---75864 --- Arm-Lift arm Screw- # 10-24 x 3/k" binding head machine screw and internal lockwasher Screw- # 10-24 x %" binding head machine screw and internal lockwasher 103 75859 Lever-Landing selector lever 104 75860 Spring-Return spring (coil type) for landing se- 105 --- lector lever (.110" O.D. x %"-14 turns) Washer-Metal washer (steel) (1/32" x 7/16" O.D. 106 --- x .140) Screw-#6-32 x 1/4" hex head screw 107 76312 Spring-Reject spring (special) 108 75392 Washer-"C" washer for mounting reject lever 109 75856 Lever-Reject lever 1111101t- 75857 Switch-"On-Off" switch complete with insulating strip (111) and cover (112) 112, 113 76908 Retainer-Switch 114 76314 Sp-r1in4gt-uRrentsu)rn spring (coil type) (.125" O.D. x 7/16" 115 76313 Lever-Stop lever 116 77258 Strip-Bearing strip for stop lever shaft 117 76912 Nut-Speed nut for mounting stop lever bearing shafts 118 76944 Spring-Pickup arm return lever spring (coil) (.593" 0.D.-31/2 turns) 119 75848 Washer-Fibre washer for pickup arm pivot shaft 120 75849 Lever-Pickup arm return lever 121 75850 Retainer-Retaining ring for pickup arm return lever 122 76952 Nut-Elevating rod adjustment nut 123 76951 Rod-Elevating rod 124 76946 Shaft-Pickup arm pivot shaft and lever 125 76906 Spring-Thrust spring (conical) for elevating rod 126 77269 Ring-Retaining ring 127 75397 Washer-"C" washer 128 76309 Spring-Trip pawl spring 129 77250 Pawl-Trip pawl-upper 129A 77249 Spring-Trip pawl cushion spring (coil) 130 76955 Gear-Cycling gear complete with shaft and en- gagement pawl 130A 131 76953 Pawl-Trip pawl-lower 132 76900 Bumper-Rubber bumper for 10' indexing lever 133 76901 Lever -10" indexing lever 134 135 ---76314 Spring-Return spring (coil type) (.125" O.D. x 7/16" -14 turns) Washer-Metal washer (steel) (1/32" x 7/16" O.D. 136 --- x .140) Screw- # 6-32 x 1/4" hex head screw 137 75862 Link-Control link 138 75397 Washer-"C" washer 139 76950 Slide-Trip slide 140 75861 Spring-Escape lever spring (coil) (.120" O.D. x 1/2" -21 turns) 141 76956 Slide-Cycling slide and cam assembly-less escape lever spring 142 77228 Spring-Stabilizing spring (coil) for cycling slid* 143 --- (.146" O.D. x 3/4"-141/2 turns) Screw- # 6-32 x 1/4" hex head screw 144 75872 Plate-Bearing plate for cycling slide 145 146 - -- 76897 Washer-Metal washer (brass) for cycling slide Screw- # 6-32 x 1/4" hex head screw 14C1 77934 Spring-Slide detent spring 11 74 930409 Series REPLACEMENT PARTS (Cont.) ILL. STOCK NO. NO. DESCRIPTION MOTOR ASSEMBLIES Motors Stamped: 5046-for 930409-3 & -6 5355-for 930409-5 & -10 5047-for 930409-9 5432-for 930409-11 59 76744 Spring-Hairpin spring for idler wheel 60 76743 Washer-Flat metal washer 61 76750 Wheel-Idler wheel 62 77132 Plate-Drive pulley mounting plate complete with three pulleys 62A 76746 Pulley -78 r.p.m. pulley 62B 76747 Pulley -45 r.p.m. pulley 62C 76748 Pulley -33 1/3 r.p.m. pulley - 63 Screw-Screw to mount drive pulley plate - 64 Lockwasher-Lockwasher for pulley plate screw 65 77685 Lever-Speed shift lever for #5046, #5047,and #5432 motors (930409-3. -6. -9 and -11) 65 77133 Lever-Speed shift lever for #5355 motor (930409-5 and -10) 66 77229 Grommet-Rubber grommet for speed shift lever 67 75432 Spring-Hairpin spring for idler wheel plate and support 68 Plate-Idler wheel slide plate and support assembly 69 78374 Spring-Slide plate tension spring 70 76751 Grommet-Rubber grommet for motor mounting 71 76743 Washer-Slide plate bearing washer (metal) 72 76749 Sleeve-Spring sleeve pulley for 60 cycle operation 72 77686 Sleeve-Spring sleeve pulley for 50 cycle operation f-o9ramndoto-Irls)#5432, #5046 and #5047 (930409-3, -6, - 73 30870 Connector -2 prong male connector 74 Motor-Motor assembly complete (Refer to page 13) 75 76755 Spring-Detent spring for speed shift lever 76 77134 Collar-Collar for speed shift lever mounting Iteamnd68knduiscckolnetijnouiendt.aUssseemStbolcyk dNeos.c7r8ib3e7d1 atotpripglhatte. Two other types of motors have been used as alter- nates for the above listed motors. See page 13. "WOW" OR SLOW SPEED"Wow" or slow speed is generally most noticeable in the 33 1/3 RPM position but may also occur on the 45 RPM and 78 RPM positions. The most frequent causes of "wow" and slow speed are listed below. It is suggested that all these items be checked when servicing changers. A. CHANGERS USING IDLER WHEEL SLIDE PLATE TYPE MOTOR ASSEMBLIES 1. PIN IN SLIDE PLATE RESTRICTS MOVEMENT OF SLIDE PLATE. This prevents idler wheel from making firm contact with turntable rim. TO CORRECT-Remove pin from slide plate and discard-remove all burrs from around the hole after pin is removed. 2. BIND IN IDLER WHEEL SLIDE PLATE. The slide plate must be completely free to move its full travel without binding. It must be flat and without burrs or scratches. TO CORRECT-Straighten slide plate if necessary. Remove any burrs on slide plate. Thoroughly clean slide plate and slots of casting with carbon tetrachloride. Lubricate slide plate with STA-PUT #320 to assure ample lubrication at all slide contact surfaces. 3. OIL ON RUBBER TIRES. TO CORRECT-Wash all rubber tires with carbon tetrachloride. Do not handle with oily fingers. 4. IDLER WHEEL TENSION SPRING TOO LONG. TO CORRECT-Remove turns if necessary-there should be only 18 active turns. It may be necessary to remove as much as 5 turns. Stock No. 78374 spring should be used for replacement. B. IDLER WHEEL TOP PLATE AND KNUCKLE -JOINT ASSEMBLY, STOCK NO. 78371 If the procedure in section "A" does not prove completely satisfactory for critical applications, the original slide plate assembly may be replaced with the idler wheel top plate and knuckle -joint assembly, Stock No. 78371 using the following procedure: Disassembly 1. Remove turntable "C" washer and lift turntable up. 2. Remove idler wheel, two fiber washers, and hair pin retainer spring. (Items 59, 60, 61). 3. Remove motor (held by three "C" washers) (Item 77) from changer and disengage the speed shift linkage rod (Item 49). Transfer of Usable Parts 1. Transfer rubber mounting grommets (Item 70) from old plate to new plate. 2. Remove motor top plate (held by three screws to motor laminations). Motor bearings are loose and must be kept intact during the transfer of plates. 3. Remove detent spring (Item 75) from detent lever on bottom surface of old top plate and transfer this spring to corresponding location on new plate. 4. Transfer the idler speed -changer mounting plate and speed -shift lever from old plate to new plate. (Held by screw, washer, and collar.) 5. Assemble new plate to motor laminations. Make sure motor bearings are properly positioned and that armature is free after screws are tightened. Fig. 29-Assembly of Motors Stamped 5046, 5047, 5355 and 5432 Assembly of New Top Plate 1. Engage speed shift linkage rod, and re -assemble motor to changer. 2. Install idler wheel with fiber washers, top and bottom, and hair pin retainer spring to knuckle -joint lever, applying not more than one drop of STA-PUT #320 lubricant to the idler wheel bearing. 3. Thoroughly clean surface of idler wheel, pulleys on speed change plate, upper end of motor shaft, and inner rim of turntable with carbon tetrachloride to remove all traces of oil and grease. 4. Replace turntable and retaining "C" washer, making sure that idler wheel is pressed inward under the turntable before seating the turntable, to avoid damage to the idler or knuckle -joint assembly. 12 ILL. STOCK NO. NO. DESCRIPTION MOTOR ASSEMBLIES Stamped: 5685-for 930409-9 5686-for 930409-5 & -10 5687-for 930409-11 1 76750 2 75433 3 76744 4 78645 5 78646 6 78647 7 78648 8 9 78374 10 11 12 76751 13 30870 14 76755 15 77134 16 78371 17 76749 17 77686 18 77685 19 77229 20 77132 20A 76748 20B 76747 20C 76746 20D 75428 20E 75427 - 21 - 22 460A001 78372 78373 Wheel-Idler wheel Washer-Fibre washer Retainer-Idler wheel retainer (hairpin spring) Support-Idler wheel support Retainer-Support retainer (hairpin spring) Washer-Bearing washer Link-Idler wheel support link Spacer-Metal spacer for link mounting Spring-Idler wheel tension spring Screw-Screw for mounting plate Lockwasher-Lockwasher for mounting plate Grommet-Rubber grommet for motor mounting Plug-Two (2) prong male plug Spring-Detent spring Collar-Speed shift lever collar (nut) Plate-Mounting plate assembly includes items 4, 5, 6, 7, 8, and 9 Sleeve-Spring sleeve pulley for 60 cycle operation of #5685, #5686 and #5687 Sleeve-Spring sleeve pulley for 50 cycle operation of #5685 and #5687 Lever-Speed shift lever Grommet-Rubber grommet for shift lever Plate-Speed pulley mounting plate with 3 pulleys Pulley -33 1/3 r.p.m. speed pulley Pulley -45 r.p.m. speed pulley Pulley -78 r.p.m. speed pulley Washer-Felt washer Retainer-Retainer for speed pulleys Screw-Screw for mounting pulley plate Lockwasher-Lockwasher for pulley plate Motor-Motor assembly (#5685) COMPLETE for 230 volts, 50 cycles Motor-Motor assembly (#5686) with mounting plate and idler support-LESS idler wheel, speed shift lever and pulley mounting plate for 115 volts, 60 cycles. Motor-Motor assembly (#5687) COMPLETE for 115 volts, 50 cycles. 75 ILL. STOCK NO. NO. 930409 Series DESCRIPTION MOTOR ASSEMBLIES Stamped 4638-for 930409-3,-5,-6,-10 and -11 1 78508 Wheel-Idler wheel with fibre washer 2 78509 Washer-Fibre washer 3 78510 Washer-Felt washer 4 78511 Washer-"C" washer 5 78512 Spring-Idler spring 6 Screw-Holddown plate mounting screw 7 Lockwasher-Holddown plate mounting screw lock - washer 8 78513 Plate-Holddown plate 9 78514 Grommet-Motor mounting grommet 10 78515 Washer-Blued steel washer 11 78516 Plate-Idler plate assembly 12 78517 Link-Idler link 13 78518 Arm-Pulley plate latch arm 14 78519 Spring-Pulley latch spring 15 78520 Spring-Shifter latch spring 16 78521 Lever-Latch arm lever 17 78522 Sleeve-Spring sleeve pulley for 60 cycle operation 17 78523 Sleeve-Spring sleeve pulley for. SP. cycle operation 18 78524 Plate-Speed pulley mounting plate -less pulleys 18A 78525 Pulley -33 1/3 r.p.m. pulley 18B 78526 Pulley -45 r.p.m. pulley 18C 78527 Pulley -78 r.p.m. pulley 18D 78528 Washer-Speed pulley fibre washer 19 78529 Lever-Speed shift lever 20 78530 Grommet-Speed shift lever grommet 21 30870 Plug -2 prong male plug 78531 Motor-Motor assembly COMPLETE-less mounting grommets and plug-for 115 volts, 60 cycles. MOTOR ASSEMBLIES Motor Stamped: 5191-for 930409-4 Order by description Fig. 30- Assembly of itlotors Stamped 5685; 5686 and 5687 13 Fig. 3I- Assembly of Motor Stamped 4638 76 930409 Series ILL. STOCK NO. NO. REPLACEMENT PARTS (Cont.) DESCRIPTION ILL. STOCK NO. NO. DESCRIPTION 10 S-5652 10 75044 10A 75046 10B 75045 10C 75274 10 162A001 10A 490B001 10B 490A001 10 75475 10 77779 10A 75497 10B 75496 108 77899 IOC 74230 5 76902 6 76898 PICKUP ASSEMBLIES For 930409-3 and 930409-9 Pickup-Ceramic pickup complete with two styli -for 930409-3 Pickup-Crystal pickup complete with two styli -for 930409-9 Stylus-Osmium tip stylus art.i holder (.003" r., uncoded) for 78 r.p.m. Stylus-Osmium tip stylus and holder (.001" r., coded red) for 45-331/4 r.p.m. Nut-Knurled nut to mount stylus PICKUP ASSEMBLIES For 930409-4 and 930409-6 Pickup-Ceramic pickup complete with two styli Stylus-Osmium tip stylus (.003" r., uncoded) for 78 r.p.m. Stylus-Osmium tip stylus (.001" r., coded red) for 45-331/3 r .p.m . PICKUP ASSEMBLIES For 930409-5, 930409-10 and 930409-11 Pickup-Crystal pickup complete with two osmium styli Pickup-Crystal pickup complete with one osmium stylus and one sapphire stylus Stylus-Osmium tip stylus (.003" r., uncoded) for 78 r.p.m. Stylus-Osmium tip stylus (.001" r., coded red) for Sty45lu-3s3-S1a/3ppr.hpi.rme.tip stylus (.001" r., coded red) for 45-33 1/3 r.p.m. Nut-#00-112 nut arid washer to mount stylus PICKUP ARM ASSEMBLIES Knob-Stylus selector knob less screw Screw-#2-56 x 3/16" headless set screw for stylus selector knob 7 76949 Arm-Pickup arm shell (plastc) for 930409-5, -10 and -11 7 100A001 Arm-Pickup arm shell (plastic) for 930409-3, -4, -6 and -9 7A 76948 Screw-Pickup arm mounting bracket pivot screw 713 76947 Bearing -- Pickup arm mounting bracket pivot bearing 8 75808 Cable-Three (3) wire pickup cable complete with connectors for 930409-5, -10 .:nd -11 8 163A001 Cable --Three (3) wire pickup cable complete with connectors for 930409-3. -4. -6 and -9 9 Screw -.4-40 x ,,i," fillister head screw to mount pickup cartridge 11 76957 Swivel --Pickup cartridge mount and swivel assembly for 930409-5, -10 and -11 11 130A001 Swivel-Pickup cartridge mount and swivel assem- bly for 930409-3, -4, -6 and -9 12 75809 Spring --Pickup arm counterbalance spring 13 75810 Bracket-Pickup arm weight adjustment bracket (slide) 14 76899 I Screw --v6-32 x !4" round head screw for pickup arm weight adjustment bracket 15 76896 Screw -.4 x 1/4" binding head sheet metal screw to mount swivel assembly in arm 16 75812 Spring-Lock spring (coil type) for height adjust - ment screw 17 75813 Screw --Height adjustment screw (hex head - .5-40 thread) 18 76943 Spring -Tension spring (coil) for landing adjust - ment stud 19 76911 Cam- Landing adjustment cam 20 76907 Bracket- Pickup arm mounting bracket complete with pin 20A 75816 Stud --Landing adjustment stud (eccentric) 20B 75818 Nut - Speed nut for landing adjustment stud APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS Pickup Stock No. S-5652 Fig. 32 --Pickup Arm Assembly for 930409-5 and -10 14 Pickup Stock No. 162A001 77 RCAVICTOR Model 17T150 "Colby" Mahogany Finish Metal TELEVISION RECEIVERS MODELS 1711501 17T151, 171163 Chassis No. KCS66C - Mfr. No. 274 - SERVICE DATA -1952 No. T1- Model 17T151 "Glentide" Mahogany Grained Metal Model 17T163 "Cra/ton" Walnut, Mahogany, Limed Oak PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. GENERAL DESCRIPTION Models 17T150, 17T151, and 17T163 are deluxe "17 inch" television receivers. The receivers are identical except for cabinets, and speakers. Features of the television unit are: full twelve channel coverage; "totem" r -f amplifier; intercarrier FM sound system; ratio detector; 40 mc picture i-f; improved picture brilliance; pulsed picture A -G -C; A -F -C horizontal hold; stabilized vertical hold; compensated video gain control; noise saturation circuits; improved sync separator and clipper; four mc. band width for picture channel and reduced hazard high voltage supply. An auxiliary audio input jack is provided to permit -the use of an external record playing attachment. ELECTRICAL AND MECHANICAL SPECIFICATIONS PICTURE SIZE 146 square inches on a 17QP4 Kinescope TELEVISION R -F FREQUENCY RANGE All 12 television channels, 54 mc. to 88 mc., 174 mc. to 216 mc. Picture I -F Carrier Frequency Sound I -F Carrier Frequency 45.75 mc. .41.25 mc. and 4.5 mc. VIDEO RESPONSE To 4 mc. SWEEP DEFLECTION Magnetic FOCUS Magnetic POWER SUPPLY RATING KCS66C 115 volts, 60 cycles, 190 watts AUDIO POWER OUTPUT RATING KCS66C 5 0 watts max. CHASSIS DESIGNATIONS KCS66C In Models 17T150, 17T151 & 17T163 LOUDSPEAKERS Model 17T150 (971614-1) 4"x6" PM Dynamic, 3.2 ohms Models 17T151 & 17T163 (971490-2) 8" PM Dynamic, 3.2 ohms WEIGHT Model Chassis with Tubes in cabinet Shipping Weight 17T150 17T151 17T163 88 lbs. 88 lbs. 95 lbs. 103 lbs. 103 lbs. 115 lbs. RECEIVER ANTENNA INPUT IMPEDANCE Choice: 300 ohms balanced or 72 ohms unbalanced. RCA TUBE COMPLEMENT Tube Used Function RCA 6BQ7 R -F Amplifier RCA 6X8 R -F Oscillator and Mixer RCA 6AU6 1st Picture I -F Amplifier RCA 6CB6 2nd Picture I -F Amplifier RCA 6CB6 3rd Picture I -F Amplifier RCA 6CB6 4th Picture I -F Amplifier RCA 6AG7 Video Amplifier RCA 6AU6 1st Sound I -F Amplifier RCA 6AU6 2nd Sound I -F Amplifier RCA 6AL5 Ratio Detector RCA 6AV6 1st Audio Amplifier RCA 6AQ5 Audio Output RCA 6CB6 AGC Amplifier (14) RCA 6SN7GT Sync Separator (15) RCA 6SN7GT. Vert Sync Amplifier and Vert Sweep Osc. (16) RCA 6AQ5 Vertical Sweep Output (17) RCA 6SN7GT Horizontal Sync Amplifier (18) RCA 6SN7GT .Horizontal Sweep Oscillator and Control (19) RCA 6BQ6GT Horizontal Sweep Output (20) RCA 6W4GT Damper (21) RCA lB3-GT/8016 High Voltage Rectifier (22) RCA 17QP4 Kinescope 78 17T150, 17T151, 17T163 ELECTRICAL AND MECHANICAL SPECIFICATIONS (Continued) PICTURE INTERMEDIATE FREQUENCIES Picture Carrier Frequency Adjacent Channel Sound Trap Accompanying Sound Traps Adjacent Channel Picture Carrier Trap 45.75 mc. 47.25 mc. 41.25 mc. 39.25 mc. SOUND INTERMEDIATE FREQUENCIES Sound Carrier Frequency 41.25 mc. and 4.5 mc. VIDEO RESPONSE To 4 mc. FOCUS Magnetic SWEEP DEFLECTION. Magnetic SCANNING Interlaced, 525 line HORIZONTAL SWEEP FREQUENCY 15,750 cps VERTICAL SWEEP FREQUENCY 60 cps FRAME FREQUENCY (Picture Repetition Rate) .30 cps OPERATING CONTROLS (front Panel) Channel Selector t Fine Tuning Picture t Brightness Picture Horizontal Hold Picture Vertical Hold Sound Volume and On -Off Switch t Tone Control and Phono Switch S Dual Control Knobs Dual Control Knobs Dual Control Knobs Dual Control Knobs NON -OPERATING CONTROLS (not including r -f and i-f adjustments) Picture Centering Width top chassis adjustment rear chassis adjustment Height rear chassis adjustment Horizontal Linearity rear chassis screwdriver adjustment Vertical Linearity rear chassis adjustment Vertical Peaking Control. rear chassis adjustment Horizontal Drive rear chassis screwdriver adjustment Horizontal Oscillator Frequency Horizontal Oscillator Waveform Horizontal Locking Range Focus Ion Trap Magnet . rear chassis adjustment bottom chassis adjustment rear chassis adjustment top chassis adjustment top chassis adjustment Deflection Coil AGC Control top chassis wing nut adjustment rear chassis adjustment HIGH VOLTAGE WARNING OPERATION OF THIS RECEIVER OUTSIDE THE CABINET OR WITH THE COVERS REMOVED, INVOLVES A SHOCK HAZARD FROM THE RECEIVER POWER SUPPLIES. WORK ON THE RECEIVER SHOULD NOT BE ATTEMPTED BY ANYONE WHO IS NOT THOROUGHLY FAMILIAR WITH THE PRECAUTIONS NECESSARY WHEN WORKING ON HIGH VOLTAGE EQUIPMENT. DO NOT OPERATE THE RECEIVER WITH THE HIGH VOLTAGE COMPARTMENT SHIELD REMOVED. KINESCOPE HANDLING PRECAUTIONS DO NOT REMOVE THE RECEIVER CHASSIS, INSTALL, REMOVE OR HANDLE THE KINESCOPE IN ANY MANNER UNLESS SHATTERPROOF GOGGLES, AND HEAVY GLOVES ARE WORN. PEOPLE NOT SO EQUIPPED SHOULD BE KEPT AWAY WHILE HANDLING KINESCOPES. KEEP THE KINESCOPE AWAY FROM THE BODY WHILE HANDLING. The kinescope bulb encloses a high vacuum and, due to its large surface area, is subjected to considerable air pressure .For this reason, the kinescope must be handled with more care than ordinary receiving tubes. The large end of the kinescope bulb-particularly that part at the rim of the viewing surface-must not be struck, scratched or subjected to more than moderate pressure at any time. During service if the tube sticks or fails to slip smoothly into its socket, or deflecting yoke, investigate and remove the cause of the trouble. Do not force the tube. Refer to the Receiver Installation section for detailed instructions on kinescope installation. All RCA replacement kinescopes are shipped in special cartons and should be left in the cartons until ready for installation in the receiver. 2 OPERATING INSTRUCTIONS 79 17T150, 17T151, 17T163 The following adjustments are necessary when turning the receiver on for the first time. 8. Adjust the PICTURE and BRIGHTNESS controls for suitable picture contrast and brightness. 1. See that the TV -PH switch is in the "TV" position. 2. Turn the receiver "ON" and advance the SOUND VOLUME control to approximately mid -position. 3. Set the STATION SELECTOR to the desired channel. 4. Adjust the FINE TUNING control for best pix and the SOUND VOLUME control for suitable volume. 9. In switching from one channel to another, it may be necessary to repeat steps 4 and 8. 10. When the set is turned on again after an idle period it should not be necessary to re peat the adjustment if the positions of the controls have not been changed. If any adjustment is necessary, step number 4 is generally sufficient. 5. Turn the BRIGHTNESS con- trol fully counter -clockwise, then clockwise until a light pattern appears on the screen. 6. Adjust the VERTICAL hold control until the pattern stops vertical movement. 7. Adjust the HORIZONTAL VERT CAL hold control until a picture is HOLD obtained and centered. HORIZONTAL HOLD BRIGHTNESS PICTURE ON -OFF TONE .13103 SOUND PI PHONO VOLUME SWITCH STATION SELECTOR 11. If the positions of the controls have been changed, it may be necessary to repeat steps 2 through 8. 12. To use a record player, plug the record-player output CHANNEL NO. cable into the PHONO jack on the rear apron, and set the FINE TV -PH switch to "PH". TUNING Figure 1-Receiver Operating Controls INSTALLATION INSTRUCTIONS UNPACKING.-These receivers are shipped complete in cardboard cartons. The kinescope is shipped in place in the receiver. Take the receiver out of the carton and remove all packing material. Make sure that all tubes are in place and are firmly seated in their sockets. Check to see that the kinescope high voltage lead clip is in place. Plug a power cord into the 115 volt a -c power source and into the receiver interlock receptacle. Turn the receiver power switch to the "on" position, the brightness control fully clockwise, and the picture control counter -clockwise. ION TRAP MAGNET ADJUSTMENT.-Set the ion trap magnet approximately in the position shown in Figure 2. Starting from this position immediately adjust the magnet by moving it forward or backward at the same time rotating it slightly around the neck of the kinescope for the brightest raster on the screen. Reduce the brightness control setting until the raster is slightly above average brilliance. Turn the focus control (shown in Figure 2) until the line structure of the raster is clearly visible. Readjust the ion trap magnet for maximum raster brilliance. The final touches of this adjust- ment should be made with the brightness, control at the maximum clockwise position with which good line focus can be maintained. PIN -CUSHION CORRECTION FOCUS MAGNET MAGNET MOUNTING SCREW KINESCOPE SOCKET ION TRAP MAGNET DEFLECTION YOKE ADJUSTMENT.-If the lines of the raster are not horizontal or squared with the picture mask, rotate the deflection yoke until this condition is obtained. Tighten the yoke adjustment wing screw. PICTURE ADJUSTMENTS.-It will now be necessary to obtain a test pattern picture in order to make further adjustments. Connect the antenna transmission line to the receiver. If the Horizontal Oscillator and AGC System are operating properly, it should be possible to sync the picture at this point. However, if the AGC control is misadjusted, and the receiver is overloading, it may be impossible to sync the picture. If the receiver is overloading, turn R175 on the rear apron (see Figure 3) counter -clockwise until the set operates normally and the picture can be synced. CHECK OF HORIZONTAL OSCILLATOR ALIGNMENT.-Turn the horizontal hold control to the extreme counter -clockwise position. The picture should remain in horizontal sync. Momentarily remove the signal by switching off channel then back. Normally the picture will be out of sync. Turn the control clockwise slowly. The number of diagonal black bars will be gradually reduced and when only 2 or 3 bars sloping downward to the left are obtained, the picture will pull into sync upon slight additional clockwise rotation of the control. Pull -in should occur before the control has been turned 120 degrees from the extreme counter -clockwise position. The picture should remain in sync for approximately 90 R -F UNIT R214 VERTICAL LINEARITY CONTROL K I NE FOCUS CONTROL CENTERING ADJUSTMENT LOCK SCREW DEFLECTION YOKE NINE CUSHION CENTERING ADJUSTMENT LEVER Figure 2- Yoke and Focus Magnet Adjustments 3 R203 HEIGHT CONTROL R175 AGC CONTROL TI I3 HORIZONTAL 050 LLATOR FREQ. ADJ. C18,1B HORIZONTAL DRIVE \ L 107 HORIZONTAL LINEARITY CONTROL L106 WIDTH CONTROL 6 6 J103 J104 C18IA @ANON°. VIDEO © LONG INPUT JACK RANGE Figure 3-Rear Chassis Adjustments 80 17T150, 17T151, 17T163 INSTALLATION INSTRUCTIONS degrees of additional clockwise rotation of the control. At the extreme clockwise position, the picture should remain in sync and should not show a black bar in the picture. If the receiver passes the above checks and the picture is normal and stable the horizontal oscillator is properly aligned. Skip "Alignment of Horizontal Oscillator" and proceed with "Focus Magnet Adjustment." ALIGNMENT OF HORIZONTAL OSCILLATOR.-If in the above check the receiver failed to hold sync with the hold control at the extreme counter -clockwise position or failed to hold sync over 90 degrees of clockwise rotation of the control from the pull -in point it will be necessary to make the following adjustments. Horizontal Frequency Adjustment.-Turn the horizontal hold control to the extreme clockwise position. Tune in a television station and adjust the T113 horizontal frequency adjustment at the rear of the chassis until the picture is just out of sync and the horizontal blanking appears as a vertical or diagonal black bar in the raster. Then turn the T113 core until the bar moves out of the picture leaving it in sync. Horizontal Locking Range Adjustment.-Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T113 rear core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 3 bars are present just before the picture pulls into sync adjust the horizontal locking range trimmer C181A slightly clockwise. If less than 2 bars are present, adjust CI81A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 or 3 bars are present. Repeat the adjustments under "Horizontal Frequency Adjustment" and "Horizontal Locking Range Adjustment" until the conditions specified under each are fulfilled. When the horizontal hold operates as outlined under "Check of Horizontal Oscillator Alignment" the oscillator is properly adjusted. If it is impossible to sync the picture at this point and the AGC system is in proper adjustment it will be necessary to adjust the Horizontal Oscillator by the method outlined in the alignment procedure on page 11. For field purposes paragraph "B" under Horizontal Oscillator Waveform Adjustment may be omitted. FOCUS MAGNET ADJUSTMENT.-The focus magnet should be adjusted so that there is approximately three -eighths inch of space between the rear cardboard shell of the yoke and the flat of the front face of the focus magnet. This spacing gives best average focus over the face of the tube. The axis of the hole through the magnet should be parallel with the axis of the kinescope neck with the kinescope neck through the center of the opening. PIN CUSHION CORRECTION.-Two pin -cushion correction magnets are employed to correct a small amount of pin -cushion of the raster due to the lens effect of the face of the kinescope. These magnets are mounted on small arms, one on each side of the kinescope as shown in Figure 2. The arms hinge in one plane on self tapping screws which act both as a hinge and an adjustment locking screw. When the magnets are swung towards the tube, maximum correction is obtained. Minimum correction is obtained when the arms are swung away from the tube. To adjust the magnets, loosen the two self tapping screws and position the magnets until the sides of the raster appear straight. Tighten the screws without shifting the position of the magnets. In some cases it may be necessary to twist or bend the magnet support arms to obtain the appearance of straight raster edges. CENTERING ADJUSTMENT. -No electrical centering controls are provided. Centering is accomplished by means of a separate plate on the focus magnet. The centering plates include a locking screw which must be loosened before centering Up and down adjustment of the plate moves the picture side to side and sidewise adjustment moves the picture up and down. If a corner of the raster is shadowed, check the position of the ion trap magnet. Reposition the magnet within the range of maximum raster brightness to eliminate the shadow and recenter the picture by adjustment of the focus magnet plate. In no case should the magnet be adjusted to cause any loss of brightness since such operation may cause immediate or eventual damage to the tube. In some cases it may be necessary to shift the position of the focus ,magnet in order to eliminate a corner shadow. WIDTH, DRIVE AND HORIZONTAL LINEARITY ADJUSTMENTS.-Adjustment of the horizontal drive control affects the high voltage applied to the kinescope. In order to obtain the highest possible voltage hence the brightest and best focused picture adjust horizontal drive trimmer C181B counter -clockwise until the picture begins to "wrinkle" in the middle then clockwise until the "wrinkle" disappears. Turn the horizontal linearity control L107 clockwise until the picture begins to "wrinkle" on the right and then counterclockwise until the "wrinkle" disappears and best linearity is obtained. Adjust the width control L106 to obtain correct picture width. A slight readjustment of tliese three controls may be necessary to obtain the best linearity. Adjustments of the horizontal drive control affect horizontal oscillator hold and locking range. If the drive control was adjusted, recheck the oscillator alignment. HEIGHT AND VERTICAL LINEARITY ADJUSTMENTS.-Adjust the height control (R203 on chassis rear apron) until the picture fills the mask vertically. Adjust vertical linearity (R214 on rear apron) until the test pattern is symmetrical from top to bottom. Adjustment of either control will require a readjustment of the other. Adjust centering to align the picture with the mask. FOCUS. -Adjust the focus magnet for maximum definition in the test pattern vertical "wedge" and best focus in the white areas of the pattern. Recheck the position of the ion trap magnet to make sure that maximum brightness is obtained. Check to see that the yoke thumbscrew and the focus magnet mounting screws are tight. STATION SELECTOR FINE TUNING TO REMOVE ESCUTCHEON, SLIDE SPRING CLIP TO LEFT -OSCILLATOR ADJUSTMENT FOR CHANNEL NUMBER Figure 4-R -F Oscillator Adjustments CHECK OF R -F OSCILLATOR ADJUSTMENTS. - Tune in all available stations to see if the receiver r -f oscillator is adjusted to the proper frequency on all channels. If adjustments are required these should be made by the method outlined in the alignment procedure on page 9 The adjustments for channels 2 through 12 are available from the front of the cabinet by removing the station selector escutcheon as shown in Figure 4. Adjustment for channel 13 is on top of the chassis. AGC THRESHOLD CONTROL. -The AGC threshold control R175 is adjusted at the factory and normally should not require readjustment in the field. To check the adjustment of the AGC Threshold Control tune in a strong signal and sync the picture. Momentarily remove the signal by switching off channel and then back. If the picture reappears immediately, the receiver is not overloading due to improper setting of R175. If the picture requires an appreciable portion of a second to reappear, or bends excessively, R175 should be readjusted. 4 INSTALLATION INSTRUCTIONS 81 17T150, 17T151, 17T163 Turn R175 fully counter -clockwise. The raster may be bent slightly. This should be disregarded. Turn R175 clockwise until there is a very, very slight bend or change of bend in the picture. Then turn R175 counter -clockwise just sufficiently to remove this bend or change of bend. If the signal is weak, the above method may not work as it may be impossible to get the picture to bend. In this case, turn R175 clockwise until the snow in the picture becomes more pronounced, then counter -clockwise until the best signal to noise ratio is obtained. The AGC control adjustment should be made on a strong signal if possible. If the control is set too far clockwise on a weak signal, then the receiver may overload when a strong signal is received. FM TRAP ADJUSTMENT.-In some instances inter- ference may be encountered from a strong FM station signal. A trap is provided to eliminate this type of interference. To adjust the trap tune in the station on which the interference is observed and adjust the L58 core on top of the antenna matching transformer for minimum interference in the picture. CAUTION.-In some receivers, the FM trap L58 will tune down into channel 6 or even into channel 5. Needless to say, such an adjustment will cause greatly reduced sensitivity on these channels. If channels 5 or 6 are to be received, check L58 to make sure that it does not affect sensitivity on these two channels. Replace the cabinet back and connect the receiver antenna leads to the cabinet back. Make sure that the screws holding it are up tight, otherwise it may rattle or buzz when the receiver is operated at high volume. KINESCOPE SCREEN CLEANING.-The kinescope safety glass is held in place by four spring clips which may be removed from the back of the front panel. This permits removing the safety glass for cleaning without the necessity of removing the chassis and kinescope. CHASSIS REMOVAL.-To remove the chassis from the cabinet for repair or installation of a new kinescope, remove the control knobs, the cabinet back, unplug the speaker cable, the kinescope socket, the antenna cable, the yoke and high voltage cable. Take out the chassis bolts under the cabinet. Withdraw the chassis from the back of the cabinet. KINESCOPE HANDLING PRECAUTION.-Do not install, remove, or handle the kinescope in any manner, unless shatterproof goggles and heavy gloves are worn. People not so equipped should be kept away while handling the kinescope. Keep the kinescope away from the body while handling INSTALLATION OF KINESCOPE.-To remove the kinescope from the cabinet, loosen the two nuts and disengage the rods alongside the kinescope. Remove the wing screw which holds the yoke frame to the cabinet. Remove the kinescope, the yoke frame with yoke and focus magnet as an assembly. Handle this tube by the portion at the edge of the screen. Do not cover the glass bell of the tube with fingermarks as it will produce leakage paths which may interfere with reception. If this portion of the tube has inadvertently been handled, wipe it clean with a soft cloth moistened with "dry" carbon tetrachloride. INSTALLATION OF KINESCOPE.-Wipe the kinescope screen surface and front panel safety glass clean of all dust and fingermarks with a soft cloth moistened with "Windex" or similar cleaning agent. Replace the kinescope and chassis by reversal of the removing process. The kinescope should be installed so that the high voltage contact is to the right when looking at it from the rear of the cabinet. The magnet of the ion trap magnet should be to the left. CABINET ANTENNA.-A cabinet antenna is provided in model 17T163 receivers and the leads are brought out near the antenna terminal board. The cabinet antenna may be employed in place of the outdoor antenna in areas where the signals are strong and no reflecti6ns are experienced. ANTENNAS.-The finest television receiver built may be said to be only as good as the antenna design and installation. It is therefore important to select the proper antenna to suit the particular local conditions, to install it properly and orient it correctly. If two or more stations are available and the two stations are in different directions, it may be possible to make a compromise orientation which will provide a satisfactory signal on all such channels. If it is impossible to obtain satisfactory results on one or more channels, it may become necessary either to provide means for turning the antenna when switching channels or to install a separate antenna for one or more channels and to switch antennas when switching channels. In some cases, the antenna should not be installed permanently until the quality of the picture reception has been observed on a television receiver. A temporary transmission line can be run between receiver and the antenna, allowing sufficient slack to permit moving the antenna. Then, with a telephone system connecting an observer at the receiver and an assistant at the antenna, the antenna can be positioned to give the most satisfactory results on the received signal. A shift of direction or a few feet in antenna position may effect a tremendous difference in picture reception. REFLECTIONS.-Multiple images sometimes known as echoes or ghosts, are caused by the signal arriving at the antenna by two or more routes. The second or subsequent image occurs when a signal arrives at the antenna after being reflected off a building, a hill or other object. In severe cases of reflections, even the sound may be distorted. In less severe cases, reflections may occur that are not noticeable as reflections but that will instead cause a loss of definition in the picture. Under certain extremely unusual conditions, it may be possible to rotate or position the antenna so that it receives the cleanest picture over a reflected path. If such is the case, the antenna should be so positioned. However, such a position may give variable results as the nature of reflecting surfaces may vary with weather conditions. Wet surfaces have been known to have different reflecting characteristics than dry surfaces. Depending upon the circumstances, it may be possible to eliminate the reflections by rotating the antenna or by moving it to a new location. In extreme cases, it may be impossible to eliminate the reflection. INTERFERENCE.-Auto ignition, street cars, electrical machinery and diathermy apparatus may cause interference which spoils the picture. Whenever possible, the antenna location should be removed as far as possible from highways, hospitals, doctors' offices and similar sources of interference. In mounting the antenna, care must be taken to keep the antenna rods at least 1/4 wave length (at least 6 feet) away from other antennas, metal roofs, gutters or other metal objects. Short-wave radio transmitting and receiving equipment may cause interference in the picture in the form of moving ripples. In some instances it may be possible to eliminate the interference by the use of a trap in the antenna transmission line. However, if the interfering signal is on the same frequency as the television station, a trap will provide no improvement. WEAK PICTURE.-When the installation is near the limit of the area served by the transmitting station, the picture may be speckled, having a "snow" effect, and may not hold steady on the screen. This condition is due to lack of signal strength from the transmitter. RECEIVER LOCATION.-The owner should be advised of the importance of placing the receiver in the proper location in the room. The location should be chosen-Away from bright windows and so that no bright light will fall directly on the screen. (Some illumination in the room is desirable, however.) - To give easy access for operation and comfortable viewing. -To permit convenient connection to the antenna. -Convenient to an electrical outlet. -To allow adequate ventilation. 5 82 17T150, 17T151, 17T163 CHASSIS TOP VIEW TO ANTENNA TERMINALS T2 A NTENNA MATCHING TRANSFORMER 68V627 R- F AMP. ..---- V1 6 X B & MOSIXCE. R i.,.. "-- - k " 1'4/ A .I I -__-- ,., l'.--- /k,,` -- ,.,.\ . --,- . ., ,. , T1 I ,.:., - CONVERTER 1 1.1--/ 1 TRANSFORMER....i____4 FINE TUNING CONTROL SPEAKER CABLE CHANNEL SELECTOR SWITCH R203 HEIGHT CONTROL T102 RATIO OLT 2141 VERT. LiN. TRANS. viO3 6ALS RATIO DET. VIII 6C86 A GC AMP 5TH PIX viol 64u6 1sT sNo O TRANS. T*11S0. r. TAKE -OFF TRANS. TES NTT__ V112 65N7GT HOR. SYNC AMPLIFIER/ TP102 0 TEST POINT TP,01 V110 6 AG7 VIDEO MPLIFIE -41fiCitEkTONE 5101 CONTROL T108 4TH PIX I -F O TRANS. PHONO SWITCH 1088CEI6 vi07 D PiX I -F AMP T107 ECBR 2ND piX 1-F MP 3RToRPIAX NI -FS. ni-sci 2NOPIXO 1 -IF G ID TRANS. -11 .111 I 104 6 AVE AUDIO AMP. 11 L I 1i 11 .1 IL II --11- -JF-J 5102- R117 ON OFF SWITCH B. VOLUME CONTROL T 104 IST piX0 GRID TRANS. 105 6A05 AUDIO )UTPU R217 BRIGHTNESS CONTROL v116 \ I ESN 7GT NOR:SWEEP' OSC \CONTROL vii9 11330T/80.16 HIGH VOLTAGE v120 RECTIFIER 6W4GT1 DAMPER. c113 6N7GT SYNC. SEPARATOR R167 PICTURE CONTROL T112 POWER TRANSFORMER 6A10155 V RT.SW EP OUTPUT L108 FILTER CHOKE Till VERTICAL SWEEP OUTPUT TRANSFORMER R167 PICTURE CONTROL R 201A VERTICAL HOLD CONTROL V114 6SN7GT VERT. SYNC. AMP&VERT SwEEP OSC. I2201 HORIZONTAL HOLD CONTROL KINESCOPE SOCKET t Figure 5-Chassis Top View 6 POWER CORD FINE TUNING CONTROL CHANNEL SELECTOR SWITCH SIO1 TONE CONTROL PHONo SWITCH kr , S102 -R117 ON -OFF SWITCH & VOLUME CONTROL R217 BRIGHTNESS CONTROL R167 PICTURE CONTROL R20 IA VERTICAL HOLD CONTROL R2018 HORIZONTAL HOLD CONTROL VII 4 65N7G VERTICAL SYNC. AMP. 6. VERT. SWEEP OSC. CHASSIS BOTTOM VIEW 83 17T150, 17T151, 17T163 R -F ( UNIT TZ ANTENNA MATCHING TRANSFORMER TO ANTENNA TERMINALS SPEAKER CABLE 1107 3RD PIX I -F TRANS. T108 4TH PIX I -F TRANS. Z.10PIX I -F GRID TRANS. T105 IST six® I -F PLA=1;114S. TIOS 5TH PIX I- F TRANS. 1110 SOUND TAKE- OFF ITRANSJ TiO2 RATIO tI t9 DET. TRANS. TIO4 1ST PIX® I -F GRID TRANS. V115 6A05 VERT. SWEEP OUTPUT R167 PICTURE CONTROL E 0) V113 6SN7GT SYNC. SEPARATOR 7 V116 6SN701 HORIZ. SWEEP AONSDC. CONTROL 1 POWER CORD KINESCOPE SOCKET Figure 6-Chassis Bottom View 7 84 17T150, 17T151, 17T163 ALIGNMENT PROCEDURE TEST EQUIPMENT. -To properly service the television chassis of this receiver, it is recommended that the following test equipment be available: R -F Sweep Generator meeting the following requirements: (a) Frequency Ranges 35 to 90 mc., 1 mc. to 12 mc. sweep width 170 to 225 mc., 12 mc. sweep width (b) Output adjustable with at least .1 volt maximum. (c) Output constant on all ranges. (d) "Flat" output on all attenuator positions. Cathode -Ray Oscilloscope. -For alignment purposes, the oscilloscope employed must have excellent low frequency and phase response, and should be capable of passing a 60 -cycle square wave without appreciable distortion. For video and sync waveform observations, the oscilloscope must have excellent frequency and phase response from 10 cycles to at least two megacycles in all positions of the gain control. Signal Generator to provide the following frequencies with crystal accuracy. (a) Intermediate frequencies 4.5 mc. sound i-f transformer 39.25 mc. adjacent channel picture trap 41.25 mc. sound trap 45.75 mc. picture carrier 47.25 mc. adjacent channel sound trap (b) Radio frequencies Channel Number 2 3 4 5 6 7 8 9 10 11 12 13 Picture Carrier Freq. Mc. 55.25 61.25 67.25 77.25 83.25 175.25 181.25 187.25 193.25 199.25 205.25 211.25 Sound Carrier Freq. Mc. 59.75 65.75 71.75 81.75 87.75 179.75 185.75 191.75 197.75 203.75 209.75 215.75 Receiver R -F Osc. Freq. Mc. 101 107 113 123 129 221 227 233 239 245 251 257 (c) Output of these ranges should be adjustable and at least .1 volt maximum. Heterodyne Frequency Meter with crystal calibrator if the signal generator is not crystal controlled. Electronic Voltmeter of Junior or Senior "VoltOhmyst" type and a high voltage multiplier probe for use with this meter to permit measurements up to 20 kv. CAUTION: Do not short the kinescope second anode lead. Its short circuit current presents a considerable overload on the high voltage rectifier V119. ORDER OF ALIGNMENT. -When a complete receiver alignment is necessary, it can be most conveniently performed in the following order: (1) Ant. Matching Unit (2) R -F Unit (3) Ratio Detector (4) Sound I -F Trans. (5) Sound Take -Off Trans. (6) Picture I -F Traps (7) Picture I -F Trans. (8) Sweep Alignment of I -F (9) Horizontal Oscillator (10) Sensitivity Check ANTENNA MATCHING UNIT ALIGNMENT. -The antenna matching unit is accurately aligned at the factory. Adjustment of this unit should not be attempted in the cus- tomer's home since even slight misalignment may cause serious attenuation of the signal especially on channel 2. The r -f unit is aligned with a particular antenna matching transformer in place. If for any reason, a new antenna matching transformer is installed, the r -f unit should be realigned. The F -M Trap which is mounted in the antenna matching unit may be adjusted without adversely affecting the alignment of the unit. To align the antenna matching unit disconnect the lead from the FM trap L58 to the channel selector switch 55. With a short jumper, connect the output of the matching unit through a 1000 mmf capacitor to the grid of the second pix i-f amplifier, pin 1 of V107. Replace the cover on the matching unit while making all adjustments. Remove the first pix i-f amplifier tube V106. Connect the positive terminal of a bias box to the chassis and the potentiometer arm to the junction of R143 and R144. Set the potentiometer to produce approximately -6.0 volts of bias at the test point TP101. Connect an oscilloscope to the video test point TP102 and set the oscilloscope gain to maximum. Connect a signal generator to the antenna input terminals: Modulate the signal generator 30% with an audio signal. Tune the signal generator to 45.75 mc. and adjust the generator output to give an indication on the oscilloscope. Adjust L59 in the antenna matching unit for minimum audio indication on the oscilloscope. Tune the signal generator to 41.25 mc. and adjust L60 for minimum audio indication on the oscilloscope. Remove the jumper from the output of the matching unit. Connect a 300 ohm 1/2 watt composition resistor from L58 to ground, keeping the leads as short as possible. Connect an oscilloscope low capacity crystal probe from L58 to ground. The sensitivity of the oscilloscope should be approximately 0.03 volts per inch. Set the oscilloscope gain to maximum. Connect the r -f sweep generator to the matching unit antenna input terminals. In order to prevent coupling reactance from the sweep generator into the matching unit, it is advisable to employ a resistance pad at the matching unit terminals. Figure 11 shows three different resistance pads for use with sweep generators with 50 ohm co -ax output, 72 ohm co -ax output or 300 ohm balanced output. Choose the pad to match the output impedance of the particular sweep employed. Connect the signal generator loosely to the matching unit antenna terminals. Set the sweep generator to sweep from 45 mc. to 54 mc. With RCA type WR59A sweep generators, this may be accomplished by retuning channel number 1 to cover this range. With WR59B sweep generators this may be accomplished by retuning channel number 2 to cover the range. In making these adjustments on the generator, be sure not to turn the core too far clockwise so that it becomes lost beyond the core retaining spring. Adjust L61 and L62 to obtain the response shown in figure 12. L61 is most effective in locating the position of the shoulder of the curve at 52 mc. and L62 should be adjusted to give maximum amplitude at 53 mc. and above consistent with the specified shape of the response curve. The adjustments in the matching unit interact to some extent. Repeat the above procedure until no further adjustments are necessary. Remove the 300 ohm resistor and crystal probe connections. Restore the connection between L58 and S5. Replace V106. R -F UNIT ALIGNMENT. -An r -f unit which is operative and requires only touch up adjustments, requires no presetting of adjustments. For such units, skip the remainder of this paragraph. For units which are completely out of adjustment, preset all adjustments to the approximate center of their range with the following exceptions: Set C18 so that the screw head is approximately three -eighths of an inch above chassis. Set the Tl core for maximum inductance (core turned counter -clockwise). Set C11 near maximum capacity (one quarter turn from tight). Do not change any of the adjustments in the antenna matching unit. Disconnect the link from terminals "A" and "B" of T104 and terminate the link with a 39 ohm composition resistor. The r -f unit is aligned with zero AGC bias. To insure that the bias will remain constant, take a clip lead and short circuit the r -f unit power terminal board terminal 3 to ground. 8 ALIGNMENT PROCEDURE 85 17T150, 17T151, 17T163 Connect the oscilloscope to the test point TP1 on top of the r -f unit. Set the oscilloscope gain to maximum. Turn the receiver channel selector switch to channel 2. Connect the output of the signal generator to the grid of the r -f amplifier, V2. To do this, remove the tube from the socket and fashion a clip by twisting one end of a small piece of wire around pin number 7. Replace the tube in the socket leaving the end of the wire protruding from under the tube. Connect the signal generator to this wire through a 1,500 mmf capacitor. Tune the signal generator to 43.5 mc. and modulate it 30' with a 400 cycle sine wave. Adjust the signal generator for maximum output. Adjust L65 on top of the r -f unit for minimum 400 cycle indication on the oscilloscope. If necessary, this adjustment can be retouched in the field to provide additional rejection to one specific frequency in the i-f band pass. However, in such cases, care should be taken not to adjust it so as to reduce sensitivity on channel 2. Remove the wire clip from pin 7 of V2 and replace the tube and tube shield. Set the channel selector switch to channel 8. Turn the fine tuning control 30 degrees clockwise from the center of its mechanical range now and at all times when adjusting the oscillator frequency. Adjust Cl for proper oscillator frequency, 227 mc. This may be done in several ways. The easiest way and the way which will be recommended in this procedure will be to use the signal generator as a heterodyne frequency meter and beat the oscillator against the signal generator. To do this, tune the signal generator to 227 mc. with crystal accuracy. Insert one end of a piece of insulated wire into the r -f unit through the hole provided for the adjustment for Cll. Be careful that the wire does not touch any of the tuned circuits as it may cause the frequency of the r -f unit oscillator to shift. Connect the other end of the wire to the "r -f in" terminal of the signal generator. Adjust Cl to obtain an audio beat with the signal generator. Connect the sweep generator through a suitable attenuator as shown in Figure 11 to the input terminals of the antenna matching unit. Connect the signal generator loosely to the antenna terminals. Set the sweep oscillator to cover channel 8. Set the oscilloscope to maximum gain and use the minimum input signal which will produce a useable pattern on the oscilloscope. Excessive input can change oscillator injection during alignment and produce consequent misalignment even though the response as seen on the oscilloscope may look normal. Insert markers of channel 8 picture carrier and sound carrier, 181.25 mc. and 185.75 mc. Adjust C9, C11, C15 and C18 for approximately correct curve shape, frequency, and band width as shown in Figure 13. The correct adjustment of C18 is indicated by maximum amplitude of the curve midway between the markers. C15 tunes the r -f amplifier plate circuit and affects the frequency of the pass band most noticeably. .Q9 tunes the mixer grid circuit and affects the tilt of the curve most notice- ably (assuming that C18 has been properly adjusted). C11 is the coupling adjustment and hence primarily affects the response band width. Set the receiver channel switch to channel 6. Adjust the signal generator to the channel 6 oscillator frequency 129 mc. Turn the fine tuning control 30 degrees clockwise from the center of its mechanical range. Adjust L5 for an audible beat with the signal generator as before. Set the sweep generator to channel 6. From the signal generator, insert channel 6 sound and picture carrier markers, 83.25 mc. and 87.75 mc. Adjust L48, L50 and L53 for proper response as shown in Figure 13. L50 tunes the r -f amplifier plate circuit and primarily affects the frequency of the pass band. L53 tunes the r -f amplifier grid and is adjusted to give maximum amplitude of the curve between the markers. L48 affects the tilt of the curve but not quite the same as C9 adjustment. When the circuits are correctly adjusted and L48 is rocked on either side of its proper setting, the high frequency (sound carrier) end of the curve appears to remain nearly fixed in amplitude while the picture carrier end tilts above or below this point. Turn off the sweep and signal generators. Connect the "VoltOhmyst" to the r -f unit test point TP1. Adjust the oscillator injection trimmer C8 for --3.5 volts or at maximum if -3.5 volts cannot be reached. This voltage should fall between -2.5 and -5.5 volts on all channels when the alignment of all circuits is completed. Turn the sweep oscillator and signal generator back on and recheck channel 6 response. Readjust L48, L50 and L53 if necessary. Set the receiver channel selector switch to channel 8 and readjust Cl for proper oscillator frequency, 227 mc. Set the sweep oscillator and signal generator to channel 8: Readjust C9, C11, C15 and C18 for correct curve shape, frequency and band width. Turn off the sweep and signal generators, switch back to channel 6 and check the oscillator injection voltage at TP1 if C9 was adjusted in the recheck of channel 8 response. If the initial setting of oscillator injection trimmer C8 was far off, it may be necessary to adjust the oscillator frequency and response on channel 8, adjust the oscillator injection on channel 6 and repeat the procedure several times before the proper setting is obtained. Turn off the sweep generator and switch the receiver to channel 13. Adjust the signal generator to the channel 13 oscillator frequency 257 mc. Set the fine tuning control 30 degrees clockwise from the center of its mechanical range. Adjust L46 to obtain an audible beat. Slightly overshoot the adjustment of L46 by turning the slug a little more in the same direction from the original setting, then reset the oscillator to proper frequency by adjusting Cl to again obtain the beat. Check the responSe of channels 7 through 13 by switching the receiver channel switch, sweep oscillator and marker oscillator to each of these channels and observing the response and oscillator injection obtained. See Figure 13 for typical response curves. It should be found that all these channels have the proper shaped response with the markers above 80% response. If the markers do not fall within this requirement, switch to channel 8 and readjust C9, C11, C15 and C18 as necessary. Turn off the sweep generator and check the channel 8 oscillator frequency. If Cl has to be readjusted for channel 8, the principle of overshooting the adjustment and then correcting by adjusting L46 should be followed in order to establish the L/C ratio for the desired oscillator tracking. Turn the receiver channel selector switch to channel 6. Adjust L5 for correct oscillator frequency, 129 mc. Turn the sweep oscillator on and to channel 6 and observe the response curve. If necessary readjust L48, L50 and L53. Switch the receiver through channel 6 down through channel 2 and check for normal response curve shapes and oscillator injection voltage. If excessive tilt in the same direction occurs on channels 2, 3 and 4, adjust C18 on channel 2 to overshoot the correction of this tilt, then switch to channel 6 and adjust L53 for maximum amplitude of curve between markers. This adjustment should produce "flat" response on the low channels if the other adjustments especially L48 are correct. Likewise check channels 7 through 13, stopping on 13 for the next step. With the receiver on channel 13, check the receiver oscillator frequency. Correct by adjustment of Cl if necessary. Adjust the oscillator to frequency on all channels by switching the receiver and the frequency standard to each channel and adjusting the appropriate oscillator trimmer to obtain the audible beat. It should be possible to adjust the oscillator to the correct frequency on all channels with the fine tuning control in the middle third of its range. When employing WR39 calibrators to adjust the receiver oscillator, tune the calibrator to one-half the receiver oscillator frequency on channels 4, 5 and 6 and to one-fourth the receiver oscillator frequency on channels 11, 12 and 13. 9 86 17T150, 17T151, 17T163 ALIGNMENT PROCEDURE Picture Sound Receiver Channel Channel Carrier Carrier R -F Osc. Oscillator Number Freq. Mc. Freq. Mc. Freq. Mc. Adjustment 2 55.25 59.75 101 LI 3 61.25 65.75 107 L2 4 67.25 71.75 113 L3 5 77.25 81.75 123 L4 6 83.25 87.75 129 L5 7 175.25 179.75 221 L6 8 181.25 185.75 227 L7 9 187.25 191.75 233 L8 10 193.25 197.75 239 L9 11 199.25 203.75 245 L10 12 205.25 209.75 251 L11 13 211.25 215.75 257 Cl Remove the 39 ohm resistor from the link and reconnect the link to terminals "A" and "B" of T104. RATIO DETECTOR ALIGNMENT. -Set the signal generator at 4.5 mc. and connect it to the second sound i-f grid, pin 1 of V102. Set the generator for 30' ; 400 cycle modulation. As an alternate source of signal, the RCA WR39B or WR39C calibrator may be employed. If used connect its output cable to the grid of the 4th pix i-f amplifier pin 1 of V109. Set the frequency of the calibrator to 45.75 (pix carrier) and modulate with 4.5 mc. crystal. Also turn on the internal AM audio modulation. The 4.5 mc signal will be picked off at T110A and amplified through the sound i-f amplifier. Connect the "VoltOhmyst" to the junction of R110 and R114. Connect the oscilloscope across the speaker voice coil and turn the volume control for maximum output. Set the trimmer C226 (on the bottom of the V103 socket) for minimum capacity. Tune the ratio detector primary, T102 top core for maximum DC output on the "VoltOhmyst." Adjust the signal level from the signal generator for 10 volts on the "VoltOhmyst" when finally peaked. This is approximately the operating level of the ratio detector for average signals. Tune the ratio detector secondary T102 bottom core for minimum AM output on the oscilloscope. Repeat adjustments of T102 top for maximum DC and T102 bottom for minimum output on the oscilloscope making final adjustment with the 4.5 mc. input level adjusted to produce 10 volts d -o on the "VoltOhmyst." Connect the "VoltOhmyst" to the junction of R112 and C113 and note the amount of d -c present. If this voltage exceeds ±1.5 volts, adjust C226 by turning the core in until zero d -c is obtained. Readjust the T102 bottom core for minimum output on the oscilloscope. Repeat the adjustments of C226 and T102 bottom core until the voltage at R112 and C113 is less than +1.5 volts when T102 bottom core is set for minimum indication on the oscilloscope. Connect the "VoltOhmyst" to the junction of R110 and R114 and repeat the T102 top core for maximum d -c on the meter and again reset the generator output so that the meter reads minus 10 volts. Repeat the adjustments in the above two paragraphs until the voltage at R112 and C113 is less than ±1.5 volts when the T102 top core is set for maximum d -c at the junction of R110 and R114 and the T102 bottom core is set for minimum indication on the oscilloscope. SOUND I -F ALIGNMENT. --Connect the sweep generator to the first sound i-f amplifier grid, pin 1 of V101. Adjust the generator for a sweep width of 1 mc. at a center frequency of 4.5 mc. Insert a 4.5 mc. marker signal from the signal generator into the first sound i-f grid. Connect the oscilloscope in series with a 10,000 ohm resistor to terminal A of T101. Adjust T101 top and bottom cores for maximum gain and symmetry about the 4.5 mc. marker on the i-f response. The pattern obtained should be similar to that shown in Figure 14. The output level from the sweep should be set to produce approximately 2.0 volt peak -to -peak at terminal A of T101 when the final touches on the above adjustment are made. It is necessary that the sweep output voltage should not exceed the specified values otherwise the response curve will be broadened permitting slight misadjustment to pass unnoticed and possibly causing distortion on weak signals. Connect the oscilloscope to the junction of 11112 and C113 and check the linearity of the response. The pattern obtained should be similar to that shown in Figure 15. SOUND TAKE -OFF ALIGNMENT. -Connect the 4.5 mc. generator in series with a 1,000 ohm resistor to terminal "C" of T110. The input signal should be approximately 0.5 volts. Short the fourth pix i-f grid to ground, pin 1 V109, to prevent noise from masking the output indication. As an alternate source of signal the RCA WR39B or WR39C calibrator may be used. In such a case, disregard the above two paragraphs. Connect calibrator across link circuit, T104 A, B, and modulate 45.75 carrier with 4.5 mc. crystal. Connect the crystal diode probe of a "VoltOhmyst" to the plate of the video amplifier, pin 8 of V110. Adjust the core of T110 for minimum output on the meter. Remove the short from pin 1 V109 to ground, if used. PICTURE I -F TRAP ADJUSTMENT. -Connect the i-f signal generator across the link circuit on terminals A and B of T104. Connect the "VoltOhmyst" to test point TP101. Obtain a 7.5 volt battery capable of withstanding appreciable current drain and connect the ends of a 1 000 ohm potentiometer across it. Connect the battery positive terminal to chassis and the potentiometer arm to the junction of R143 and R144. Set the bias pot to produce approximately -1.0 volt of bias at test point TP101. Connect the "VoltOhmyst" to test point TP102 at the picture detector. Set the signal generator to each of the following frequencies and adjust the corresponding circuit for minimum d -c output at TP102. Use sufficient signal input to produce 1.0 volt of d -c on the meter when the final adjustment is made. 39.25 mc 41.25 mc. 47.25 mc T104 top core T105 bottom core T106 bottom core PICTURE I -F TRANSFORMER ADJUSTMENTS. Set the signal generator to each of the following frequencies and peak the specified adjustment for maximum indication on the "VoltOhmyst." During alignment, reduce the input signal if necessary in order to produce 1.0 volt of d -c at test point TP102 with -1.0 volt of i-f bias at test point TP101. 43.7 mc 45.5 mc 41.8 mc T109 T108 T107 To align T105 and T106 connect the sweep generator to the first picture i-f grid pin 1 of V106 through a 1,000 mmf ceramic capacitor. Shunt R141 R149 and terminals "A" and "F" of T109 with 330 ohm composition resistors. Set the i-f bias to -1.0 volt at test terminal TP101 Adjust T105 and T106 top cores for maximum gain and curve shape as shown in Figure 16. For final adjustments set the output of the sweep generator to produce 0.5 volts peak to -peak at the oscilloscope terminals. To align T1 and T104 connect the sweep generator to the mixer grid test point TP2. Use the shortest leads possible with not more than one inch of unshielded lead at the end of the sweep cable. Set the channel selector switch to channel 4. Connect a 180 ohm composition resistor from terminal B of T105 to the junction of R135 and C132. Connect the oscilloscope diode probe to terminal B of T105 and to ground. Couple the signal generator loosely to the diode probe in order to obtain markers. In most receivers, C221 is variable and is provided as a band width adjustment. Preset C221 to minimum capacity. Adjust T1 top and T104 bottom for maximum gain at 43.5 mc. and with 45.75 mc. at 70% of maximum response. Adjust C221 until 41.25 mc. is at 85% response with respect to the low frequency shoulder at approximately 41.9 mc. as shown in Figure 17. In receivers in which C221 is fixed, adjust Ti top and T104 bottom for maximum gain and the response shown in Figure16. Disconnect the diode probe, the 180 ohm and three 330 ohm resistors. SWEEP ALIGNMENT OF PIX I -F. -Connect the oscilloscope to the test point TP102. Adjust the bias potentiometer to obtain -6.0 volts of bias as measured by a "VoltOhmyst" at test point TP101. 10 ALIGNMENT PROCEDURE 87 17T150, 17T151, 17T163 Leave the sweep generator connected to the mixer grid test point TP2 with the shortest leads possible and with not more than one inch of unshielded lead at the end of the sweep cable. If these precautions are not observed, the receiver may be unstable and the response curves obtained may be unreliable. Adjust the output of the sweep generator to obtain 3.0 volts peak -to -peak on the oscilloscope. Couple the signal generator loosely to the grid of the first pix i-f amplifier. Adjust the output of the signal generator to produce small markers on the response curve. Retouch T108 and T109 to obtain the response shown in Figure 18. Do not adjust T107 unless absolutely necessary. If T107 is adjusted too low in frequency it will raise the level of the 41.25 mc. sound i-f carrier and may create interference in the picture. It will also cause poor adjacent channel picture rejection. If T107 is tuned too high in frequency, the level of the 41.25 mc. sound i-f carrier will be too low and may produce noisy sound in weak signal areas. Remove the oscilloscope, sweep and signal generator connections. Remove the bias box employed to provide bias for alignment. HORIZONTAL OSCILLATOR ADJUSTMENT.-Normolly the adjustment of the horizontal oscillator is not considered to be a part of the alignment procedure, but since the oscillator waveform adjustment may require the use of an oscilloscope, it can not be done conveniently in the field. The waveform adjustment is made at the factory and normally should not require readjustment in the field. However, the waveform adjustment should be checked whenever the receiver is aligned or whenever the horizontal oscillator operation is improper. Horizontal Frequency Adjustment.-Tune in a station and sync the picture. If the picture cannot be synchronized with the horizontal hold control R201B, then adjust the T113 frequency core on the rear apron until the picture will synchronize. If the picture still will not sync, turn the T113 waveform adjustment core (under the chassis) out of the coil several turns from its original position and readjust the T113 frequency core until the picture is synchronized. Examine the width and linearity of the picture. If picture width or linearity is incorrect, adjust the horizontal drive control C181B, the width control L106 and the linearity control L107 until the picture is correct. Horizontal Oscillator Waveform Adjustment.-- The horizontal oscillator waveform may be adjusted by either of two methods. The method outlined in paragraph A below may be employed in the field when an oscilloscope is not available. The service shop method outlined in paragraph B below requires the use of an oscilloscope. A.-Turn the horizontal hold control completely clockwise. Place adjustment tools on both cores of T113 and be prepared to make simultaneous adjustments while watching the picture on the screen. First, turn the T113 frequency core (on the rear apron) until the picture falls out of sync and one diagonal black bar sloping down to the right appears on the screen. Then, turn the waveform adjustment core (under the chassis) into the coil while at the same time adjusting the frequency core so as to maintain one diagonal black bar on the screen. Continue this procedure until the oscillator begins to motorboat, then turn the waveform adjustment core out until the motorboating just stops. As a check, turn the T113 frequency core until the picture is synchronized then reverse the direction of rotation of the core until the picture begins to fall out of sync with the diagonal bar sloping down to the right. Continue to turn the frequency core in the same direction. Additional bars should not appear on the screen. Instead, the horizontal oscillator should begin to motorboat. Retouch the adjustment of the T113 waveform adjustment core if necessary until this condition is obtained. B.-Connect the low capacity probe of an oscilloscope to terminal C of T113. Turn the horizontal hold control onequarter turn from the clockwise position so that the picture is in sync. The pattern on the oscilloscope should be as shown in Figure 19. Adjust the waveform adjustment core of T113 until the two peaks are at the same height. During this adjustment, the picture must be kept in sync by readjusting the hold control if necessary. This adjustment is very important for correct operation of the circuit. If the broad peak of the wave on the oscilloscope is lower than the sharp peak, the noise immunity becomes poorer, the stabilizing effect of the tuned circuit is reduced and drift of the oscillator becomes more serious. On the other hand, if the broad peak is higher than the sharp peak, the oscillator is overstabilized, the pull -in range becomes inadequate and the broad peak can cause double triggering of the oscillator when the hold control approaches the clockwise position. Remove the oscilloscope upon completion of this adjustment. Horizontal Locking Range Adjustment.-Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T113 frequency core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 3 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C181A slightly clockwise. If less than 2 bors are present, adjust C181A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 or 3 bars are present. Turn the horizontal hold control to the maximum clockwise position. Adjust the T113 frequency core so that the diagonal bar sloping down to the right appears on the screen and then reverse the direction of adjustment so that bar just moves off the screen leaving the picture in synchronization. SENSITIVITY CHECK. --A comparative sensitivity check can be made by operating the receiver on a weak signal from a television station and comparing the picture and sound obtained to that obtained on other receivers under the same conditions. This weak signal can be obtained by connecting the shop antenna to the receiver through a ladder type attenuator pad. RESPONSE CURVES.-The response curves shown on page 14 are typical though some variations can be expected. The response curves are shown in the classical manner of presentation, that is with "response up" and low frequency to the left. The manner in which they will be seen in a given test set-up will depend upon the characteristics of the oscilloscope and the sweep generator. The curves may be seen inverted and/or switched from left to right depending on the deflection polarity of the oscilloscope and the phasing of the sweep generator. NOTES ON R -F UNIT ALIGNMENT.-- Because of the frequency spectrum involved and the nature of the device, many of the r -f unit leads and components are critical in some respects. Even the power supply leads form loops which couple to the tuned circuits, and if resonant at any of the frequencies involved in the performance of the tuner, may cause serious departures from the desired characteristics. In the design of the receiver these undesirable resonant loops have been shifted far enough away in frequency to allow reasonable latitude in their components and physical arrangement without being troublesome. When the r -f unit is aligned in the receiver, no trouble from resonant loops should be experienced. However, if the unit is aligned in a jig separate from the receiver, attention should be paid to insure that unwanted resonances do not exist which might present a faulty representation of r -f unit alignment. A resonant circuit exists between the r -f tuner chassis and the outer shield box, which couples into the antenna and r -f plate circuits. The frequency of this resonance depends on the physical structure of the shield box, and the capacitance between the tuner chassis and the front plate. This resonance is controlled in the design by using insulating washers of proper thickness in the front plate to tuner chassis mounting. The performance of the tuner will be impaired if the proper washers are not used. Obviously then, if the r -f unit is removed for service, the washers should be :replaced in the correct order when the unit is replaced. 11 88 17T150, 17T151, 17T163 ALIGNMENT TABLE THE DETAILED ALIGNMENT PROCEDURE BEGINNING ON PAGE 8 SHOULD BE READ BEFORE ALIGNMENT BY USE OF THE TABLE IS ATTEMPTED Step CONNECT SIGNAL SIGNAL GEN. CONNECT SWEEP CONNECT HET. SWEEP GEN. HETERODYNE METER MISCELLANEOUS CONNECT CONNECTIONS No. GENERATOR TO FREQ. MC. GENERATOR FREQ. FREQ. METER FREQ. OSCILLOSCOPE AND TO MC. TO MC. TO INSTRUCTIONS ADJUST REFER TO ANTENNA MATCHING UNIT ALIGNMENT 1 Do not adjust this unit unless fairly certain 1000 mmf. to pin 1 of V107. Replace cover othnamt iattcrehqinugiruensiat.dRjuesmtmoveentV. D10is6cfornonmecstolcekaedt.fCroomnnLec5t8btioasSb5o.xCtoonjnuenccttioountpouf tRo1f4m3 aatncdhRin1g4u4niatntdhrsoeutgtoh produce -6 volts. 2 Antennatermi- 45.75 mc. Not used nals 30% mod. 3 " 41.25 me. " 30% mod. - Not used - " 4 Antennaterminals loosely Ananltsentnhartoeurmghi- 45 to 54 mc. ,, pad - TP102. Scope - L59 for min. audio Fig. 7 - gain to max. " - on scope L60 for min. audio Fig. 7 - on scope Scope a stal probe to gnd. Connect 300 ohms from L58 to grid. tLa61i nanrdesLp6o2ntsoeoobf- Fig. 12 Fig. 7 Fig. 11 Fig. 12 R -F UNIT ALIGNMENT S If unit is completely out of adjustment, preset all adjustments to center of range with following exceptions. Set Set T1 max. counterclockwise. Set Cll 1/4 turn from max. clockwise. Disconnect Ink from T104 and terminate C18 with so that head is 3/8" 39 ohms. Short r -f aubnoitvpeowchear stseirs-. - - minal 3 to ground. Set fine tuning 30 degrees clockwise from mechanical center of its range for all oscillator adjustments. 6 Grid, pin 7 of 43.5 mc. Not used V2through 1500 30% mod. Not used TP 1 . Gain to maximum Set r - f unit on channel 2 L65 for min. indication on scope Fig. 7 Fig. 10 mmf. 7 Not used 8 Antennatermi- nals loosely 9 Not used 10 Antennatermi- nals loosely 11 Not used - 181.25 and -185.75 83.25 and -87.75 Not used - Loosely to r -f unit oscillator Ananltsentnhartoeurmghi- Channel Not used 8 pad Not used - Loosely to r -f unit oscillator Ananltsentnhartoeurmghi- Channel Not used 6 pad Not used - Not used 227 mc. - 129 mc. - Not used R -F unit on chan- Cl for beat on het. Fig. 7 nel 8 freq. meter TP1. Gain to " C9, C11, C15 and Fig. 7 maximum C18 for response Fig. 13 shown in Fig. 13 Not used R -F unit on chan- L5 for beat on het. Fig. 8 nel 6 freq. meter TP1. Gain to maximum " L48, L50 and L53 Fig. 7 for response shown Fig. 13 in Fig. 13 Not used On channel6. Con- C8 for -3.5 volts on Fig. 7 nect"VoltOhmyst" meter 12 Antennaterminals loosely 13 Not used 14 Antennatermi- nals loosely 83.25 and -87.75 181.25 and 185.75 Ananltsentnhartoeurmghi- Channel Not used 6 - pad Not used - Loosely to r -f 227 mc. unit oscillator Arinatlesntnhartoerumgih- Channel Not used 8 - pad TP1. Gain to maximum Not used TP1. Gain to maximum to TP1 R -F unit on channel 6 R -F unit on channel 8 " Check response. Readjust L48, L50 and L53 if necessary Cl for beat on het. freq. meter Check response adjaunsdt CC91,8 iCf 11n,eCce1s5sary Fig. 7 Fig. 13 Fig. 7 Fig. 7 15 16 - - If C9 was readjusted in step 14, repeatstep 11, step 13 and step 14 untilthe conditions specified in each step are fulfilled without additional adjustments. Not used Not used Loosely to r -f 257 mc. Not used unit oscillator Rec. on channel 13 L46 for beat on het. Fig. 7 safhrneodqo. at dmLj4eu6tsetrs.CliOglvhfetolryr- beat. 17 Antenna terminals loosely 211.25 215.75 Ananltsentnharoteurmghi- Channel Not used 13 pad - TP1. Gain to Rec. on channel 13 Check to see that Fig. 13 maximum "VoltOhmyst" on TP1 raensdpo-n3s.e0isvocoltrsreocft osc. injection is present 18 " 205.25 " Channel Not used - " Rec. on channel 12 " Fig. 13 19 " 209.75 199.25 12 " Channel " - " Rec. on channel 11 " Fig. 13 20 " 203.75 193.25 11 " Channel " - " Rec. on channel 10 " Fig. 13 21 " 197.75 187.25 10 " Channel " - " Rec. on channel 9 " Fig. 13 22 ' 191.75 181.25 9 " Channel " - " Rec. on channel 8 ' Fig. 13 23 " 185.75 175.25 8 " Channel " - " Rec. on channel 7 " Fig. 13 179.75 7 24 If the response of any channel (steps 17 through 23) is below 80% at either marker, adjust C9, Cli C15 and C18 as necessary to pull response up on the low channel yet maintain correct response on channel 8. 25 Repeat step 13. If the oscillator is off frequency overshoot the adjustment of Cl and correct by adjusting L46. - - 26 Repeat steps 16 through 25 until all adjustments are obtained. 27 Not used Not used Loosely to r -f 129 mc. Not used unit oscillator Rec. on channel6 L5 for beat on het. Fig. 7 freq. meter 28 Antennaterminals loosely 83.25 87.75 Ananltsentnhartoeurmghi- Channel Not used 6 pad - TP1. Gain to maximum Rec. on channel 6 "VoltOhmyst" on TP1 Check to see that arensdpo-3ns.0e ivsoclotsrrecoft Fig. 7 Fig. 13 osc. injection is present 29 " 77.25 " Channel " - " Rec. on channel 5 " Fig. 13 30 " 81.75 5 67.25 , " Channel ' - " Rec. on channel 4 ,. Fig. 13 31 .. 71.75 61.25 4 " Channel " - " Rec. on channel 3 " Fig. 13 65.75 3 12 91 17T150, 17T151, 17T163 TEST PATTERN PHOTOGRAPHS Figure 20-Normal Picture Figure 2I-Focus Magnet and Ion Trap Magnet Misadjusted Figure 22-Horizontal Linearity Control Misadjusted (Picture Cramped in Middle) Figure 23-Width Control Misadjusted 400.11.--> Figure 24-horizontal Drive FIEF Control Misadjusted Figure 25-Transients -)41410-0- Figure 26-Test Pattern Show- ing Out of Sync Condition When Horizontal Hold Control Is in a Counter -clockwise Position-Just Before P4u-ll4in0g I4nto Sync Figure 27-Test Pattern Show- ing Out of Sync Condition When Horizontal Hold Control Is at the Maximum Clockwise Position *104110.-015 92 17T150, 17T151, 17T163 SERVICE SUGGESTIONS Following is a list of symptoms of possible failures and an indication of some of the possible faults: NO RASTER ON KINESCOPE: (1) Incorrect adjustment of ion trap magnet. Magnet reversed either front to back or top to bottom. (2) V116 or V117 inoperative. Check waveforms on grids and plates. (3) No high voltage-if horizontal deflection is operating as evidenced by the correct waveform on terminal 1 of high voltage transformer, the trouble can be isolated to the 1B3GT circuit. Either the T114 high voltage winding is open, the 1B3GT tube is defective, its filament circuit is open or C197 is shorted. (4) V110 circuit inoperative-Refer to schematic and waveform chart. (5) Damper tube (V120) inoperative. (6) Defective kinescope. (7) R218 open. (8) No receiver plate voltage-filter capacitor shorted-or filter choke open. NO VERTICAL DEFLECTION: (1) V114B or V115 inoperative. Check voltage and waveforms on grids and plates. (2) Till open. (3) Vertical deflection coils open. SMALL RASTER : (1) Low Plus B or low line voltage. (2) V117 defective. POOR VERTICAL LINEARITY : 1) If adjustments cannot correct, change V115. (2) Vertical output transformer Till defective. (3) V114B defective-check voltage and waveforms on grid and plate. (4) C168, C170, C171, C172, C173 or C174 defective. (5) Low plate voltage-check rectifiers and capacitors in supply circuits. (6) If height is insufficient, try changing V114. POOR HORIZONTAL LINEARITY: (1) If adjustments do not correct, change V117, or V120. (2) T114 or L107 defective. (3) C195 or C196 defective. WRINKLES ON SIDE OF RASTER: (1) C199 defective. (2) Defective yoke. TRAPEZOIDAL OR NON SYMMETRICAL RASTER: (I) Improper adjustment of centering of focus magnet or ion trap magnet. (2) Defective yoke. RASTER AND SIGNAL ON KINESCOPE BUT NO SOUND: (1) T110 defective. (2) Sound i-f, ratio detector or audio amplifier inoperative- check V101, V102, V103 and their socket voltages. (3) Audio system defective. (4) Speaker defective. SIGNAL AT KINESCOPE GRID BUT NO SYNC: (1) AGC control R175 misadjusted. (2) Viii, inoperative. Check voltage and waveforms at its grid and plate. SIGNAL ON KINESCOPE GRID BUT NO VERTICAL SYNC: (1) Check V114B and associated circuit. (2) Integrating network inoperative-Check. (3) V113 or V114A defective or associated circuit defective. (4) Gas current grid emission or grid cathode leakage in V114. Replace. SIGNAL ON KINESCOPE GRID BUT NO HORIZONTAL SYNC: (1) T113 misadjusted-readjust as instructed on page 11. (2) V112 or V113 inoperative-check socket voltages and waveforms. (3) T113 defective. (4) C157, C181A, C182, C183, C184, C185, C186, C187 or C188 defective. (5) If horizontal speed is completely off and cannot be adjusted check R226, R227, R201B, R229, R230 and 5231. SOUND AND RASTER BUT NO PICTURE OR SYNC: (1) Picture, detector or video amplifier defective-check CR101 and V110-check socket voltages. (2) Bad contact to kinescope cathode. PICTURE STABLE BUT POOR RESOLUTION: (1) CR101 or V110 defective. (2) Peaking coils defective-check resistance. (3) Make sure that the focus control operates on both sides of proper fckus. (4) R -F and I -F circuits misaligned. PICTURE SMEAR: (1) R -F or I -F circuits misaligned. (2) Open peaking coil. (3) This trouble can originate at the transmitter --check on another station. PICTURE OUT OF SYNC HORIZONTALLY: (1) T113 incorrectly tuned. (2) R226, R227 or R201B defective. PICTURE JITTER: (1) AGC control R175 misadjusted. (2) If regular sections at the left picture are displaced change V117. 16 89 Step No. 32 33 34 35 36 P 38 39 40 41 42 43 44 45 46 AT !'""!!!!ENT TABLE 17T150, 17T151, 17T163 CONNECT SIGNAL GENERATOR TO - " SIGNAL GEN. FREQ. MC. 55.25 59.75 CONNECT SWEEP GENERATOR TO " SWEEP CONNECT GEN. HETERODYNE FREQ. FREQ. METER MC. TO Channel .. 2 HET. MISCELLANEOUS METER CONNECT CONNECTIONS FREQ. OSCILLOSCOPE AND MC. TO INSTRUCTIONS " Rec. on channel 2 ADJUST " REFER TO Fig. 13 If excessive tilt in the same direction occurs nel 6 and adjust 153 for max. amplitude of on channels 2, 3 and 4, adjust C18 on response between carrier markers. channel 2 to overshoot the correction of thistilt then switch to chan- Check r -f response and oscillator injection on channels 7 through 13 steps 23 back up through step 17 stopping on channel 13 for the next step. - - Not used Nut used Loosely coupled 257 mc. to r -f oscillator TP 1 . Gain to maximum Rec. on channel 13 CI for beat on het. freq. meter Fig. 7 - - " " " 251 mc. " Rec. on channel 12 L11 as above Fig. 7 '"- - " 245 mc. " Rec. on channel 11 110 as above Fig. 7 --- --- ".. " " 239 mc. Rec. on channel 10 L9 as above Fig. 7 " " ' 233 mc. " Rec. on channel 9 L8 as above Fig. 7 " " " 227 mc. " Rec. on channel 8 17 as above Fig. 7 - - " " " 221 mc. " Rec. on channel 7 L6 as above Fig. 7 - - " " " 129 mc. " Rec. on channel 6 L5 as above Fig. 7 - - " " " 123 mc. " Rec. on channel 5 L4 as above Fig. 7 - - " " " 113 mc. " Rec. on channel 4 L3 as above Fig. 7 - - " " ' 107 mc. " Rec. on channel 3 L2 as above Fig. 7 - - " " " 101 mc. " Rec. on channel 2 LI as above Fig. 7 47 Repeat steps 35 through 46 as a check. On completion, remove 39 ohm resistor and reconnect link to terminals A and B of T104. RATIO DETECTOR, SOUND I -F AND SOUND TAKE -OFF ALIGNMENT 48 Grid 2nd Snd. 4.5 mc. Not used I -F (pin 1, V102) 400 cy. or WR39B or C mod. or connect to grid 45.75 mc. 4th pix I -F (pin mod. by 1, V109.) 4.5 mc. and 400 cy. 49 - Not used - 50 Sig. Gen. to 1st Snd. I -F 4.5 mc. g1rstidSo(upnidn I -F 1, 4.5 mc. V101) - Across speaker voice coil. Volume control set for max. volume. j"auVnndoclRttiOoInh1mo4yf s.Rt"1S1et0ot Cpa2c2i6tyf.oSremt isnig. cnaa-l gen. to give -10 V T102 top core for mTfo1arx0m.2dibn-oc. taotounmdmiocetooerrne. the oscilloscope. Fig. 9 Fig. 10 on meter. - " "VoltOhmyst" to 'unction R112 and C113. If the meter reads more than ± 1.5 Fig. 9 Fig. 10 volts, adjust C226 for zero on the meter and readjust T102 (bot.) for min. output - In series with t1e0r,m00i0naolhAm,s otof T101. on scope. Repeat steps 48 and 49 until all conditions are satisfied. dSuwceeedptooutppruotvirdee- TIO1 top and bot. cores for max. gain 2 v p -p on scope. and symmetry at 4.5 mc. Fig. 9 Fig. 10 Fig. 14 51 52 Sriiegs. Gweinth. in se- 1000 " Not used ohms to T110 -C or WR39 across T104 A and B. " - .. - Junction of R112 Check for symmetrical response wave and C113 form (positive and negative). "VoltOhmyst" xtal probe V110. Itfosigp.ingen8., Amidniimusut mT 1reIa0difnogr on "VoltOhmyst". Fig. 15 Fig. 9 is used short pin 1, V109 to ground. PICTURE I -F AND TRAP ADJUSTMENT 53 Not used - Not used - Not used - Not used Connect bias box to junction of R143 and 54 Sig. Gen. across 39.25 mc. .. - .. - T104 A and B R144 and to gnd. Adjust to give -1.0 v on VoltOhmyst" at TP101. .. "VoltOhmyst" to T104 top tToPg10iv2.eG-e1n..0ovutoplutt give min. meter. core to d -c on Fig. 9 55 " 41.25 mc. " 56 " 47.25 mc. " 57 " 43.7 mc. " --- ' " " --- d -c. " " T105 bot. for min. Fig. 10 " T106 bot. for min. Fig. 10 " Sig. Gen. output to give -1.0 V d -c at T109 for max. Fig. 7 58 " 45.5 me. " - '' - 59 " 41.8 mc. " - " - TP102. " " " " T108 for max. T107 for max. Fig. 9 Fig. 9 60 (Fpiirnst 1p,ixVi-1f 0g6ri)d loosely. Various See Fig. 16 tFphiirrnsotu1pgixh, i-f grid V 1 0 6 1000 40 to 48 mc. " mmf. 61 Con n e c t e d loosely to diode probe. Various See Fig. 17 Mixer grid test point TP2 with 40 to 48 mc. short lead. " - To test point TP102 aSnhduntteRrm14i1n,aRls14A9 and F of T109 with TmA1ad0xj6u. sgtotapTinc1oa0rn5edsarfneod-r Fig. 9 Fig. 16 330 ohms, 0.5 v p -p sponse shown in on scope. Fig. 16. - Scope diode probe to T105 -B and to gnd. Rec. on chart. 4. CfroonmneTct110850 -oBhmtos Set C221 to min. Adjust T1 top and T104 bot. for max. Fig. 9 Fig. 17 junction R135 and C132. Upon cornpletion disconnect scope and shunting resistors. gain and 45a.t7543m.5c. mc. at 70%. Adjust C221 until 41.25 mc. is at 80%. 62 Connected Various loosely to grid See " of 1st pix i-f. Fig. 18 " - Connect scope to TP102. "TVPo1lt0O1h.mSyestt"biatso box for -6.0 volts oswn etheepmouettepru.tSteot produce 3.0 volts Retouch T108 and T109 to obtain re sponse shown in Fig. 18. Do not ad jaubsstoluTt1e0l7y nuencleess-s Fig. 18 p-p on scope. sary. 13 ALIGNMENT DATA 17T150, 17T151, 17 C1 OSC. FRED. TI C9 MIXER MIXER TRANS. GRID TP2 TEST POINT C15 R -F PLATE CIS LSO LEI L62 R -F F -m GRIO TRAP C2 FINE TUNING L46 L1 THROUGH 1.11 INCIPADUAL CHANNEL OSC. ADJUSTMENTS 41100*%t L60 41.25 MC. I -F TRAP L59 45.75 MC. I -F TRAP C II BANDWIDTH MS 1163 INJECT ADJUSTMENT ON COT8H°E5RCS. IDE MLIX4E8R GRID L 53 CHAN. 6 R -F GRID L50 CHAN. 6 R -F PLATE Figure 7 -R -F Unit Adjustments PAD FOR 5011. COAX. PAD FOR 724 COAX. PAD FOR 3004 BAL INPUT L 5611 130A 130 4 300.11. BALANCED OUTPUT 3004 BALANCED OUTPUT 474? 47 3so.n. 474 300 4 BALANCI m31164 0 UT PU Figure 11 -Sweep Attenuator Pads SHOULDER AT 52 MC. 60 MC. (53 MC. 100% RESPONSE Cv 123 50 MC. AT 60% ± 15% RESPONSE POINT Figure 12 -Antenna Matching Unit Response p S Figure 8 -R -F Oscillator Adjustments Jo cowrROC HVVT - coNyxRATIO -STOURND. OET TR. !W.'. A 0 i 102 TRH 4.5 4.s0 71013- TIO7 4TH PIE 3R0.PIX. 5TN. - 1.F TR.-1-F TR. 1-F TR. 45.5 MC 41.13 MC. ui &A.1L14S.541. E m AOC I' SOUND TAKE -OFF TR. GRID TR. 1ST. P1 I -F Pt TR 1ST PIE. I -F GRID TR. 441.4C: os ZAaOSrm, Figure 9 -Top Chassis Adjustments SWITCH TOME COMTli & 1/1.0010 SW/ 1/1 .311,1/ & VOLUME COMT1101_ Figure 13 -R -F Response 42.025 PA 4.5 MC E-4 Figure 14 Sound I -F Response 41.9 MC.' 41.25 MCI' 44.5 MC 85% CV ma Figure 15 Ratio Det. Response 42.25 MC. /45.75MC 70% 40.5 MCAT 20 % 41 2SMC 47.2SMC' Figure T105 and ResponJ 42.5 MC. 45 MC. .85% 45.75 A 50% caxw:16GR2IDNOIPRIXA.1N-F. 1ST PiX. adLOE. PLATE TRAM. Figure 10 -Bottom Chassis Adjustments CV 124 -I Figure 17 TI and T104 Response 48.5 5% Figure 18 Over-all I -F Response 1717 INCORRECT INCORRECT C/111 CORRECT Figure 19 -Horizontal Oscillator Waveforms SERVICE SUGGESTIONS 93 17T150, 17T151, 17T163 (3) Vertical instability may be due to loose connections or noise. (4) Horizontal instability may be due to unstable transmitted sync. RASTER BUT NO SOUND, PICTURE OR SYNC: (1) Defective antenna or transmission line. (2) R -F oscillator off frequency. (3) R -F unit inoperative-check VI, V2. DARK VERTICAL LINE ON LEFT OF PICTURE: (1) Reduce horizontal drive and readjust width and horizontal linearity. (2) Replace V117. LIGHT VERTICAL LINE ON LEFT OF PICTURE: (1) C193 defective. (2) V120 defective. PICTURE I -F RESPONSE.-At times it may be desirable to observe the individual i-f stage response. This can be achieved by the following method: For T107, T108 or T109, shunt all i-f transformers with a 330 ohm carbon resistor except the one whose response is to be observed. Connect a wide band sweep generator to the second pix i-f grid and adjust it to sweep from 38 mc. to 48 mc. Connect the oscilloscope to test point TP102 and observe the overall response. The response obtained will be essentially that of the unshunted stage. To see the response of transformers Tl, T104 and T105, T106, follow the instructions given on page 10. Figures 28 through 36 show the response of the various stages obtained in the above manner. The curves shown are typical although some variation between receivers can be expected. Relative stage gain is not shown. RESPONSE PHOTOGRAPHS Taken from RCA W058A Oscilloscope Figure 28-Overall Pix 1-F Response Figure 19-Response of T1 -T104 Pix I -F Transformers Figure 30-Response of T105 -T106 Pix I -F Transformer Figure 31-Response of T107 Pix I -F Transformer Figure 32-Response .of T108 Pix I -F Coil Figure 33-Response of T109 Pix I -F Coil Figure 34-Video Response at Average Contrast CV14.9 Figure 35-Video Response (100 KC Square Wave) 17 Figure 36-Video Response (60 Cycle Square Wave) 94 17T150, 17T151, 17T163 WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Grid of 1st Video Amplifier (Pin 4 of VII0) (6AG7) Voltage Depends on Picture Figure 37-Vertical (Oscilloscope Synced to 1/2 of Vertical Sweep Rate) (6.0 Volts PP) 4-444. Figure 38-Horizontal (Oscilloscope Synced to 1/2 of Horizontal Sweep Rate) (6.0 Volts PP) 44010-0. Plate of 1st Video Amplifier (Pin 8 of VI lo) (6AG7) Voltage depends o:: picture Figure 39- Ve4rt-ic0a4I 4(105 Volts PP) Figure 40-Horizontal (105 Volts PP) 100.10-0.. *4 l ... Ame044' CV 135 E. Grid of Sync Separator (Pin 4 of V113) (6SN7) Voltage depends on picture Figure 41-Vertical (30 Volts PP) <- --4(E Figure 42-Horizontal (30 Volts PP) . CV 13k. Plate of Sync Separator (Pin 5 of VI13) (6SN7) (.25 mfd in series with probe) Figure 43-V4er-ti4ca4l 4(33 Volts PP) Figure 44-Horizontal (8 Volts PP) 771 Grid of Vertical Sync Amp. (Pin 4 of VII4A) (6SN7) Figure 45-V4er-ti4ca4l 4(12 Volts PP) Figure 46-Horizontal (5 Volts PP) 11.11* -10- 18 WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Plate of Vertical Sync APO. (Pin 5 of V114A) (6SN7) Figure 47-Vertical (27 Volts PP) Figure 48-Horizontal (16 Volts PP) 30)40-o - 95 17T150, 17T151, 17T163 Figure 49-Grid of Vertical Sweep Osc. (Pin 1 of VI14B) (6SN7) (25 Volts PP) (_-444 Figure 50-Plate of Vertical Sweep Osc. (Pin 2 of V114B) (30 Volts PP) 137 13 CV 137 C Figure 51-Grid of Vertical Sweep Output (Pin I of VI15) (6AQ5) (35 Volts PP) -4-444 Figure 52-Plate of Vertical Sweep Output (Pin 5 of V115) (6AQ5) (800 Volts PP) 4000--0- Cathode of Sync Separator (Pin 3 of V113) (6SN7) Figure 53-Vertical (11 Volts PP) -4-444 Figure 54-Horizontal (6 Volts PP) ti Grid of Sync Separator (Pin 1 of V113) (6SN7) FEE Figure 55-Vertical (40 Volts PP) CV 1313A Figure 56-Horizontal (40 Volts PP) 19 96 17T150, 17T151, 17T163 impumwrionmpain7 CV138 WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Plate of Sync Separator (Pin 2 of V113) (6SN7) Figure 57- Vertical (15 Volts PP) Figure 58-Horizontal (15 Volts PP) CV 138E Grid of Hor. Sync Amp. (Pin 4 of V112) (6SN7) Figure 59-Vertical (15 Volts PP) 4--4441 Figure 60-Horizontal (15 Volts PP) 10400--1. CV 139A Plate of Hor. Sync Amp. (Pin 5 of V112) (6SN7) Figure 61-V.e4rt-ic4a4l (*70 Volts PP) Figure 62-Horizontal (70 Volts PP) 3110110 -0 - Grid of Hor. Sync Amp. (Pin 1 of V112) (6SN7) Figure 63- Vertical (65 Volts PP) 4-4441 Figure 64-Horizontal (65 Volts PP) Cathode of Hor. Sync Amp. (Pin 3 of V112) (6SN7) Figure 65-Vertical (18 Volts PP) *--044 Figure 66-Horizontal (18 Volts PP) 20 CV 1398 CV139D WAVEFORM PHOTOGRAPHS Taken from RCA W053A Oscilloscope Figure 67-Grid of Horizontal Oscillator Control (Pin 1 of V116) (6SN7GT) (22 Volts PP) -4--.44411 Figure 68-Cathode of Horizontal Oscillator Control (Pin 3 of VI16) (6SN7GT) (1.3 Volts PP) 97 17T150, 17T151, 17T163 CV140 ..111111111"Iti CV 1401 Figure 69-Grid of Horizontal Oscillator (Pin 4 of V116) (6SN7G<T)-(439404Volts PP) Figure 70-Plate of Horizontal Oscillator (Pin 5 of V116) (6SN7GT) (140 Volts PP) Figure 71-terminal "C" of T113 (120 Volts PP) Figure 7 2 - Grid of Horizontal Output Tube (Pin 5 of V117) (68Q6) (95 Volts PP) 3000.--11- Figure 73-Plate of Horizontal Output (Approx. 4000 Volts PP) (Measured Through a Capacity Voltage Divider Connected from Top Cap of V117 to Ground) .4-40111 Figure 74-Cathode of Damper (Pin 3 of V120) (6W4GT) (2300 Volts PP) Figure 75-Plate of Damper (Pin 5 of V120) (6W4GT) (180 Volts PP) Figure 76-Plate of AGC Amplifier (Pin 5 of V111) (6CB6) (600 Volts PP) 21 CV141D 98 17T150, 17T151, 17T163 VOLTAGE CHART The following measurements represent two sets of conditions. In the first condition, a 5000 microvolt test pattern signal was fed into the receiver, the picture synced and the AGC control properly adjusted. The second condition was obtained by removing the antenna leads and short circuiting the receiver antenna terminals. Voltages shown are read with a type WV97A senior "VoltOhmyst" between the indicated terminal and chassis ground and with the receiver operating on 117 volts, 60 cycles, a -c. The symbol < means less than. Tube No. V 1 V 1 V2 V2 V101 V102 V103 V104 V105 V106 V107 V108 V109 V110 V 111 Tube Type 6X8 6X8 6BQ7 6BQ7 6AU6 6AU6 6AL5 6AV6 6AQ5 6AU6 6CB6 6CB6 6CB6 6AG7 6CB6 Operating Function Condition Mixer 5000 Mu. V. Signal No Signal R -F 5000 Mu. V. Oscillator Signal No Signal R -F Amplifier 5000 Mu. V. Signal No Signal R -F Amplifier 5000 Mu. V. Signal No Signal 1st Sound 5000 Mu. V. I -F Amp. Signal No Signal 2d Sound 5000 Mu. V. I -F Amp. Signal No Signal Ratio Detector 5000 Mu. V. Signal No Signal 1st Audio 5000 Mu. V. Amplifier Signal No Signal Audio Output 5000 Mu. V. Signal No Signal 1st Pix. I -F 5000 Mu. V. Amplifier Signal No Signal 2nd Pix. I -F 5000 Mu. V. Amplifier Signal No Signal 3d Pix. I -F 5000 Mu. V. Amplifier Signal No Signal 4th Pix. I -F 5000 Mu. V. Amplifier Signal No Signal Video 5000 Mu. V. Amplifier Signal No Signal AGC 5000 Mu. V. Amplifier Signal No Signal E. Plate Pin No. Volts 9 145 to 9 150 3- 88 to 3 108 6- 133 to 6 138 - 1 1 260 5 255 5 245 5 260 5 255 7 0.54 7 -0.85 7 102 7 100 5 245 5 240 5 248 5 150 5 249 5 145 5 145 5 130 5 215 5 210 8 135 8 100 5 -35.8 5 4.0 E. Screen Pin No. Volts 8- 145 to 8 150 -- -- -- -- -- -- 6 185 6 165 6 52 6 54.0 ---- 6 254 6 250 6 255 6 120 6 232 6 108 6 135 6 127 6 150 6 140 6 150 6 125 6 238 6 265 E. Cathode Pin No. Volts 6 0 6 0 6 0 6 0 8- 8 1.1 3- 133 to 3 138 7 0.8 7 0.9 7 0.17 7 0.12 1 15.1 1 *6.85 2 0 2 0 2 17 2 17 7 0.2 7 1.0 2 0.15 2 0.8 2 1.2 2 1.1 2 2.1 2 2.0 5 1.35 5 1.65 2 120 2 100 E. Grid Pin No. Volts 7- -2.8 to 7 -3.5 2- -3.0 to 2 -5.1 7722- Notes on Measurements Depending on channel Depending on channel Depending on channel Depending on channel 1 -1.0 1 0 1 -24 *Unreliable measuring point. 1 *-1.5 Voltage depends on noise. -- 7.5 kc deviation at 400 cycles - - *Unreliable measuring point. Voltage depends on noise. 1 -0.3 At min. volume 1 -0.3 At mM. volume 7 0 At min. volume 7 0 At min. volume 1 -6.7 *Unreliable measuring point. 1 *0 Make measurement at T104 -D. 1 --6.7 1 0 1 0 1 0 1 0 1 0 4 -3.0 4 *-0.6 1 120 1 80 *Depends on noise AGC control set for normal operation AGC control set for normal operation 22 VOLTAGE CHART 99 17T150, 17T151, 17T163 TttghhrheeoeuprfenioccdlteluoairvnweedirsnywagnnimcttheeendtanhasaeunrdtreeemrtchmeeeiinvnAteasGrlrseoC.ppVrceeoorsanletttanirngot geltwsporosnohpso1eew1trs7lnyovfaaorcdletojsunr,sed6taie0tddioc.wnyTsicht.lheeInsas,ettahcyeo-pcnfe.idrWTscthoVceno9dsn7yidtmAiiotbinsooenwln,<aiosamro5"eb0Vat0ano0isnltmelOedsihcsbmrytohyvrasoent"ml.t boteevstiwtnpgeaettnhteetrhnaensitinegndnniacalawlteeaadsdstfeeardnmdiinnstaohlotarhtnecdrierccchueaiistvisenirsg, Tube No. V112 Tube Type 6SN7GT Function Hor. Sync Amplifier Operating Condition 5000 Mu. V. Signal E. Plate Pin No. Volts 2 150 No Signal 2 143 5000 Mu. V. Signal 5 77 No Signal 5 75 Hor. Sync 5000 Mu. V. V113 6SN7GT Separator Signal 2 269 No Signal 2 263 V113 Vert. Sync 6SN7GT Separator 5000 Mu. V. Signal 5 450 No Signal 5 400 Vert. Sync 5000 Mu. V. V114A 6SN7GT Amplifier Signal 5 12.0 No Signal 5 11.0 Vertical 5000 Mu. V. V114B 6SN7GT Oscillator Signal 2 *53 Vertical V115 6AQ5 Output No Signal 2 *53 5000 Mu. V. Signal 5 245 No Signal 5 240 V116 Horizontal 5000 Mu. V. 6SN7GT Osc. Control Signal 2 182 No Signal 2 180 5000 Mu. V. Signal 2 135 5000 Mu. V. Signal 2 225 Horizontal 5000 Mu. V. V116 6SN7GT Oscillator Signal 5 185 No Signal 5 180 5000 Mu. V. Signal 5 185 5000 Mu. V. Signal 5 185 Horizontal 5000 Mu. V. V117 6BQ6GT Output Signal Cap No Signal Cap 1B3GT H. V. V119 /8016 Rectifier 5000 Mu. V. Signal Cap No Signal Cap V120 6W4GT Damper 5000 Mu. V. Signal 5 266 No Signal 5 261 5000 Mu. V. V121 17QP4 Kinescope Signal Cone 13,500 No Signal Cone 13,200 E. Screen Pin No. Volts ---------- ---- E. Cathode Pin No. Volts 3 1.2 3 0.68 6 0 6 0 3 118 3 *90 6 125 6 100 6 0 6 0 3 0 3 0 6 259 2 21.5 6 252 2 21.6 - - 3 +8.0 - - 3 -3.0 - - 3 +8.8 - - 3 +8.8 -- 6 0 - -I 6 0 --6 0 --6 0 4 168 8 18.0 4 168 8 18.5 - - 2 & 7 13,500 - - 2 & 7 13,200 -- 3 -- 3 10 475 11 140 10 470 1 11 135 E. Grid Pin No. Volts Notes on Measurements 1 -38.0 *Unreliable measurement 1 *- 18 point. Voltage depends on noise. 4 -1.3 4 *-0.8 *Voltage depends on noise. 1 100 *Unreliable measurement 1 *80 points. Voltage depends on noise. 4 100 4 80 4 -0.13 4 -0.05 1 *-14.8 *Depends on setting of Vert. hold control. Voltages shown are synced pix adjustment. 1 * -14.1 1 0 1 0 1 -12.5 1 -19.5 1 -13.5 Hor. hold counter -clockwise 1 -12.5 Hor. hold clockwise 4 -58 4 -67 4 -58 Hor. hold counter -clockwise 4 -58 Hor. hold clockwise 5 -15.0 5 -15.0 ----- *High Voltage Pulse Present *High Voltage Pulse Present *High Voltage Pulse Present 2 90 2 90 At average Brightness 23 100 17T150, 17T151, 17T163 R -F UNIT WIRING DIAGRAM IS or r 55 -REAR . L. L54 8 pIT L42 LOS I -I - 54 -FRONT P I I 55- REAR `Ly L24 53- FRONT 52 -REAR 00 C IS 1I 0L49 0 V2 Li 132N L57 _ X11111111 L51 B C 22 0 L65 C13 lllllllllll . Figure 77 -R -F Unit Wiring Diagram SWITCH CONNECTIONS AS SHOWN ARE VIEWED FROM DIRECTION Of ARROWS. 51 -FRONT L9 e:r CI C 2 I .0-48164- 0 CRITICAL LEAD DRESS: 1. Keep all wiring in the pia i-f, sound i-f and video circuits as short as possible. 2. Keep 8111, the leads on R112, R114, RC111150a, nCd1R1213, 3C1as12s, hCo2r0t0a, nRd10d9i,rRec1t10a,s possible. 3. Do not change the bus wire connection to pin 2 of V101 and V102. Sleeving is used on these wires to insure length and to prevent shorting. 4. Dress C114 down between R117 (volume control) and wafer S101-2. 5. Ground R130 to pin 3 of V106 and R138 to pin 7 of V107. 6. Do not change the grounding of R141, R146 and R149. 7. Keep the bus wire from T109 -A to C146 (plug in capacitor) short and direct. 8. Ground the filaments of sockets independently of the socket center V107, V108 and V109 pin. Use ground lances proved near each socket. 9. Dress C198 straight up to act as a shield between T101 -A and V110-4. 10. Dress C153 and 8170 (kine cathode) up in the air above the terminal board. 11. Kgeueidpet)hedolewandsscootnhnaetcttheedytowTi1l1l 3n-oCt and T113 -D (syncho- short out when the chassis is placed in the cabinet. 12. Do not reroute any wires between T104 and the terminal board alongside it. Keep all leads on the foot side of the terminal board. 13. Dress all wires routed past T104, shielded wires W102 and W103 under the big lances near T104. 14. Dress all a -c leads to 5102 under the large lances on the front apron. 15. Dress R116 close to the chassis with leads as short as possible. 16. Dress C212 and C221 up in the air and away from all other leads and components. 17. The blue lead from pin 5 of V111 to the terminal board under the high voltage cage should be routed between V117 socket and the rear apron. 18. Dress all 2 watt resistors away from each other and all other wires and components. 19. Dress all wires away from damper tube V120. 20. Blue wire from pin 5 V116 to T113 -A should not be more than 5 inches long. 21. Dress all peaking coils up and away from the base. 22. Dress all leads in the high voltage compartment away from each other and away from the high voltage trans- former. 24 107 17T150, 17T151, 17T163 REPLACEMENT PARTS (Continued) STOCK No. DESCRIPTION 76141 76633 76728 18469 76464 76675 76452 76796 76639 76465 76469 76390 76638 502043 30732 504047 502056 34763 13961 502110 504110 503118 503133 503147 504147 513147 513156 34766 503210 504210 30731 503212 503222 504233 30694 503239 503247 504247 503256 14659 503268 513268 523268 502282 503282 503310 504310 503312 503315 523315 503318 523318 503322 71989 513322 503327 513327 503333 513333 503339 503347 513347 502356 503356 513356 503368 504368 513368 8064 512382 513382 Magnet -Ion trap magnet (P.M. type) Magnet -Pin cushion correction magnet complete with support arm Nut -Spend nut for trimmer capacitor 76800 Plate -Bakelite mounting plate for electrolytic 75220 Plate -Hi -voltage plate-bakelite-complete with tubs socket and corona ring Rectifier -Picture detector crystal rectifier (CR101) Rectifier -Selenium rectifier (SRI01, SR102) Resistor -Wire wound. 5.1 ohms, V3 watt (R241) Resistor -Wire wound, 180 ohms, 2 watts (R234) Resistor -Wire wound, 330 ohms, 1 watt (R122, R123) Resistor -Wire wound, 2500 ohms, 10 watts (R131) Resistor -Wire wound, 5600 ohms, 5 watts (R151) Resistor -Wire wound, 6000 ohms, 6 watts (R163) Resistor -Fixed, composition: - 43 ohms, ±5%, 1/2 watt (R159) 47 ohms, ± 5%, 1/2 watt (R109) 47 ohms, ±20%, 1/2 watt (R233) 56 ohms, ±5%. 1/2 watt (R138) 68 ohms, ±5%, 1/2 watt (R105, R146) 82 ohms, ± 5%, 1/2 watt (R101) 100 ohms, ± 5%, 1/2 watt (R130) 100 ohms, ±20%, 1/2 watt (R126, R133) 180 ohms, ± 10%, 1/2 watt (R152) 330 ohms, ± 10%, V2 watt (R160) 470 ohms, ± 10%, 1/2 watt (R215) 470 ohms, ±20%, 1/2 watt (R177) 470 ohms, ± 10%, 1 watt (R246) 560 ohms, ± 10%, 1 watt (R253) 1000 ohms, ±5%, 1/2 watt (R111) 1000 ohms, ± 10%. 1/2 watt (R135, R137, R142, R153, R180) 1000 ohms, ±20%, 1/2 watt (R103, R108. R125, R140, R148, R156) 1200 ohms, ±5%, 1/2 watt (R110) 1200 ohms, ± 10%, 1/2 watt (R183) 2200 ohms, ± 10%, 1/2 watt (R168) 3300 ohms, ±20%, 1/2 watt (R259) 3900 ohms, ± 5%. 1/2 watt (R157) 3900 ohms, ± 10%, 1/2 watt (R228) 4700 ohms, ± 10%, 1/2 watt (R162) 4700 ohms, ±20%, 1/2 watt (R147) 5600 ohms, ± 10%, 1/2 watt (R164) 6800 ohms, ±5%, 1/2 watt (R114, R115, R141) 6800 ohms, ± 10%, 1/2 watt (R158. R176) 6800 ohms, ± 10%, 1 watt (R155) 6800 ohms, ± 10%, 2 watts (R235) 8200 ohms, ±5%, 1/2 watt (R229) 8200 ohms, ± 10%, 1/2 watt (R165. R196, R197, R212) 10,000 ohms, ± 10%, 1/2 watt (R208) 10,000 ohms, ±20%, 1/2 watt (R172) 12,000 ohms, ± 10%, I/2 watt (R178, R181) 15,000 ohms, ± 10%, 1/2 watt (R258) 15,000 ohms, ± 10%, 2 watts (R173) 18,000 ohms. ± 10%, 1/2 watt (R106, R113, R271) 18,000 ohms. ± 10%, 2 watts (R161) 22,000 ohms, ± 10%, 1/2 watt (R118, R195) 22,000 ohms, ±5%, 1 watt (R210, R211) 22,000 ohms, ± 10%, 1 watt (R227) 27,000 ohms. ± 10%, 1/2 watt (R102, R119) 27,000 ohms, ± 10%, 1 watt (R184) 33,000 ohms, ± 10%, 1/2 watt (R273) 33,000 ohms, ± 10%, 1 watt (R169) 39,000 ohms, ± 10%, V2 watt (R112, R194) 47,000 ohms, ± 10%. 1/2 watt (R104, R191, R265, R267) 47,000 ohms. ± 10%, 1 watt (R132, R139, R269) 56,000 ohms, ±5%. 1/2 watt (R149) 56,000 ohms, ± 10%, 1/2 watt (R187, R236, R256) 56,000 ohms, ± 10%, 1 watt (R107) 68,000 ohms, ± 10%, 1/2 watt (R128, R143) 68,000 ohms, ±20%, 1/2 watt (R198, R205) 68,000 ohms, ± 10%, 1 watt (R226) 82,000 ohms, ± 5%, 1/2 watt (R144) 82,000 ohms, ± 5%, 1 watt (R231) 82,000 ohms, ± 10%, 1 watt (R225) STOCK No. DESCRIPTION 503410 504410 30180 503412 503415 504415 512415 503418 503422 503427 503433 512433 503447 504447 503456 30562 503482 503510 504510 503512 503515 11769 504522 503539 503556 503582 504610 71456 76455 73584 71508 50367 73117 73115 75222 76453 31251 75718 74834 75173 76636 76428 76446 76795 76440 76429 76439 76438 76437 76431 76432 76434 76435 76433 76436 76482 76616 100,000 ohms, ± 10%, 1/2 watt (R129, R206, R220, R268) 100,000 ohms, ± 20%, 1/2 watt (R136) 120,000 ohms. ± 5%. 1/2 watt (R209) 120,000 ohms, ± 10%, 1/2 watt (R190, R242, R245) 150,000 ohms, ± 10%, 1/2 watt ('42145, R150. R186, R221) 150,000 ohms, ± 20%, 1/2 watt (R170, R217) 150,000 ohms, ± 5%, 1 watt (R230) 180,000 ohms, ± 10%, 1/2 watt (R257) 220,000 ohms, ± 10%, 1/2 watt (R185, R219) 270,000 ohms, ± 10%, 1/2 watt (R193) 330,000 ohms, ± 10%, 1/2 watt (R120, R222) 330,000 ohms, ± 5%. 1 watt (R224) 470,000 ohms, ± 10%, 1/2 watt (R199, R232, R264) 470,000 ohms, ±20%. 1/2 watt (R121, R263) 560.000 ohms, ± 10%, 1/2 watt (R202, R270) 680,000 ohms, ± 5%, 1/2 watt (R127) 820,000 ohms, ± 10%, 16 watt (R200, R204, R223) 1 megohm, ± 10%, 1/2 watt (R189) 1 megohm, ± 20%, 1/2 watt (R182) 1.2 megohm, ± 10%. 1/2 watt (R171) 1.5megohm, ± 10%. 1/2 watt (R192) 1.8 megohm, ±5%, 1/2 watt (R266) 2.2 megohm. ±20%, 1/2 watt (R207, R213) 3.9 megohm, ± 10%, 1/2 watt (R179) 5.6 megohm. ± 10%, 1/2 watt (R166) 8.2 megohm, ± 10%. 1/2 watt (R255) 10 megohm, ± 20%. 1/2 watt (R116) Screw -#8-32 x 7/16" wing screw to mount deflection yoke Shaft -Connecting shaft (nylon) for picture and brightness controls Shield -Tube shield Socket -Tube socket for 1B3GT /8016 Socket -Tube socket, 6 pin, moulded, saddle mounted Socket -Tube socket, 7 pin, wafer, miniature Socket -Tube socket, 7 pin, moulded, miniature, plate mounted Socket -Tube socket, octal, ceramic, plate mounted Socket -Tube socket, octal, moulded bakelite, plate mounted Socket -Tube socket, octal, wafer Socket -Channel indicator lamp socket and lead Socket -Kinescope socket Stud -Adjustable stud for trimmer capacitor 76800 Stud -Adjusting stud complete with guard for focus magnet Support -Bakelite support only -part of hi -voltage shield Switch -Tone control and phono switch (S101) Transformer -Hi -voltage transformer (T114) Transformer -Horizontal oscillator transformer com- plete with adjustable cores (T113) Transformer -Power transformer, 115 volts, 60 cycle (T112) Transformer -Ratio detector transformer complete with adjustable cores (T102, C108, C109) Transformer -Sound i-f transformer complete with adjustable cores (T101, C103, C104) Transformer -Sound take -off transformer complete with adjustable cores (T110. C148) Transformer -Vertical output transformer (T111) Transformer -First pix i-f grid transformer complete with adjustable cores (T104, C121, R124) Transformer -First pix i-f plate transformer complete with adjustable cores (T105, C130, C131, R134) Transformer -Second pix i-f grid transformer complete with adjustable core (T106, C133) Transformer -Third or fourth pie i-f transformer (T107, T108) Transformer -Fifth pix i-f transformer (T109, C145. C147, CR101, L102, R154) Trap -4.5 me trap (L114, C137) Yoke -Deflection yoke complete with 6 contact male connector (L109, L110, L111, L112, C199, R243, R244, R262, P102) 31 108 17T150, 17T151, 17T163 REPLACEMENT PARTS (Continued) STOCK No. DESCRIPTION 5039 76834 76156 SPEAKER ASSEMBLY 971614 -1W RL100D3 RMA-274 For Model 17T150 Connector -4 contact male connector for speaker (J101) Speaker -4" x 6" P.M. speaker complete with cone and voice coil less transformer and connector Transformer -output transformer (T103) 75024 5039 75022 75520 SPEAKER ASSEMBLY 971490-2W RLIO5E8 RMA-274 For Models 177151, 177163 Cone -Cone and voice coil assembly (3.2 ohms) Connector -4 prong male connector for speaker (J101) Speaker -8" P.M. speaker complete with cone and voice coil (3.2 ohms) less transformer and plug Transformer -Output transformer (T103) 77129 SPEAKER ASSEMBLIES 971490 2R RMA285 For Models 17T151, 17T163 Cone -Cone and voice coil Note: -If stamping on speaker in instrument does not agree with above speaker number, order replacement parts by referring to model number of instrument, number stamped on speaker and full description required. X3249 X3250 7CB8 CABINET BASE For use with Model 17T15(), 17T151 Pull -Door pull -mahogany finish -for maroon bases Pull -Door pull -blonde finish -for mahogany bases 76805 76827 76184 76811 76812 76814 76829 76823 X3128 X3222 X3248 39153 75474 71457 76818 76807 MISCELLANEOUS Back -Cabinet back complete with power cord and terminal board for Models 17T150, 17T151 Back -Cabinet back complete with power cord for Model 17T163 Board -"Antenna" terminal board Bracket -Hanger bracket for deflection yoke hood for Models 17T150, 17T151 Bracket -Hanger bracket for deflection yoke hood for Model 17T163 Bracket -Stiffening bracket for kinescope cradle (2 req'd) for Models 17T150, 17T151 Bracket -Stiffening bracket for kinescope bracket (2 req'd) for Model 17T163 Clip -Spring clip for spacing ground braid Cloth -Grille cloth for Models 17T150, 17T151 Cloth -Grille cloth for oak instruments for Model 17T163 Cloth -Grille cloth for mahogany or walnut instruments for Model 17T163 Connector -4 contact male connector for antenna cable Connector -Single contact male connector for antenna cable (2 req'd) Cord -Power cord and plug Cushion -Rubber cushion (1/16" x 1" x sis " . 1/4") for kinescope and cradle support (4 req'd) Cushion-Vinylite cushion (formed) for picture opening STOCK No. DESCRIPTION 76511 76512 75456 74889 76806 76595 76596 76593 76594 76591 76592 74963 75464 76597 76598 11765 75459 76589 76822 71455 76177 76819 76825 76824 76826 76828 76816 76809 76810 76821 76808 73643 76820 30330 14270 72845 36580 76813 76817 76815 75457 75500 75458 76836 Decal -Control panel function decal for maroon, ma hogany or walnut instruments Decal -Control panel function decal for blonde or oak instruments Escutcheon -Channel marker escutcheon -gold Foot -Felt foot for cabinet (4 req'd) for Models 177150, 177151 Glass -Safety glass Kn-mobar-oBornig(hotnuetesrs)control or vertical hold control knob Knob -Brightness control or vertical hold control knob -beige (outer) Knob -Channel selector knob -maroon (inner) Knob -Channel selector knob -beige (inner) Knob -Fine tuning control knob -maroon (outer) Knob -Fine tuning control knob -beige (outer) Knob -Picture control, horizontal hold control or volume control and power switch knob -maroon (inner) Knob -Picture control, horizontal hold control or volume control and power switch knob -beige (inner) Knob -Tone control and phono switch knob -maroon (outer) Knob -Tone control and phono switch knob -beige (outer) Lamp -Channel marker escutcheon -lamp -Mazda 51 Mask -Channel marker escutcheon light mask -burgundy Mask -Channel marker escutcheon light mask -me dium dark beige Nut -Speed nut to lock flexible straps Nut- #8-32 wing nut to fasten deflection yoke hood to hanger bracket Nut- # 10-32 special nut for deflection rods (2 req'd) Pad -Rubber pad (channel) for flexible straps (2 req'd) Pad -Rubber pad (channel) mounted on cradle support to cushion kineecop Panel -Metal front panel for mahogany or walnut in - struments for Model 17T163 Panel -Metal front panel for oak instruments for Model 17T163 Plate -Plate complete with weld bolts for kinescope cradle lower support for Model 17T163 Retainer -Safety glass retainer (2 req'd) Rod -"L" shape threaded rod to support deflection yoke hood assembly (2 req'd) for Models 17T150, 177151 Rod -"L" shape threaded rod to support deflection yoke hood assembly (2 req'd) for Model 17T163 Screw- #10 x 13/8" hex head tapping screw to lock flex - ible straps Sleeve -Polyethylene sleeve for insulating high voltage lead -on R.H. support rod Spring -Channel marker escutcheon spring clip Spring -Formed spring for safety glass retainers (4 req'd) Spring -Retaining spring for knobs 74963 and 75464 Spring -Retaining spring for knobs 76593, 76594, 76595, 76596, 76597, 76598 Spring -Retaining spring for knobs 76591 and 76592 Spring -Suspension spring (coil type) for ground braid Strap -Flexible steel strap to secure kinescope Support -Cradle support for kinescope Support -Lower support for kinescope cradle support Washer -Felt washer -dark brown -between knob and channel marker escutcheon Washer -Felt washer for cabinet back mounting screws Washer -Felt washer -beige -between knob and chan- nel marker escutcheon Washer -Cellulose washer -gold -for knobs The system of employing an asterisk before the stock number of new items has been discontinued. APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS. 32 11101-F SPEAKER PLUG (REAR) .2 if 4, 5101-1 io REAR os.6 16 CMAPIKEL IRO LAMP CHASSIS WIRING DIAGRAM BRN C/42 R -F SECTION SEE DRWG. 48784 101- 102 17T150, 17T151, 17T163 7110 5A ,-GRR-WKT V106 MI 'INT fin allimamo*4f4 bd I :lab 7104 12Si C153 API RIG7 PtC7DKE V113 GRK WIT ERN WKT. CI815 J 102-F KINESCOPE PLUG TO PLATE CAP OF VII? 0 1 ° 04 \ 0 03 \ T114 ICE479IS TO PLATE CAP OF V119 It= %'C197 '0140LE BLK RED OLD BRN. C180 C156 au -WIT. 2 &LK Li07 'LK* HOLE Figure 78-Chassis Firing Diagram 25 26 103 -104 CIRCUIT SCHEMATIC DIAGRAM 17T150, 17T151, 17T163 ANT. T.B. U BAL. 4 CI 2 1 4 ANT MATCHING UNIT §00...ra. LEO I -F TRAP 41.25 MC. L59 L58 I -F TRAP F-134 co A5.75 MC. TRAP 01 B REAR VIEW R - UNIT 127 1000 PIA- NI REAR VIEW .11- F FRONT VIEW T2 I L.1 ANT. 1 TRANS C27 , C25 C24 18 It!i, r.e-T 27 33 o T C19 812 R13 22 3300 150 13 12 11 o loe 9° ; 0 8 55 55 FRONT REAR I, o 2 12 03 110 .4 ,00 os 8 2 L54 L42 L43 L44 L45 L.55 1.52 1.37 L36 1.35 1.34 L33 L32 L53 l-s-AAATC2n 8 11500 r L39 F211 3300 1.40 54 L41 FRONT 53 -FRONT 1C-I48 53 -REAR L49 V2 6 R B -F 0".'7L.470R8K R 14 1000 7 V101 6AU6 1ST. SOUND I -F AMPL. C101 I .01 Y R101 82 T101 SOUND I -F TRANS. 4.5 MC. 115 v102 6A U 6 2ND. SOUND I -F AMPL. C102 A C1028 Cloy 56 T01 1.01 C106. R105 R10010 030' I 68 0)075 01076 .01 T1OZ RATIO DE T. V 103 GALS TRANS. 4.5 MC RATIO DETECTOR 6.8 v./Th : JE:226? 1 I 1 -- i i-1)°09-1.;-- - - 8110 -0.9V 1200 T -J4.. 70 ....,C2.00 5 MF. ....C112 4. a .., ..4.4. RII4 6800 R1I5 6800 CI14 .0047 RII7 1.5 MEG VOL CoNTR CIIS z .01 -0. 250K 4 250 R116 10 MEG. I RI19 R108 27K 1000 R4.7'"..14.C.-313.100.1-. 1R00"01 4.9*1R0K0IC2II32 C116 t P.118 ,015 > 22 K +265V. FUNCTION SWITCHES VIEWED FROM FRONT, AND SHOWN IN P03.1 MAX. COUNTER- CLOCKWISE) Pos. -TV MR4.14i6145. 2 -TV NORMAL. 3 -TV MIN. LOWS 4 -PHONO. MIN, HIGHS. 5-PHONO. NORMAL. + 265V. 101- 2 FRONT la 10 SRI:AIR-21+ 11/3 t4itiTEL .11 9 5 J103 PHONo INPUT -C207 °F5 '10C02I5 v 104 6A V6 1ST. AUDIO AMP L. +1 R12I +17V 4 47013 C1113 8122 .0027 -o 330 I "-I C217170 1 3R3I200K 3R3I 203 v 105 6A 0.5 AUDIO OUTPUT PI01-F REAR vIEW LU 50 V. -7 7- CHIN oR SRN C2050 20 MF. C205 C 10 mP. J 101- AI 7103 PIN AUDIO viEw OUTPUT TR. 14 2 5 RED V.0 V 134 SPEAKER R472046 + 265V. SI01-1 FRONT 1 10 +265V. 2 it 1 1 TI5C0130 C12 270 PG 100K 120 L50 L IX L28 L28 02 03 L29 L25 -'4 30 L24 0.5 1.23 31 7 G C14 L22 270 Fr°1.1-.*WIR5 0 TP2 10013 = 52 -FRONT L17 LIG o2 LIE 04 L14 °S L 13 L47 LIZ STRAIGHT WIRE C 10 470 52 -REAR ,z. 15 Ito 100 1.19 1.20 1.21 7 .L48 260v C 15 0.8- 133 TO I38v. L5I C28 10510601 15001 3.8 R9 47 V eil 9 4 3 133 To 4.1.35.,7 5 V. 8 L65 . 435 Mc 5,', TI041ST. PIX. 1-F V106 6AU 6 GRID TRANS.1ST. PIX. C17 RIO C23 LS7 15001= 82 1500T TI 1+ -TRACONNYS. .7W51. ICI! r55-80 VI 0° + 145 TO + 150V. 6X8 : 05C. AND MIXER 2!713<0, COA X. I. +58 To +108 V. L5 4 c..1 1455 1500. 39:ITS I -F AMPL. + 150V. WIO7 ;IRA, pp- EfIg<4 La -6"' R158 0122 6800 1-1i- 4700 R130 100 V C127 0 4.700 C12e 4R713K.1 R4 3300 LG4 L63 r C134 p2I25 4700 1000 o. "t-1 CI21; 4700 T105 1ST. PIX. I -F PLATE TRANS. T106 2ND. Pig. I -F GRID TRANS. 8134 4700 C130 I 1 100 1 C131 I I1 15 IB C 133 12 41.25110. I I MC,' I I 44;7.i2c5 C 8135 1000 C2251 82 = R137 1000 IT -j_ C132 T 4700 CIs2o1oT L.56 C22 11 500 R177 470 R133 100 12151 560o R136 100 K 6-PHONO. MIN. LOWS. V107 6CB6 2ND. PI X I -F AMPL. > 5 +145 V. 7 T 107 3RO. PIX. I -F TRANS. 41.5 MC. A R141 6600 C I35A CI35B C 4700 4700 Fr) 4- R139 471( R140 R146 1000 68 L.101 71.1$11.) V108 6C B 6 I- F AMPL. T 108 4TH. PIK. TRANS. 45.5 MC. v 109 6C B 6 4TH. PIX. 1- F AMPL R149 56K C1414 C1412, 4700 4700 Fri C MO R147 RI48 CI42 4700 1000 4700 > 4 R152 RI53 180 1000 C1425 4700 T 109 T 110 5TH PiX. I -F souNd TRANS. L102 TAKE -OFF D A -30 TRANS. -(TOPI --(Top Mu'R TP102. RI88 3300 R 156 1000 CI45 8 A CRIOI Ct47 I 10 I 437 L103 C1413 72 MU -17 10 010I -RED CI,TET 1500 tt R 157 54.5:41 390o c227 C144 R269 47K I R155 - r 6800 C198 0 I c 216 = .01 L113 R263 500 mu 470K GEN-tv R159 43 3 R271 VII0 6AG7 VIDEO AM PL. L104 93 A4L1-14 0 RN Cl2oI9 LI14 4.5MC.TRAP BLU-YEL. + ioov R261 toK 4725V. 8212704 C137 47 C2058 L105 R "F 50o Mu.H GRO.5s1 C 100 R 161 16 K R163 6000 R162 4700 C 150 1000 33 4R7206K4 RI69 33K R168 220o R167 IS K PICTuRE CoNTR. toeC-93.8 L16 3.. CB '015-` Lik 51 -FRONT C3 10 ) 1 C -2.8 To 3.5 V C2 FINE TUNING 10K +13, %Ns -C6 11500 26 0 11 RI27 6503 C1242 mF C214 047 4.4.-C71043013 C41740304 1147C0I203 +265V TP101 + 2 R131 2500 +143 V. I 5Cm20F6.B 12143 65K C139 .01 47K 120 K 18 K 265 v. C223 .1104 +265V. R270 560 K R170 150K CI53 0.1 JEWEL ON CONSOLES CHANNEL IND. LAMP L10/ L9 0 L8 L-7` 1:6- LS Ik L1 1.2 L3 4 TOC.765 RI S1 C5 100 K 122 CHANNEL BELECTOR SWITCHES VIEWED FROM FRONT AND SHOWN IN CHANNEL NO. Z (54 - GO MC.) POSITION. Tom ANT TB 00. BAL. ANT MATCHING UNIT L6o I -F TRAP 41.25 . L SS L-5-117/ 1-0 T1100 0,1 45.75 TRAP PI B -NI REAR VIEW R- F UNIT M REAR VIEW .11- F I T2 FRONT : ANT. VIEW TRANS SO 50 , 2FRON REAR 11 ne 3 L54 L42 .43 L44 L4S L55 19 RI2 Ri3 22 3300 i5o E-""'W'rr2r3- L313 11500 L3S LEO LI RII 3300 54 FRONT -C125 Ri2B 14700 68K 4C720204 4C710260T Rt29 look C2I2 .047 R255 8.2 MEG. R257 180K -M94. R256 RI76 56K 680 I -F A.G.0 C138 VIII vim 6CI3 6 65N7-GT AMPL. NOR. SyNC.AmPL. R181 +143V 12K R17811c156 2 475* I2K > to 158 R14.4 82 K 61145 150K vt13 65N7-GT SYNC. SEPARATOR 4400V. R192 1.5 MEG RI57 561( VI1A,A, 65N7-GT VERT. SYNC AM PL . 0161 5 idl .047 4.11V. 5 - 4.80V 4.265V 4 8172 1013 C155 R 179 4 3.914E6 3 a R182 1 KE6 8184 27K 3 R245 120K 12171 R 173 MC 2064 CI57- R180 IC51: - 1.261E6 151( I10 14F 82 1000 RI83 1200 R175 50 K A.G-C CONTR 0159 .01 8186 CI60 150K .022T R189 2.4EG. +265V. TZ .7 R20113 50 K +265V R268 100K V114 B 65N 7-GT VERT. SwEEP CI62 RI95 RI96 R197 0165 8198 °sc. DISCH. .01 22K 8200 8200 .001 68K -t4.1 v. R205 R206 C172 CI75 8813 100K .0022 .022 R194 C163 C164. CI66 RIGG 39K 100221004710047 154E66. RI93 270K R199 470K R2014 I MEG. VERTICAL HOLD CONTR. +53V C167 - 390 C169 0.1 CI68 CI73 R22.207 1.001 10022 MEG. R210 2213 R211 22K 87 C01.7,0 R205 6-1 10 K R2o4t Cl/ 820KN .033 R202. , 3 560K R209 120K 4265V. 2.5 MEG HEIGHT CONTR BEN v 15 6A0.5 VERT. SWEEP OUTPUT Ws. R219 22o K R215 f R2I7 TIII 20OR 1 ISOK VERTICAL BRiGHTN5 90 V. 1.1.1 OUTPUT TR IsLur G.R.N R220 1.0178 C176 100K 0.1 .047 YEL Wo 8259 3300 C2I31 R258 R160 330 .0047 I IS /3 GLASS 10 4470V. OATING R214 1500 VERT. LINE. CONTR. emmom. R2t5 470 +265v VIZI 170.P4 KINESCOPE R7 1000 53 -FRONT CI8 1-4 So -REAR 149 66v207 R -F AMPL R8 4.70K RIL 1000 7 127 L28 LOS 15002 L213 LOS m i1%029 30 L24 45.5 MCI L31 Ll R6 R5 100K 100K 93 -FRONT 330IS CID SV.So 6XviS 52.REAR OSC.AND MIXER C7.1v. 71 - TRANS. 735 1-44 27N Lle L13 Llo L21. :ZS C3 12 021 500 =1500 .6 To 3.3 v. as 10K 86822K6 140R. HOLD CONTR. R227 22K - 0182 0185 - 68 .047 C18IA 10-160 HORiZ. ..oCKiNG RANGE R222 330K C.183 0.1 R223 -19.5v C220 12224 12221 330K 1501( vile 65N7- GT HOR.5WEEP 05C. AND CONTR. 5 4430v. R22 8200 Tt13 NOR. OSC. TRANS. tt IC CI87 I 330 0158 .01 4- 265V. R200 820K C189 680 R232 470 K V117 65 0.6-GT HOR. SWEEP OUTPuT R233 47 -15V C 1818 10- 160 HoRtz. DRIVE CONTR R235 6800 4 168 C192 a 0.1 Y R231 8213 C v30 820 C201 r." R234 180 C191 F 101 0.2 AmP 51.0 - BLOW R236 56 K %71 NOR SWEEP OUTPUT AND H V TRANS, 7114 VII9 153-GT 14-V RECT. 15C0I907 4 L 106 +5 BOOST I; CWoIDt..TxHa 3032101 C196 .027 3 VI20 L115 6W4'0" 1.5 MU -11 DAMPER +261V L107 022714 tt HOR. LIN. CoNTR. R253 560 0177 220 E10 3 J I I 5, 1U 7 13,200 V. PI02 - DEFL. YOKE PIN VIEW 0199 91 R262 000 vERT C0iLS I RE I.110 Lio9 GR.N 5243 8244 I 560 960 1 YES. C2054 100 MKT L108 =ILTER CHOKE 0203 150 MF J 102-F REA.R VIEW EILU-TEL i4 6. r 1.2A LI19, +265V. SUPPLY EE- 47910 - 1 CI80 .047 6.3V 6.3Y o.64. CI79 .047 T 12 I w103 9103 INTERLOCK 55 v. 60 SUPPLY SI RONT LI L2 L3 4 LSLS CI R1 IOOK FiNE ruNING CS 22 -re ilsoo CHANNEL SELECTOR SWITCHES VIEWED FROM FRONT AN0 SHOWN IN CHANNEL N0.2 (54- SO MC.) POSITION. Sorne early production r -f units may be wired as shown in the partial schematic diagram. Later production units wired as shown in Figure 19 are marked "Ml". Replacement parts are affected. All resistance values in ohms. k = 1000. All capacitance values less than 1 in MF and above 1 in MMF unless otherwise noted. Coil resistance values less than 1 ohm are not shown. Direction of arrows at controls indicates clockwise rotation. All voltages measured with "VoltOhmyst" and with no signal input. Voltages should hold within ±20% with 117 v. a -c supply. In some receivers, R273 at V107-1 was omitted. In some receivers, F101 was .25 amp. "fast blowing" type fuse. 27 2 8 Figure 79 -Circuit Schematic Diagram 105 17T150, 17T151, 17T163 REPLACEMENT PARTS STOCK No. DESCRIPTION 76539 76531 76522 76845 75186 93056 70597 55326 76550 54207 76557 76558 70935 76739 76527 75199 76552 75198 75166 73748 75610 71088 75184 76545 76781 76532 76143 73591 76560 73477 R -F UNIT ASSEMBLIES KRK1I Board -Antenna matching transformer terminal board less coils L58, L59, L60 and less capacitors C24, C25, C26, 027 Board -Terminal board, 5 contact and ground Bracket -Vertical bracket for holding r -f OSC and mixer tube (6X8) shield (early production) Bracket -Vertical bracket for holding oscillator -mixer tube shield (production marked "Ml") Capacitor -Ceramic, variable, for fine tuning -plunger type (C2) Capacitor -Ceramic, 5 mmf. (C26) Capacitor -Ceramic, 8 mmf. (C29) Ca"pMacIi"t)or -Ceramic, 10 mmf. (C3) (production marked Capacitor -Ceramic, 12 mmf. (C3) (early production) Capacitor -Ceramic, 18 mmf. (C27) Capacitor -Ceramic, 22 mmf. (C19) Capacitor -Ceramic, 22 mmf. (C5) , Capacitor -Ceramic, 27 mmf. (C25) Capacitor -Ceramic, 33 mmf. (C24) Capacitor -Mica trimmer, 55-80 mmf. (C11) Capacitor -Ceramic, 270 mmf. (C12, C14) Capacitor -Ceramic, 330 mmf. (C10) (early production) Ca"pMacIi"to)r -Ceramic, 470 mmf. (C10) (production marked Capacitor -Ceramic, 1500 mmf. (stand-off) (C13, C17, C21, C22, C28) Capacitor -Ceramic. 1500 mmf. (C16, C20, C23) Capacitor -Ceramic, 1500 mmf. (C6) Capacitor -Ceramic, 0.68 mmf. (C7) Capacitor -Ceramic, adjustable, 0.75-4 mmf. complete with adjusting stud (C1, C9) Capacitor -Tubular, steatite, adjustable 0.8-2.25 mmf. (C8) (early production) Capacitor -Tubular, steatite, adjustable 0.8-1.4 mmf. (C8) (production marked "Ml") Capacitor -Adjustable trimmer, steatite, 1.0-4.0 mmf. (C18) Clip -Tubular, clip for mounting stand-off capacitors Coil -Antenna matching coil (2 req'd) Coil -Channel #13 converter coil (L47) (early production) Coil -Choke coil (L57) 76562 76537 76538 76529 76559 38853 76460 75187 76543 76521 73453 76524 503047 503082 504115 504210 503233 504310 Coil -R -F amplifier coupling coil (1.51) Coil -Shunt coil complete with adjustable core (L61) Coil -Shunt coil complete with adjustable core (1.62) Coil -Trimmer coil (3 turns) with adjustable inductance core and capacitor stud (screw adjustment) for r -f section (L49, CIS) Connector -Oscillator grid connector Connector -4 contact female connector -part of antenna matching transformer Contact -Test point contact Core -Adjustable core for fine tuning capacitor Core -Adjusting core for FM trap Detent-Detent mechanism and fibre shaft Form -Coil form for coils L48, L50 & 1.53 Link -Link assembly for fine tuning Resistor-Fized, composition: - 47 ohms, ± 10%, 1/2 watt (R9) 82 ohms, ± 10%, 1/2 watt (R10) 150 ohms, ±20%, 1/2 watt (R13) 1000 ohms, ± 20%, 1/2 watt (R7, R14) 3300 ohms, ± 10%, 1/2 watt (R4, R11, R12), 10,000 ohms, ± 20%, 1/2 watt (R2) STOCK No. DESCRIPTION 504410 100,000 ohms, ± 20%, 1/2 watt (RI, R5, R6) 504447 470,000 ohms, ±20%, % watt (R8) 14343 Retainer -Fine tuning shaft retaining ring 75164 Rod -Actuating plunger rod (fibre) for fine tuning link 76547 Screw- # 4-40 x 1/2" adjusting screw for coils L6, L7, L8, L9, 1..10, L11 76548 Screw- # 4-40 x 5/16" adjusting screw for coils LI, L2, L3, L4, 1.46 76549 Screw- # 4-40 x 1/2" adjusting screw for coil 1.5 76519 Shaft -Channel selector shaft and plate 76134 Shaft -Fine tuning shaft and cam 76518 Shield -Front shield complete with shaft bushing and bracket 76534 Shield -Tube shield (plain) for V2 (also VI in "Ml" production) 76533 Shield -Tube shield (lead coated) for VI (early production) 76336 Socket -Tube socket, 9 pin, miniature, bakelite, saddle mounted 76530 Socket -Tube socket, 9 pin, miniature, ceramic, saddle mounted 75191 Spacer -Insulating spacer for front plate (4 req'd) 75163 Spring -Friction spring (formed) for fine tuning cam 30340 Spring -Hairpin spring for fine tuning link 76523 Spring -Retaining spring for oscillator mixer tube shield (early production) 75068 Spring -Retaining spring for oscillator mixer tube shield (production marked "Ml") 73457 Spring -Return spring for fine tuning control 76554 Stator -Antenna stator complete with rotor, coils, capacitor and resistor (S5, L42, L43, L44, L45, L54, 1.55, C20) 76551 Stator -Converter stator complete with rotor, coils, capacitors and resistors (S2, L12, L13, 1.14, L15, L16, L17, L18, L19, L20, L.21, 1,48, CIO, C12, R4, R5, R6) (early production) 76780 Stator -Converter stator complete with rotor, coils, capacitors and resistors (S2, L12, L13, 1.14. L15, L16, L17, t1i.o1n8,mL1a9rk, 1e.d20'',MLl2"1), L48, C10, C12, R4, R5, R6) (produc- 76546 Stator -Oscillator stator complete with rotor, coils, and capacitor (Si, C3, Cl, Ll, L2, L3, L4, LS, 1.6, L7, L8, L9. 1.10, LI1, L46) (early production) 76779 Stator -Oscillator stator complete with rotor, coils, and capacitor (Sl, C3, C7, Ll, L2, L3, L4, L5, L6, L7, L8, L9, LIO, L11, L46) (production marked "Ml") 76556 Stator -R -F grid stator complete with rotor, coils and resistors (S4, L32, L33, L34, L35. L36, L37, L38, L39, 1.40, 1.41, 1.53, 019, R11, RI2) 76553 Stator -R -F plate stator complete with rotor, coils, capacitor and resistor (S3, L22, L23, L24, L25, L26, 1.27, L28, L29, L30, L31, L50, C14, R7) 76561 Strap -Channel #13 r -f grid strap (L52) 76526 Strip -Coil segment mounting strip -1..H. lower 76544 Strip -Coil segment mounting strip-L.H. upper -less trimmer 76525 Strip -Coil segment mounting strip-R.H. center 75446 Stud -Capacitor stud -brass- # 4-40 x 13/16" with 3/64" screw driver slot for trimmer coil L49, CIS uncoded and coded "ER" 75447 Stsucdre-Cwadparicviteorrssltoutdfo-brrtarsism-m#4e-r4c0ozil1L3/4196,"Cw1i5thc3o/d6e4d" numerically and "Hi ()" 76740 Stud- # 6-32 x 1" adjusting stud for capacitor No. 76545 (early production) 75173 Stud -#6-32 z 13/16" adjusting stud for capacitor No. 76781 (production marked "Ml") 76536 Transformer -Antenna matching transformer complete (T2, C24, C25, C26, C27, L58, L59, L60, L61, 1.62, Jl) 76528 Transformer -Converter transformer (T1. R3) 76540 Trap -FM trap complete with adjustable core (L58) 76535 Trap -I -F trap (L65) 76542 Trap -I -F trap (41.25 MC) complete with core (L60) 76541 Trap -I -F trap (45.75 MC) complete with core (L59) 75190 Washer -Insulating washer (neoprene) for mounting capacitor on coil strip 29 106 REPLACEMENT PARTS (Continued) 17T150, 17T151, 17T163 STOCK No. DESCRIPTION CHASSIS ASSEMBLIES KCS-66C 76456 76454 76800 71496 31709 75217 33380 38868 71924 76475 71514 76474 39396 75437 76673 47617 73091 76473 76476 73094 39644 76461 76477 75166 73473 76470 73960 75877 76742 74521 28417 75218 76451 75220 76479 75643 73598 Bracket -Channel indicator lamp bracket Brpaiccktuerte-Mcoonutrnotling bracket complete with insulator for Capacitor -Adjustable trimmer, steatite, 1.-4. mmf. (C226) Capacitor -Adjustable, 4-70 mmf. (C221) Capacitor -Ceramic. 10 mmf. (C219, C227) Capacitor -Mica trimmer, dual 10-160 mmf. (C181A, C181B) Capacitor -Ceramic, 12 mmf. (C220) Capacitor -Ceramic, 33 mmf. (C151) Capacitor -Ceramic, 56 mmf. (C105) Capacitor -Mica, 68 mmf. (C182) Capacitor -Ceramic. 82 mmf. (C225) Capacitor -Mica, 82 mmf. (C157) Capacitor -Ceramic, 100 mmf. (C156, C215) Capacitor -Ceramic, 100 mmf. (C222) Capacitor -Ceramic, 220 mmf. (C177) Capacitor -Ceramic, 270 mmf. (C117) Capacitor -Mica, 270 mmf. (C218) Capacitor -Mica, 330 mmf. (C110) Capacitor -Mica, 330 mmf. (C187, C211) Capacitor -Mica, 390 mmf. (CI67) Capacitor -Mica, 470 mmf. (C111, C112) Capacitor -Ceramic, 500 mmf., 20,000 volts (C197) Capacitor -Mica. 820 mmf. (C190) Capacitor -Ceramic, 1500 mmf. (stand-off) (C146) Capacitor -Ceramic, 4700 mmf. (CI22, C123, C125, C126, C:127, -C128, C129, C132, C134, C136, C140, C144, C224) Capacitor -Ceramic, dual 4700 mmf. (C135A, C135B, C141A, C141B, C142A, C142B, C143A, C145B) Capacitor -Ceramic, 10,000 mmf. (C101, C106, C139, C198, C216) Capacitor -Ceramic, dual 10,000 mmf. (C102A, C102B, C1OTA, C1078) Capacitor -Electrolytic, 2 mfd., 10 volts (C124, C138) Capacitor -Electrolytic, S mfd., 50 volts (C200) Capacitor -Electrolytic, 5 mfd., 450 volts (C201) Capacitor -Electrolytic comprising 1 section of 10 mfd., 350 volts, 1 section of 5 mfd., 350 volts and 1 section of 150 mfd., 50 volts (C206A, C206B, C206C) Capacitor -Electrolytic comprising 1 section of 100 mfd., 350 volts, 2 sections of 10 mfd., 350 volts and 1 section of 20 mfd., 50 volts (C205A, C205B, C205C, C205D) Capacitor -Electrolytic, 150 mfd., 200 volts (C203, C204) Capacitor -Tubular, moulded paper, oil impregnated, .00068 mfd., 600 volts (C189) Capacitor -Tubular, paper, oil impregnated, .001 mfd., 1000 volts (C150, C1S8, C165, C168) Capacitor -Tubular, paper, oil impregnated, 600 volts (C154) .0015 mfd., 73595 73803 Capacitor -Tubular, paper, oil impregnated, .0022 mfd., 600 volts (C113, C163, C173) Capacitor -Tubular, paper, oil impregnated, .0022 mfd.. 1000 volts (CI72) 73599 Capacitor -Tubular, paper, oil impregnated, .0027 mfd., 600 volts (C118) 73795 73920 73561 73594 73797 73562 Capacitor -Tubular, paper, oil impregnated, .0033 mfd., 600 volts (C120, C149) Capacitor -Tubular, paper, oil impregnated, .0047 mfd., 600 volts (C114, C164, C166, C213) Capacitor -Tubular, paper, oil impregnated, .01 mfd., 400 volts (C115, C119, C159, C162) Capacitor -Tubular, moulded paper, oil impregnated, .01 mid., 600 volts (C188) Ca6p0a0cviotoltrs (-CT1u1b6u, lCa2r0, 7p)aper, oil impregnated, .015 mfd., Capacitor -Tubular, paper, oil impregnated, .022 mfd., 400 volts (C160, C184) STOCK No. DESCRIPTION 73798 Capacitor -Tubular, paper, oil impregnated, .022 mfd., 600 volts (C175) 73810 Capacitor -Tubular, paper, oil impregnated, .022 mfd., 1000 volts (C195) 73811 Capacitor -Tubular, paper, oil impregnated, .027 mfd., 1000 volts (C196) 73552 Capacitor -Tubular, paper, oil impregnated, .033 mfd., 400 volts (C223) 73596 Capacitor -Tubular, paper, oil impregnated. .033 mfd., 600 volts (C171) 73558 Capacitor -Tubular, paper, oil impregnated, .047 mfd., 200 volts (C155) 73553 Capacitor -Tubular, paper, oil impregnated, .047 mfd., 400 volts (C212) 75071 Capacitor -Tubular, moulded paper, .047 mfd., 400 volts (C179, C180) 73592 Capacitor -Tubular, paper, oil impregnated, .047 mfd., 600 volts (C161, C185, C214) 73597 Capacitor -Tubular, paper, oil impregnated, .047 mfd., 1000 volts (C176) 73792 Capacitor -Tubular, paper, oil impregnated, .068 mfd., 200 volts (C174) 73784 Capacitor -Tubular, paper, oil impregnated, 0.1 mfd., 200 volts (C153, C169) 73551 Capacitor -Tubular, paper, oil impregnated, 0.1 mfd., 400 volts (C178, C183) 73557 Capacitor -Tubular, paper, oil impregnated, 0.1 mfd., 600 volts (C170, C192) 73786 Capacitor -Tubular, paper, oil impregnated, 0.27 mfd., 200 volts (C191) 73787 Capacitor -Tubular, paper, oil impregnated, 0.47 mfd., 200 volts (C186) 76498 Choke -Filter choke (L108) 73477 Coil -Choke coil (L101) 76640 Coil -Choke coil (1.5 muh) (L115) 76442 Coil -Horizontal linearity coil complete with adjustable core (1.107) 76646 Coil -Peaking coil (72 muh) (1.103, R188) 72619 Coil -Peaking coil (93 muh) (L104, R261) 75252 Coil -Peaking coil (500 muh) (L105, L113) 76441 Coil -Width coil complete with adjustable core (L106) 74594 Connector -2 contact male connector for power cord 5040 Connector -4 contact female connector for speaker cable (P101) 75542 Connector -6 contact male connector -part of deflection yoke (P102) 50367 Connector -6 contact female connector for deflection yoke leads (J102) 76804 Connector -Anode connector for kinescope 35787 Connector-Phono input connector (J103) 76457 Connector -Second anode lead connector mounted on hi -voltage capacitor 76460 Contact -Test point contact 76447 Control-AGC control (R175) 76444 Control Brightness control (R218) 76448 Control -Height control (R203) 76443 Control -Horizontal and vertical hold control (R201A, R201B) 76445 Control -Picture control (R167) 76449 Control -Vertical linearity control (R214) 76171 Control -Volume control and power switch (R117, S102) Crystal -See Rectifier, Crystal Rectifier 74956 Cushion -Rubber cushion for deflection yoke hood 74839 Fastener -Push fastener for mounting tube sockets 76801 Fuse -0.2 amp., 250 volts 76459 Grommet -Rubber grommet for 2nd. anode lead exit 37396 Grommet -Rubber grommet for mounting tube sockets 76830 Hood -Deflection yoke hood less cushions 75482 Jack -Video jack (J104) 76480 Lead -Anode lead complete with eyelet 78168 Maangdnesttu-dFocus magnet complete with adjustable plate 30 1 09 RCAVICTOR Model 17T200 "Shelly" Ebony Model 17T201 "Hadley" Maroon (Shown on base) Model 17T202 "Kentwooa Mahogany, Grained (Shown on base) TELEVISION RECEIVERS MODELS 171200, 171201, 171202, 171211, 171220 Chassis No. KCS72, KCS72M1 or KCS72M2 -Mfr. No. 274 - SERVICE DATA -1952 No. T2 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA DIVISION CAMDEN, N. J., U. S. A. Model 17T211 "Ashton" Walnut, Mahogany, Blonde Model 17T220 "Albury" Walnut, Mahogany GENERAL DESCRIPTION Models 17T200, 17T201, 17T202, 17T211, and 17T220 are "17 inch" television receivers. The receivers are.identical except for cabinets, and speakers. Features of the television un't are: full twelve channel coverage; intercarrier FM sound system; ratio detector; improved picture brilliance; pulsed picture A -G -C; A -F -C horizontal hold; stabilized vertical hold; noise saturation circuits; improved sync separator and clipper; 3.2 mc. band width for picture channel and reduced hazard high voltage supply. An auxiliary audio input jack is provided to permit the use of an external record playing attachment. ELECTRICAL AND MECHANICAL SPECIFICATIONS PICTURE SIZE .146 square inches on a 17QP4 Kinescope TELEVISION R -F FREQUENCY RANGE All 12 television channels, 54 mc. to 88 mc., 174 mc. to 216 mc. Picture I -F Carrier Frequency 25.50 mc. Sound I -F Carrier Frequency 21.00 mc. and 4.5 mc. POWER SUPPLY RATING 115 volts, 60 cycles, 190 watts AUDIO POWER OUTPUT RATING 4 0 watts max. VIDEO RESPONSE To 3.2 mc. SWEEP DEFLECTION Magnetic FOCUS Magnetic LOUDSPEAKERS In Models 17T200, 17T201 & 17T202 .971636-1 5" PM Dynamic, 3.2 ohms In Models 17T211 & 17T220 . (971490-3) 8" PM Dynamic, 3.2 ohms WEIGHT AND DIMENSIONS Net Shipping Width Model Weight Weight Inches 17T200... 88 lbs 103 lbs 21'h 17T20 1... 88 lbs 103 lbs 21'/: 17T202... 88 lbs 103 lbs 21'/z 17T211... 95 lbs 116 lbs 241/2 17T220 ..106 lbs 130 lbs 231/4 Height Inches 22 22 22 35'/4 35% Depth Inches 21% 21% 21% 2 PA 231/4 RECEIVER ANTENNA INPUT IMPEDANCE Choice: 300 ohms balanced or 72 ohms unbalanced. RCA TUBE COMPLEMENT Tube Used Function ( 1) RCA 6CB6 R -F Amplifier ( 2) RCA 6J6 R -F Oscillator and Mixer ( 3) RCA 6CB6 1st Picture I -F Amplifier ( 4) RCA 6CB6 2nd Picture I -F Amplifier ( 5) RCA 6CB6 3rd Picture I -F Amplifier ( 6) RCA 12AU7 . Picture 2nd Detector and Vert. Sync. Sep. ( 7) RCA 6CL6 (6AC7) (6AG7) *Video Amplifier ( 8) RCA 6AU6 1st Sound I -F Amplifier ( 9) RCA 6AU6 2nd Sound I -F Amplifier (10) RCA 6AL5 Ratio Detector (11) RCA 6AV6 1st Audio Amplifier (12) RCA 6K6GT (13) RCA 6AU6 Audio Output AGC Amplifier (14) RCA 6SN7GT Horizontal Sync. Sep. and Sync. Output (15) RCA 6J5 Vertical Sweep Oscillator (16) RCA 6K6GT Vertical Sweep Output (17) RCA 6SN7GT . Horizontal Sweep Oscillator and Control (18) RCA 6BQ6GT Horizontal Sweep Output (19) RCA 6W4GT Damper (20) RCA 1B3-GT/8016 High Voltage Rectifier (21) RCA 17QP4 Kinescope (22) RCA 5U4G Rectifier (23) RCA 5Y3GT *1See Figure 67) Rectifier 1 10 17T200,17T201, 17T202, 17T211, 17T220 ELECTRICAL AND MECHANICAL SPECIFICATIONS (Continued) PICTURE INTERMEDIATE FREQUENCIES Picture I -F Carrier Frequency 25.50 mc. Adjacent Channel Sound Trap 27.00 mc. SOUND INTERMEDIATE FREQUENCIES Sound Carrier Frequency Sound I -F Frequency 21.00 mc. 4 5 mc. VIDEO RESPONSE To 3.2 mc. FOCUS Magnetic SWEEP DEFLECTION Magnetic SCANNING Interlaced, 525 line HORIZONTAL SWEEP FREQUENCY 15,750 cps VERTICAL SWEEP FREQUENCY 60 cps FRAME FREQUENCY (Picture Repetition Rate) 30 cps OPERATING CONTROLS (Front Panel) Channel Selector Fine Tuning s Picture Brightness c Picture Horizontal Hold t Picture Vertical Hold S Sound Volume and On -Off Switch TV Tone & Phono Switch Dual Control Knobs Dual Control Knobs Dual Control Knobs Dual Control Knobs NON -OPERATING CONTROLS (not including r -f and i-f adjustments) Picture Centering top chdssis adjustment Width rear chassis adjustment Height rear chassis adjustment Horizontal Linearity rear chassis screwdriver adjustment Vertical Linearity rear chassis adjustment Horizontal Drive rear chassis screwdriver adjustment Horizontal Oscillator Frequency . rear chassis adjustment Horizontal Oscillator Waveform bottom chassis adjustment Horizontal Locking Range rear chassis adjustment Focus top chassis adjustment Ion Trap Magnet top chassis adjustment Deflection Coil top chassis wing nut adjustment AGC Control rear chassis adjustment HIGH VOLTAGE WARNING OPERATION OF THIS RECEIVER OUTSIDE THE CABINET OR WITH THE COVERS REMOVED, INVOLVES A SHOCK HAZARD FROM THE RECEIVER POWER SUPPLIES. WORK ON THE RECEIVER SHOULD NOT BE ATTEMPTED BY ANYONE WHO IS NOT THOROUGHLY FAMILIAR WITH THE PRECAUTIONS NECESSARY WHEN WORKING ON HIGH VOLTAGE EQUIPMENT. DO NOT OPERATE THE RECEIVER WITH THE HIGH VOLTAGE COMPARTMENT SHIELD REMOVED. KINESCOPE HANDLING PRECAUTIONS DO NOT REMOVE THE RECEIVER CHASSIS, INSTALL, REMOVE OR HANDLE THE KINESCOPE IN ANY MANNER UNLESS SHATTERPROOF GOGGLES, AND HEAVY GLOVES ARE WORN. PEOPLE NOT SO EQUIPPED SHOULD BE KEPT AWAY WHILE HANDLING KINESCOPES. KEEP THE KINESCOPE AWAY FROM THE BODY WHILE HANDLING. The kinescope bulb encloses a high vacuum and, due to its large surface area, is subjected to considerable air pressure. For this reason, the kinescope must be handled with more care than ordinary receiving tubes. The large end of the kinescope bulb-particularly that part at the rim of the viewing surface-must not be struck, scratched or subjected to more than moderate pressure at any time. During service if the tube sticks or fails to slip smoothly into its socket, or deflecting yoke, investigate and remove the cause of the trouble. Do not force the tube. Refer to the Receiver Installation section for detailed instructions on kinescope installation. All RCA replacement kinescopes are shipped in special cartons and should be left in the cartons until ready for installation in the receiver. 2 OPERATING INSTRUCTIONS 17T200, 17T201, 17T202, 17T211, 17T220 The following adjustments are necessary when turning the receiver on for the first time. 8. Adjust the CONTRAST and BRIGHTNESS controls for suitable piCture contrast and brightness. 1. See that the TV -PH switch is in the "TV" position. 2. Turn the receiver "ON" and advance the SOUND VOLUME control to approximately mid -position. 3. Set the STATION SELECTOR to the desired channel. 4. Adjust the FINE TUNING control for best pix and the SOUND VOLUME control for suitable volume. 5. Turn the BRIGHTNESS control fully counter -clockwise, then clockwise until a light pattern appears on the screen. 9. In switching from one channel to another, it may be necessary to repeat steps 4 and 8. 10. When the set is turned on again after an idle period it should not be necessary to repeat the adjustment if the positions of the controls have not been changed. If any adjustment is necessary, step number 4 is generally sufficient. 11. If the positions of the controls have been changed, it may be necessary to repeat steps 2 6. Adjust the VERTICAL hold control until the pattern stops vertical movement. through 8. 12. To use a record player, plug the record-player output 7. Adjust the HORIZONTAL hold control until a picture is obtained and centered. VERTICAL HOLD HORIZONTAL HOLD BRIGHTNESS ON -OFF SW. SOUND VOLUME CONTRAST TV TONE 11. PHONO SWITCH STATION SELECTOR CHANNEL NO. FINE TUNING cable into the PHONO jack on the rear apron, and set the TV -PH switch to "PH". Figure 1-Receiver Operating Controls INSTALLATION INSTRUCTIONS UNPACKING. -These receivers are shipped complete in cardboard cartons. The kinescope is shipped in place in the receiver. Take the receiver out of the carton and remove all packing material. Make sure that all tubes are in place and are firmly seated in their sockets. Check to see that the kinescope high voltage lead clip is in place. Plug a power cord into the 115 volt a -c power source and into the receiver interlock receptacle. Turn the receiver power switch to the "on" position, the brightness control fully clockwise, and the picture control counter -clockwise. ION TRAP MAGNET ADJUSTMENT.-Set the ion trap magnet approximately in the position shown in Figure 2. Starting from this position immediately adjust the magnet by moving it forward or backward at the same time rotating it slightly around the neck of the kinescope for the brightest raster on the screen. Reduce the brightness control setting until the raster is slightly above average brilliance. Turn the focus control (shown in Figure 2) until the line structure of the raster is clearly visible. Readjust the ion trap magnet for maximum raster brilliance. The final touches of this adjustment should be made with the brightness control at the maximum clockwise position with which good line focus can be maintained. KINESCOPE SOCKET FOCUS MAGNET MOUNTING SCREW ION TRAP MAGNET PIN -CUSHION CORRECTION MAGNET KINE FOCUS CONTROL CENTERING ADJUSTMENT LOCK SCREW DEFLECTION YOKE KINE CUSHION CENTERING ADJUSTMENT LEVER Figure 2-Yoke and Focus Magnet Adjustments DEFLECTION YOKE ADJUSTMENT.-If the lines of the raster are not horizontal or squared with the picture mask, rotate the deflection yoke until this condition is obtained. Tighten the yoke adjustment wing screw. PICTURE ADJUSTMENTS.-It will now be necessary to obtain a test pattern picture in order to make further adjustments. Connect the antenna transmission line to the receiver. If the Horizontal Oscillator and AGC System are operating properly, it should be possible to sync the picture at this point. However, if the AGC control is misadjusted, and the receiver is overloading, it may be impossible to sync the picture. If the receiver is overloading, turn R149 on the rear apron (see Figure 3) counter -clockwise until the set operates normally and the picture can be synced. CHECK OF HORIZONTAL OSCILLATOR ALIGNMENT.-Turn the horizontal hold control to the extreme counter -clockwise position. The picture should remain in horizontal sync. Momentarily remove the signal by switching off channel then back. Normally the picture will be out of sync. Turn the control clockwise slowly. The number of diagonal black bars will be gradually reduced and when only 2 or 3 bars sloping downward to the left are obtained, the picture will pull into sync upon slight additional clockwise rotation of the control. Pull -in should occur before the control has been turned 120 degrees from the extreme counter -clockwise position. The picture should remain in sync for approximately 90 R -F UNIT R173 HEIGHT CONTROL R181 VERTICAL LINEARITY CONTROL R149 AGC CONTROL HORIZONTAL OSCILLATOR FREQ. ADJ. LIOB HORIZONTAL LINEARITY CONTROL CILIB HORIZONTAL L106 WIDTH CONTROL DRIVE J101 0 PHONO VJIDIOEZO INPUT JACK 0 C16IA HORIZ LOCKING 0, RANGE Figure 3-Rear Chassis Adjustments 3 1 12 17T200, 17T201, 17T202, 17T211, 17T220 INSTALLATION INSTRUCTIONS degrees of additional clockwise rotation of the control. At the extreme clockwise position, the picture should remain in sync and should not show a black bar in the picture. If the receiver passes the above checks and the picture is normal and stable, the horizontal oscillator is properly aligned. Skip "Alignment of Horizontal Oscillator" and proceed with "Focus Magnet Adjustment." ALIGNMENT OF HORIZONTAL OSCILLATOR. -If in the above check the receiver failed to hold sync with the hold control at the extreme counter -clockwise position or failed to hold sync over 90 degrees of clockwise rotation of the control from the pull -in point, it will be necessary to make the following adjustments. Horizontal Frequency Adjustment. -Turn the horizontal hold control to the extreme clockwise position. Tune in a television station and adjust the T110 horizontal frequency adjustment at the rear of the chassis until the picture is just out of sync and the horizontal blanking appears as a vertical or diagonal black bar in the raster. Then turn the T110 core until the bar moves out of the picture leaving it in sync. Horizontal Locking Range Adjustment.-Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T110 rear core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 3 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C161A slightly clockwise. If less than 2 bars are present, adjust C161A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 or 3 bars are present. Repeat the adjustments under "Horizontal Frequency Adjustment" and "Horizontal Locking Range Adjustment" until the conditions specified under each are fulfilled. When the horizontal hold operates as outlined under "Check of Horizontal Oscillator Alignment" the oscillator is properly adjusted. If it is impossible to sync the picture at this point and the AGC system is in proper adjustment it will be necessary to adjust the Horizontal Oscillator by the method outlined in the alignment procedure on page 11: For field purposes paragraph "B" under Horizontal Oscillator Waveform Adjustment may be omitted. If a corner of the raster is shadowed, check the position of the ion trap magnet. Reposition the magnet within the range of maximum raster brightness to eliminate the shadow and recenter the picture by adjustment of the focus magnet plate. In no case should the magnet be adjusted to cause any loss of brightness since such operation may cause immediate or eventual damage to the tube. In some cases it may be necessary to shift the position of the focus magnet in order to eliminate a corner shadow. WIDTH, DRIVE AND HORIZONTAL LINEARITY ADJUSTMENTS.-Adjustment of the horizontal drive control affects the high voltage applied to the kinescope. In order to obtain the highest possible voltage hence the brightest and best focused picture, adjust horizontal drive trimmer C161B counter -clockwise until the picture begins to "wrinkle" in the middle then clockwise until the "wrinkle" disappears. Turn the horizontal linearity control L108 clockwise until the picture begins to "wrinkle" on the right and then counterclockwise until the "wrinkle" disappears and best linearity is obtained. Adjust the width control L106 to obtain correct picture width. A slight readjustment of these three controls may be necessary to obtain the best linearity. Adjustments of the horizontal drive control affect horizontal oscillator hold and locking range. If the drive control was adjusted, recheck the oscillator alignment. HEIGHT AND VERTICAL LINEARITY ADJUSTMENTS.-Adjust the height control (R173 on chassis rear apron) until the picture fills the mask vertically. Adjust vertical linearity (R181 on rear apron), until the test pattern is symmetrical from top to bottom. Adjustment of either control will require a readjustment of the other. Adjust centering to align the picture with the mask. FOCUS.-Adjust the focus magnet for maximum definition in the test pattern vertical "wedge" and best focus in the white areas of the pattern. Recheck the position of the ion trap magnet to make sure that maximum brightness is obtained. Check to see that the yoke thumbscrew and the focus magnet mounting screws are tight. STATION SELECTOR FINE TUNING FOCUS MAGNET ADJUSTMENT. -The focus magnet should be adjusted so that there is approximately three -eighths inch of space between the rear cardboard shell of the yoke and the flat of the front face of the focus magnet. This spacing gives best average focus over the face of the tube. The axis of the hole through the magnet should be parallel with the axis of the kinescope neck with the kinescope neck through the center of the opening. PIN -CUSHION CORRECTION. - Two pin -cushion correc- tion magnets are employed to correct a small amount of pin -cushion of the raster due to the lens effect of the face of the kinescope. These magnets are mounted on small arms, one on each side of the kinescope as shown in Figure 2. The arms hinge in one plane on self tapping screws which act both as a hinge and an adjustment locking screw. When the magnets are swung towards the tube, maximum correction is obtained. Minimum correction is obtained when the arms are swung away from the tube. To adjust the magnets, loosen the two self tapping screws and position the magnets until the sides of the raster appear straight. Tighten the screws without shifting the position of the magnets. In some cases it may be necessary to twist or bend the magnet support arms to obtain the appearance of straight raster edges. CENTERING ADJUSTMENT. -No electrical centering controls are provided. Centering is accomplished by means of a separate plate on the focus magnet. The centering plates include a locking screw which must be loosened before centering. Up and down adjustment of the plate moves the picture side to side and sidewise adjustment moves the picture up and down. 110101. TO REMOVE ESCUTCHEON, SLIDE SPRING CLIP TO LEFT -OSCILLATOR ADJUSTMENT FOR CHANNEL NUMBER Figure 4-R -F Oscillator Adjustments CHECK OF R -F OSCILLATOR ADJUSTMENTS. - Tune in all available stations to see if the receiver r -f oscillator is adjusted to the proper frequency on all channels. If adjustments are required, these should be made by the method outlined in the alignment procedure on page 9. The adjustments for channels 2 through 12 are available from the front of the cabinet by removing the station selector escutcheon as shown in Figure 4. Adjustment for channel 13 is on top of the chassis. AGC THRESHOLD CONTROL. -The AGC threshold control R149 is adjusted at the factory and normally should not require readjustment in the field. To check the adjustment of the AGC Threshold Control, tune in a strong signal and sync the picture. Momentarily remove the signal by switching off channel and then back. If the picture reappears immediately, the receiver is not overloading due to improper setting of 11149. If the picture requires an appreciable portion of a second to reappear, or bends excessively, R149 should be readjusted. 4 113 INSTALLATION INSTRUCTIONS 17T200, 17T201, 17T202, 17T211, 17T220 Turn R149 fully counter -clockwise. The raster may be bent slightly. This should be disregarded. Turn R149 clockwise until there is a very, very slight bend or change of bend in the picture. Then turn R149 counter -clockwise just sufficiently to remove this bend or change of bend. If the signal is weak, the above method may not work as it may be impossible to get the picture to bend. In this case, turn R149 clockwise until the snow in the picture becomes more pronounced, then counter -clockwise until the best signal to noise ratio is obtained. The AGC control adjustment should be made on a strong signal if possible. If the control is set too far clockwise on a weak signal, then the receiver may overload when a strong signal is received. FM TRAP ADJUSTMENT. -In some instances interference may be encountered from a strong FM station signal. A trap is provided to eliminate this type of interference. To adjust the trap tune in the station on which the interference is observed and adjust the L203 core on top of the antenna matching transformer for minimum interference in the picture. CAUTION. -In some receivers, the FM trap L203 will tune down into channel 6 or even into channel 5. Needless to say, such an adjustment will cause greatly reduced sensitivity on these channels. If channels 5 or 6 are to be received, check L203 to make sure that it does not affect sensitivity on these two channels. Replace the cabinet back and connect the receiver antenna leads to the cabinet back. Make sure that the screws holding it are up tight, otherwise it may rattle or buzz when the receiver is operated at high volume. KINESCOPE SCREEN CLEANING. -The kinescope safety glass is held in place by four spring clips which may be removed from the back of the front panel. This permits removing the safety glass for cleaning without the necessity of removing the chassis and kinescope. CHASSIS REMOVAL. -To remove the chassis from the cabinet for repair or installation of a new kinescope, remove the control knobs, the cabinet back, unplug the speaker cable, the kinescope socket, the antenna cable, the yoke and high voltage cable. Take out the chassis bolts under the cabinet. Withdraw the chassis from the back of the cabinet. KINESCOPE HANDLING PRECAUTION. -Do not install, remove, or handle the kinescope in any manner, unless shatterproof goggles and heavy gloves are worn. People not so equipped should be kept away while handling the kinescope. Keep the kinescope away from the body while handling. REMOVAL OF KINESCOPE. -To remove the kinescope from the cabinet, loosen the two nuts and disengage the rods alongside the kinescope. Remove the screw which holds the yoke frame to the cabinet. Remove the kinescope, the yoke frame with yoke and focus magnet as an assembly. Handle this tube by the portion at the edge of the screen. Do not cover the glass bell of the tube with fingermarks as it will produce leakage paths which may interfere with reception. If this portion of the tube has inadvertently been handled, wipe it clean with a soft cloth moistened with "dry" carbon tetrachloride. INSTALLATION OF KINESCOPE. -Wipe the kinescope screen surface and front panel safety glass clean of all dust and fingermarks with a soft cloth moistened with "Windex" or similar cleaning agent. Replace the kinescope and chassis by reversal of the removing process. The kinescope should be installed so that the high voltage contact is to the right when looking at it from the rear of the cabinet. The magnet of the ion trap magnet should be to the left. CABINET ANTENNA. -A cabinet antenna is provided in Models 17T211 and 17T220 and the leads are brought out near the antenna terminal board. The cabinet antenna may be employed in place of the outdoor antenna in areas where the signals are strong and no reflections are experienced. ANTENNAS. -The finest television receiver built may be said to be only as good as the antenna design and installation. It is therefore important to select the proper antenna to suit the particular local conditions, to install it properly and orient it correctly. If two or more stations are available and the two stations are in different directions, it may be possible to make a compromise orientation which will provide a satisfactory signal on all such channels. If it is impossible to obtain satisfactory results on one or more channels, it may become necessary either to provide means for turning the antenna when switching channels or to install a separate antenna for one or more channels and to switch antennas when switching channels. In some cases, the antenna should not be installed permanently until the quality of the picture reception has been observed on a television receiver. A temporary transmission line can be run between receiver and the antenna, allowing sufficient slack to permit moving the antenna. Then, with a telephone system connecting an observer at the receiver and an assistant at the antenna, the antenna can be positioned to give the most satisfactory results on the received signal. A shift of direction or a few feet in antenna position may effect a tremendous difference in picture reception. REFLECTIONS.-Multiple images sometimes known as echoes or ghosts, are caused by the signal arriving at the antenna by two or more routes. The second or subsequent image occurs when a signal arrives at the antenna after being reflected off a building, a hill or other object. In severe cases of reflections, even the sound may be distorted. In less severe cases, reflections may occur that are not noticeable as reflections but that will instead cause a loss of definition in the picture. Under certain extremely unusual conditions, it may be possible to rotate or position the antenna so that it receives the cleanest picture over a reflected path. If such is the case, the antenna should be so positioned. However, such a position may give variable results as the nature of reflecting surfaces may vary with weather conditions. Wet surfaces have been known to have different reflecting characteristics than dry surfaces. Depending upon the circumstances, it may be possible to eliminate the reflections by rotating the antenna or by moving it to a new location. In extreme cases, it may be impossible to eliminate the reflection. INTERFERENCE. -Auto ignition, street cars, electrical machinery and diathermy apparatus may cause interference which spoils the picture. Whenever possible, the antenna location should be removed as far as possible from highways, hospitals, doctors' offices and similar sources of interference. In mounting the antenna, care must be taken to keep the antenna rods at least 1/4 wave length (at least 6 feet) away from other antennas, metal roofs, gutters or other metal objects. Short-wave radio transmitting and receiving equipment may cause interference in the picture in the form of moving ripples. In some instances it may be possible to eliminate the interference by the use of a trap in the antenna transmission line. However, if the interfering signal is on the same frequency as the television station, a trap will provide no improvement. WEAK PICTURE. -When the installation is near the limit of the area served by the transmitting station, the picture may be speckled, having a "snow" effect, and may not hold steady on the screen. This condition is due to lack of signal strength from the transmitter. RECEIVER LOCATION. -The owner should be advised of the importance of placing the receiver in the proper location in the room. The location should be chosen- - Away from bright windows and so that no bright light will fall directly on the screen. (Some illumination in the room is desirable, however.) -To give easy access for operation and comfortable viewing. - To permit convenient connection to the antenna. - Convenient to an electrical outlet. -To allow adequate ventilation. 5 114 17T200, 17T201, 17T202, 17T211, 17T220 CHASSIS TOP VIEW TO ANTENNA TERMINALS ANTENNA MATCH I NG TRANSFORMER SPEAKER CABLE CHANNEL SELECTOR SW I FINE TUNING CONTROL T1OZ RATIO DET. TRANS V103 GALS RATIO DET. V102 GAU6 SNDI- AMP.P. 1101 SOUND TRANS. V101 6AUG IVSND14 AMP T107 4t5 PIX. 1-F (V109 TRANS 12AU7 DET. VERT. SYNC SEP V106 6C B6 12PIX14 AMP 1106 359 PIX I- F TRANS. V107 6C86 PIX I -F AMP,/ 1105 Z5 PIX I -F TRANS 106 6(66 iSTPix I -F AMP V111 6A U6 AGC AMP V11Z GSN7GT NOR SYNC SEP EVERT SYNC OUTPUT V110 E.C.LG VIDEO AMP. V104 GAVE. AUDIO AMP. V105 6K6 GT AUDIO OUTPUT 5101 TV-PHONO SWITCH 5102 R109 ON -OFF SWITCH & VOL. CONTROL RI B4 BRIGHTNESS CONTROL // V116 \ 6BQGGT HORIZONTAL OUTPUT; ,/ V115 6SN 7GT &CONTROL/ T109 POWER TRANSFORMER Vi14 6K6GT VERTICAL SWEEP OUTPUT, VI ZO SU 4G RECT. (...-V1 Z1 SY 3GT RECT. 1108 VERT Sw P. OUTPUT TRANS. 5170650m V113 G.J5 VERT. SWP. OSC. /R137 PICTURE CONTROL R170 A VERTICAL HOLD CONTROL 1 R170B HORIZONTAL MOLD CONTROL D461101 -I KINESCOPE SOCKET Figure 5-Chassis Top View 6 POWER CORD CHASSIS BOTTOM VIEW 115 17T200, 17T201, 17T202, 17T211, 17T220 CHANNEL SELECTOR SWITCH FINE TUNING CONTROL R -F UNIT ANTENNA MATCHING TRANSFORMER TO ANTENNA TERMINALS SPEAKER CABLE SIO1 Tv - PHONO SWITCH 9102- R109 ON -OFF SWITCH 8. VOL. CONTROL R1114 BRIGHTNESS CONTROL RI 37 PICTURE CONTROL V104 6AV 6 AU ENO AMP. T105 2.12 FIX I -F TRANS. V107 6C B6 2.9 PIX I -F AmF 7106 302 PIX. I -F TRANS. V106 6CBG 1sT PIX 1-F AMP T104 PIX TRANS. VIOB 6CB6 3'3 FIX I -F AMP. T107 4,2! PIN I -F TRANS. V109 12AU7 Poi DET5 7101 SOUND I -F VERT SYNC. TRANS. SEP. V101 6AU6 I3X SNO. I -F /AR 102 GALA 21.1? SNO 1-F AMP T102 RATIO DET. TRANS. v103 GALS RATIO DET. V110 GCL6 VIDEO AMP. V112 6SN7GT NOR SYNC SEP. VERT. SYNC. OUTPUT V111 6AU6 AGC AMP. VIN 61166T VERT SWP. OUT. VII 5 65N7 GT NOR OSC I. CONTROL v116 6 BQGGT HORIZONTAL OUTPUT R170 A VERTICAL HOLD CONTROL R17013 HORIZONTAL HOLD CONTROL 2170A 1117011 v113 6.15 VERT SWP OSC. V121 5Y3 GT RECT. VI2.0 SO 4G RECT. POWER CORO KINESCOPE SOCKET Figure 6-Chassis Bottom View 7 116 17T200, 17T201, 17T202, 17T211, 17T220 ALIGNMENT PROCEDURE TEST EQUIPMENT. -To properly service the television chassis of this receiver, it is recommended that the following test equipment be available: R -F Sweep Generator meeting the following requirements: (a) Frequency Ranges 20 to 30 mc., 1 mc. and 10 mc. sweep width 50 to 90 mc., 10 mc. sweep width 170 to 225 mc., 10 mc. sweep width (b) Output adjustable with at least .1 volt maximum. (c) Output constant on all ranges. (d) "Flat" output on all attenuator positions. Cathode -Ray Oscilloscope. -For alignment purposes, the oscilloscope employed must have excellent low frequency and phase response, and should be capable of passing a 60 -cycle square wave without appreciable distortion. For video and sync waveform observations, the oscilloscope must have excellent frequency and phase response from 10 cycles to at least two megacycles in all positions of the gain control. Signal Generator to provide the followingfrequencies with crystal accuracy. (a) Intermediate frequencies 22.25 and 25.5 mc. cony. and first pix i-f trans. 22.75 mc. second picture i-f transformer 24.25 mc. fourth picture i-f transformer 25.5 mc. third picture i-f transformer 25.50 mc. picture carrier 27.00 mc. adjacent channel sound trap (b) Radio frequencies Channel Number 2 3 4 5 6 7 8 9 10 11 12 13 Picture Carrier Freq. Mc. 55.25 61.25 67.25 77.25 83.25 175.25 181.25 187.25 193.25 199.25 205.25 211.25 Sound Carrier Freq. Mc. 59.75 65.75 71.75 81.75 87.75 179.75 185.75 191.75 197.75 203.75 209.75 215.75 (c) Output of these ranges should be adjustable and at least .1 volt maximum. Heterodyne Frequency Meter with crystal calibrator which covers the frequency range from 80 mc. to 109 mc. and from 200 mc. to 237 mc. Electronic Voltmeter of Junior or Senior "VoltOhmyst" type and a high voltage multiplier probe for use with this meter to permit measurements up to 15 kv. Service Precautions. -If possible, the chassis should be serviced without the kinescope. However, if it is necessary to view the raster during servicing, it would be a great convenience to have a bench mounted kinescope and speaker complete with a set of extension cables. CAUTION: Do not short the kinescope second anode lead. Its short circuit current presents a considerable overload on the high voltage rectifier V117. Adjustments Required. -Normally, only the r -f oscillator and mixer lines will require the attention of the service technician. All other circuits are either broad or very stable and hence will seldom require readjustment. ORDER OF ALIGNMENT. -When a complete receiver alignment is necessary, it can be most conveniently performed in the following order: (1) R -F unit (2) Picture i-f transformers (3) Picture i-f trap (4) Sweep of picture i-f (5) Ratio detector alignment ( 6) Sound i-f alignment ( 7) 4.5 Mc Trap Adjustment ( 8) Check of overall response ( 9) AGC control adjustment (10) Horizontal oscillator alignment R -F UNIT ALIGNMENT. -Disconnect the co -ax link from terminal 2 of the r -f unit terminal board and connect a 39 ohm composition resistor between lugs 1 and 2. Detune Ti by backing the core all the way out of the coil. Back the L44 core all the way out. Back the L203 core all the way out. In order to align the r -f tuner, it will first be necessary to set the channel -13 oscillator to frequency. The shield over the bottom of the r -f unit must be in place when making any adjustments. The oscillator may be aligned by adjusting it to beat with a crystal -calibrated heterodyne frequency meter. Couple the meter probe loosely to the receiver oscillator. Set the channel selector switch to 13. Adjust the heterodyne frequency meter to the correct frequency (236.75 mc). Set the fine tuning control 30 degrees clockwise from the mechanical center of its range. Adjust Cl for an audible beat on the heterodyne frequency meter. Now that the channel -13 oscillator is set to frequency, we may proceed with the r -f alignment. Turn the AGC control fully clockwise. Obtain a 7.5 volt battery capable of withstanding appreciable current drain and connect the ends of a 1,000 ohm potentiometer across it. Connect the battery positive terminal to chassis and the potentiometer arm to terminal 3 of the r -f unit. Adjust the bias box potentiometer to produce -3.5 volts of bias at the r -f unit terminal board. Connect the oscilloscope to the test point TP1 on top of the r -f unit. Connect the r -f sweep oscillator to the receiver antenna terminals. The method of connection depends upon the output impedance of the sweep. The P300 connections for 300 -ohm balanced or 72 -ohm single -ended input are shown in the circuit schematic diagram. If the sweep oscillator has a 50 -ohm or 72 -ohm single -ended output, 300 -ohm balanced output can be obtained by connecting as shown in Figure 9. Connect the signal generator loosely to the receiver antenna terminals. Set the receiver channel switch to channel 8. Set the sweep oscillator to cover channel 8. Insert markers of channel 8 picture carrier and sound carrier, 181.25 mc. and 185.75 mc. Adjust C9, C11, C16 and C22 for approximately correct curve shape, frequency, and band width as shown in Figure 11. The correct adjustment of C22 is indicated by maximum amplitude of the curve midway between the markers. C16 tunes the r -f amplifier plate circuit and affects the frequency of the curve most noticeably. C9 tunes the converter grid circuit and affects the tilt of the curve most noticeably (assuming that C22 has been properly adjusted). C11 is the coupling adjustment and hence primarily affects the response band width. Set the receiver channel switch to channel 6. Adjust the heterodyne frequency meter to the correct frequency (108.75 mc.). Set the fine tuning control 30 degrees clockwise from the mechanical center of its range. Adjust L5 for an audible beat on the heterodyne frequency meter. 8 ALIGNMENT PROCEDURE 117 17T200, 17T201, 17T202, 17T211, 17T220 Set the sweep generator to channel 6. From the signal generator, insert channel 6 sound and picture carrier markers, 83.25 mc. and 87.75 mc. Adjust L42, L45 and L49 for proper response as shown in Figure 12. L42 is adjusted to give maximum amplitude of the curve between the markers. L45 primarily affects the tilt of the curve. L49 primarily affects the frequency of response. Connect the "VoltOhmyst" to the r -f unit test point TP1. Adjust C7 for -3.0 volts at the test point. Retouch L42, L45 and L49 for proper response if necessary. If necessary, retouch C11 for proper band width on channel 6. Continue these retouching adjustments until proper response is obtained and -3.0 volts of oscillator injection are present at the test point, TP1. Set the receiver channel selector switch to channel 8 and readjust Cl for proper oscillator frequency. Set the sweep oscillator and signal generator to channel 8. Readjust C9, C16 and C22 for correct curve shape, frequency and band width. Readjust C11 only if necessary. Switch the receiver, the sweep oscillator and signal generator to channel 13. Adjust L52 for maximum amplitude of the curve midway between markers and then overshoot the adjustment by turning the slug in the same direction from the initial setting a little more than the amount of turning required to reach maximum amplitude of response. Adjust C22 for maximum amplitude of response. Turn off the sweep generator. Adjust the L43 core for correct channel 13 oscillator frequency, then overshoot the adjustment by turning the slug a little more in the same direction from the initial setting. Reset the oscillator to proper frequency by adjustment of Cl. Turn the sweep oscillator back on. Check the response of channels 7 through 13 by switching the receiver channel switch, sweep oscillator and marker oscillator to each of these channels and observing the response and oscillator injection obtained. See Figure 11 for typical response curves. It should be found that all these channels have the proper shaped response with the markers above 80', response. If the markers do not fall within this requirement, switch to channel 8 and readjust C9, C11, C16 and C22 as necessary. If C22 required adjustment, the adjustment should be overshot a small amount and corrected by adjustment of L52 to give maximum amplitude of response between the sound and picture carrier markers. The antenna circuit (L52, C22) is broad so that tracking is not particularly critical. If the valley in the top of the selectivity curves for the high channels is deeper than normal, the curve can be flattened somewhat by decreasing the inductance of L44 by turning the core stud in. Be sure to check for undesirable resonant suck outs on channels 7 and 8 if this is done. Turn the sweep oscillator off and check the receiver channel 8 r -f oscillator frequency. If the oscillator is off frequency overshoot the adjustment of Cl and correct by adjusting L43. Turn the receiver channel selector switch to channel 6. Adjust L5 for correct oscillator frequency. Turn the sweep oscillator on and to channel 6 and observe the response curve. If necessary readjust L42, L45 and L49. It should not be necessary to touch C11. Check the oscillator injection voltage at the test point TP1. If necessary adjust C7 to give -3 volts injection. If C7 is adjusted, switch to channel 8, and readjust C9 for proper curve shape, then recheck channel 6. Switch the receiver through channel 6 down through channel 2 and check for normal response curve shapes and oscillator injection voltage. Likewise check channels 7 through 13, stopping on 13 for the next step. With the receiver on channel 13, check the receiver oscilla- tor frequency. Correct by adjustment of Cl if necessary. Adjust the oscillator to frequency on all channels by switching the receiver and the heterodyne frequency meter to each channel and adjusting the appropriate oscillator trimmer to obtain a beat on the freq. meter. It should be possible to adjust the oscillator to the correct frequency on all channels with the fine tuning control 30 degrees clockwise from the mechanical center of its range. Picture Sound Receiver Channel Channel Carrier Carrier R -F Osc. Oscillator Number Freq. Mc. Freq. Mc. Freq. Mc. Adjustment 2 55.25 59.75 80.750 LI 3 61.25 65.75 86.750 L2 4 . 67.25 71.75 92.750 L3 5 77.25 81.75 102.750 L4 6 83.25 87.75 108.750 L5 7 175.25 179.75 200.750 L6 8 181.25 185.75 206.750 L7 9 187.25 191.75 212.750 L8 10 193.25 197.75 218.750 L9 11 199.25 203.75 224.750 L10 12 . . 205.25 209.75 . . 230.750 L11 13 211.25 .215.75 236.750 Cl Switch to channel 8 and observe the response. Adjust Tl clockwise while watching the change in response. When Ti is properly adjusted, the selectivity curve will be slightly wider with a slightly deeper valley in, its top. Switch through all channels and observe response, oscillator injection and r -f oscillator frequency. Minor touch-ups of adjustments may be made at this time. However, if C7 or C9 are changed appreciably, then a recheck of the oscillator frequency on all channels should be made. Reconnect the link from T101 to terminal 2 of the r -f unit terminal board. Since Ti was adjusted during the r -f unit alignment it will be necessary to sweep the overall i-f response. R -F UNIT TUBE CHANGES. -Since most of the circuits are low capacitance circuits the r -f unit may require readjustments when the tubes are changed. If the 6CB6 r -f amplifier tube is changed, it may be necessary to readjust C16 and C22. If the 6J6 oscillator and mixer tube is changed, then more extensive adjustments are required. For good conversion efficiency, the oscillator injection to a triode mixer must be held reasonably close to the optimum value. Although there is some latitude in this level, it is nearly expended in the normal variation in injection from channel to channel. Consequently, the adjustment of C7 is limited primarily to establishing the conditions for good conversion. Since changes in oscillator injection affect conversion gain, it also affects the input capacity of the mixer, thus also affecting tracking of the mixer grid circuit. These tube variations with their consequent effect on circuit alignment thereby require readjustment of the r -f unit if maximum conversion efficiency is to be retained after the 6J6 tube is changed. It may be possible, however, to try several 616 tubes and select one which gives satisfactory performance without realignment. PICTURE I -F TRANSFORMER ADJUSTMENTS. Connect the "VoltOhmyst" to the junction of R142 and R143. Turn the AGC control fully clockwise. Obtain a 7.5 volt battery capable of withstanding appreciable current drain and connect the ends of a 1,000 ohm potentiometer across it. Connect the battery positive terminal to chassis and the potentiometer arm to the junction R142 and R143. Adjust the potentiometer for -5.0 volts indication on the "VoltOhmyst". Set the channel switch to channel number 9, 10 or 11. Connect the "VoltOhmyst" to pin 2 of V110 (Pin 4 if 6AC7 or 6AG7 is used) and to ground. Connect the output of the signal generator to the mixer grid test point TP2 in series with a 1500 mmf ceramic capacitor. Connect a separate -5 volt bias supply to TP1 with the positive terminal to ground. Set the generator to each of the following frequencies and with a thin fiber screwdriver tune the specified adjustment for maximum indication on the "VoltOhmyst". In each instance the generator should be checked against a crystal calibrator to insure that the generator is on frequency. 9 118 17T200, 17T201, 17T202, 17T211, 17T220 ALIGNMENT PROCEDURE Adjust the signal generator output to give 3 volts on the "VoltOhmyst" as the final adjustment is made. (1) 24.25 mc.-T107 (3) 22.75 mc.-T105 (2) 25.5 mc.-T106 PICTURE I -F TRAP ADJUSTMENT. -With the same connections as above, tune the generator to 27.00 mc. and adjust the T104 top core for minimum d -c on the "VoltOhmyst". Set the generator output so that this minimum is about 3 volts when final adjustment is made. If necessary, the i-f bias may be reduced in order to obtain the 3 volt reading on the "VoltOhmyst". SWEEP ALIGNMENT OF PIX I -F. -To align T1 and T104, connect the sweep generator to the mixer grid test point TP2. In series with a 1500 mmf ceramic capacitor use the shortest leads possible, with not more than one inch of unshielded lead at the end of the sweep cable. Connect the sweep ground lead to the r -f unit outer shield. Connect a separate -5.0 volt bias supply to TP1 with the positive terminal connected to ground and by-pass TP1 to ground with a 1500 mmf. ceramic capacitor. Set the channel selector switch between channels 2 and 13. Clip 330 ohm resistors across terminals A and B of T106 and T107. Preset C115 to minimum capacity. Adjust the bias box potentiometer to obtain -5.0 volts of bias as measured by a "VoltOhmyst" at the junction of R142 and R143. Leave the AGC control fully clockwise. Connect a 180 ohm composition resistor from pin 5 of V106 to terminal A of T105. Connect the oscilloscope diode probe to pin 5 of V106 and to ground. Couple the signal generator loosely to the diode probe in order to obtain markers. Adjust Ti (top) and T104 (bottom) for maximum gain and with 25.5 mc. at 70' ; of maximum response. Set the sweep output to give 0.3 volt peak -to -peak on the oscilloscope when making the final touch on the above adjustment. Adjust C115 until 22.25 mc. is at 70% response with respect to the low frequency shoulder of the curve as shown in Figure 12. Disconnect the diode probe, the 180 ohm and two 330 ohm resistors. Connect the oscilloscope to pin 2 of V110 socket (or pin 4 of 6AC7 or 6AG7). Leave the sweep generator connected to the mixer grid test point TP2 with the shortest leads possible. Adjust the output of the sweep generator to obtain 3.0 volts peak -to -peak on the oscilloscope. Couple the signal generator loosely to the grid of the first pix i-f amplifier. Adjust the output of the signal generator to produce small markers on the response curve. Retouch T105, T106 and T107 to obtain the response shown in Figure 13. It is especially important that the 22.4 mc. marker should fall at 55% on the overall i-f response curve. If the marker should fall appreciably higher than 55%, trouble may be experienced with sound in the picture. If the marker should fall appreciably below 55% response, the sound sensitivity may be reduced and may cause the sound to be noisy in weak signal areas. RATIO DETECTOR ALIGNMENT. -Set the signal generator at 4.5 mc. and connect it to the first sound i-f grid, pin 1 of V101. As an alternate source of signal, the RCA WR39B or WR39C calibrator may be employed. In such a case, connect the calibrator to the grid of the third pix i-f amplifier, pin 1 of V108. Set the frequency of the calibrator to 25.50 mc. (pix carrier) and modulate with 4.5 mc. crystal. The 4.5 mc. signal will be picked off at L102 and amplified through the sound i-f amplifier. Connect the "VoltOhmyst" to pin 2 of V103. Tune the ratio detector primary, T102 top core for maximum d -c output on the "VoltOhmyst". Adjust the signal level from the signal generator for 6 volts on the "VoltOhmyst" when finally peaked. This is approximately the operating level of the ratio detector for average signals. Connect the "VoltOhmyst" to the junction of R106 and C108. Tune the ratio detector secondary T102 bottom core for zero d -c on the "VoltOhmyst". Repeat adjustments of T102 top for maximum d -c at pin 2 of V103 and T102 bottom for zero d -c at the junction of R106 and C108. Make the final adjustments with the signal input level adjusted to produce 6 volts d -c on the "VoltOhmyst" at pin 2 of V103. SOUND I -F ALIGNMENT. -Connect the signal generator to the first sound i-f amplifier grid, pin 1 of V101. As an alternate source of signal, the RCA WR39B or WR39C calibrator may be employed as above. Connect the "VoltOhmyst" to pin 2 of V103. Tune the T101 top core for maximum d -c on the "VoltOhmyst". The output from the signal generator should be set to produce approximately 6.0 volts on the "VoltOhmyst" when the final touches on the above adjustment are made. 4.5 MC. TRAP ADJUSTMENT. -Connect the signal generator in series with a 1,000 ohm resistor to pin 2 of V109. Set the generator to 4.5 mc. and modulate it 30' ;, with 400 cycles. Set the output to approximately 0.5 volts. Short the third pix i-f grid to ground, pin 1, V108, to prevent noise from masking the output indication. Connect the crystal diode probe of an oscilloscope to the plate of the video amplifier, pin 6 of V110 (pin 8 when 6AC7 or 6AG7 is used). Adjust the core of L103 for minimum output on the oscilloscope. Remove the short from pin 1, V108 to ground. As an alternate method, this step may be omitted at this point in the alignment procedure and the adjustment made "on the air" after the alignment is completed. If this is done, tune in a station and observe the picture on the kinescope. If no 4.5 mc. beat is present in the picture, when the fine tuning control is set for proper oscillator -frequency, then L103 requires no adjustment. If a 4.5 mc. beat is present, turn the fine tuning control slightly clockwise so as to exaggerate the beat and then adjust L103 for minimum beat. CHECK OF OVERALL RESPONSE. -If desired, the overall response of the receiver can be checked on each channel. Connect the r -f sweep generator to the receiver antenna input terminals. If necessary, employ one of the pads shown in Figure 9 to match the sweep output cable to the r -f unit. Connect the signal generator loosely to the first pix i-f amplifier grid. Adjust the bias potentiometer to obtain -5.0 volts of bias as measured by a "VoltOhmyst" at the junction of R142 and R143. Connect the oscilloscope to pin 2 of V110 (or pin 4 if 6AC7 or 6AG7 is used). Check the response of channels 2 through 13 by switching the receiver channel switch and sweep oscillator to each of these channels and observing the response obtained. On each channel, adjust the output of the sweep generator to obtain 3.0 volts peak -to -peak on the oscilloscope. I -F markers at 22.4 mc., 24.75 mc. and 25.5 mc. should be provided by the signal generator. The response obtained in this manner should be very similar to that shown in Figure 13. Some curves may show a 10% sag in the top between 22.75 mc. and 24.75 mc. while others may show a 10% peak in this region. This may be considered normal. If the picture carrier is consistently high or low on all channels, T106 may be adjusted slightly. Do not adjust T105. AGC CONTROL ADJUSTMENT. -Disconnect all test equipment except the oscilloscope which should be connected to pin 6 of V110 (pin 8 when 6AC7 or 6AG7 is used). Connect an antenna to the receiver antenna terminals. Turn the AGC control fully counter -clockwise. Tune in a strong signal and adjust the oscilloscope to see the video waveform. Turn the AGC control clockwise until the tips of sync begin to be compressed, then counter -clockwise until no compression is obtained. 10 ALIGNMENT PROCEDURE 1 19 17T200, 17T201, 17T202, 17T211, 17T220 HORIZONTAL OSCILLATOR ADJUSTMENT.-Nor- molly the adjustment of the horizontal oscillator is not considered to be a part of the alignment procedure, but since the oscillator waveform adjustment may require the use of an oscilloscope, it can not be done conveniently in the field. The waveform adjustment is made at the factory and normally should not require readjustment in the field. However, the waveform adjustment should be checked whenever the re- ceiver tion is is aligned improper. or whenever the horizontal oscillator opera- Horizontal Frequency Adjustment.-Tune in a station and sync the picture. If the picture cannot be synchronized with the horizontal hold control R170B, then adjust the T110 frequency core on the rear apron until the picture will synchronize. If the picture still will not sync, turn the T110 waveform adjustment core (under the chassis) out of the coil several turns from its original position and readjust the T110 frequency core until the picture is synchronized. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 3 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C161A slightly clockwise. If less than 2 bars are present, adjust C161A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 or 3 bars are present. Turn the horizontal hold control to the maximum clockwise position. Adjust the T110 frequency core so that the diagonal bar sloping down to the right appears on the screen and then reverse the direction of adjustment so that bar just moves to the left side of the screen leaving the picture in synchronization. wiEdxthamorinleintehaeriwtyiditshianncdorlrienceta,raitdyjuosftththeephicotruirzeo.nItfalpidctruivree control C161B, the width control L106 and the linearity control L108 until the picture is correct. Horizontal Oscillator Waveform Adjustment.-The horizontal oscillator waveform may be adjusted by either of two methods. The method outlined in paragraph A below may be employed in the field when an oscilloscope is not available. The service shop method outlined in paragraph B requires the use of an oscilloscope. below A.-Turn the horizontal hold control completely clockwise. Place adjustment tools on both cores of T110 and be prepared to make simultaneous adjustments while watching the picture on the screen. First, turn the T110 frequency core (on the rear apron) until the picture falls out of sync and three or four dsciaregeonn.aTl hbelanc,ktubranrsthselowpainvgefdoormwnadtojutshtemreignht tcoarpep(euanrdoenr tthhee chassis) into the coil while at the same time adjusting the fre- quency core so as to maintain three or four diagonal black bars on the screen. Continue this procedure until the oscillator begins to motorboat, then turn the waveform adjustment core out until the motorboating just stops. As a check, turn the T1I0 frequency core until the picture is synchronized then reverse the direction of rotation of the core until of sync with the diagonal bars sloping tdhoewpnicttuorethfealrlisghout.t Continue to turn the frequency core in the same direction. No more than three or four bars should appear on the screen. Instead, the horizontal oscillator should begin the motorboat. Retouch the adjustment of the T110 waveform adjustment if necessary until this condition is obtained. core B.-Connect terminal C of the low capacity probe of T110. Turn the horizontal haonldosccoilnlotrsoclopoeneto- quarter turn from the clockwise position so that the picture is in sync. The pattern on the oscilloscope should in Figure 14. Adjust the waveform adjustment until the two peaks are at the same height. be as shown DcourerionfgTt1h1i0s adjustment, the picture must be kept in sync by readjusting the hold control if necessary. This adjustment is very important for correct operation of the circuit. If the broad peak of the wave on the oscilloscope is lower than the sharp peak, the noise immunity becomes poorer, the stabilizing effect of the tuned circuit is reduced and drift of the oscillator becomes more serious. On the other hand, if the broad peak is higher than the sharp peak, the oscillator is overstabilized, the pull -in range becomes inadequate and the broad peak can cause double triggering of the oscillator when the hold control approaches the clockwise position. Remove the oscilloscope upon completion of this adjustment. Horizontal Locking Range Adjustment.-Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T110 frequency core slightly and momentarily switch off channel. SENSITIVITY CHECK.-A comparative sensitivity check can be made by operating the receiver on a weak signal from u television station and comparing the picture and sound obtained to that obtained on other receivers under the same conditions. This weak signal can be obtained by connecting the shop anterma to the receiver through a ladder type attenuator pad. The number of stages in the pad depends upon the signal strength available at the antenna. A sufficient number of stages should be inserted so that a somewhat less than normal contrast picture is obtained when the picture control is at the maximum clockwise position. Only carbon type resistors should be used to construct the pad. RESPONSE CURVES.-The response curves shown on page 14 and referred to throughout the alignment procedure were taken from a production set. Although these curves are typical, some variations can be expected. The response curves are shown in the classical manner of presentation, that is with "response up" and low frequency to the left. The manner in which they will be seen in a given test set-up will depend upon the characteristics of the oscilloscope and the sweep generator. The curves may be seen inverted and/ox switched from left to right depending on the deflection polarity of the oscilloscope and the phasing of the sweep generator. NOTE ON R -F UNIT ALIGNMENT.-Because of the frequency spectrum involved and the nature of the device, many of the r -f unit leads and components are critical in some respects. Even the power supply leads form loops which couple to the tuned circuits, and if resonant at any of the frequencies involved in the performance of the tuner, may cause serious departures from the desired characteristics. In the design of the receiver these undesirable resonant loops have been shifted far enough away in frequency to allow reasonable latitude in their components and physical arrangement without being troublesome. When the r -f unit is aligned in the receiver, no trouble from resonant loops should be experienced. However, if the unit is aligned in a jig separate from the receiver, attention should be paid to insure that unwanted resonances do not exist which might present a faulty repre- sentation of r -f unit alignment. A resonant circuit exists between the r -f tuner chassis and the outer shield box, which couples into the antenna and r -f plate circuits. The frequency of this resonance depends on the physical structure of the shield box, and the capacitance between the tuner chassis and the front plate. In the KRK8 units, this resonance should fall between 120 and 135 mc. and is control:ed in the design by using insulating washers of different thicknesses (in the front plate to tuner chassis mounting) to compensate for differences in the shield boxes of different models of receivers. The performance of the tuner, particularly on channels 7 and 8 will be impaired if the proper washers for the particular shield box involved are not used. Obviously then, if the r -f unit is removed for service, the washers should be replaced in the correct order when the unit is replaced. 11 1 20 17T200, 17T201, 17T202, 17T211, 17T220 ALIGNMENT TABLE THE DETAILED ALIGNMENT PROCEDURE BEGINNING ON PAGE 8 SHOULD BE READ BEFORE ALIGNMENT BY USE OF THE TABLE IS ATTEMPTED CONNECT SIGNAL CONNECT SWEEP CONNECT HET. STEP. SIGNAL GEN. SWEEP GEN. HETERODYNE METER CONNECT No. GENERATOR FREQ. GENERATOR FREQ. FREQ. METER FREQ. "VOLTOHMYST" TO MC. TO MC. TO MC. TO MISCELLANEOUS CONNECTIONS AND INSTRUCTIONS ADJUST REFER TO R -F UNIT ALIGNMENT 1 Disconnect the T1 by backing co -ax link from terminal 2 the core all the way out of of the r -f unit the coil. Back terminal board and connect a the L44 core al the way out. 39 ohm composition resistor between lugs 1 Back the L203 core all the way out. In order and 2. to align Detune the r -f taunnyera,dijtuwstimll efnirtsst.be necessary to set the channel 13 oscillator to frequency The shield over the bottom of the r -f unit must be in place when making 2 Not used Not used Loosely coupled 236.75 Not used to r -f oscillator MC. Fine tuning 30 de- CI foranaudiblebeat Fig. 7 grees clockwise from on het. freq. meter mechanical center of its range. Receiver on channel 13. 3 .. 4 Antenna 181.25 Antenna Sweep- Not used terminal 185.75 terminals ing (loosely) (see text for channel precaution) 8 Connect "Vo't- Turn AGC control Adjust the bias box Ohmyst" to ter- minal 3 of the fully clockwise. Con- potentiometer for nect bias box to ter- -3.5 volts. r -f unit terminal minal 3 of r -f unit board term. board - Not used Rec. on chan. 8. Connect oscilloscope to TP1. Fig. 7 Adjust C9, C11, C16 and C22 for correct curve shape, frequency and band width. C22 is adjusted to give max. amplitude between markers. C9 affects tilt and C16 affects the frequency of response. C11 affects the re- sponse band width. 5 Not used 6 Antenna terminal (loosely) 7 Not used 83.25 87.75 - Not used Antenna terminals (see text for precaution) Not used Not used Loosely coupled to r -f oscillator Channel Not used 6 - Not used 108.75 - - " Connect "Volt- Ohmyst" to r -f unit test point TP1 Rec. on channel 6 L5 for audible beat on het. freq. meter. Fig. 8 Rec. on chan. 6. Adjust L42, L45 and L49 for proper response. L42 is adjusted to give max. amplitude between markers. L45 primarily affects tilt and L49 primarily affects freq. of response. If necessary, retouch C11 proper width. for Fig. 11 Rec. on channel 6 Adjust C7 for -3.0 volts at the test point Fig. Fig. 7 15 8 Repeat above steps until the specified conditions are obtained. 9 Not used Not used - Loosely coupled 206.75 to r -f oscillator Rec. on chart. 8 I CI on fhoert.aufdreibq.lembeeteart Fig. 7 10 Atenrmteinnnaal 181.25 Antenna 185.75 terminals Sweep- Not used ing (loosely) (see text for channel precaution) 8 - Not used Rec. on than. 8. Readjust C9, C16 and C22 for correct curve shape, frequency and band Fig. 7 Fig. 11 width. Readjust C11 only if necessary. (8) 11 " 211.2.5 .. Sweep- Not used 215.75 ing channel 13 - Not used Rec. on chan. 13. Adjust L52 for max. ampli- tude between markers, overshoot a little Fig. 7 Fig. 11 mAodrjeustht aCn2r2eqtouirreedgatoinremacahx.maamx.prleitsupdoensoef. (13) 12 215.75 Not used - Loosely coupled 236.75 to r -f oscillator response. Receiver on chan. 13. Adjust L43 for correct channel 13 osc. freq. then overshoot. Reset the osc. to proper freq by adjustment of Cl. Fig. Fig. 7 8 13 205.25 209.75 Antenna terminals channel Not used 12 - Connect "Volt- Rec. on chan. 12 Ohmyst" to r -f unit test point TP1 Check to see that response is correct and Fig. 11 -3.0 volts of osc. in - jection is present (see text for 14 " 199.25 precaution) channel " 203.75 11 15 ' 193.25 " channel 197.75 10 - - " Rec. on chan. 11 Rec. on chan. 10 " Fig. 11 (11) Fig. 11 (10) 16 " 187.25 ' channel - 191.75 9 17 - 181.25 " channel " - 185.75 8 18 175.25 channel " - 179.75 7 Rec. on chan. 9 Rec. on chan. 8 Rec. on chan. 7 " Fig. 11 (9) " Fig. 11 (8) " Fig. 11 (7) 19 If the response of any channel (steps 3 through 18) is below 80% at either marker, repeat step 10 and adjust C9, C11, C16 and C22 as necessary to pull response up on the low channel yet maintain correct small amount and corrected by adjustment of L52 to give response on channel 8. If C22 required adjustment, the adjustment should be overshot maximum amplitude of response between the sound and picture carrier markers. a 20 Repeat step 9. If the oscillator is off frequency overshoot the adjustment of Cl and correct by adjusting L43. 21 Repeat steps 13 through 20 until all requirements are obtained. 22 Not used - Not used - Loosely coupled 108.75 to r -f oscillator Rec. on chan. 6 I L5 for zero beat on het. freq. meter Fig. 8 Antenna 23 Antenna terminals 83.25 terminals Sweeping Not used 87.75 (see text for channel (loosely) precaution) 6 24 Not used - Not used - Not used Antenna 25 Antenna terminals (loosely) 77.25 terminals channel " 81.75 (see text for precaution) 5 - Not used Observe response. If necessary readjust L42, Lto4u5chanCdllL. 49. It should not be necessary to Fig. 7 Fig. 11 - Connect Ohmyst- t"oVothlte- r -f unit test point Check osc. injection. If necessary adjust C7 to give -3 volts. If C7 is adjusted, switch to channel 8, and readjust C9 for proper re- Fig. 7 Fig. 11 TP1 sponse then repeat step 23. - " Rec. on chan. 5 Check to see that re- Fig. 11 sponse is correct and -3.0 volts of osc. in- (5) jection is present 12 ALIGNMENT TABLE 121 17T200, 17T201, 17T202, 17T211, 17T220 CONNECT SIGNAL CONNECT SWEEP HET. MISCELLANEOUS STEP SIGNAL GEN. SWEEP GEN. CONNECT FREQ. CONNECT CONNECTIONS No. GENERATOR FREQ. GENERATOR FREQ. HETERODYNE METER "VOLTOHMYST" AND TO MC. TO MC. FREQ. METER MC. TO INSTRUCTIONS ADJUST REFER TO 26 Antenna terminals (loosely) 27 '' 28 " t7.23 Ant. tenni- channel Nut used 71.75 nals (see text 4 for precaution) 61.25 " channel " 65.75 3 55.25 " 59.75 channel " 2 - Connect "Volt- Rec. on ohan. 4 Ohmyst" to the r -f unit test point TP1 - Rec. on chart. 3 - " Rec. on chan. 2 Check to see that response is correct and -3.0 volts of osc. injection is present " " Fig. II (4) Fig. 11 (3) Fig. 11 (2) 29 Likewise check channels 7 through 13, as outlined in steps 18 back through 13, stopping on channel 13 for next step. 30 Antenna 215.75 Not used terminals - Loosely coupled 236.75 Not used to r -f oscillator Fine tuning 30 de- Cl for zero beat on Fig. 7 grees clockwise from het. freq. meter mechanical center of its range. Receiver on 31 " 209.75 " 32 ' 203.75 33197.75 " " 34 " 191.75 " 35 185.75 ' 179."75-" 36 " - " - " - " - " - " 230.75Rec.channel 13 " on chan. 12 224.75 " Rec. on chart. 11 218.75 " Rec. on chart. 10 212.75 " Rec. on chart. 9 206.75 Rec. on chart. 8 200.75 " Rec. on chan. 7 Lil as above L10 as above L9 as above L8 as above L7 as above L6 as above Fig. 8 Fig. 8 Fig. 8 Fig. 8 Fig. 8 Fig. 8 37 " 38 " 39 " 40 " 41 87.75 " 81.75 71.75 " 65.75 59.75 " - .. - 102.75Rec. 108.75 " Rec. on chan. 6 on chart. 5 -80.75 - " - " " 92.75 ' 86.75 Rec. on chart. 4 Rec. on chart. 3 Rec. on chan. 2 L5 as above L4 as above L3 as above L2 as above LI as above Fig. 8 Fig. 8 Fig. 8 Fig. 8 Fig. 8 42 Repeat steps 30 through 41 as a check. 43 Antenna 181.25 Antenna terminals 185.75 terminals Sweep- Not used ing - channel 8 Rec. on chart. 8 Oscilloscope at test point Fig. 11 TP1. Adjust T1 clockwise. When properly (8) adjusted, curve will be slightly wider with a slightly deeper valley in top. 44 Switch through all channels and observe response, oscillator injection and r -f oscillator frequency. Minor touch-ups of adjustments may be made at this time. However, if 07 or C9 are changed appreciably, then a recheck of the oscillator frequency on all channels should be made. 45 Remove 39 ohm resistor and reconnect link from T101 to terminal 2 of r -f unit terminal board. STEP No. CONNECT SIGNAL GENERATOR TO 46 Not used SIGNAL OEN. FREQ. MC. 47 " 48 Mixer grid test point 24.25 TP2 in series with 1500 mmf. 49 " 25.5 50 " 22.75 51 " 27.00 52 Connected loosely Various to diode probe See Fig. 13 CONNECT SWEEP GENERATOR TO Not used " " Mixer grid test point TP2 in series with 1500 mmf. PICTURE I -F AND TRAP ADJUSTMENT SWEEP GEN. FREQ. MC. - CONNECT OSCILLOSCOPE TO Not used CONNECT "VOLTOHMYST" TO Junction of R142 & R143 - - 20 to 28 mc Test point TP1 Pin 2 of V110 and to ground " Scope diode probe to pin 5 of V106 and t1o8g0nodh. mCornenseiscttoar from pin 5 of V106 to pin A of T105 Junction of R142 & R143 MISCELLANEOUS CONNECTIONS AND INSTRUCTIONS ADJUST Connect bias box to junction of R142 & Afodrjus-t5p.0otenvtoioltms etoenr R143 and to ground meter AGC fully clockwise Connect bias box to " TP1 and to ground Bias boxes con- T107 (top) for max. netted as above T106 (top) for max. T105 (top) for max. " T104 (top) for min. Shunt terminals A and B of T106 and T107 with 330 ohms. Set C115 to min. Adjust T1 top and T104 bot. for max. gain Bias boxes connected with 25.5 mc. at 70%. as above. .3v p -p on C115 for 22.5 at 70% scope REFER TO Fig. 3 Fig. 7 Fig. 15 Fig. 15 Fig.15 Fig. 15 Fig. 7 Fig. 16 53 Connected loosely Various " to grid Adjust off1osrt psimx ai-lfl. See Fig. 14 marker indication " Connect scope to pin 2 of V110. Re- move shunt & diode probe used above Remove shunts from T106 & T107 RarenesdtpoToucn1hs0e7T1sth0oo5o,wbTnt1a0iinn6 Fig. 13 Fig. 13 RATIO DETECTOR, SOUND I -F AND 4 5 MC TRAP ALIGNMENT 54 Grid 1st Snd. I -F 25.50mc. Not used (pin 1, V101) or mod. by - Not used Pin 2 of V103 Set signal gen. to T102 top core for ma:. Fig. 15 give 6V on meter d -c on meter WR39B or C con- 4.5 mc. nett to grid 3rd pix I -F (pin 1, V108) 55 " -"VoltOhmyst" " " to junction R106 and C108. Fig .15 Adjust T102 bottom core for zero DC on Fig.16 meter. Repeat steps 54 and 55 until all conditions are satisfied. 56 Sig. Gen. to 1st 4.5 mc. " - Snd. I -F grid Signal generator T101 top core for max. Fig. 15 output adjusted to DC on meter provide 6 v on meter 57 Sig. Gen. in series 4.5 mc. " with 1000 ohms to mod.30% pin 2 of V109 with 400 cy. - Diode probe to Not used pin 6 of V110 Short pin 1 of V108 to ground Amdjuumst Lo10u3tfpour mt ionin- Fig. 15 oscilloscope ALIGNMENT DATA 122 17T200, 17T201, 17T202, 17T211, 17T220 C7 OSCILLATOR INJECTION ON TWIS SIDE C25 TEST FINE POINT TUNING TP2 TEST POINT TPI C22 R -F GRID L52 IN BACK i Z..OSC. elj' ,op oot 0 MS 1141 C11 BAND WIDTH IN BACK T1 CONVERTER TRANS. L49 L45 1 Figure 7 -R -F Unit Adjustments L3-CHAN.4 L4 CHAN. 5 L5 CHAN. 6 I\ 0 Figure 11 -R-F Response Figure 8 -R -F Oscillator Adjustments PAD FOR Son COAX PAD FOR 72 IL CoA X . PAD FOR 300 IL BAL INPUT 471 300sL BALANCED OUTPUT 300 /1_ BALANCED OUTPUT 47n M51164 Figure 9 -Sweep Attenuator Pads SHOULDER AT 52 MC. 60 MC. "-53 MC. 100% RESPONSE 50 MC. AT 60% ± 15% RESPONSE POINT CV 123 Figure 10 -Antenna Matching Unit Response Figure 12 T1 and T104 Response CY Figure 13 Over-all I -F Response INCORRECT CORRECT Figure 14 -Horizontal Oscillator Wave Forms 123 17T200, 17T201, 17T202, 17T211, 17T220 ALIGNMENT DATA L203 FM TRAP L42 L52 C7 *OSCILLATOR INJECTION FINE TUNING CONTROL L'1 -q CHANNEL SELECTOR SWITCH RATIO D T TRANS SND I -F TRANS /- T102 V102 ,T101 wog vloe 4:11(.7 T105- 2P.112 ) 4.5MC w6A5U269 4.5mc PIX DET $VERT66C66 3UPIXe6036_2Nopixe PIX I -F fp:LI:11:1r SYNC SEPT, 07 I -F AMP T106 q±/:1P TRANS _44,---iri II S101 TV-PHONO SWITCH - /V103\ AMP ,,..-.611144.... I -F 6AL5 RATIO DET 6AU61.s1 SNDI-F 4TH PIX I -F 3RD PIX I -F -k.!......,IP TR 24.25MC TR 25.5MC L 103 "86(v-110oP0I2X:75Mec_li1i .._ ii N :___ \tytp.....0 /cTi;\1. 5102-R109 AT/117s\ 4.5MC TRAP V110 6AU6-AGC 17112 AMP 65N7GT 601_6 VIDEO HOR SYNC SEP & AMP C184 IT1041 27.00 MC 6AV6 AUDIO ON -OFF SWITCH 4VOL.CONTROL VERT SYNC V105 6K6 GT AUDIO Figure I5-Top thassis Adjustments FINE TUNING CONTROL rrl CHANNEL SELECTOR SWITCH 5101 TV-PHONO SWITCH 5102-R109 ON -OFF SWITCH &VOL.CONTROL /- TIOS V107 O(6C86 MAX) I -F AMP e- T0106660EV11068 \ T107 ii2VAI0u97\ EPPIX/ 'PIX.DET! I-F AMP syN6c,...VERsET.prv-I6Aoui 7101 SND I -F TRANS.R,, RATIO DET. TRANS. V102 2M.P. T102 SND. 1-0 AMP. 4.5MC 6AV6. AUDIO A:11, vi (6C66 -19PPI1X9) I -F AMP. 1§:r. PIX I -F TRANS, VIOS 6K6GT AUDIO OUTPUT I CIBS 5ND. I -F AMU /*V103) 6AL5 - RATIO DET,/ r-V11i) V112 6SN7GT AU (IAm6GpC/6 HOR.SYNC.SEP. "VERT SYNC. OUTPUT Figure 16-Bottom Chassis Adjustments 15 124 17T200, 17T201, 17T202, 17T211, 17T220 TEST PATTERN PHOTOGRAPHS Figure 17-Normal Picture Figure 18-Focus Magnet and Ion Trap Magnet Misadjusted Figure 19-Horizontal Linearity Control Misadjusted (Picture Cramped in Middle) ESE Figure 20-Width Control Misadjusted 31404* -0 - Figure 21-Horizontal Drive Control Misadjusted Figure 22-Transients - ii,a31,1' Figure 23-Test Pattern Show- ing Out of Sync Condition When Horizontal Hold Control Is in a Counter -clockwise Position-Just Before Pulling Into Sync -4-44* Figure 24-Test Pattern Show- ing Out of Sync Condition When Horizontal Hold Control Is at the Maximum Clockwise Position 16 125 SERVICE SUGGESTIONS 17T200, 17T201, 17T202, 17T211, 17T220 Following is a list of symptoms of possible failures and an indication of some of the possible faults: NO RASTER ON KINESCOPE: (1) Incorrect adjustment of ion trap magnet. Magnet reversed either front to back or top to bottom. (2) V115 or V116 inoperative. Check waveforms on grids and plates. (3) No high voltage-if horizontal deflection is operating as evidenced by the correct waveform on terminal 1 of high voltage transformer, the trouble can be isolated to the 1B3GT circuit. Either the T111 high voltage winding is open, the 1B3GT tube is defective or its filament circuit is open. (4) V110 circuit, inoperative-Refer to schematic and waveform chart. (5) Damper tube (V118) inoperative. (6) Defective kinescope. (7) R184 open. (8) No receiver plate voltage-filter capacitor shorted-or filter choke open. NO VERTICAL DEFLECTION: (1) V113 or V114 inoperative. Check voltage and waveforms on grids and plates. (2) T108 open. (3) Vertical deflection coils open. SMALL RASTER : (1) Low Plus B or low line 'voltage. (2) V116, V120 or V121 defective. SIGNAL AT KINESCOPE GRID BUT NO SYNC: (1) AGC control R149 misadjusted. (2) Viii, inoperative. Check voltage and waveforms at its grid and plate. SIGNAL ON KINESCOPE GRID BUT NO VERTICAL SYNC: ( 1) Check V113 and associated circuit. (2) Integrating network inoperative-Check. (3) V109B or V112B defective or associated circuit defective. (4) Gas current, grid emission or grid cathode leakage in V112. Replace. SIGNAL ON KINESCOPE GRID BUT NO HORIZONTAL SYNC: (1) T110 misadjusted-readjust as instructed on page 11. (2) V112 inoperative-check socket voltages and waveforms. (3) T110 defective. (4) C192, C161A, C163, C165, C166, C167, C168, C169 or C170 defective. (5) If horizontal speed is completely off and cannot be adjusted check R192, R193, R170B, R195, R196 and R198. SOUND AND RASTER BUT NO PICTURE OR SYNC: (1) Picture, detector or video amplifier defective-check V109A and V110-check socket voltages. (2) Bad contact to kinescope cathode. POOR VERTICAL LINEARITY: (1) If adjustments cannot correct, change V114. (2) Vertical output transformer T108 defective. (3) V113 defective-check voltage and waveforms on grid and plate. . (4) C151, C152, C153, C155, or C156 defective. (5) Low plate voltage-check rectifiers and capacitors in supply circuits. (6) If height is insufficient, try changing V113. POOR HORIZONTAL LINEARITY: (1) If adjustments do not correct, change V116, or V118. (2) T108 or L108 defective. (3) C176 or C177 defective. PICTURE STABLE BUT POOR RESOLUTION: (1) V109A or V110 defective. (2) Peaking coils defective-check resistance. (3) Make sure that the focus control operates on both sides of proper focus. (4) R -F and I -F circuits misaligned. PICTURE SMEAR: ( 1) R -F or I -F circuits misaligned. (2) Open peaking coil. (3) This trouble can originate at the transmitter-check on another station. PICTURE JITTER: WRINKLES ON SIDE OF RASTER: (1) C181 defective. (2) Defective yoke. PICTURE OUT OF SYNC HORIZONTALLY: (1) T110 incorrectly tuned. (2) R192, R193 or R170B defective. TRAPEZOIDAL OR NON SYMMETRICAL RASTER: (1) Improper adjustment of centering of focus magnet or ion trap magnet. (2) Defective yoke. RASTER AND SIGNAL ON KINESCOPE BUT NO SOUND: (1) L102 defective. (2) Sound i-f, ratio detector or audio amplifier inoperative- check V101, V102, V103 and their socket voltages. (3) Audio system defective. (4) Speaker defective. (1) AGC control R149 misadjusted. (2) If regular sections at the left picture are displaced change V116. (3) Vertical instability may be due to loose connections or noise, (4) Horizontal instability may be due to unstable trans- mitted sync. RASTER BUT NO SOUND, PICTURE OR SYNC: (1) Defective antenna or transmission line. (2) R -F oscillator off frequency. (3) R -F unit inoperative-check VI, V2. DARK VERTICAL LINE ON LEFT OF PICTURE: (1) Reduce horizontal drive and readjust width and horizontal linearity. (2) Replace V116. LIGHT VERTICAL LINE ON LEFT OF PICTURE: (1) V118 defective. 17 126 17T200, 17T201, 17T202, 17T211, 17T220 RESPONSE AND WAVE FORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Figure 25-Overall Pix I -F Response .4-444 Figure 26-Response of T1 -T104 Pix I -F Transformers ill41141P-11. Figure 27-Response of T105 Pix Transformer Figure 28-Response of T106 Pix I -F Transformer Figure 29-Response of T107 Pix I -F Transjoriaer S Figure 30-Video Response at Average Contrast 1144111.-0. Grid of Video Amplifier (Pin 2 of Vim) (6CL6) Voltage Depends on Picture Figure 31-Vertical (Oscilloscope Synced to 1/2 of Vertical Sweep Rate) (1.5 Volts PP) .1-44* Figure 32-Horizontal (Oscilloscope Synced to 1/2 of Horizontal Sweep Rate) (1.5 Volts PP) Plate of Video Amplifier (Pin 6 of Vuo) (6CL6) Voltage depends on picture Figure 33-Vertical (85 Volts PP) -S-40* Figure 34-Horizontal (85 Volts PP) 18 75.5 MC. CV 162D LET77c 4.4 11414%14 CV I63A WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Grid of Horizontal Sync Separator (Pin 1 of V112A) (6SN7) Voltage depends on picture Figure 35-Vertical (85 Volts PP) Figure 36-Horizontal (85 Volts PP) S 12277 17T200, 17T201, 17T202, 17T211, 17T220 "Pk CVI63C Cathode of Horizontal Sync Sep. (Pin 3 of V1I2A) (6SN7) Figure 37-Vertical (7.5 Volts PP) *--.0041 Figure 38-Horizontal (5 Volts PP) 31.0111. -0 - CVI63E Plate of Horizontal Sync Separator (Pin 2 of V11221) (6SN7) Figure 39- Vertical (45 Volts PP) .1-4401 Figure 40-Horizontal (45 Volts PP) Grid of Vertical Sync Sep. (Pin 7 of VIO9B) (12AU7) Figure 41-Vertical (55 Volts PP) .0-444E Figure 42-Horizontal (55 Volts PP) Plate of Vertical Sync Sep. (Pin 6 of VIO9B) (12AU7) Figure 43-Vertical (65 Volts PP) Figure 44-Horizontal (65 Volts PP) 19 128 17T200, 17T201, 17T202, 17T211, 17T220 WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Grid of Sync Output (Pin 4 VII2B) (6SN7) Figure 45-Vertical (40 Volts PP) Figure 46-Horizontal (40 Volts PP) 11111111111111111111 .11111111M CV 1G4C Plate of of Sync Output (Pin 5 of V112) (6SN7) Figure 47-Vertical (47 Volts. PP) Figure 48-Horizontal (47 Volts PP) 414,10-> CV 1,1 h Figure 49-Grid of Vertical Sweep Osc. (Pin 5 of V113) (6J5) (30 Volts PP) <-444 Figure 50-Plate of Vertical Sweep Osc. (Pin 3 of V113) (100 Volts PP) )1811811.-0. CV1640 Figure 51-Grid of Vertical Sweep Output (Pin 5 of V114) (6K6) (100 Volts PP) ESE Figure 52-Plate of Vertical Sweep Output (Pin 3 of V114) (6K6) (715 Volts PP) CV 164 I Cathode of Kinescope (Pin 11 of V119) (17QP4) Voltage depends on picture Figure 53-Vertical Figure 54-Horizontal 3181811"-I. 20 CV164H WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Figure 55-Grid of Horizontal Oscillator Control (Pin 1 of V115) (6SN7GT) (19 Volts PP) Figure 56-Cathode of Horizontal Oscillator Control (Pin 3 of V115) (6SN7GT) (1.2 Volts PP) 129 17T200, 17T201, 17T202, 17T211, 17T220 cv16.53 Figure5577-G-Grirdidof Horizontal Oscillator (Pin 4 of V115) (6SN7GT) (330 Volts PP) Figure 58-Plate of Horizontal Oscillator (Pin 5 of V115) (6SN7GT) (140 Volts PP) 411.1140 -0 - Figure 59-Terminal "C' of TI10 (150 Volts PP) 4 -444 - Figure 60-Grid of Horizontal Output Tube (Pin 5 of V116) (6BQ6) (90 Volts PP) Figure 61-Plate of Horizontal Output (Approx. 4000 Volts PP) (Measured Through a Capacity Voltage Divider Connected from Top Cap of V116 to Ground) 4-444 Figure 62-Cathode of Damper (Pin 3 of VI18) (6)r4GT) (2350 Volts PP) 31.1114.-0. CVI65 i Figure 63-Plate of Damper (Pin 5 of V118) (6W4GT) (160 Volts PP) Figure 64-Plate of AGC Amplifier (Pin 5 of VIII) (6A116) (560 Volts PP) 21 130 17T200, 17T201, 17T202, 17T211, 17T220 VOLTAGE CHART The following measurements represent two sets of conditions. In the first condition, a 15000 microvolt test pattern signal was fed into the receiver, the picture synced and the AGC control properly adjusted. The second condition was obtained by removing the antenna leads and short circuiting the receiver antenna terminals. Voltages shown are read with a type WV97A senior "VoltOhmyst" between the indicated terminal and chassis ground and with the receiver operating on 117 volts, 60 cycles, a -c. The symbol < means less than. Tube Tube No. Type Function Operating Condition E. Plate No. Volts E. Screen Pin No. Volts VI 6J6 Mixer 15000 Mu. V. Signal 2 - 153 - No Signal - - 2 135 VI R -F 15000 Mu. V. 6J6 Oscillator Signal 1 - - 100 No Signal - - 1 85 R -F 15000 Mu. V. V2 6CB6 Amplifier Signal 5 260 6 150 No Signal 5 220 6 100 1st Sound 15000 Mu. V. V101 6AU6 I -F Amp. Signal 5 130 6 142 No Signal 5 116 6 129 2d Sound 15000 Mu. V. V102 6AU6 I -F Amp. Signal 5 131 6 148 No Signal 5 110 6 120 Ratio V103 6AL5 Detector 15000 Mu. V. Signal 7 0-- No Signal - - 7 0.7 1st Audio 15000 Mu. V. V104 6AV6 Amplifier Signal 7 87 - - No Signal - - 7 76 Audio V105 6K6GT Output 15000 Mu. V. Signal 3 260 4 263 No Signal 3 250 4 251 1st Pix. I -F 15000 Mu. V. V106 6CB6 Amplifier Signal 5 246 6 258 No Signal 5 108 6 108 2nd Pix. I -F 15000 Mu. V. V107 6CB6 Amplifier Signal 5 242 6 255 No Signal 5 108 6 .108 3rd Pix. I -F 15000 Mu. V. V108 6CB6 Amplifier Signal 5 133 6 172 Picture V109A 12AU7 2d Det. No Signal 5 115 6 162 - 15000 Mu. V. Signal 1 -8.4 - No Signal - - 1 -1.8 Vert. Sync 15000 Mu. V. V109B 12AU7 Separator Signal 6 71 - - No Signal - *50 6 to 100 - E. Cathode E. Grid Pin Pin No. Volts No. Volts *_3 7 0 5 to -5 *_3 7 0 5 to -5 *_3 7 0 6 to -5 *_3 7 0 6 to -5 2 .1 1 -5.8 2 1.0 1 -0.1 Notes on Measurements *Depending on channel *Depending on channel *Depending on channel *Depending on channel 7 0.8 1 0 7. 0.6 1 0 7 0 1 -5.1 *Unreliable measuring point. 7 0 1 *-0.3 Voltage depends on noise. - - 1 12 7.5 kc deviation at 1000 cycles 1 - *5.1 - *Unreliable measuring point. Voltage depends on noise. 2 0 1 -0.7 At min. volume 2 0 1 -0.6 At min. volume 8 19 5 -0.7 At min. volume 8 18.5 5 -0.7 At min. volume 2 <0.1 1 -8.6 *Unreliable measuring point. 2 0.7 1 *--0.2 Make measurement at T104 -B 2 <0.1 1 -8.6 2 0.5 1 -0.2 2 2.1 1 0 2 1.9 1 0 3 0 2 -1.3 3 0 2 -0.6 8 0 7 -40 8 0 7 *-15 *Unreliable, depends on noise 22 VOLTAGE CHART 1 3 1 17T200, 17T201, 17T202, 17T211, 17T220 Tube Tube No. Type Function Operating Condition E. Plate Pin No. Volts E. Screen Pin No. Volts E. Cathode Pin No. Volts E. Grid Pin No. Volts Notes on Measurements Video 15000 Mu. V. V110 6CL6 Amplifier Signal 6 130 8 *(6AC7) *(6AG7) No Signal 6 110 8 Viii AGC 6AU6 Amplifier 15000 Mu. V. Signal 5 -40 6 No Signal 5 +2.3 6 Hor. Sync 15000 Mu. V. V112A 6SN7GT Separator Signal 2 263 - No Signal - 2 258 Sync V112B 6SN7GT Output 15000 Mu. V. Signal 5 - 58 No Signal - 5 48 V113 615 Vertical 15000 Mu. V. Oscillator Signal 3 - 70 No Signal - 3 68 Vertical 15000 Mu. V. V114 6K6GT Output Signal 3 265 4 No Signal 3 253 4 Horizontal 15000 Mu. V. V115 6SN7GT Osc. Control Signal 2 - 165 No Signal 2 Horizontal 15000 Mu. V. V115 6SN7GT Oscillator Signal 5 - 160 - 185 No Signal - 5 170 Horizontal 15000 Mu: V. V116 6BQ6GT Output Signal Cap 4 No Signal Cap 4 1B3GT H. V. 15000 Mu. V. V117 8016 Rectifier Signal Cap - No Signal Cap - V118 6W4GT Damper 15000 Mu. V. Signal 5 - 270 No Signal - 5 260 15000 Mu. V. V119 21AP4 Kinescope Signal Cap 14,000 10 No Signal Cap 13,600 10 V120 V121 5U4G 5Y3GT Rectifiers - 15000 Mu. V. Signal 4 & 6 - - No Signal 4 & 6 - 149 1 0.2 4 130 1 0.5 4 250 7 153 1 258 7 135 1 - 3 190 1 - 3 138 1 - 6 0 4 - 6 0 4 -8 0 5 -8 0 5 270 8 30 5 260 8 28 5 - 3 +1.5 1 - 3 -10 1 - 6 0 4 - 6 0 4 180 8 21.2 5 170 8 21.0 5 - - 2 & 7 14,000 - - 2 & 7 13,600 -3 - -3 - 400 11 170 2 385 11 150 2 - - 2 & 8 285 - - 2 & 8 275 -1.3 -0.6 AGC control set for normal operation *Refer to Fig. 67 for socket connections 151 105 130 110 -2.1 +0.6 *Depends on noise -15 *Depends on setting of Vert. hold control -14 Voltages shown are synced pix adjustment -5 -5 -21 -24 -80 -88 -13 *High Voltage Pulse Present -13 *High Voltage Pulse Present - *High Voltage Pulse Present - *High Voltage Pulse Present - *High Voltage Pulse Present - *High Voltage Pulse Present 120 At average Brightness 115 At average Brightness - - 23 1 3 2 17T200, 17T201, 17T202, 17T211, 17T220 R -F UNIT WIRING DIAGRAM .TO 1.205 C205 ANTENNA MASC° UNIT TO TV CHASSIS lb T104 to Ct f t t 5.3V. 1 I 4 RIS4 4 2 1 1 4° INA I 0 41 13 4 an ..s 050 -** .1 L J _J CoNNECnoNs AS SAPTAO. COORS TOOK optecrow OP ARROWS ORM E 0 150.N ; .4 4., 'Rona IS, .4 129 M1 r - .9 REAR 1. 1X1 ' 0 Js I/ C 24 C RI L SO (10 ruPm s ) @TP2 TEST CONN L40 C16 (TOP) T P 1 T ST CONN. L47 C (TOP) V 144 C 14 0 Figure 65-R -F Unit Wiring Diagram 0-40053-0 CRITICAL LEAD DRESS : 1. Keep all wiring in the pix i-f, sound i-f and video circuits as short as possible. 2. Keep the leads on C118, C120, C122, C124, C126, R114, R121 and R123 as short and direct as possible. 3. Do not run any leads under C115 trimmer capacitor. 4. Dress C118 vertically parallel to terminals A and B of T104. Dress C135 parallel to terminals A and B of T104 close to the chassis. 5. Keep C127 away from chassis with no more than 1/4 inch leads at each end. 6. Dress the lead from T105(C) to the terminal board, close to the chassis. 7. Keep all filament leads dressed close to the chassis. 8. Ground filaments of V106, V107 and V108 independently of tube shields (pin 8). Use ground lances provided near pins of each socket. 9. Dress lead from pin 5 of V110 to J102-2 close to the chassis. 10. Keep leads to L103 as short as possible. 11. Dress C130, C132, L102, L104, L105, L114, 8131,11133,11135 and 1j139 away from the chassis. 12. Do not tape kinescope cathode lead in with other kinescope leads. 13. Do not change the bus wire connections to pin 2 of V101 and V102. Sleeving is used to insure length and to prevent shorting. 14. Keep leads on C136 short and direct. Dress the lead from C136 to pin 5 of V111 as shown in wiring diagram. 15. Do not dress 0170 in such a position that adjustment of T110 is inaccessible. 16. Keep the leads on R201 as short and direct as possible. 17. Dress the lead from pin 3 of V113 to C153 as shown in the wiring diagram. 18. Mount C183 directly on the terminal board provided keeping it as far away from T109 as possible. 19. Dress all leads in the high voltage compartment away from each other and away from the high voltage transformer. 24 139 REPLACEMENT PARTS (Continued) 17T200, 17T201, 17T202, 17T211, 17T220 STOCK No. DESCRIPTION 76633 76464 76796 76639 76988 76469 76989 503033 502039 502047 503047 504047 503082 502118 503139 503147 513156 504210 503222 523222 504233 523223 502239 503239 503256 523268 503282 513282 502310 504310 502312 503312 523312 50331S 503318 523318 503322 513322 503327 513327 513333 503339 513339 503347 504347 512347 513347 S03356 512356 503368 513368 513382 504410 513410 30180 503415 504415 512415 502418 502427 Magnet -Pin cushion correction magnet complete with support arm Plate -Hi -voltage plate (bakelite) assembly complete with tube socket* and corona ring Resistor -Wire wound, 5.1 ohms, 1/3 watt (R205) Resistor -Wire wound, 180 ohms, 2 watts (R202) Resistor -Wire wound, 820 ohms, 1 watt (R113) Reerstor-Wire wound, 2500 ohms, 10 watts (R115) Resistor -Wire wound, 4650 ohms, 7 watts (R116) Resistor -Fixed, composition:33 ohms, ± 10%, 1/2 watt (R130) 39 ohms. ± 5%. 1/2 watt (R122) 47 ohins, ±5%, 1/2 watt (R119) 47 ohms. ± 10%. 1/2 watt (RIOS) 47 ohms, ± 20%, 1/2 watt (R201) 82 ohms, ± 10%, 1/2 watt (R101) 180 ohms. ± 5%. 1/2 watt (R125) 390 ohms, ± 10%. 1/2 Watt (14182) 470 ohms. ± 10%, 1/2 watt (R114) 560 ohms, ± 10%. 1 watt (R207) 1000 ohms, ± 20%, 1/2 watt (R102, R118. R120. R124, R127) 2200 ohms. ± 10%, 1/2 watt (R104, R212) 2200 ohms, ± 10%, 2 watts (14131) 3300 ohms, ±20%, 1/2 watt (R211) 3300 ohms, ± 10%, 2 watts (R131) 3900 ohms, ± 5%, 1/2 watt (R129. R164) 3900 ohms, ± 10%, 1/2 watt (R194) 5600 ohms, ± 10%, 1/2 watt (R138) 6800 ohms, ± 10%, 2 watts (R203) 8200 ohms, ± 10%, IA watt (R176, R179) 8200 ohms, ± 10%, 1 watt (R165) 10,000 ohms. ± 5%, 1/2 watt (RI07, R108, R123) 10.000 ohms, ±20%, 1/2 watt (R152) 12,000 ohms, ± 5%, 1/2 watt (R121) 12,000 ohms, t 10%, 1,4 watt (14145) 12,000 ohms, ± 10%. 2 watts (R135) 15,000 ohms, ± 10%, l/2 watt (R153) 18,000 ohms, ± 10%. 1/2 watt (R128, RI58, R166, R196) 18,000 ohms, ± 10%, 2 watts (R133) 22,000 ohms, ± 10%, i/2 watt (R167, R217) 22,000 ohms. ± 10%, 1 watt (R193) 27,000 ohms, ± 10%, 1/2 watt (R215) 27,000 ohms, ± 10%, 1 watt (R218) 33,000 ohms. ± 10%, 1 watt (R214) 39,000 ohms, ± 10%, 1/2 watt (R106, RI42) 39,000 ohms, ± 10%. I watt (R132) 47,000 ohms. ± 10%, 1/2 watt (R160) 47,000 ohms, ± 20%, 'A watt (R144) 47,000 ohms, ±5%. 1 watt (R148) 47,000 ohms, + 10%, 1 watt (R132) 56,000 ohms, ± 10%, 1/2 watt (R146, R185, R204) 56,000 ohms, ±5%, 1 watt (R178) 68,000 ohms, ± 10%, 1/2 watt (R219) 68,000 ohms, ± 10%, 1 watt (R192) 82,000 ohms, ± 10%, 1 watt (R191) 100,000 ohms, ±20%, 1/2 watt (R213) 100,000 ohms, ± 10%, 1 watt (R175) 120,000 ohms, ± 5%, 1/2 watt (R143) 150,000 ohms, ± 10%, l/z watt (R174, R183, R187) 150,000 ohms, 1-20%. 1/2 watt (R139) 150,000 ohms, ±5%, 1 watt (R195) 180,000 ohms, ± 5%, 1/2 watt (R141) 270,000 ohms, ± 5%, 1/2 watt (R177) STOCK No. DESCRIPTION 503427 503433 512433 503439 503447 504447 503456 503468 503482 503510 502511 503512 503515 11769 39063 503522 504610 71456 76455 73584 76972 75718 74834 31251 71508 50367 73117 76453 50367 72627 76971 77470 76636 77011 76463 76977 76795 76440 76982 76984 77112 76981 76978 76979 76980 75449 75242 76983 76616 270.000 ohms. ± 10%. 1/2 watt (R157) 330.000 ohms. ± 10%, 1/2 watt (R111, R188) 330,000 ohms, ±5%, 1 watt (R190) 390,000 ohms, ± 10%, 1/2 watt (R168) 470,000 ohms, ± 10%, 1/2 watt (R150, R200) 470.000 ohms, ±20%, 1/2 watt (R112, 14147) 560,000 ohms, ± 10%, 1/2 watt (R148, R171) 680,000 ohms, ± 10%, 1/2 watt (R154, R161) 820,000 ohms. ± 10%. 1/2 watt (R189, R199) 1 megohm, ± 10%, 1/2 watt (R155) 1.1 megohm, ±5%, 1/2 watt (RI36) 1.2 megohm, ± 10%, 1/2 watt (R180) 1.5 megohm, ± 10%. 1/2 watt (R172) 1.8 megohm, + 5%, 1/2 watt (R140) 1.8 megohm. + 5%. 1 watt (R197) 2.2 megohm, ± 10%, 1/2 watt (R126, R159) 10 megohm, ±20%, 1/2 watt (R110) Screw -#8-32 x 7/16" wing screw to mount deflection yoke Shaft -Connecting shaft (nylon) for picture and bright- ness controls Shield -Tube shield for V101, V102, V103, V108 Shield -Tube shield for V109 Socket -Channel indicator lamp socket and leads Socket -Kinescope socket Socket -Tube socket, octal, wafer for V105, V110, V112, V113, V116, V120, V121 for KCS72 (KCS72 uses 6AC7 for V110) Socket -Tube socket. 6 pin, moulded -for V117 Socket -Tube socket, 6 pin. moulded, saddle mounted for V118 Socket -Tube socket. 7 pin, wafer miniature for V101, V102, V103, V104, V106, V107, V108, V111 Socket -Tube socket, octal, moulded, saddle -mounted for V110 for KCS72-M1 (KCS72-M1 uses 6AG7 for V110) Socket-Tube socket, 8 pin, moulded saddle -mounted for V114 Socket -Tube socket. 8 pin, steatite saddle mounted for V115 Socket -Tube socket, 9 pin, wafer miniature for V109 Socket -Tube socket, 9 pin, miniature, wafer for V110 for KCS72-M2 (KCS72-M2 uses 6CL6 for V110) Stud -Adjusting stud complete with guard for focus magnet Switch -Tone control and phono switch less volume control and power switch (S101) Terminal -Screw type grounding terminal Transformer -Antenna matching transformer complete (T200, C200. C201, C202, C203, 1.200, 1.201, 1.202, 1.203. J200) Transformer -Hi -voltage transformer (T111) Transformer -Horizontal oscillator transformer complate with adjustable cores (T110) Transformer -Output transformer (T103) Transformer -Power transformer. 117 volts 60 cycle (T109) Transformer -Ratio detector transformer (T102. C105) Transformer -Sound i-f transformer complete with adjustable core (T101, C102, C103, R103) Transformer -Vertical output transformer (T108) Transformer -First pix, i-f transformer complete with adjustable cores (T104, C116, R117) Transfeorrmcoemr p-Sleetceowndit,hthadirjdusotarbfloeucrtohrepi(xT10i-5f.tr7a1n0s6-, T107) Trap -FM trap complete with adjustable core and stud (L203, C203) Trap -I -F trap (1.200, 1.201, C200, C201) Trap -4.5 MC trap (L103, C128) Yoke -Deflection yoke complete with 6 contact male connector (1.109, 1.110, L111, L112, C181, P103, R208, R209, R210) SPEAKER ASSEMBLIES 971636-1W RL-10105 RMA-274 (For Models 177200, 17T201 & 177202) 77000 Speaker -5" P.M. speaker complete with cone and voice coil (3.2 ohms) 31 140 17T200, 17T201, 17T202, 17T211, 17T220 REPLACEMENT PARTS (Continued) STOCK No. DESCRIPTION SPEAKER ASSEMBLIES 971490 -3W RL-105E6 RMA-274 (For Models 177211 & 177220) 75024 Cone -Cone and voice coil (3.2 ohms) 75022 Speaker -8" P.M. speaker complete with cons and voice coil (3.2 ohms) 77189 77190 76184 76811 77001 76812 76814 76829 71892 76823 X3128 X3199 X1756 75474 39153 71457 76818 77014 71984 77012 75456 74889 76806 74308 76595 76593 76591 74963 76597 76596 76594 76592 75464 NOTE: If stamping on speaker in instruments does not agree with above speaker number, order replacement parts by referring to model number of instrument, numbreeqrusitraedm. ped on speaker and full description of part MISCELLANEOUS Back -Cabinet back complete for Models 177200, 177201, 17T202 Back -Cabinet back complete for Models 17T211. 17T220 Board -"Antenna" terminal board. Bracket -Hanger bracket for deflection yoke hood for Models 17T200, 17T201, 17T202 Bracket -Hanger bracket for deflection yoke hood for Model 17T211 Bracket -Hanger bracket for deflection yoke hood for Model 17T220 Bracket -Stiffening bracket for kinescope cradle (4 req'd) for Models 17T200, 17T201, 17T202 Bracket -Stiffening bracket for kinescope cradle for Models 17T211, 17T220 Catch -Bullet catch and strike for Model 17T220 Clip -Spring clip for spacing ground braid Cloth -Grille cloth for Models 17T201, 17T202 Cloth -Grille cloth for mahogany cabinet for Model 17T211 Cloth -Grille cloth for mahogany and walnut instruments for Model 17T220 Connector -Single contact male connector for antenna cable (2 req'd) Connector -4 contact male connector for antenna cable Cord -Power cord and plug Cuksihnieosnco-pReuabnbdercradculeshsiuopnpor(t1/(146"rexq1'd" )x Vs" x 1/4") for Decal -Control panel function decal for mahogany or walnut instruments for Models 177201, 17T202, 17T211 & 17T220 Decal -Trade mark decal for Model 17T220 Emblem -"RCA Victor" emblem for Models 17T202. 17T211, 17T220 Escutcheon -Channel marker escutcheon -gold Foot -Felt foot (4 req'd) for Models 17T200, 17T201 & 17T202 Glass -Safety glass Hinge -Cabinet door hinge (1 set) for Model 17T220 K-nmobar-oBoring-h(tonuestesrc)ontrol or vertical hold control knob Knob -Channel selector knob -maroon -(inner) Knob -Fine tuning control knob -maroon -(outer) Knob -Picture control, horizontal hold control or vol- urn, control and power switch knob -maroon -(inner) Knob - Tons control and phono switch knob -maroon- (outer) Kn-bobei-gBer-i(gohutnteers)s control or vertical hold control knob Knob -Channel selector knob -beige -(inner) Knob -Fine tuning control knob -beige -(outer) Knuombe-cPoicntturorel acnodntproolw, ehrosriwzoitnchtalknhoobld-cboeingtero-l-(oirnnveorl)- STOCK No. 76598 77264 77261 77262 77265 77263 11765 75459 76589 77267 76177 76822 77013 73634 76825 76819 77005 77260 77187 77188 77002 76816 76809 76810 76632 74113 76821 76808 73643 76820 77006 30330 72845 76837 74936 36580 72936 76813 76600 77003 76836 75457 75458 77266 75500 DESCRIPTION - Knob -Tone control and phono switch knob -maroon (outer) Kn-eobbo-Bnyri-g(hotunteesrs)control or vertical hold control knob Knob -Channel selector knob -ebony -(inner) Knob -Fine tuning control knob -ebony -(outer) Knob -Picture control, horizontal hold control or volume control and power switch knob -ebony -(inner) Knob -Tone control and phono switch knob -ebony (outer) Lamp-Channdl marker escutcheon lamp -Mazda #51 Mask -Channel marker escutcheon light mask -bur - Bundy Mask -Channel marker escutcheon light mask -beige Mask -Channel marker escutcheon light mask -ebony Nut -#10-32 special nut for deflection yoke hood sup port rods (2 req'd) Nut -Speed nut to lock flexible straps for kinescope Nut -Speed nut for fastening "RCA Victor" emblem on metal panel for Models 177202, 177211 & 177220 'Nut -Speed nut for speaker mounting screws for Model 17T211 Patod c-RusuhbiobnerKpiandes(ccohpaennel) mounted on cradle support Pad -Rubber pad (channel) for flexible straps (2 req'd) Panel -Metal front panel for mahogany struments for Models 17T211 & 17T220 or walnut in - Panel -Metal front panel for blonde instruments forModel 17T211 Pull -Door pull for television compartment doors for Model 17T220 Pull -Door pull for false door (2 req'd) for Model 17T220 Remtaaihnoegr a-nSyafgertaying,lmasashroegtaainnyeror(2wraelnqu'dt)infostrrummaeronotsn, Reintastirnuemr e-Sntasfety glass retainer (2 req'd) for blonde Rod -"L" shape threaded rod to support deflection yoke hood assembly (2 req'd) for Models 17T200, 17T201 & 17T202 Rod -"L" shape threaded rod to support deflection yokel hood assembly (2 req'd) for Models 17T211 & 17T220 Screw -#8 x 5/8" hex head screw for mounting front panel or hanger bracket for Models 17T211 & 17T220 Screw -#8-32 x 1" trimit head screw for door pull for Model 17T220 Scfroerwk-i#n1es0coxp1e%" hex head screw to lock flexible straps Sleleeavde --oPnolsyuepthpyolretnreodsleeve for insulating high voltage Spring -Channel marker escutcheon spring clip Spring -Formed spring for safety glass retainers Spproinrtgr-oRdestaining spring for deflection yoke hood sup - Spring -Retaining spring for knobs 74963. 75464, 77285 Spring -Retaining spring for knobs 76591. 76592, 77262 Spring -Retaining spring for knobs 76593, 76594, 76595, 76596, 76597, 76598, 77261, 77264, 77263 Spring -Suspension spring for kinescope socket leads Sprin g -Suspension spring (coil) for ground braid Stop -Cabinet door stop for Model 17T220 Strap -Flexible steel strap to secure kinescope Strap -Ground strap (.005" x l/2" soft copper strip) for Models 17T211 & 17T220 Support -Cradle support for kinescope Washer -Cellulose washer -gold -for knobs Wcahsahnenre-lFmelatrwkearsheescru-tdcahrekobnrown -between knob and Wnasehl emra-rFkeelrt ewsacushtcehre-obneige -between knob and chart - Wnaeslhmera-rFkeelrt ewscaushtcehre-oenbony -between knob and chan- Washer -Felt washer for cabinet back mounting screws APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 32 TO SPEAKER LD f Azis) HT-BLU RIDS VOLUME ON -OFF V104 C106 WHT GRN. CHANNEL LAMP BRIGHTNESS RI92 TO R173-2 WHT GRN BLK. WHT. WHT. BLU. BLU. LIES WHT BLU RED GRN WHT. RED V1ZO 25 CHASSIS WIRING DIAGRAM R -F SECT ION ANT. MATCHING UNIT 133-0-134 17T200, 17T201, 17T202, 17T211, 17T220 TO VI13-4 AND R172 V101fl RII5 RIOT HOLE BAN -BRN- IN RECEIVERS USING A 6CLG FOR VII0 THE WIRING ISAS SHOWN ABOVE. WHT BRN RED 0HOLE GRN BLK BRN YEL D-2 0 05 r/Th 06 gp0.7 KINESCOPE PLUG (REAR VIEW) HOLE WHT BRN GRN HOLE TO PLATE CAP OF VII6 EE47938-1 --tR200 HOLE \ 4 I, 03 ` TIII o 1 // a 0 0 TO PLATE CAP OF VII7 WHT BL YEL. URN A 8207 HOLE HOLE WW2 RED YEL BLU WHT-RED Figure 66-Chassis Wiring Diagram BLU,-- V118 YEL7BLU.-. N 0 BLU 26 TO VII0 CIRCUIT SCHEMATIC DIAGRAM KCS72M2 135 - 136 17T200, 17T201, 17T202, 17T211, 17T220 ANT. TB !1,404 -CE. TO ANT 72 A COAX. P300A-M REAR VIEW P30013- +4 REAR VIEW ANT.MATCHIN-11 R -F UNIT- KR K 8D UNIT F.MrRAo 1200 L203 L201 C20 6 Cvli 6 270 R -F AmHL 3 vio, 6A U6 1101 SOUND I -F V102 6AU6 T102 RATIO OCT 'sr SOUND TRANS. 2ND. SOUND TRANS 1-F ANTI. 4,5 MC I -F AMPL, r0 B-1 , . It---): II6V +110 V. F Sr. ft rg3V0031I .,,1201(1 0en 1, \+120V j +179Vi_ C Al T 4.5 MC B V 103 6A L5 RATIO DETECTOR 0.7 V -5V CIOIA C101 I.01 .01 ER 102 1000 I01 / 5104 2200 R 105 47 .0C047 12109 1 MEG. R110 VOL . 4 10 CONTR MEG R2i5T 27K V104 6AVG IST. AUDIO ArAPL V105 6KG-GT AUDIO OUTPUT 3 +260V I C 112 .0027 y 2701 5113 /R3i3t0i K 020 T103 AUDIO OUTPUT TRAMS. r---rc L103 P. en SPEAKER v110 6AC7 L104 3200-F FRONT VIEW s, 0 FRONT 1.35 L35 L34 I-33 04 Os 05 C 22 7-30 L52 +135V R213 ioOK C01.313I11C1141790103 R -F A.G C 5101 FUNCTION SWITCH VIEWED FROM FRONT AND SHOWN IN POSITION NO.1 (MAX, COUNTER CLOCKWISE) PCB - TV ANN HIGHS 2 - Tv. NORMAL 3- pHOA3 NORMAL FRONT 5101 REAR J101 PRIMO INPUT +260v. C 1g4 4R71K32 * v110 - VIDE0 AmRL. CONN. WHEN 6AC7 SOW uNIT.3. USED ON 132 C21720 ^ SIC FRONT 13. 41 '2° o SIC -REAR 8 1.26 L29 1_25 1_30 L31 L49 L24 L23 1.22 05 cs 7 I C6 I 1500 _L.-) 6J 6 osc « MIXER 1 CI C4 +85V. - 2 +135V. 0.8-3.87^ T 3 SIB (CIS 11500 COAXc TI CONY TRAN. WIO2 T 104 1ST. PIK. i-F TRANS O 470 5.70 L_ 5 C 118 4700 V106 6CB6 1ST PIX F AMPL 41015V. AT NO 1611AL 6 7.1 -0.2y 2117 TIOS 200 Pt% -F TRANS 22.75 MC. D IVA' / v107 6C B 6 1-106 l-3;2rD.R.5Pt.45 I2- "F 0.4 PeRIX. 258.55 DC tTszos, t R, 6cvi0163 6 1-F AMPL 115 V on 4TH Fix I -F TRANS. 24.25 MC. BD 5128 18K Ac TI IC120".1C122 14700 14700 5 R120 1000 C189 R122 47001 39 5124 > 14700 iggdgsz,f 11125 T_ 18° .1C 1266 14700 8214 7 33K SIB FRONT L14 2 REAR LI C3-> 1.20 15 A L50 (ON WI) C18 11500 19 11500 6 0115 R140 2500 1.8 MEG RII6 4650 1000 iVigt 14C710806 012581 026 4700 I 14700 L13 T0P2-0 C 25 FINE TUNING 0.68=7 L21 1.45 L47 1.43 T1447;I0I90A 5211 3300 C518M5 BF I C 1351 y"4144. R118401 K 14700 +260 v , 4 0 . 3 31 5143 120 K R142 39 K 1.F AGC 0155 MEG.1 . FRONTI I L$II 3 LIO 1.9 t 1.811 *L6 LI CHANNEL SELECTOR SWITCH (SI) VIEWED 112 FROM FRONT, AND SHOWN IN CHANNEL 2 #13 (Es-GOLIC PCEITIOR 523 0.68 MIAF C7 C35911S10R0I K 0.8-1.4 4 c4 -0.8-3.87- PRODUCTION CHANGES IN KCS72 The schematic is shown in the latest condition. The notes below tell how early receivers differed from the schematic shown above. In some receivers, C27 was omitted. +135 V. R146 56K = .00103373 C136220 +toss.; VIII 6A U 6 AGC AMPL. 2.3V 541744K I .C01134 82I9 255V 680 v 112A v109 B 65N7-GT RIA° 12AU7 NOR SYNC SEPARATOR 4258v C140 VERT. SYNC 11--- 270 SEPARATOR R152 10 K 2 4110V P157 C144. 270K 0.1 4R710470 <j.10C011358 34 21 I 1C011M35FA 0 145 12K R148 560K 2 5149 500 K AGC CONTR. +200V. 3 R150 470K 4 68 K 3 C143 8 330 Y 8153 R159 15K MEG ITC.0I03395 K 260 V R161 6800 +260 V. R164 vit2B c 3900 65N7-GT SYNC. "v 8R200 OUTPUT l'41° R217 22 K C 146 220 4 +0.6 V +1094 12AU7 2110 PIE DE T. R126t I C187 L101 36 NUN 0125-NiNT -C12 7 L103 4.5 MC TRAP A 5, * V110 6C L6 VIDEO AMPL R129 3900 C417213 T 1 1510002MUM InA 5 ORN-WilT Ci 29 .015 L 10et 93 000 RED 0 V C11341 10 ME C130 --2I70 C;1 1105 1000 6111-51, GRN R137 15 K PICTURE CONTR e 12138 5600 4260V +260 V. rz R183 ISO K R154 200K 1SAGHTN3 2 > C01.518 I R1G7 22 K C147 C148 00111--AA4.R168 Ri6E 390 K.1. 18 K RI70A 1.2 MEG VERT NOLO C0+4TR +260v. 6J5 v 113 vER0T5.CS.wEEPISRO17K4 8175 C155 100K .00 5 C.012527 1 11 6 8 V Cia9 C151 390 10047 5178 56K 0.1 1 11 7 RI72 RI76 1.5 MEG 8200 RIBO ±C156 1.2 .0613 mEG YR 1133 c,52 R177 .033 2708 2.5 MEG HEIG.IT CONTR 11 C154 10022 820 0 V114 6 K6 -6T VERT. SWEEP OUTPuT ;'4.253V. VEIZTVw#EP r -7 OUTPUT TR. ISLu I le 1 428V. 1_ _J R lel w 1000 +X vERT LINE CoNTR R182 390 +260V. 17(2P4 KINESCOPE GLASS COATING CHANNEL IND. LAMP BRN 9--4. 21 TO voi -4 T 109 In some receivers, C130 was 120 mmf. In some receivers, C189 was omitted. In some receivers, R12 was 8200 ohms. In some receivers, R126 was 220,000 ohms and was connected between the junction of V109A pin 1 and C187, and the i-f AGC buss. In some receivers, R131 was 3300 ohms. In some receivers, R132 was 47,000 ohms. In some receivers, R133 was 27,000 ohms. In some receivers, R135 was 12,000 ohms. In some receivers, R182 was 470 ohms. In some receivers, 11183 was 100,000 ohms. In some receivers, 11185 was 56,000 ohms. In some receivers, R185 was 100,000 ohms. In some receivers, R185 was omitted. 5193 22K R i7013 75 K NCORO. NNOTLRO.516882K C1421 V11582 GT NOR SWEEP OSC AND CONTR. +160 V. +170V. TIIO NOR. SWEE P OSC. TRANS *852'9099 +260V -1C.0IG4G7 lE.31 .001 C 161A 10-160 NOR LOCKING RANGE C61864.-1.3031081K3 11 DI g:143 .022 53900 W 0-1C1169 330 If,--1--1---I C 170 .01 0.195 1500. C68O0I P42701 I M. ' :72004 j 10C-16IG15O 1.- DRIVE I( C172 .0012 1!,179,° 4- 260 F101 0.2 .44.41. SLO-BLOW C150 C183 RI71 560K V116 613G6 -6T NOR. SWEEP OUTPUT R204 56K 7111 H -V TRAN, Rs2;35 v,17 183-GT 1-1- RECT 13,600 v .1 0C1.7247 I II i:4' L106 C 177 .022 Vw ii 4. WIDTH C175 R207 .c.cHATR 4-4I Ict 76 R202 .027 4 vile, 1 (---w/Vheb 6W4-GT 3 180 C178 L107 DAMPER 270 1.3 14 u. N 7 +260v L108 H0R. LINE. CONTR. DEFL YOKE 31c031 VERT COILS 1 91 L110 L109 %2010° v121 v 20 SY3-GT SU4G RECT SECT P103 M J011. PIN VIEW REAR VIEW sv +275V. 5 A. EE- 47917- 3 BLU- TEL 5102 SIN.RED ILK V.60. SUPPLT In some receivers, 13218 was omitted. In some receivers, R219 was omitted. In some receivers, V119-10 was connected to the junction of R171 and C183. All resistance values in ohms. K =1000. Direction of arrows at controls indicates All voltages measured with "VoltOhmyst" * In KCS72 V110 was a 6AC7. All capacitance values less than 1 in MF clockwise rotation. and above 1 in MMF unless otherwise noted. and with no signal input. Voltages should In KCS72M1 V110 was a 6AG7 (same hold within +20';'e with 117 v. a -c supply. pin connections as 6AC7). Figure 67 -Circuit Schematic Diagram 27 28 137 17T200, 17T201, 17T202, 17T211, 17T220 REPLACEMENT PARTS STOCK No. DESCRIPTION 75188 76845 R -F UNIT ASSEMBLIES KRK8D Board -Terminal board, 5 contact and ground Bracket -Vertical bracket for holding oscillator tube shield 75201 Cable -76 ohm coax cable (71/4') complete with coil (W1, L50) 76965 Capacitor -Ceramic, variable for fine tuning -plunger type (C2S) 71088 Capacitor -Headed Lead, 0.68 mmf. (C27) 76968 Capacitor -Ceramic. 3 mmf. (C4) 75200 Capacitor -Ceramic, 12 mmf. (C24) 45465 Capacitor -Ceramic, 15 mmf. (C3) 75196 Capacitor -Ceramic. 39 mmf. (CS) 75199 Capacitor -Ceramic, 270 mmf. (C12. C13, C20) 75641 Capacitor -Ceramic. 390 mmf. (C10) 75166 Capacitor -Ceramic, 1500 mmf. (C6, C14, C15, C19) 73748 Capacitor -Ceramic. 1500 mmf. (C18, C26) 75089 Capacitor -Ceramic, dual 1500 mmf. (C17A, Cl7B) 73473 Capacitor -Ceramic, 5000 mmf. (C21) 75172 Capacitor -Tubular, steatite, a djustable, 0.65 - 1.2 mmf. (C7) 71504 Capacitor -Ceramic, 0.68 mmf. (C23) Capacitor -Ceramic. adjustable, 0.75 - 4 mmf.. complete with adjusting stud (Cl) 75197 Capacitor -Ceramic. 6.8 mmf. (C8) 75189 Capacitor -Adjustable, 7-30 mmf. (C22) 75174 Capacitor -Ceramic, trimmer. 50-75 mmf. (C11) 76143 Clip .-Tubular clip for mounting stand-off capacitors 73477 Coil -Choke coil (L51) 75202 Coil -Choke coil, .56 muh (L46) 75185 75182 Coil -Converter plate loading coil (L44) Coil -Trimmer coil (11/2 turns) with adjustable induc- tance core and capacitor stud (screw adjustment) for converter section (C9, L47) 75183 Coil -Trimmer coil (3 turns) with adjustable inductance core and capacitor stud (screw adjustment) for r -f section (L48. C16) 76460 76966 75162 73453 75165 76518 Contact -Test point contact Core -Adjustable core for fine tuning capacitor Detent-Detent mechanism and fibre shaft Form -Coil form for L45, L49 Link -Link assembly for fine tuning Plate -Front plate and shaft bearing Resistor -Fixed, composition:- 503027 27 ohms. ± 10%. 1/2 watt (R8) 503068 68 ohms, ± 10%, 1/2 watt (R13) 504115 150 ohms, ± 20%, I/2 watt (R10) 503222 2200 ohms, ± 10%, 1/2 watt (R6) 503239 3900 ohms, ± 10%. 1/2 watt (R9, R11) 503247 4700 ohms, ± 10%, 1/2 watt (R12) 502310 1000 ohms, ± 5%. 1/2 watt (R3) 504310 10,000 ohms. ± 20%, 1/2 watt (R2) 503322 504410 14343 22,000 ohms, ± 10%, 1/2 watt (R7) 100,000 ohms, ±20%, 1/2 watt (RI, R4, R5) Retainer -Fine tuning shaft retaining ring STOCK No. DESCRIPTION 75164 71476 75177 75176 73640 74575 76519 76134 76962 76967 75088 75191 75163 30340 74578 76961 73457 75180 77459 76963 76964 75170 75171 75169 75446 75447 75173 75181 75607 75190 Rod -Actuating plunger rod (fibre) for fine tuning link Screw -=4-40 x 1/4" adjusting screw for L6. L7, L8, L9, LIO, L11 Screw- =4-40 x 3/s" adjusting screw for LI, L2, L3, L4. L43 Screw -04-40 x 7/16" adjusting screw for LS Screw- 04-40 x 7/16" adjusting screw for L52 Screw -444-40 x .359" adjusting screw for L42 Shaft -Channel selector shaft and plate Shaft- Fine tuning shaft and cam Shield -Oscillator and converter sections shield -snap - on type Shield -Tube shield for VI, V2 Socket -Tube socket, 7 contact, miniature, ceramic, saddle -mounted Spacer -Insulating spacer for front plate Spring -Friction spring (formed) for fine tuning cam Spring -Hair pin spring for fine tuning link Spring -Retaining spring for adjusting screws Spring -Retaining spring for oscillator tube shield Spring -Return spring for fine tuning control Stator -Antenna stator complete with rotor, coils, ccipacitors (C20, C21) and resistors (R9, R10, R11) (S1-4, C20, C2I. L32, L33, L34, L35, L36, L37, L38, L39, L40, L4I, L42. L52, R9, RIO, R11) Stator -Converter stator complete with rotor, coils, capacitors and resistors (S1-2, C10, C12, L12. L13, L14, LIS, L16, L17, L18. L19, L20, L21. L45, R4, RS, R12) Stator -Oscillator section stator complete with rotor. segment, coils, adjusting screws and capacitors C3. C23 (S1-1, C3. C23. LI, L2, L3, L4, L5, L6, L7, L8, L9, LIO, LI1, Stator -R -F amplifier stator complete with rotor, coils. capacitors (C13) and resistor (R6) (51-3, C13. L22, L23, L24, L25, L26, L27, L28, L29, L30, L31, L49, R6) Strip -Coil segment mounting strip-L.H. lower Strip -Coil segment mounting strip -L.H. upper -less trimmer C7 Strip -Coil segment mounting strip-R.H. center Stud -Capacitor stud- brass- g 4-40 x 3/16" with 3/64" screw driver slot for trimmer coils L47, L48 and capacitor Cl uncoded and coded "ER" Stud -Capacitor stud -brass -4:4-40 x 3/16" with 3/64" screw driver slot for trimmer coils L47, L48 and capacitor Cl coded numerically and "Hi -O" Stud -4,6-32 x 13/16" adjusting stud for trimmer C7 Transformer -Converter transformer (T1) Washer -Insulating washer (hex) Washer -Insulating washer (neoprene) for trimmer C7 76456 76454 71496 33098 33380 75450 73664 76475 76474 75437 CHASSIS ASSEMBLIES KCS72 Bracket -Channel indicator lamp bracket Bracket -Mounting bracket complete with insulator for picture control Capacitor -Adjustable, mica, 5-70 mmf. (C115) Capacitor -Ceramic, 10 mmf. (C127) Capacitor -Ceramic, 12 mmf. (C162) Capacitor -Ceramic. 39 mmf. (C203) Capacitor -Ceramic, 39 mmf. (C131) Capacitor -Mica. 68 mmf. (C164) Capactor-Mica, 82 mmf. (C142) Capacitor -Ceramic, 100 mmf. (C202) 29 138 17T200, 17T201, 17T202, 17T211, 17T220 REPLACEMENT PARTS (Continued) STOCK No. DESCRIPTION STOCK No. DESCRIPTION 76673 75248 47617 39638 73091 76476 39640 73094 39644 76990 73473 73960 76991 74521 75218 75217 76987 76970 76479 75643 76995 76508 77123 73595 73599 73818 73795 73920 73808 73561 73594 74938 73797 73562 73798 73810 73811 73596 Capacitor -Ceramic, 220 mmf. (C136) Capacitor -Mica, 220 mmf. (C146) Capacitor -Ceramic, 270 mmf. (C106) 73553 75071 Capacitor -Tubular, paper, oil impregnated, .047 mfd., 400 volts (C145, CI66) Capacitor -Tubular, moulded paper, .047 mfd.. 400 volts (C159, C160) Capacitor -Mica. 270 mmf. (C130) Capacitor -Mica, 270 mmf. (C140. C178) Capacitor -Mica, 330 mmf. (CI69, C175) Capacitor -Mica, 330 mmf. (C143) Capacitor -Mica, 390 mmf. (CI49) 73792 73784 73551 Capacitor -Tubular, paper, oil impregnated, .068 mfd., 400 volts (C156) Capacitor -Tubular, paper, oil impregnated, 0.1 mfd., 200 volts (C132, C133) Capacitor -Tubular, paper, oil impregnated, 0.1 mid,. 400 volts (C144, C150. C158, CI65, 0183) Capacitor -Mica. 470 mmf. (C107, C121) Capacitor -Ceramic, dual 4700 mmf. (CII7A, C117B, C119A. C119B, C125A, C125B, C126A, C126B) Capacitor -Ceramic. 4700 mmf. (C118. C120, C122, C123, C124, C186, C189) Capacitor -Ceramic, 10,000 mmf. (C104, C187) Capacitor -Ceramic, dual 10,000 mmf. (CIOIA, C101B) Capacitor -Electrolytic, 5 mfd., 50 volts (C109) Capacitor -Electrolytic, comprising 1 section of 10 mfd., 350 volts, 1 section of 5 mfd., 3S0 volts and 1 section of 150 mfd., 50 volts (CI85A, C185B, C185C) Capacitor -Mica trimmer, dual 10-160 mmf. (C161A , C161B) Capacitor -Electrolytic, comprising 1 section of 80 mfd., 400 volts and 1 section of 10 mfd., 350 volts (C182A, C182B) Capacitor -Electrolytic comprising 1 section of 100 mfd., 400 volts. 1 section of 10 mfd., 350 volts and 1 section of 20 mfd., SO volts (C184A, C184B, C184C) Capacitor -Tubular, moulded paper, oil impregnated, .00068 mfd., 600 volts (CI71) 73557 73786 76994 73787 76498 73591 75241 76442 76441 76640 76011 71527 71526 Capacitor -Tubular, paper, oil impregnated, 0.1 mfd., 600 volts (C153, C173) Capacitor -Tubular, paper, oil impregnated, 0.27 mfd.. 200 volts (C174) Capacitor -Tubular, paper, oil impregnated, 0.33 mfd., 200 volts (C135) Capacitor -Tubular, paper, oil impregnated, 0.47 mfd., 200 volts (C168) Choke -Filter choke (L113) Coil -Antenna matching coil (2 req'd) (Part of T200) Coil -Antenna shunt coil (L202) Coil -Horizontal linearity coil complete with adjustable core (L108) Coil -Width coil complete with adjustable core (L106) Coil -Peaking coil (1.5 muh) (L107) Coil -Peaking coil (36 muh) (L101) Coil -Peaking coil (93 muh) (L104) Coil -Peaking coil (250 muh) (L114) Capacitor -Tubular, paper, oil impregnated, .001 mfd., 1000 volts (C148, C163) 75252 Coil -Peaking coil (500 muh) (L102) 77124 Coil -Peaking coil (1000 muh) (L105, R216) Capacitor -Tubular, moulded paper, oil impregnated, .0012 mfd., 600 volts (C172) Capacitor -Tubular, paper, oil impregnated, .0015 mfd., 600 volts (C138) Capacitor -Tubular, moulded paper, oil impregnated, .0015 mfd., 1000 volts (C155) 71789 35787 75474 75482 Connector -Anode lead connector complete Connector-Phono input connector (J101) Connector -Single contact male connector for speaker cable Connector -Video connector (J102) Capacitor -Tubular, paper, oil impregnated, .0022 mfd., 74594 Connector -2 contact male connector for power cord 600 volts (C108, C154) 38853 Connector -4 contact female connector for antenna Capacitor -Tubular, paper, oil impregnated, .0027 mfd.,transformer (J200) 600 volts (C112) S0367 Connector -6 contact female connector for yoke lead Capacitor -Tubular, paper, oil impregnated, .0027 mfd., (J103) 1600 volts (C114) 75542 Connector -6 contact male connector -part of deflection yoke (P103) Capacitor -Tubular, paper, oil impregnated, .0033 mfd.. 600 volts (C137, C139) 76975 Control-AGC control (R149) Capacitor -Tubular, paper, oil impregnated, .0047 mid.. 600 volts (CI10, C151) 76444 Control -Brightness control (R184) 76448 Control -Height control (R173) Capacitor -Tubular, paper, oil impregnated. .0082 mfd.. 1000 volts (C147) 76974 Control -Horizontal and vertical hold control (R170A, R170B) Capacitor -Tubular, paper, oil impregnated, .01 mfd., 400 volts (C111, C113, C134) Capacitor -Tubular, moulded paper, oil impregnated, .01 mfd., 600 volts (C170) Capacitor --Tubular, paper, oil impregnated. .012 mfd. 200 volts (C188) 76445 76976 77010 71498 76986 Control -Picture control (R137) Control -Vertical linearity control (R181) Control -Volume control and power switch (R109, S102) Core -Adjustable core and stud for FM trap 75449 Cover -Back cover for hi -voltage compartment Capacitor -Tubular, paper, oil impregnated, .015 mfd. 600 volts (C129) Capacitor -Tubular, paper, oil impregnated, .022 mfd., 400 volts (C167) 76985 74956 74839 Cover -Side cover for hi -voltage compartment Cushion -Rubber cushion for deflection yoke hood Fastener -Push fastener for mounting tube socket 76453 Capacitor -Tubular. paper, oil impregnated. .022 mfd., 600 volts (C157) Capacitor -Tubular, paper, oil impregnated, .022 mfd. 1000 volts (C177) 73600 37396 764S9 Fuse -0.25 amps., 250 volts (F101) Grommet -Rubber grommet for mounting tube socket 76453 Grommet -Rubber grommet for 2nd. anode lead exit Capacitor -Tubular, paper, oil impregnated, .027 mfd., 1000 volts (C176) Capacitor -Tubular, paper, oil impregnated, .033 mfd. 1000 volts (C152) 76830 76168 76141 Hood -Deflection yoke hood less rubber cushions Magnet -Focus magnet Magnet -Ion trap magnet (P.M. type) 30 1 4 1 RCAVICTOR Model 17T250DE "Brett" Walnut, Mahogany Shown on Base TELEVISION RECEIVERS MODELS 17T250DE, 17T261DE Chassis No. KCS74 or KCS74M1 - Mfr. No. 274 - SERVICE DATA - 1952 No. T3 - Model 17T261DE "Ainsworth" Walnut, Mahogany, Blonde PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. GENERAL DESCRIPTION Models 17T250DE and 17T261DE are deluxe "17 inch" tele- vision receivers. The receivers are identical except for cabinets, and speakers. Features of the television unit are: full twelve channel coverage; "totem" r -f amplifier; intercarrier FM sound system; ratio detector; 40 mc picture i-f; improved picture brilliance; pulsed picture A -G -C; A -F -C horizontal hold; stabilized vertical hold; compensated video gain control; noise saturation cir- cuits; improved sync separator and clipper; four mc. band width for picture channel and reduced hazard high voltage supply. An auxiliary audio input jack is provided to permit the use of an external record playing attachment. ELECTRICAL AND MECHANICAL SPECIFICATIONS PICTURE SIZE 146 square inches on a 17QP4 Kinescope TELEVISION R -F FREQUENCY RANGE All 12 television channels, 54 mc. to 88 mc., 174 mc. to 216 mc. Picture I -F Carrier Frequency 45.75 mc. Sound I -F Carrier Frequency 41.25 mc. and 4.5 mc. VIDEO RESPONSE To 4 mc. SWEEP DEFLECTION Magnetic FOCUS. Magnetic POWER SUPPLY RATING KCS74 115 volts, 60 cycles, 190 watts AUDIO POWER OUTPUT RATING KCS74 5 0 watts max. CHASSIS DESIGNATIONS KCS74 or KCS74M1 In Models 17T250DE and 17T261DE *KCS74 (V110-6CL6)-KCS74M1 (V110-6AG7) LOUDSPEAKERS Model 17T250DE Model 17T261DE (971490-3) 8" PM Dynamic, 3.2 ohms (92569-12) 12" PM Dynamic, 3.2 ohms WEIGHT Model 17T250DE.... 88 lbs. 17T261DE.... 102 lbs. . Shipping Width Weight Inches ... 105 lbs. 215/8 . 126 lbs. . .. 24 . Height Depth Inches Inches . 225ia . . 221/4 ... . 371/4 231/4 RECEIVER ANTENNA INPUT IMPEDANCE Choice: 300 ohms balanced or 72 ohms unbalanced. RCA TUBE COMPLEMENT Tube Used Function ( 1 ) RCA 6BQ7 R -F Amplifier ( 2 ) RCA 6X8 R -F Oscillator and Mixer ( 3 ) RCA 6AU6 1st Picture I -F Amplifier ( 4 ) RCA 6CB6 2nd Picture I -F Amplifier ( 5 ) RCA 6CB6 3rd Picture I -F Amplifier ( 6 ) RCA 6CB6 4th Picture I -F Amplifier ( 7 ) RCA 6CL6 (6AG7) * Video Amplifier ( 8 ) RCA 6AU6 1st Sound I -F Amplifier ( 9 ) RCA 6AU6 2nd Sound I -F Amplifier (10) RCA 6AL5 Ratio Detector (11) RCA 6AV6 1st Audio Amplifier (12) RCA 6AQ5 Audio Output (13) RCA 6CB6 AGC Amplifier (14) RCA 6SN7GT. Sync Separator (15) RCA 6SN7GT.. Vert. Sync Amplifier and Vett. Sweep Osc. (16) RCA 6AQ5 Vertical Sweep Output (17) RCA 6SN7GT Horizontal Sync Amplifier (18) RCA 6SN7GT....Horizontal Sweep Oscillator and Control (19) RCA 6BQ6GT Horizontal Sweep Output (20) RCA 6W4GT Damper (21) RCA 1B3-GT/8016 High Voltage Rectifier (22) RCA 17QP4 Kinescope *(Refer to Figure 79) 142 17T250DE, 17T261DE ELECTRICAL AND MECHANICAL SPECIFICATIONS (Continued) PICTURE INTERMEDIATE FREQUENCIES Picture Carrier Frequency Adjacent Channel Sound Trap Accompanying Sound Traps Adjacent Channel Picture Carrier Trap 45.75 mc. 47.25 mc. 41.25 mc. 39.25 mc. SOUND INTERMEDIATE FREQUENCIES Sound Carrier Frequency 41.25 mc. and 4.5 mc. VIDEO RESPONSE To 4 mc. FOCUS Magnetic SWEEP DEFLECTION Magnetic SCANNING Interlaced, 525 line HORIZONTAL SWEEP FREQUENCY 15.750 cps VERTICAL SWEEP FREQUENCY. 60 cps FRAME FREQUENCY (Picture Repetition Rate) 30 cps OPERATING CONTROLS (Front Panel) Channel Selector Fine Tuning Picture Brightness Picture Horizontal Hold Picture Vertical Hold Sound Volume and On -Off Switch Tone Control and Phono Switch Dual Control Knobs Dual Control Knobs Dual Control Knobs Dual Control Knobs NON -OPERATING CONTROLS (not including IA and i-f adjust. ments) Picture Centering top chassis adjustment Width rear chassis adjustment Height rear chassis adjustment Horizontal Linearity rear chassis screwdriver adjustment Vertical Linearity rear chassis adjustment Horizontal Drive. rear chassis screwdriver adjustment Horizontal Oscillator Frequency rear chassis adjustment Horizontal Oscillator Waveform bottom chassis adjustment Horizontal Locking Range. rear chassis adjustment Focus top chassis adjustment Ion Trap Magnet top chassis adjustment Deflection Coil top chassis wing nut adjustment AGC Control rear chassis adjustment HIGH VOLTAGE WARNING OPERATION OF THIS RECEIVER OUTSIDE THE CABINET OR WITH THE COVERS REMOVED, INVOLVES A SHOCK HAZARD FROM THE RECEIVER POWER SUPPLIES. WORK ON THE RECEIVER SHOULD NOT BE ATTEMPTED BY ANYONE WHO IS NOT THOROUGHLY FAMILIAR WITH THE PRECAUTIONS NECESSARY WHEN WORKING ON HIGH VOLTAGE EQUIPMENT. DO NOT OPERATE THE RECEIVER WITH THE HIGH VOLTAGE COMPARTMENT SHIELD REMOVED. KINESCOPE HANDLING PRECAUTIONS DO NOT REMOVE THE RECEIVER CHASSIS, INSTALL, REMOVE OR HANDLE THE KINESCOPE IN ANY MANNER UNLESS SHATTERPROOF GOGGLES ARE WORN. PEOPLE NOT SO EQUIPPED SHOULD BE KEPT AWAY WHILE HANDLING KINESCOPES. KEEP THE KINESCOPE AWAY FROM THE BODY WHILE HANDLING. The kinescope bulb encloses a high vacuum and, due to its large surf ace area, is subjected to considerable air pressure. For this reason, the kinescope must be handled with more care than ordinary receiving tubes. The large end of the kinescope bulb-particularly that part at the rim of the viewing surface-must not be struck, scratched or subjected to more than moderate pressure at any time. During service if the tube sticks or fails to slip smoothly into its socket, or deflecting yoke, investigate and remove the cause of the trouble. Do not force the tube. Refer to the Receiver Installation section for detailed instructions on kinescope installation. All RCA replacement kinescopes are shipped in special cartons and should be left in the cartons until ready for installation in the receiver. 2 OPERATING INSTRUCTIONS 143 17T250DE, 17T261DE The following adjustments are necessary when turning the receiver on for the first time. 1. See that the TV -PH tone switch is in a "TV" position. 2. Turn the receiver "ON" and advance the SOUND VOLUME control to approximately mid -position. 3. Set the STATION SELECTOR to the desired channel. 4. Adjust the FINE TUNING control for best pix and the SOUND VOLUME control for suitable volume. 5. Turn the BRIGHTNESS control fully counter -clockwise, then clockwise until a light pattern appears on the screen. 8. Adjust the PICTURE and BRIGHTNESS controls for suitable picture contrast and brightness. 9. In switching from one channel to another, it may be necessary to repeat steps 4 and 8. 10. When the set is turned on again after an idle period it should not be necessary to repeat the adjustment if the positions of the controls have not been changed. If any adjustment is necessary, step number 4 is generally sufficient. 11. If the positions of the controls have been changed, it may be necessary to repeat steps 2 through 8. 6. Adjust the VERTICAL hold control until the pattern stops vertical movement. 7. Adjust the HORIZONTAL hold control until a picture is obtamed and centered. VERT CAL HOLD HORIZONTAL HOLD BRIGHTNESS PICTURE ON -OFF TONE SOUND PHONO VOLUME SWITCH STATION SELECTOR Figure 1-Receiver Operating Controls 12. To use a record player, plug the record-player output CHANNEL cable into the PHONO jack on NO. the rear apron, and set the TV - FINE TUNING PH tone switch to a "PH" posi- tion. INSTALLATION INSTRUCTIONS UNPACKING.-These receivers are shipped complete in cardboard cartons. The kinescope is shipped in place in the receiver. Take the receiver out of the carton and remove all packing material. Make sure that all tubes are in place and are firmly seated in their sockets. Check to see that the kinescope high voltage lead clip is in place. Plug a power cord into the 115 volt a -c power source and into the receiver interlock receptacle. Turn the receiver power switch to the "on" position, the brightness control fully clockwise, and the picture control counter -clockwise. ION TRAP MAGNET ADJUSTMENT. - Set the ion trap magnet approximately in the position shown in Figure 2. Starting from this position immediately adjust the magnet by moving it forward or backward at the same time rotating it slightly around the neck of the kinescope for the brightest raster on the screen. Reduce the brightness control setting until the raster is slightly above average brilliance. Turn the focus control (shown in Figure 2) until the line structure of the raster is clearly visible. Readjust the ion trap magnet for maximum raster brilliance. The final touches of this adjustment should be made with the brightness control at the maximum clockwise position with which good line focus can be maintained. PIN -CUSHION KINESCOPE SOCKET FOCUS MAGNET MOUNTING SCREW ION TRAP MAGNET i &W MAGNET DEFLECTION YOKE ADJUSTMENT HINE DEFLECTION YOKE KINE CUSHION FOCUS CONTROL DEFLECTION YOKE ADJUSTMENT. - If the lines of the raster are not horizontal or squared with the picture mask, rotate the deflection yoke until this condition is obtained. Tighten the yoke adjustment wing screw. PICTURE ADJUSTMENTS. It will now be necessary to obtain a test pattern picture in order to make further adjust- ments. Connect the antenna transmission line to the receiver. If the Horizontal Oscillator and AGC System are operating properly, it should be possible to sync the picture at this point. However, if the AGC control is misadjusted, and the receiver is overloading, it may be impossible to sync the picture. If the receiver is overloading, turn R181 on the rear apron (see Figure 3) counter -clockwise until the set operates normally and the picture can be synced. CHECK OF HORIZONTAL OSCILLATOR ALIGNMENT. Turn the horizontal hold control to the extreme counterclockwise position. The picture should remain in horizontal sync. Momentarily remove the signal by switching off channel then back. Normally the picture will be out of sync. Turn the control clockwise slowly. The number of diagonal black bars will be gradually reduced and when only 2 or 3 bars sloping downward to the left are obtained, the picture will pull into sync upon slight additional clockwise rotation of the control. Pull -in should occur before the control has been turned 120 degrees from the extreme counter -clockwise position. The picture should remain in sync for approximately 90 R -F UNIT R211 VERTICAL LINEARITY CONTROL R199 HEIGHT CONTROL AGC CONTROL T113 HORIZONTAL OSCILLATOR FREQ. ADJ. C191/1 HORIZONTAL DRIVE L107 HORIZONTAL LINEARITY CONTROL L106 WIDTH CONTROL CENTERING ADJUSTMENT LOCK SCREW CENTERING ADJUSTMENT LEVER r411.11118. J101 ©PNONO INPUT JIOS C19IA VIDEO re:), MIL JACK RANGE Figure 2-Yoke and Focus Magnet Adjustments 3 Figure 3-Rear Chassis Adjustments 144 17T250DE, 17T26 IDE INSTALLATION INSTRUCTIONS degrees of additional clockwise rotation of the control. At the extreme clockwise position, the picture should remain in sync and should not show a black bar in the picture. If the receiver passes the above checks and the picture is normal and stable, the horizontal oscillator is properly aligned. Skip "Alignment of Horizontal Oscillator" and proceed "Focus Magnet Adjustment." with abAoLveIGcNhMecEkNtTheOrFeHceOivReIZr OfaNilTeAdLtoOhSoClIdLLsAyTnOcRw. i-thIftheinhotlhde control at the extreme counter -clockwise position or failed to hold sync over 90 degrees of clockwise rotation of the control from the pull -in point, it will be necessary to make the ing adjustments. follow- Horizontal Frequency Adjustment. - Turn the horizontal hold control to the extreme clockwise position. Tune in a television station and adjust the T113 horizontal frequency adjustment at the rear of the chassis until the picture is just out of sync and the horizontal blanking appears as a vertical or diagonal black bar in the raster. Then turn the T113 core until the bar moves out of the picture leaving it in sync. Horizontal Locking Range Adjustment. - Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T113 rear core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal before the picture pulls into sync. bars obtained just If more than 3 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C191A slightly clockwise. If less than 2 bars are present, adjust C191A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 or 3 bars are present. Repeat the adjustments under "Horizontal Frequency Adjustment" and "Horizontal Locking Range Adjustment" until the conditions specified under each are fulfilled. When the horizontal hold operates as outlined under "Check of Horizontal Oscillator Alignment" the oscillator is properly adjusted. If it is impossible to sync the picture at this point and the AGC system is in proper adjustment it will be necessary to adjust the Horizontal Oscillator by the method outlined in the alignment procedure on page 11. For field purposes paragraph "B" under Horizontal Oscillator Waveform Adjustment may be omitted. If a corner of the raster is shadowed, check the position of the ion trap magnet. Reposition the magnet within the range of maximum raster brightness to eliminate the shadow and recenter the picture by adjustment of the focus magnet plate. In no case should the magnet be adjusted to cause any loss of brightness since such operation may cause immediate or eventual sary to damage shift the to the tube. position of In some cases it may be necesthe focus magnet in order to eliminate a corner shadow. WIDTH, DRIVE AND HORIZONTAL LINEARITY ADJUSTMENTS. - Adjustment of the horizontal drive control affects the high voltage applied to the kinescope. In order to obtain the highest possible voltage hence the brightest and best focused picture, adjust horizontal drive trimmer C191B counterclockwise until the picture begins to "wrinkle" in the middle then clockwise until the "wrinkle" disappears. tcishloeTocbupktriawcnitnuitsehredee.ubhneotgriiilzntoshnettoa"l"wwlirnrinienakkrlilete"y"dcoionsnattphropeleraLigr1sh0ta7anncdldobcethksewtnislcieonuenaurtneittryi-l Adjust the width control L106 to obtain correct picture width. A slight readjustment of these three controls sary to obtain the best linearity. may be neces- Adjustments oscillator hold of the horizontal drive and locking range. If control affect horizontal the drive control was adjusted, recheck the oscillator alignment. jusHt EthIGe HhTeiAghNtDcoVnEtRroTlIC(RA1L9L9INonEAchRaITssYisADreJUarSaTpMrEoNn)TuS.nt-ilAthde- picture fills the mask vertically. Adjust vertical linearity (R211 on rear apron), until the test pattern is symmetrical from to bottom. Adjustment of either control will require a top re- adjustment of the other. Adjust centering to align with the mask. the picture FOCUS. in the test white areas - Adjust the focus magnet for maximum definition pattern vertical "wedge" and best focus of the pattern. in the Recheck the position of the ion trap magnet to make sure that maximum brightness is obtained. Check to see that the yoke thumbscrew and the focus magnet mounting screws are tight. STATION SELECTOR FINE TUNING FOCUS MAGNET ADJUSTMENT. - The focus magnet should be adjusted so that there is approximately three -eighths inch of space between the rear cardboard shell of the yoke and the flat of the front face of the focus magnet. This spacing gives best average focus over the face of the tube. The axis of the hole through the magnet should be parallel with the axis of the kinescope neck with the kinescope neck through the center of the opening. PIN -CUSHION tion magnets are CORRECTION. - Two employed to correct pin -cushion correc- a small amount of pin -cushion of the raster due to the lens effect of the face of the kinescope. These magnets are mounted on small arms, one on each side of the kinescope as shown in Figure 2. The arms hinge in one plane on self tapping screws which act both as a hinge and an adjustment locking screw. When the magnets are swung towards the tube, maximum correction is obtained. Minimum correction is obtained when the arms are swung away from the tube. To adjust the magnets, loosen the two self tapping screws and position the magnets until the sides of the raster appear straight. Tighten the screws without shifting the position of the magnets. In some cases it may be necessary to twist or bend the magnet support arms to obtain the appearance of straight raster edges. CENTERING ADJUSTMENT. - No electrical centering con- trols are provided. Centering is accomplished by means of a separate plate on the focus magnet. The centering plates in- clude a locking screw which must be loosened before cen- tering. Up and down adjustment of the plate moves the picture side to side and sidewise adjustment moves the picture and down. up 4 TO REMOVE ESCUTCHEON, SLIDE SPRING CLIP TO LEFT -OSCILLATOR ADJUSTMENT -FOR CHANNEL NUMBER Figure 4-R -F Oscillator Adjustments aadllCjuaHsvEtaeCidlKatboOleFthsRetap-FtriooOpnSesCrtIfoLrLesqAeueTeOnifRcytAhoDenJrUeaclSleTicMvheaErnNnrT-efSls.o.-scTIiflulaandtojeur sitni-s ments are required, these should lined in the alignment procedure be on made page by 9. the The method outadjustments for channels 2 through 12 are available from the front of the cabinet by removing the station selector escutcheon as shown in Figure 4. Adjustment for channel 13 is on top of the chassis. AGC THRESHOLD CONTROL - The AGC threshold con- trol R181 is adjusted at the factory and normally require readjustment in the field. should not To check the adjustment of the AGC Threshold Control, tune in a strong signal and sync the picture. Momentarily remove the signal by switching off channel and then back. If the picture reappears immediately, the receiver is not over- loading due to improper setting of 11181. an appreciable portion of a second to Irfetahpeppeiacrtu, reorrebqeunirdess excessively, R181 should be readjusted. INSTALLATION INSTRUCTIONS 145 17T250DE, 17T261DE Turn R181 fully counter -clockwise. The raster may be bent slightly. This should be disregarded. Turn R181 clockwise until there is a very, very slight bend or change of bend in the picture. Then turn R181 counter -clockwise just sufficiently to remove this bend or change of bend. If the signal is weak, the above method may not work as it may be impossible to get the picture to bend. In this case, turn R181 clockwise until the snow in the picture becomes more pronounced, then counter -clockwise until the best signal to noise ratio is obtained. The AGC control adjustment should be made on a strong signal if possible. If the control is set too far clockwise on a weak signal, then the receiver may overload when a strong signal is received. FM TRAP ADJUSTMENT. - In some instances interference may be encountered from a strong FM station signal. A trap is provided to eliminate this type of interference. To adjust the trap tune in the station on which the interference is observed and adjust the L58 core on top of the antenna matching transformer for minimum interference in the picture. CAUTION. - In some receivers, the FM trap L58 will tune down into channel 6 or even into channel 5. Needless to say, such an adjustment will cause greatly reduced sensitivity on these channels. If channels 5 or 6 are to be received, check L58 to make sure that it does not affect sensitivity on these two channels. Replace the cabinet back and connect the receiver antenna leads to the cabinet back. Make sure that the screws holding it are up tight, otherwise it may rattle or buzz when the receiver is operated at high volume. KINESCOPE SCREEN CLEANING. - The kinescope safety glass is held in place by four spring clips which may be removed from the back of the front panel. This permits removing the safety glass for cleaning without the necessity of removing the chassis and kinescope. CHASSIS REMOVAL. - To remove the chassis from the cabinet for repair or installation of a new kinescope, remove the control knobs, the cabinet back, unplug the speaker cable, the kinescope socket, the antenna cable, the yoke and high voltage cable. Take out the chassis bolts under the cabinet. Withdraw the chassis from the back of the cabinet. KINESCOPE HANDLING PRECAUTION. - Do not install, remove, or handle the kinescope in any manner, unless shatter- proof goggles and heavy gloves are worn. People not so equipped should be kept away while handling the kinescope. Keep the kinescope away from the body while handling. REMOVAL OF KINESCOPE.-To remove the kinescope from the cabinet, loosen the two nuts and disengage the rods alongside the kinescope. Remove the wing screw which holds the yoke frame to the cabinet. Remove the kinescope, the yoke frame with yoke and focus magnet as an assembly. Handle this tube by the portion at the edge of the screen. Do not cover the glass bell of the tube with fingermarks as it will produce leakage paths which may interfere with reception. If this portion of the tube has inadvertently been handled, wipe it clean with a soft cloth moistened with "dry" carbon tetrachloride. INSTALLATION OF KINESCOPE. - Wipe the kinescope screen surface and front panel safety glass clean of all dust and fingermarks with a soft cloth moistened with "Windex" or similar cleaning agent. Replace the kinescope and chassis by reversal of the removing process. The kinescope should be installed so that the high voltage contact is to the right when looking at it from the rear of the cabinet. The magnet of the ion trap magnet should be to the left. CABINET ANTENNA.-A cabinet antenna is provided in these receivers and the leads are brought out near the antenna terminal board. The cabinet antenna may be employed in place of the outdoor antenna in areas where the signals are strong and no reflections are experienced. ANTENNAS.-The finest television receiver built may be said to be only as good as the antenna design and installation. It is therefore important to select the proper antenna to suit the particular local conditions, to install it properly and orient it correctly. If two or more stations are available and the two stations are in different directions, it may be possible to make a compromise orientation which will provide a satisfactory signal an all such channels. If it is impossible to obtain satisfactory results on one or more channels, it may become necessary either to provide means for turning the antenna when switching channels or to install a separate antenna for one or more channels and to switch antennas when switching channels. In some cases, the antenna should not be installed permanently until the quality of the picture reception has been observed on a television receiver. A temporary transmission line can be run between receiver and the antenna, allowing sufficient slack to permit moving the antenna. Then, with a telephone system connecting an observer at the receiver and an assistant at the antenna, the antenna can be positioned to give the most satisfactory results on the received signal. A shift of direction or a few feet in antenna position may effect a tremendous difference in picture reception. REFLECTIONS. - Multiple imagcs sometimes known as echoes or ghosts, are caused by the signal arriving at the antenna by two or more routes. The second or subsequent image occurs when a signal arrives at the antenna after being reflected off a building, a hill or other object. In severe cases of reflections, even the sound may be distorted. In less severe cases, reflections may occur that are not noticeable as reflections but that will instead cause a loss of definition in the picture. Under certain extremely unusual conditions, it may be possible to rotate or position the antenna so that it receives the cleanest picture over a reflected path. If such is the case, the antenna should be so positioned. However, such a position may give variable results as the nature of reflecting surfaces may vary with weather conditions. Wet surfaces have been known to have different reflecting characteristics than dry surfaces. Depending upon the circumstances, it may be possible to eliminate the reflections by rotating the antenna or by moving it to a new location. In extreme cases, it may be impossible to eliminate the reflection. INTERFERENCE.-Auto ignition, street cars, electrical ma- chinery and diathermy apparatus may cause interference which spoils the picture. Whenever possible, the antenna location should be removed as far as possible from highways, hospitals, doctors' offices and similar sources of interference. In mounting the antenna, care must be taken to keep the antenna rods at least 1/4 wave length (at least 6 feet) away from other antennas, metal roofs, gutters or other metal objects. Short-wave radio transmitting and receiving equipment may cause interference in the picture in the form of moving ripples. In some instances it may be possible to eliminate the interference by the use of a trap in the antenna transmission line. However, if the interfering signal is on the same frequency as the television station, a trap will provide no improvement. WEAK PICTURE.-When the installation is near the limit of the area served by the transmitting station, the picture may be speckled, having a "snow" effect, and may not hold steady on the screen. This condition is due to lack of signal strength from the transmitter. RECEIVER LOCATION.-The owner should be advised of the importance of placing the receiver in the proper location in the room. The location should be chosen-Away from bright windows and so that no bright light will fall directly on the screen. (Some illumination in the room is desirable, however.) -To give easy access for operation and comfortable viewing. -To permit convenient connection to the antenna. -Convenient to an electrical outlet. - To allow adequate ventilation. 5 146 17T250DE, 17T26 IDE CHASSIS TOP VIEW TO ANTENNA TERMINALS T2 ANTENNA MATCH I NG TRANSFORMER FINE TUNING CONTROL SPEAKER CABLE CHANNEL SELECTOR SWITCH RI99 HEIGHT CONTROL Ect RATIO 0E13 V102 6AiJ6 TRANS. ,2m3SHO TI 01 NO®! F RAN 1-r AMP. R1131 AGc R139 RATIO a"DET . BAL. VIII 6CB6 A GC AMP. J102 F / ...," --",... V117 \ 61306GT 1 I,HOR. SWEEP) Ii ',OUTPUT / ....__.../ ...---, ,' V116 \ / 6SN76T I 0-10R.SWEEPI \ OSC 6,. / \CONTROL r vii ) 1B3GT / 8010 e----.. 'VO1 LTHAIGGH E'' II; v119 , ' RECTIFIER 6W4GT i DAMPEN i I II I i II 1 -------- I II i IL- -1117L...=== _.4----_-2 5TH PIX 0I - F TRANS. T108 4TH PIX I -F TRANS. 10 6CB6 3RD PIX I- F AMP VII0 6CL6 VIDEO AMP V113 6SN7GT SYNC. SEPARATOR RI513 PICTURE CONTROL TII2 POWER TRANSFORMER / 107 GCB 6 2NO PIX I -F MP 104 6 Av 6 AUDIO AMP. 5101 TONE CONTROL PHONO SWITCH 5102- RI14 ON OFF SWITCH & VOLUME CONTROL 6A1 06 T\AP1IX1yI -F T104 1ST 1?1XO GRILL 1:FRANS. i 05 6 AQ5 AUDIO UT PU R216 BRIGHTNESS CONTROL 6A10155 V RT. SWEEP OUTPUY L115 FILTER CHOKE I \ T111 VERTICAL SWEEP OUTPUT TRANSFORMER V114 6SN7GT VERT.5YNC. AMP& VER SWEEP OSC. RISS PICTURE CONTROL 12197A VERTICAL HOLD CONTROL RI97B HORIZONTAL HOLD CONTROL KINESCOPE SOCKET A Figure 5-Chassis Top View 6 POWER CORD FINE TUNING CONTROL r-r\1 CHANNEL SELECTOR SWITCH S101 TONE CONTROL PHONO SWITCH 5102 - R114 ON -OFF SWITCH & VOLUME CONTROL R216 BRIGHTNESS CONTROL R1513 PICTURE CONTROL R197A VERTICAL HOLD CONTROL CHASSIS BOTTOM VIEW R -F UNIT TZ ANTENNA MATCHING TRANSFORMER 147 17T250DE, 17T261 DE TO ANTENNA TERMINALS SPEAKER CABLE t=0 7107 Tioa 3RD P X I -F 4TH PIX I -F TRANS. TRANS. 6107 6CB6 2ND piX I -F AMP vioe, 6C66 3RD PIX I -F AMP 109 6CI36 4TH P1x. I -F AMP T109 5TH PIA I -F TRANS. TIOI SNOS I -F BANS 6VA10U16 V102 6AU6 2NDSND I -F AM RI T102 RATIO D ET. TRANS. 101 11C76-1 1ST SND I -F AMP 6103 2Hopix ® 6A L5 10 6AV6 GRID TRANS. RATIO DET. AUDIO AMP "IFC1 pixS I -F 6A10055 AUDIO UTPU PLATE TRANS VI OR 6Au 6 1ST ptx I -F AMP. T104 V110 6CL6 VIDEO AMP. VI12 6SN7GT HORIZONTAL SYNC. A MP. V 111 6 C GB6C A AMP. ISTPIX® I -F GRID TRANS. vilS 6AGS vERT. SWEEP OUTPUT \ /..--...., \ /I ....._......, R S8 PICTURE CONTROL E vii3 6,SN767 SYNC. SEPARATOR -1 V116 6SN7GT HORIZ. SWEEP OSC. AND CONTROL V117 69060T HORiZ. SWEEP OUTPUT R19TB HORIZONTAL HOLD CONTROL V114 6SN7G VERTICAL SYNC. AMP. 6.. VERT. SWEEP OSC- POWER CORD KINESCOPE SOCKET Figure 6-Chassis Bottom View 7 148 17T250DE, 17T261DE ALIGNMENT PROCEDURE TEST EQUIPMENT. - To properly service the television chassis of this receiver, it is recommended that the following test equipment be available: R -F Sweep Generator meeting the following requirements: (a) Frequency Ranges 35 to 90 mc., 1 mc. to 12 mc. sweep width 170 to 225 mc., 12 mc. sweep width (b) Output adjustable with at least .1 volt maximum. (c) Output constant on all ranges. (d) "Flat" output on all attenuator positions. Cathode -Ray Oscilloscope. - For alignment purposes, the oscilloscope employed must have excellent low frequency and phase response, and should be capable of passing a 60 -cycle square wave without appreciable distortion. For video and sync waveform observations, the oscilloscope must have excellent frequency and phase response from 10 cycles to at least two megacycles in all positions of the gain control. Signal Generator to provide the following frequencies with crystal accuracy. (a) Intermediate frequencies 4.5 mc., 39.25 mc., 41.25 mc., 45.75 mc., 47.25 mc. (b) Radio frequencies Picture Sound Receiver Channel Carrier Carrier R -F Osc. Number Freq. Mc. Freq. Mc. Freq. Mc. 2 55.25 59.75 101 3 61.25 65.75 107 4 67.25 5 77.25 71.75 113 81.75 123 6 83.25 87.75 129 7 175.25 179.75 221 8 181.25 185.75 227 9 187.25 191.75 233 10 193.25 197.75 239 11 199.25 203.75 245 12 205.25 209.75 251 13 211.25 215.75 257 (c) Output of these ranges should be adjustable and at least .1 volt maximum. Heterodyne Frequency Meter with crystal calibrator if the signal generator is not crystal controlled. Electronic Voltmeter of Junior or Senior "VoltOhmyst" type and a high voltage multiplier probe for use with this meter to permit measurements up to 20 kv. ORDER OF ALIGNMENT. - When a complete receiver align ment is necessary, it can be most conveniently performed in the following order: (1) Ant. Matching Unit (2) R -F Unit (3) Ratio Detector (4) Sound I -F Trans. (5) Sound Take -Off Trans. (6) Picture I -F Traps (7) Picture I -F Trans. (8) Sweep Alignment of I -F (9) Horizontal Oscillator (10) Sensitivity Check ANTENNA MATCHING UNIT ALIGNMENT. - The antenna matching unit is accurately aligned at the factory. Adjustment of this unit should not be attempted in the customer's home since even slight misalignment may cause serious attenuation of the signal especially on channel 2. The r -f unit is aligned with a particular antenna matching transformer in place. If for any reason, a new antenna matching transformer is installed, the r -f unit should be realigned. The F -M Trap which is mounted in the antenna matching unit may be adjusted without adversely affecting the alignment of the unit. To align the antenna matching unit disconnect the lead from the F -M Trap L58 to the channel selector switch S5. With a short jumper, connect the output of the matching unit through a 1000 mmf capacitor to the grid of the second pix i-f amplifier, pin 1 of V107. Replace the cover on the matching unit while making all adjustments. Remove the first pix i-f amplifier tube V106. Connect the positive terminal of a bias box to the chassis and the potentiometer arm to the junction of R193 and R194. :Set the potentiometer to produce approximately -6.0 volts of bias at the junction of R193 and R194. Connect an oscilloscope to pin 2 of V110 (pin 4 if 6AG7 used) and set the oscilloscope gain to maximum. Connect a signal generator to the antenna input terminals. Modulate the signal generator 30% with an audio signal. Tune the signal generator to 45.75 mc. and adjust the generator output to give an indication on the oscilloscope. Adjust L59 in the antenna matching unit for minimum audio indication on the oscilloscope. Tune the signal generator to 41.25 mc. and adjust L60 for minimum audio indication on the oscilloscope. Remove the jumper from the output of the matching unit. Connect a 300 ohm 1/2 watt composition resistor from L58 to ground, keeping the leads as short as possible. Connect an oscilloscope low capacity crystal probe from L58 to ground. The sensitivity of the oscilloscope should be approximately 0.03 volts per inch. Set the oscilloscope gain to maximum. Connect the r -f sweep generator to the matching unit antenna input terminals. In order to prevent coupling reactance from the sweep generator into the matching unit, it is advisable to employ a resistance pad at the matching unit terminals. Figure 11 shows three different resistance pads for use with sweep generators with 50 ohm co -ax output, 72 ohm co -ax output or 300 ohm balanced output. Choose the pad to match the output impedance of the particular sweep employed. Connect the signal generator loosely to the matching unit antenna terminals. Set the sweep generator to sweep from .45 mc. to 54 mc. With RCA type WR59A sweep generators, this may be accomplished by retuning channel number 1 to cover this range. With WR59B sweep generators this may be accomplished by retuning channel number 2 to cover the range. In making these adjustments on the generator, be sure not to turn the core too far clockwise so that it becomes lost beyond the core retaining spring. Adjust L61 and L62 to obtain the response shown in Figure 12. L61 is most effective in locating the position of the shoulder of the curve at 52 mc. and L62 should be adjusted to give maximum amplitude at 53 mc. and above consistent with the specified shape of the response curve. The adjustments in the matching unit interact to some extent. Repeat the above procedure until no further adjustments are necessary. Remove the 300 ohm resistor and crystal probe connections. Restore the connection between L58 and S5. Replace V106. R -F UNIT ALIGNMENT. - An r -f unit which is operative and requires only touch up adjustments, requires no presetting of adjustments. For such units, skip the remainder of this paragraph. For units which are completely out of adjustment, preset all adjustments to the approximate center of their range with the following exceptions: Set C18 so that the screw head is approximately three -eighths of an inch above chassis. Set C11 near maximum capacity (one -quarter turn from tight). Do not change any of the adjustments in the antenna matching unit. Disconnect the link from terminals "A" and "B"' of T104 and terminate the link with a 39 ohm composition resistor. The r -f unit is aligned with zero AGC bias. To insure that the bias will remain constant, take a clip lead and short circuit the r -f unit power terminal board terminal 3 to ground. Connect the oscilloscope to the test point TP1 on top of the r -f -unit. Set the oscilloscope gain to maximum. Turn the receiver channel selector switch to channel 2. Connect the output of the signal generator to the grid of the r -f amplifier, V2. To do this, remove the tube from the socket and fashion a clip by twisting one end of a small piece of wire around pin number 7. Replace the tube in the socket leaving the end of the wire protruding from under the tube. Connect the signal generator to this wire through a 1,500 mmf. capacitor. Tune the signal generator to 43.5 mc. and modulate it 30% with a 400 cycle sine wave. Adjust the signal generator for maximum output. 8 ALIGNMENT PROCEDURE 149 17T250DE, 17T261DE Adjust L65 on top of the r -f unit for minimum 400 cycle indication on the oscilloscope. If necessary, this adjustment can be retouched in the field to provide additional rejection to one specific frequency in the i-f band pass. However, in such cases, care should be taken not to adjust it so as to reduce sensitivity on channel 2. Remove the wire clip from pin 7 of V2 and replace the tube and tube shield. Set the channel selector switch to channel 8. Turn the fine tuning control 30 degrees clockwise from the center Of its mechanical range now and at all times when adjusting the oscillator frequency. Adjust C2 for proper oscillator frequency, 227 mc. This may be done in several ways. The easiest way and the way which will be recommended in this procedure will be to use the signal generator as a heterodyne frequency meter and beat the oscillator against the signal generator. To do this, tune the signal generator to 227 mc. with crystal accuracy. Insert one end of a piece of insulated wire into the r -f unit through the hole provided for the adjustment for C11. Be careful that the wire does not touch any of the tuned circuits as it may cause the frequency of the r -f unit oscillator to shift. Connect the other end of the wire to the "r -f in" terminal of the signal generator. Adjust C2 to obtain an audio beat with the signal generator. Note.-If on some units, it is not possible to reach the proper channel 8 oscillator frequency by adjustment of C2, switch to channel 13 and adjust L46 to obtain proper channel 13 oscillator frequency as indicated in the table on page 8. Then, switch to channel 12 and adjust L11 to obtain proper channel 12 oscillator frequency. Continue down to channel 8 adjusting the appropriate oscillator trimmer to obtain the proper frequency on each channel. Then again on channel 8, adjust C2 to obtain proper channel 8 oscillator frequency. Switch back to channel 13 and adjust L46 and back to channel 8 and adjust C2. Set the T1 core for maximum inductance (core turned counter- clockwise.) Connect the sweep generator through a suitable attenuator as shown in Figure 11 to the input terminals of the antenna matching unit. Connect the signal generator loosely to the antenna ter- minals. Set the sweep generator to cover channel 8. Set the oscilloscope to maximum gain and use the minimum input signal which will produce a useable pattern on the oscilloscope. Excessive input can change oscillator injection during alignment and produce consequent misalignment even though the response as seen on the oscilloscope may look normal. Insert markers of channel 8 picture carrier and sound carrier, 181.25 mc. and 185.75 mc. Adjust C9, C11, C15 and C18 for approximately correct curve shape, frequency, and band width as shown in Figure 13. The correct adjustment of C18 is indicated by maximum amplitude of the curve midway between the markers. C15 tunes the r -f amplifier plate circuit and affects the frequency of the pass band most noticeably. C9 tunes the mixer grid circuit and affects the tilt of the curve most noticeably (assuming that C18 has been properly adjusted). C11 is the coupling adjustment and hence primarily affects the response band width. Set the receiver channel switch to channel 6. Adjust the signal generator to the channel 6 oscillator frequency 129 mc. Turn the fine tuning control 30 degrees clockwise from the center of its mechanical range. Adjust L5 for an audible beat with the signal generator as before. Set the sweep generator to channel 6. From the signal generator, insert channel 6 sound and picture carrier markers, 83.25 mc. and 87.75 mc. Adjust L48, L50 and ma for proper response as shown in Figure 13. L50 tunes the r -f amplifier plate circuit and primarily affects the frequency of the pass band. L53 tunes the r -f amplifier grid and is adjusted to give maximum amplitude of the curve between the markers. L48 affects the tilt of the curve but not quite the same as C9 adjustment. When the circuits are correctly adjusted and L48 is rocked on either side of its proper setting, the high frequency (sound carrier) end of the 9 curve appears to remain nearly fixed in amplitude while the picture carrier end tilts above or below this point. Turn off the sweep and signal generators. Connect the "VoltOhmyst" to the r -f unit test point TP1. Adjust the oscillator injection trimmer C8 for -3.5 volts or at maximum if -3.5 volts cannot be reached. This voltage should fall between -2.5 and -5.5 volts on all channels when the alignment of all circuits is completed. Turn the sweep generator and signal generator back on and recheck channel 6 response. Readjust L48, L50 and L53 if necessary. Set the receiver channel selector switch to channel 8 and readjust C2 for proper oscillator frequency, 227 mc. Set the sweep generator and signal generator to channel 8. Readjust C9, C11, C15 and C18 for correct curve shape, frequency and band width. Turn off the sweep and signal generators, switch back to channel 6 and check the oscillator injection voltage at TP1 if C9 was adjusted in the recheck of channel 8 response. If the initial setting of oscillator injection trimmer C8 was far off, it may be necessary to adjust the oscillator frequency and response on channel 8, adjust the oscillator injection on channel 6 and repeat the procedure several times before the proper setting is obtained. Turn off the sweep generator and switch the receiver to channel 13. Adjust the signal generator to the channel 13 oscillator frequency 257 mc. Set the fine tuning control 30 degrees clockwise from the center of its mechanical range. Adjust L46 to obtain an audible beat. Slightly overshoot the adjustment of L46 by turning the slug a little more in the same direction from the original setting, then reset the oscillator to proper frequency by adjusting C2 to again obtain the beat. Check the response of channels 7 through 13 by switching the receiver channel switch, sweep generator and marker oscillator to each of these channels and observing the response and oscillator injection obtained. See Figure 13 for typical response curves. It should be found that all these channels have the proper shaped response with the markers above 80% response. If the markers do not fall within this requirement, switch to channel 8 and readjust C9, C11, C15 and C18 as necessary. Turn off the sweep generator and check the channel 8 oscillator frequency. If C2 has to be readjusted for channel 8, the principle of overshooting the adjustment and then correcting by adjusting L46 should be followed in order to establish the L/C ratio for the desired oscillator tracking. Turn the receiver channel selector switch to channel 6. Adjust L5 for correct oscillator frequency, 129 mc. Turn the sweep generator on and to channel 6 and observe the response curve. If necessary readjust L48, L50 and L53. Switch the receiver, the sweep and signal generators to channel 2 and adjust T1 clockwise to a point where there is no change in the channel 2 response as T1 is turned. Switch the receiver through channel 6 down through channel 2 and check for normal response curve shapes and oscillator injection voltage. If excessive tilt in the same direction occurs on channels 2, 3 and 4, adjust C18 on channel 2 to overshoot the correction of this tilt, then switch to channel 6 and adjust L53 for maximum amplitude of curve between markers. This adjustment should produce "flat" response on the low channels if the other adjustments especially L48 are correct. Likewise check channels 7 through 13, stopping on 13 for the next step. With the receiver on channel 13, check the receiver oscillator frequency. Correct by adjustment of C2 if necessary. Adjust the oscillator to frequency on all channels by switching the receiver and the frequency standard to each channel and adjusting the appropriate oscillator trimmer to obtain the audible beat. It should be possible to adjust the oscillator to the correct frequency on all channels with the fine tuning control in the middle third of its range. When employing WR39 calibrators to adjust the receiver oscillator, tune the calibrator to one half the receiver oscillator frequency on channels 4 5 and 6 and to one-fourth the receiver oscillator frequency on channels 11, 12 and 13. 1 50 17T250DE, 17T261DE ALIGNMENT PROCEDURE Channel Number Picture Carrier Freq, Mc. Sound Carrier Freq. Mc. Receiver R -F Osc. Freq. Mc. Channel Oscillator Adjustment 2 55.25 59.75 101 Ll 3 61.25 65.75 107 L2 4 67.25 71.75 113 L3 5 77.25 81.75 1,23 L4 6 83.25 87.75 129 L5 7 175.25 179.75 221 L6 8 181.25 185.75 227 L7 9 187.25 191.75 233 L8 10 193.25 197.75 239 L9 11 199.25 203.75 245 L10 12 205.25 209.75 251 L11 13 211.25 215.75 257 Cl Remove the 39 ohm resistor from the link and reconnect the link to terminals "A" and "B" of T104. RATIO DETECTOR ALIGNMENT. - Set the signal generator at 4.5 mc. and connect it to the second sound i4 grid, pin 1 of V102. Set the generator for 30% 400 cycle modulation. As an alternate source of signal, the RCA WR39B or WR39C calibrator may be employed. If used, connect its output cable to the grid of the 4th pix i-f amplifier, pin 1 of V109. Set the frequency of the calibrator to 45.75 (pix carrier) and modulate with 4.5 mc. crystal. Also turn on the internal AM audio modulation. The 4.5 mc. signal will be picked off at T110A and amplified through the sound i-f amplifier. Connect the "VoltOhmyst" to the junction of 11110 and R150. Connect the oscilloscope to the junction of 11111 and C113. Tune the ratio detector primary, T102 top core for maximum DC output on the "VoltOhmyst." Adjust the signal level from the signal generator for 10 volts on the "VoltOhmyst" when finally peaked. This is approximately the operating level of the ratio detector for average signals. Connect the "VoltOhmyst" to the junction of R111 and C113. Tune the ratio detector secondary T102 bottom core for zero d -c on the "VoltOhmyst." Adjust R139 for minimum AM indication on the oscilloscope. Retune the T102 bottom core to obtain zero d -c on the "VoltOhmyst." Repeat the adjustment of T102 bottom core for zero d -c on the "VoltOhmyst" and R139 for minimum AM indication on the oscilloscope until both conditions are satisfied at the same settings of the adjustments. Final touches on these adjustments must be made with the input signal adjusted to produce 10 volts d -c on the "VoltOhmyst" at the junction of 11110 and R150. SOUND IT ALIGNMENT. - Connect the sweep generator to the first sound i-f amplifier grid, pin 1 of V101. Adjust the generator for a sweep width of 1 mc. at a center frequency of 4.5 mc. Insert a 4.5 mc. marker signal from the signal generator into the first sound i-f grid. Connect the oscilloscope in series with a 10,000 ohm resistor to terminal A of T101. Adjust T101 top and bottom cores for maximum gain and symmetry about the 4.5 mc. marker on the i-f response. The pattern obtained should be similar to that shown in Figure 14. The output level from the sweep should be set to produce approximately 2.0 volt peak -to -peak at terminal A of T101 when the final touches on the above adjustment are made. It is necessary that the sweep output voltage should not exceed the specified values otherwise the response curve will be broadened, permitting slight misadjustment to pass unnoticed and possibly causing distortion on weak signals. Connect the oscilloscope to the junction of R111 and C113 and check the linearity of the response. The pattern obtained should be similar to that shown in Figure 15. SOUND TAKE -OFF ALIGNMENT. - Connect the 4.5 mc. generator in series with a 1,000 ohm resistor to terminal "C" of T110. The input signal should be approximately 0.5 volts. Short the fourth pix i-f grid to ground, pin 1 V109, to prevent noise from masking the output indication. As an alternate source of signal the RCA WR39B or WR39C calibrator may be used. In such a case, disregard the above two paragraphs. Connect calibrator across link circuit, T104 A, B, and modulate 45.75 carrier with 4.5 mc. crystal. Connect the crystal diode probe of a "VoltOhmyst" to the plate of the video amplifier, pin 6 of V110 (pin 8 if 6AG7 used). Adjust the core of T110 for minimum output on the meter. Remove the short from pin 1 V109 to ground, if used. PICTURE I -F TRAP ADJUSTMENT. - Connect the i-f signal generator across the link circuit on terminals A and B of T104. Connect the "VoltOhmyst" to the junction of R193 and 11194. Obtain a 7.5 volt battery capable of withstanding appreciable current drain and connect the ends of a 1,000 ohm potentiometer across it. Connect the battery positive terminal to chassis and the potentiometer arm to the junction of R193 and 11194. Set the bias pot to produce approximately -1.0 volt of bias at the junction of R193 and R194. Connect the "VoltOhmyst" to pin 2 of V110 (pin 4 of 6AG7). Set the signal generator to each of the following frequencies and adjust the corresponding circuit for minimum d -c output at pin 2 of V110. Use sufficient signal input to produce 1.0 volt of d -c on the meter when the final adjustment is made. 39.25 mc. T104 top core 41.25 mc. 47.25 mc. T105 bottom core T106 bottom core PICTURE I -F TRANSFORMER ADJUSTMENTS. - Set the signal generator to each of the following frequencies and peak the specified adjustment for maximum indication on the "VoltOhmyst." During alignment, reduce the input signal if neces- sary in order to produce 1.0 volt of d -c at pin 2 of V110 with -1.0 volt of i-f bias at the junction of R193 and R194. 43.7 mc. 45.5 mc. 41.8 mc. T109 T108 T107 To align T105 and T106, connect the sweep generator to the first picture i-f grid, pin 1 of V106 through a 1,000 mmf ceramic capacitor. Shunt R136, R143 and terminals "A" and "F" of T109 with 330 ohm composition resistors. Set the i-f bias to -1.0 volt at the junction of R193 and R194. Connect the oscilloscope to pin 2 of V110 (pin 4 of 6AG7). Adjust T105 and T106 top cores for maximum gain and curve shape as shown in Figure 16. For final adjustments set the output of the sweep generator to produce 0.5 volts peak to -peak at the oscilloscope terminals. To align T1 and T104, connect the sweep generator to the mixer grid test point TP2. Use the shortest leads possible, with not more than one inch of unshielded lead at the end of the sweep cable. Set the channel selector switch to channel 4. Connect a 180 ohm composition resistor from terminal B of T105 to the junction of R131 and C131. Connect the oscilloscope diode probe to terminal B of T105 and to ground. Couple the signal generator loosely to the diode probe in order to obtain markers. C122 is variable and is provided as a band width adjust. ment. Preset C122 to minimum capacity. Adjust T1 top and T104 bottom for maximum gain at 43.5 mc. and with 45.75 mc. at 70% of maximum response. Adjust C122 until 41.25 mc. is at 85% response with respect to the low frequency shoulder at approximately 41.9 mc. as shown in Figure 17. Disconnect the diode probe, the 180 ohm and three 330 ohm resistors. SWEEP ALIGNMENT OF PIX I -F. - Connect the oscilloscope to pin 2 of V110 (pin 4 where V110 is a 6AG7). Adjust the bias potentiometer to obtain -6.0 volts of bias as measured by a "VoltOhmyst" at the junction of R193 and 11194. 10 ALIGNMENT PROCEDURE 1 5 1 17T250DE, 17T261DE Leave the sweep generator connected to the mixer grid test point TP2 with the shortest leads possible and with not more than one inch of unshielded lead at the end of the sweep cable. If these precautions are not observed; the receiver may be unstable and the response curves obtained may be unreliable. Adjust the output of the sweep generator to obtain 3.0 volts peak -to -peak on the oscilloscope. Couple the signal generator loosely to the grid of the first pix i-f amplifier. Adjust the output of the signal generator to produce small markers on the response curve. Retouch T108 and T109 to obtain the response shown in Figure 18. Do not adjust T107 unless absolutely necessary. If T107 is adjusted too low in frequency it will raise the level of the 41.25 mc. sound i-f carrier and may create interference in the picture. It will also cause poor adjacent channel picture rejection. If T107 is tuned too high in frequency, the level of the 41.25 mc. sound i-f carrier will be too low and may produce noisy sound in weak signal areas. Remove the oscilloscope, sweep and signal generator con- nections. Remove the bias box employed to provide bias for alignment. HORIZONTAL OSCILLATOR ADJUSTMENT. - Normally the adjustment of the horizontal oscillator is not considered to be a part of the alignment procedure, but since the oscillator waveform adjustment may require the use of an oscilloscope, it can not be done conveniently in the field. The waveform adjustment is made at the factory and normally should not require readjustment in the field. However, the waveform adjustment should be checked whenever the receiver is aligned or whenever the horizontal oscillator operation is improper. Horizontal Frequency Adjustment. -Tune in a station and sync the picture. If the picture cannot be synchronized with the horizontal hold control R197B, then adjust the T113 fre- quency core on the rear apron until the picture will syn- chronize. If the picture wave- form adjustment core (under the chassis) out of the coil several turns from its original position and readjust the T113 fre- quency core until the picture is synchronized. Examine the width and linearity of the picture. If picture width or linearity is incorrect, adjust the horizontal drive control C191B, the width control L106 and the linearity control L107 until the picture is correct. Horizontal Oscillator Waveform Adjustment.-The horizontal oscillator waveform may be adjusted by either of two methods. The method outlined in paragraph A below may be employed in the field when an oscilloscope is not available. The service shop method outlined in paragraph B below requires the use of an oscilloscope. A.-Turn the horizontal hold control completely clockwise. Place adjustment tools on both cores of T113 and be prepared to make simultaneous adjustments while watching the picture on the screen. First, turn the T113 frequency core (on the rear apron) until the picture falls out of sync and one diagonal black bar sloping down to the right appears on the screen. Then, turn the waveform adjustment core (under the chassis) into the coil while at the same time adjusting the frequency core so as to maintain three or four diagonal black bars on the screen. Continue this procedure until the oscillator begins to motorboat, then turn the waveform adjustment core out until the motorboating just stops. As a check, turn the T113 frequency core until the picture is synchronized then reverse the direction of rotation of the core until the picture begins to fall out of sync with the diagonal bars sloping down to the right. Continue to turn the frequency core in the same direction. No more than three or four bars should appear on the screen. Instead, the horizontal oscillator should begin to motorboat. Retouch the adjustment of the T113 waveform adjustment core if necessary until this condition is obtained. B.-Connect the low capacity probe of an oscilloscope to terminal C of T113. Turn the horizontal hold control onequarter turn from the clockwise position so that the picture is in sync. The pattern on the oscilloscope should be as shown in Figure 19. Adjust the waveform adjustment core of T113 until the two peaks are at the same height. During this adjustment, the picture must be kept in sync by readjusting the hold control if necessary. 11 This adjustment is very important for correct operation of the circuit. If the broad peak of the wave on the oscilloscope is lower than the sharp peak, the noise immunity becomes poorer, the stabilizing effect of the tuned circuit is reduced and drift of the oscillator becomes more serious. On the other hand, if the broad peak is higher than the sharp peak, the oscillator is overstabilized, the pull -in range becomes inadequate and the broad peak can cause double triggering of the oscillator when the hold control approaches the clockwise position. Remove the oscilloscope upon completion of this adjustment. Horizontal Locking Range Adjustment.-Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T113 frequency core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 3 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C191A slightly clockwise. If less than 2 bars are present, adjust C191A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 or 3 bars are present. Turn the horizontal hold control to the maximum clockwise position. Adjust the T113 frequency core so that the diagonal bar sloping down to the right appears on the screen and then reverse the direction of adjustment so that bar just moves off the screen leaving the picture in synchronization. SENSITIVITY CHECK.-A comparative sensitivity check can be made by operating the receiver on a weak signal from a television station and comparing the picture and sound ob- tained to that obtained on other receivers under the same conditions. This weak signal can be obtained by connecting the shop antenna to the receiver through a ladder type uator pad. atten- RESPONSE CURVES.-The response curves shown on page 14 are typical though some variations can be expected. The response curves are shown in the classical manner of presentation, that is with "response up" and low frequency to the left. The manner in which they will be seen in a given test set-up will depend upon the characteristics of the oscilloscope and the sweep generator. The curves may be seen inverted and/or switched from left to right depending on the deflection polarity of the oscilloscope and the phasing of the sweep generator. NOTES ON R -F UNIT ALIGNMENT.-Because of the frequency spectrum involved and the nature of the device, many of the r -f unit leads and components are critical in some respects. Even the power supply leads form loops which couple to the tuned circuits, and if resonant at any of the frequencies involved in the performance of the tuner; may cause serious departures from the desired characteristics. In the design of the receiver these undesirable resonant loops have been shifted far enough away in frequency to allow reasonable latitude in their components and physical arrangement without being troublesome. When the r-i unit is aligned in the receiver, no trouble from resonant loops should be experienced. However, if the unit is aligned in a jig separate from the receiver, attention should be paid to insure that unwanted resonances do not exist which might present a faulty representation of r -f unit alignment. A resonant circuit exists between the r -f tuner chassis and the outer shield box, which couples into the antenna and plate circuits. The frequency of this resonance depends r -f on the physical structure of the shield box, and the capacitance between the tuner chassis and the front plate. This resonance is controlled in the design by using insulating washers of proper thickness in the front plate to tuner chassis mounting. The performance of the tuner will be impaired if the proper washers are not used. Obviously then, if the r -f unit is removed for service, the washers should be replaced in the correct order when the unit is replaced. 1 52 17T250DE, 17T261DE ALIGNMENT PROCEDURE THE DETAILED ALIGNMENT PROCEDURE BEGINNING ON PAGE 8 SHOULD BE READ BEFORE ALIGNMENT BY USE OF THE TABLE IS ATTEMPTED CONNECT SIGNAL Step SIGNAL GEN. CONNECT SWEEP CONNECT HET. SWEEP GEN. HETERODYNE METER MISCELLANEOUS CONNECT CONNECTIONS No. GENERATOR FREQ. GENERATOR FREQ. FREQ. METER FREQ. OSCILLOSCOPE AND TO MC. TO MC. TO MC. TO INSTRUCTIONS ADJUST REFER TO ANTENNA MATCHING UNIT ALIGNMENT 1 Do not adjust this unit unless fairly certain that it requires adjustment. Disconnect lead from 1.58 to S5. Connect output of matching unit through 1000 mmf. to pin 1 of VI07. Replace cover on matching unit. Remove V106 from socket. Connect bias box to junction of R143 and R144 and set to produce -6 volts. 2 Antennatermi- 45.75 mc. Not used nals 30% mod. 3 " 41.25 mc. " 30% mod. - Not used - " 4 Antennaterminals loosely Ananltsentnhartoeurmghi- 45 to 54 mc. " pad - TP102. Scope - L59 for min. audio Fig. 7 - gain to max. " - on scope L60 for min. audio Fig. 7 - on scope Scope a :tat probe to gnd. Connect 300 ohms from L58 to gnd. tLa61inanrdesLp6o2ntsoeoobf- Fig. 7 Fig. 11 Fig. 12 Fig. 12 R -F UNIT ALIGNMENT 5 If unit Set T1 is completely out of adjustment, max. counterclockwise. Set C11 preset all adjustments to center of range with 1/4 turn from max. clockwise. Disconnect Ink following exceptions. Set C18 from T104 and terminate with so 39 that head is 3/s" ohms. Short r -f uanbiot vpeowcehrastseirs-. - - minal 3 to ground. Set fine tuning 30 degrees clockwise from mechanical center of its range for all oscillator adjustments. 6 Grid, pin 7 of 43.5 mc. Not used V2through 1500 30% mod. Not used TP1. Gain to maximum Set r -f unit on channel 2 1.65 for min. indication on scope Fig. 7 Fig. 10 mmf. 7 Not used 8 Antennatermi- nals loosely 9 Not used 10 Antennatermi- nal. loosely 11 Not used - 181.25 and -185.75 83.25 and -87.75 Not used - Loosely to r -f unit oscillator Ananbtesntnhartoerumgih- Channel Not used 8 pad Not used - Loosely to r -f unit oscillator Ananltsentnhartoeurmgih- Channel Not used 6 pad Not used - Not used 227 me. - 129 mc. - Not used R -F unit on chart- CI for beat on het. Fig. 7 nel 8 freq. meter TP1. Gain to " C9, C11, C15 and Fig. 7 maximum C18 for response Fig. 13 shown in Fig. 13 Not used R -F unit on chart- 1.5 for beat on het. Fig. 8 nel 6 freq. meter TP1. Gain to " L48, L50 and L53 Fig. 7 maximum for response shown Fig. 13 in Fig. 13 Not used On channe16. Con- C8 for -3.5 volts on Fig. 7 nett "VoltOhmyst" meter 12 Antennaterminals loosely 13 Not used 14 Antenna termi- nals loosely 83.25 and -87.75 181.25 and 185.75 Ananltsentnhartoeurmgih- Channel 6 Not used pad Not used - Loosely to r -f unit oscillator Ananltesntnhartoerumgih- Channel 8 Not used pad - 227 mc. - to TP1 TP1. Gain to R -F unit on than- maximum nel 6 Not used R -F unit on chartnel 8 TP1. Gain to " maximum Check response. Readjust L48, L50 and L53 if necessary CI for beat on het. freq. meter Check response ad- jaunsdt CC91,8 iCf 11n,ecCe1s5- Fig. 7 Fig. 13 Fig. 7 Fig. 7 sary - - 15 If C9 was readjusted instep 14, repeatstep 11, step 13 and step 14 untilthe conditions specified in each step are fulfilled without additional adjustments. 16 Not used Not used Loosely to r- f 257 mc. Not used unit oscillator Rec. on channel 13 L46 for beat on het. freq. meter. Over- Fig. 7 sahnodoat dLj4u6stsCliglhftolyr 17 Antennaterminals loosely 211.25 215.75 Ananbtesntnhartoeurmghi- Channel Not used 13 pad - beat. TP1. Gain to Rec. on channel 13 Check to see that Fig. 13 maximum "VoltOhmyst" on TP1 arensdpo-n3s.0e ivsoclotrsreocft osc. injection is present 18 " 205.25 . ., Channel Not used - " Rec. on channel 12 " Fig. 13 19 " 209.75 199.25 12 " Channel " - " Rec. on channel 11 " Fig. 13 20 " 203.75 193.25 11 " Channel " - " Rec. on channel 10 " Fig. 13 197.75 21 " 187.2.5 10 " Channel " - " Rec. on channel 9 " Fig. 13 22 " 191.75 181.25 9 " Channel " - " Rec. on channel 8 " Fig. 13 23 " 185.75 175.25 8 " Channel " - " Rec. on channel 7 " Fig. 13 179.75 7 24 If the response of any channel (steps 17 through 23) is below 80% at either marker, adjust C9, C11 C15 and C18 as necessary to pull response up on the low channel yet maintain correct response on channel 8. 25 Repeat step 13. If the oscillator is off frequency overshoot the adjustment of CI and correct by adjusting L46. 26 27 28 - - Repeat steps 16 through 25 until all adjustments are obtained. Not used Not used Loosely to r -f unit oscillator Antenna terminals loosely 83.25 87.75 Ananltsentnhartoeurmgih- Channel Not used 6 pad 129 mc. - Not used Rec. on channel 6 I.5 for beat on het. Fig. 7 freq. meter TP1. Gain to Rec. on channel 6 Check to see that Fig. 7 maximum "VoltOhmyst" on TP1 arensdpo-n3s.0e ivsoclotrsreocft Fig. 13 osc. injection is present 29 " 77.25 " Channel " - " Rec. on channel 5 " Fig. 13 30 " 81.75 67.25 5 '' Channel .. - " Rec. on channel 4 Fig. 13 31 " 71.75 61.25 4 " Channel " - " Rec. on channel 3 " Fig. 13 65.75 3 12 1 5 3 ALIGNMENT PROCEDURE 17T250DE, 17T261DE CONNECT Step SIGNAL No. GENERATOR TO 32 " SIGNAL GEN. FREQ. MC. 55.25 59.75 CONNECT SWEEP GENERATOR TO " SWEEP CONNECT GEN. HETERODYNE FREQ. FREQ. METER MC. TO Channel .. 2 HET. MISCELLANEOUS METER CONNECT CONNECTIONS FREQ. OSCILLOSCOPE AND MC. TO INSTRUCTIONS - " Rec. on channel 2 ADJUST " REFER TO Fig. 13 33 34 35 36 37 38 39 40 41 42 43 44 45 46 If excessive tilt in the same direction occurs on channels 2, 3 and 4. adjust C18 on channel 2 to overshoot the correction of this nel 6 and adjust LS3 for max. amplitude of response between carrier markers. tilt then switch to chan- Check r -f response and oscillator injection on channels 7 through 13 steps 23 back up through step 17 stopping on channel 13 for the next step. - - Not used Not used Loosely coupled 257 mc. to r -f oscillator TP 1 . Gain to maximum Roc. on channel 13 Cl for beat on het. freq. meter Fig. 7 - - " " " 251 mc. " Rec. on channel 12 Ll I as above Fig. 7 - - " " 245 mc. " Rec. on channel 11 L10 as above Fig. 7 - - " " " 239 mc. Rec. on channel 10 119 as above Fig. 7 --- --- ".. " " 233 mc. Rec. on channel 9 L8 as above Fig. 7 " " " 227 mc. " Rec. on channel 8 La as above Fig. 7 " " " 221 mc. " Rec. on channel 7 L6 as above Fig. 7 - - ' " " 129 mc. " Rec. on channel 6 L5 as above Fig. 7 --- --- "" ' " 123 mc. Rec. on channel 5 L4 as above Fig. 7 " " " 113 mc. " Rec. on channel 4 L3 as above Fig. 7 " " " 107 mc. " Rec. on channel 3 L2 as above Fig. 7 - - " " " 101 mc. " Rec. on channel 2 LI as above Fig. 7 47 Repeat steps 35 through 46 as a check. On completion, remove 39 ohm resistor and reconnect link to terminals A and B of T104. RATIO DETECTOR, SOUND I -F AND SOUND TAKE -OFF ALIGNMENT 48 Grid 2nd Snd. 4.5 mc. Not used L -F (pin 1, V102) 400 cy. or WR39B or C mod. or connect to grid 45.75 mc. 4th pix I -F (pin mod. by 1, V109.) 4.S me. and 400 cy. 49 - Not used - " 50 Sig. Gen. to let Snd. I -F 4.5 mc. 1st Sound grid (pin I -F 1, 4.5 mc. V101) - Across speaker voice coil. Volume control set for max. vol- ume. j"uVnoclttiOohnmoyfsRt"11t0o and R1 1 4 . Set Cpa2c2i6tyf.oSremt isnig. cnaa-l T102 top core for mTfo1ar0xm.2dibn-oc.ttaoounmdmioceoteorrne. the oscilloscope. Fig. 9 Fig. 10 gen. to give -10 V on meter. - .. "VoltOhmyst" to 'unction R112 and Fig. 9 C,I13. If the meter reads more than ± 1.5 Fig. 10 volts, adjust C226 for zero on the meter and readjust T102 (bot.) for min. output on scope. Repeat steps 48 and 49 until - all conditions are satisfied. In series with 10,000 ohms to terminal A, of dSuwceeedptooutppruotvirdee- 2 v p -p on scope. T101 top and bot. caonrdessfyomr mmaext.rgyaaint Fig. 9 Fig. 10 Fig. 14 T101. 4.5 mc. 51 52 Sig. Gen. in se- ries with 1000 ' Not used ohms to T110 -C or WR39 across 53 54 "" T104 A and B. Not used - Not used Sig. Gen. across 39.25 mc. T104 A and B 55 41.25 mc. 56 " 47.25 mc. 57 " 43.7 mc. " - " - Junction of R112 Check for symmetrical response wave and C113 form (positive and negative). "VoltOhmyst" xtal A d j ust T 1 10 for Vpr1o1b0e. Itfosigp.ingen8., minimum reading on "VoltOhmyst". Fig. 15 Fig. 9 is used short pin 1, V109 to ground. PICTURE I -F AND TRAP ADJUSTMENT - Not used - Not used - " - .. -- " " " --- " " " RC1o4nn4eacnt dbitaos bgorixdt.oAjudnjucstitotnoogfiRve14-31.a0nvd on "VoltOhmyst" at TP101. "VoltOhmyst" to tToPg10iv2.eG-e1n..0ovutoplutt gTiv1e04mtoinp. meter. dco-creonto Fig. 9 d -c. " T105 bot. for min. Fig. 10 " T106 bot. for min. Fig. 10 Sig. Gen. outputto T109 for max. Fig. 7 give -1.0 V d -c at 58 " 45.5 mc. " - " - 59 " 41.8 me. " - " - ' TP102. " " " T108 for max. T107 for max. Fig. 9 Fig. 9 60 F(pirisnt pIi,xVi-1f 0gr6id) loosely. Various See Fig. 16 First pix i-f grid pthinro1u,gVh 1 0 6 1000 40 to 48 me. ' mmf. - To test point TP102 aSnhduntteRrm14i1n,aRls14A9 and F of T109 with Adjust T105 and Tm1a0x6. gtoapincoarneds rfeo-r Fig. 9 Fig. 16 330 ohms. 0.5 v p -p sponse shown in on scope. Fig. 16. 61 C o n n e c t e cl Various Mixer grid test 40 to - loosely to diode probe. See Fig. 17 point TP2 with 48 me. short lead. - Scope diode probe to T105 -B and to gnd. Rec. on chap. 4. Connect 180 ohms from T105 -B to Set C221 to min. Adjust T1 top and T104 bot. for max. Fig. 9 Fig. 17 junction R135 and gain at 43.5 mc. C132. Upon corn- and 45.75 me. at pscleotpioenadnidscsohnunnetc-t 70 %. Adjust C221 until 41.25 mc. is at ing resistors. 80%. 62 Con n e c t e d loosely to grid Various See of 1st pix i-f. Fig. 18 - Connect scope to TP102. "TVPo1lt0O1h.mSyestt"biatos boswonxethefoeprmo-6ue.tt0epruv.toSltetost produce 3.0 volts Retouch T108 and T109 to obtain re sponse shown in jFaubisgts.o1l8Tu.1tD0e7loynnoutncaleedss-s- Fig. 18 p-p on scope. nary. 13 ALIGNMENT DATA 1 54 17T250DE, 17T261DE T1 C9 MIXER MIXER TRANS. GRID TP2 TEST POINT C15 R -F PLATE CIS LSO LGI L62 R -F F -A4 GRID TRAP C2. FINE TUNING L 46 LI THROUGH L11 INDIVIDUAL CM NNEL OSC. ADJUSTMENTS LEO 41.25 MC. TRAP L 59 45.75 MC. I -F TRAP CI I BANDWIDTH MS 1163 JNETC TX AC08.1°u5STCMIME OTHER SIDE OF UNIT s* L 4 8 CHAN . G MIXER GRID L S3 CHAN.P R -F GRID L 50 CHAN. 6 R -F PLATE Figure 7-RF Unit Adjustments PAD FOR SO XL COAX .1",Y PAD FOR PAD FOR 3004. BAL. IN PUT 4711 3004_ BALANCED OUTPUT 300.11. BALANCED OUTPUT 474 M51164 Figure 11 -Sweep Attenuator Pads SMOULDER AT 52 MC. 60 MC. C 53 MC. 100'7. RESPONSE CV123 50 MC. AT 60% ± 75% RESPONSE POINT Figure 12 -Antenna Matching Unit Response P CHk4. 2 L46 FOR TRACKING ON C-H5AN. 4 L4 CHAN. 5 L5 CHAN.6 L CHAN. 7 Figure 8 -R -F Oscillator Adjustments RI. WORT TIOS- TIO7 tr::: A CONT. - RATIO - Sif'4,,,, 4TH MX 3RDPIX. 5TH. PIX. - I.F TR - I -F TR. DET. TR. I -F TR. 45.5 MC 415 MC. TIO2 1 i 4.5MC RT 0 T0IOi> TIO9 MI 6.4 1 '(C1)14 i (-.e., 311t11,....r Is Tw X ,,,,,. 271aPIX I -F T . GRID TR. COMTROL 5tllC TOR TMf Sal OS VOL OVTLI e(rl 15T PIX. I -F GRID TR.--(T.241 9221C Figure 9 -Top Chassis Adjustments NO. PIE. I -F RIO TRAM RATIO DET. TRA N cv 124 Figure 13 -R -F Response 4.5 MC CV 11.5 Figure 14 Sound I -F Response 41.9 MC'" 41.25 MC:, 65% 5 mC Figure 15 Ratio Det. Response 42.25 ""45.75 MC 70% Figure 16 T105 and T106 Response -.- 42.5 MC 45 MC 85% 45.75 MC. 50% S CV 124-1 Figure 17 T1 and T104 Response 45.5 MC 5% Figure 18 Over-all I -F Response Figure 10 -Bottom Chassis Adjustments INCORRECT Figure 19 -Horizon al Oscillator Waveforms 14 155 17T250DE, 17T261DE TEST PATTERN PHOTOGRAPHS Figure 20-Normal Picture Figure 21-Focus Magnet and Ion Trap Magnet Misadjusted Figure 22-Horizontal Linearity Control Misadjusted (Picture Cramped in Middle) 4-44* Figure 23-Width Control Misadjusted Figure 24-Horizontal Drive Control Misadjusted Figure 25-Transients 340 -4 - Figure 26-Test Pattern Show- ing Out of Sync Condition When Horizontal Hold Control Is in a Counter -clockwise PositionJust Before Pulling Into Sync 4-44* Figure 27-Test Pattern Showing Out of Sync Condition When Horizontal Hold Control Is at the Maximum Clockwise Posi- tion *00-0. 15 156 17T250DE, 17T261DE SERVICE SUGGESTIONS Following is a list of symptoms of possible failures and an indication of some of the possible faults: NO RASTER ON KINESCOPE: (1) Incorrect adjustment of ion trap magnet. Magnet reversed either front to back or top to bottom. (2) V116 or V117 inoperative. Check waveforms on grids and plates. (3) No high voltage-if horizontal deflection is operating as evidenced by the correct waveform on terminal 1 of high voltage transformer, the trouble can be isolated to the 1B3GT circuit. Either the T114 high voltage winding is open, the 1B3GT tube is defective or its filament circuit is open. (4) V110 circuit inoperative-Refer to schematic and waveform chart. (5) Damper tube (V119) inoperative. (6) Defective kinescope. (7) R216 open. (8) No receiver plate voltage-filter capacitor shorted-or filter choke open. NO VERTICAL DEFLECTION: (1) V114B or V115 inoperative. Check voltage and waveforms on grids and plates. (2) T111 open. (3) Vertical deflection coils open. SMALL RASTER: (1) Low Plus B or low line voltage. (2) V117 defective. POOR VERTICAL LINEARITY: (1) If adjustments cannot correct, change V115. (2) Vertical output transformer Till defective. (3) V114B defective-check voltage and waveforms on grid and plate. (4) C176, C180, C181, C178, C177 or C182 defective. (5) Low plate voltage-check rectifiers and capacitors in sup- ply circuits. (6) If height is insufficient, try changing V114. POOR HORIZONTAL LINEARITY: (1) If adjustments do not correct, change V117, or V119. (2) T114 or L107 defective. (3) C205 or C206 defective. WRINKLES ON SIDE OF RASTER: (1) C208 defective. (2) Defective yoke. TRAPEZOIDAL OR NON SYMMETRICAL RASTER: (1) Improper adjustment of centering of focus magnet or ion trap magnet. (2) Defective yoke. RASTER AND SIGNAL ON KINESCOPE BUT NO SOUND: (1) T110 defective. (2) Sound i-f, ratio detector or audio amplifier inoperativecheck V101, V102, V103 and their socket voltages. (3) Audio system defective. (4) Speaker defective. SIGNAL AT KINESCOPE GRID BUT NO SYNC: (1) AGC control R181 misadjusted. (2) V111 inoperative. Check voltage and waveforms at its grid and plate. SIGNAL ON KINESCOPE GRID BUT NO VERTICAL SYNC: (1) Check V114B and associated circuit. (2) Integrating network inoperative- Check. (3) V113 or V114A defective or associated circuit defective. (4) Gas current, grid emission or grid cathode leakage in V114. Replace. SIGNAL ON KINESCOPE GRID BUT NO HORIZONTAL SYNC: (1) T113 misadjusted-readjust as instructed on page 11. (2) V112 or V113 inoperative-check socket voltages and waveforms. (3) T113 defective. (4) C163, C191A, C190, C194, C195, C197, C196, C198 or C199 defective. (5) If horizontal speed is completely off and cannot be adjusted check R226, R227, R197B, R228, R229, R230 and R232. SOUND AND RASTER BUT NO PICTURE OR SYNC: (1) Picture, detector or video amplifier defective-check CR101 and V110-check socket voltages. (2) Bad contact to kinescope cathode. PICTURE STABLE BUT POOR RESOLUTION: (1) CR101 or V110 defective. (2) Peaking coils defective-check resistance. (3) Make sure that the focus control operates on both sides of proper focus. (4) R -F and I -F circuits misaligned. PICTURE SMEAR: (1) R -F or I -F circuits misaligned. (2) Open peaking coil. (3) This trouble can originate at the transmitter-check on another station. PICTURE OUT OF SYNC HORIZONTALLY: (1) T113 incorrectly tuned. (2) R226, R227 or R197B defective. PICTURE JITTER: (1) AGC control R181 misadjusted. (2) If regular sections at the left picture are displaced change V117. 16 SERVICE SUGGESTIONS 1 57 17T250DE, 17T261DE (3) Vertical instability may be due to loose connections or noise. (4) Horizontal instability may be due to unstable transmitted sync. RASTER BUT NO SOUND, PICTURE OR SYNC: (1) Defective antenna or transmission line. (2) R -F oscillator off frequency. (3) R -T. unit inoperative-check VI, V2. DARK VERTICAL LINE ON LEFT OF PICTURE: (1) Reduce horizontal drive and readjust width and horizontal linearity. (2) Replace V117. LIGHT VERTICAL LINE ON LEFT OF PICTURE: (1) V119 defective. PICTURE I -F RESPONSE.-At times it may be desirable to observe the individual i-f stage response. This can be achieved by the following method: For T107, T108 or T109, shunt all i-f transformers with a 330 ohm carbon resistor except the one whose response is to be observed. Connect a wide band sweep generator to the second pix i-f grid and adjust it to sweep from 38 mc. to 48 mc. Connect the oscilloscope to test point TP102 and observe the overall response. The response obtained will be essentially that of the unshunted stage. To see the response of transformers T1, T104 and T105, T106, follow the instructions given on page 10. Figures 28 through 36 show the response of the various stages obtained in the above manner. The curves shown are typical although some variation between receivers can be expected. Relative stage gain is not shown. RESPONSE PHOTOGRAPHS Taken from RCA WO58A Oscilloscope Figure 28-Overall Pix I -F Response Figure 29-Response of T1 -T104 Pix I -F Transformers Figure 30-Response of T105 -T106 Pix I -F Transformer Figure 31-Response of T107 Pix I -F Transformer Figure 32-Response of T108 Pix I -F Coil Figure 33-Response of T109 Pix Coil Figure 34-Video Response at Average Contrast Figure 35-Video Response (100 KC Square Wave) 17 Figure 36-Video Response (60 Cycle Square Wave) 1 58 17T250DE, 17T261DE eter! WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Grid of Video Amplifier (Pin 2 of V110) (6CL6) (Pin 4 of V110) (6AG7) Figure 37-Vertical (Oscilloscope Synced to 1/2 of Vertical Sweep Rate) (6 Volts PP) 4 -4001 - Figure 38-Horizontal (Oscilloscope Synced to lh of Horizontal Sweep Rate) (6 Volts PP) 4.140-4. Plate of Video Amplifier (Pin 6 of V110) (6CL6) (Pin 8 of VI10) (6AG7) Voltage depends on picture Figure 39-Vertical (105 Volts PP) Figure 40-Horizontal (105 Volts PP) -1000-0- low CV 135E Grid of Sync Separator (Pin 4 of V113) (6SN7) Voltage depends on picture 4 - Figure 41-Vertical (30 Volts PP) Figure 42-Horizontal (30 Volts PP) 4.1010-9. Plate of Sync Separator (Pin 5 of V113) (651V7) Voltage depends on picture Figure 43-Vertical (33 Volts PP) Figure 44-Horizontal (8 Volts' PP) CV136 Cv136 C Grid of Vertical Sync Amp. (Pin 4 of V114A) (6SN7) Figure 45-Vertical (12 Volts PP) Figure 46-Horizontal (5 Volts PP) 18 WAVEFORM PHOTOGRAPHS Taken from RCA W059A Oscilloscope SIONSIralswisernallaars CV 136 E Plate of Vertical Sync Amp. (Pin 5 of V114A) (6SN7) Figure 47-Vertical (27 Volts PP) 4-.114114 - Figure 48-Horizontal (16 Volts PP) 4100.-+ Figure 49-Grid of Vertical Sweep Osc. (Pin 1 of V1148) (6SN7) (25 Volts PP) 4-40* Figure 50-Plate of Vertical Sweep Osc. (Pin 2 of V1148) (30 Volts PP) -00-* Figure 51-Grid of Vertical Sweep Output (Pin 1 of V115) (6AQ5) (35 Volts PP) 4-40. Figure 52-Plate of Vertical Sweep Output (Pin 5 of V115) (6AQ5) (800 Volts PP) 159 17T250DE, 17T261DE Cathode of Sync Separator (Pin 3 of V113) (6SN7) Figure 53-Vertical (11 Volts PP) Figure 54-Horizontal (6 Volts PP) 4044.-o. ti CV 138A Grid of Sync Separator (Pin 1 of V113) (6SN7) Figure 55-Vertical (40 Volts PP) Figure 56-Horizontal (40 Volts PP) 19 160 17T250DE, 17T261DE WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope - CV138C Plate of Sync Separator (Pin 2 of V113) Figure 57-Vertical (15 Volts PP) 4-.11104. Figure 58-Horizontal (15 Volts PP) iprismswissmsaiffref 2V 1ee Grid of Hor Sync Amp (Pin 4 of V112) (6SN7) Figure 59-Vertical (15 Volts PP, Figure 60-Horizontal (15 Volts PP) Plate of Hor Sync Amp (Pin 5 of V112) (6SN7) Figure 61-Vertical (70 Volts PP) Figure 62-Horizontal (70 Volts PP) Grid of Hor Sync Amp (Pin 1 of V112) (6SN7) Figure 63-Vertical (65 Volts PP) Figure 64-Horizontal (65 Volts PP) 40 -4 - CV 13`,E Cathode of Hor Sync Amp (Pin 3 of V112) (6SN7) Figure 65-Vertical (18 Volts PP) Figure 66-Horizontal (18 Volts PP) i0100-4. 20 CV139 D WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Figure 67-Grid of Horizontal Oscillator Control (22 Volts PP) (Pin 1 of V116) (6SN7GT) 4 -444 - Figure 68-Cathode of Horizontal Oscillator Control (1.3 Volts PP) (Pin 3 of V116) (6SN7GT) 161 17T250DE, 17T261DE Figure 69-Grid of Horizontal Oscillator (390 Volts PP) (Pin 4 of V116) (6SN7GT) Figure 70-Plate of Horizontal Oscillator (140 Volts PP) (Pin 5 of V116) (6SN7GT) 4400 -0 - Figure 71-Terminal "C" of T114 (120 Volts PP) 4-414* Figure 72-Grid of Horizontal Output Tube (95 Volts PP) (Pin 5 of V117) (6BQ6) Figure 73-Platee of Horizontal Output (Approx. 4000 Volts PP) (Measured Through a Capacity Voltage Divider Connected from Top Cap of V117 to Ground) 4-4401r Figure 74-Cathode of Damper (2300 Volts PP) (Pin 3 of V119) (6W4GT) Figure 75-Plate of Damper (180 Volts PP) (Pin 5 of V119) (6W4GT) 4-44* Figure 76-Plate of AGC Amplifier (Pin 5 of V111) (6CB6) (600 Volts PP) 21 CV 140 F Cy 141D 162 17T250DE, 17T261DE VOLTAGE CHART The following measurements represent two sets of conditions. In the first condition, a 5000 microvolt test pattern signal was fed into the receiver, the picture synced and the AGC control properly adjusted. The second condition was obtained by removing the antenna leads and short circuiting the receiver antenna terminals. Voltages shown are read with a type WV97A senior -VoltOhmyst- between the indicated terminal and chassis ground and with the receiver operating on 117 volts, 60 cycles, a -c. Tube Tube No. Type Function V1 6X8 Mixer R -F V1 6X8 Oscillator R -F V2 6BQ7 Amplifier R -F V2 6BQ7 Amplifier V101 1st Sound 6AU6 I -F Amp. 2d Sound V102 6AU6 I -F Amp. Ratio V103 6AL5 Detector 1st Audio V104 6AV6 Amplifier V105 Audio 6AQ5 Output V106 1st Pix. I -F 6AU6 Amplifier V107 2nd Pix. I -F 6CB6 Amplifier V108 3d Pix. I -F 6CB6 Amplifier V109 4th Pix. I -F 6CB6 Amplifier 6CL6 Video V110 '6AG7 Amplifier V111 AGC 6CB6 Amplifier Operating Condition 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal E. Plate Pin No: Volts - 9 145 to 9 150 E. Screen Pin No. Volts - 8 145 to 8 150 - - 88 to 3 108 - - 133 to 6 138 - - 1 260 5 140 6 152 5 112 6 122 5 258 6 58 5 255 6 55 7 - - 7 0.5 - - 7 95 - - 7 95 5 263 6 273 5 262 6 272 5 242 6 279 5 140 6 135 5 240 6 267 5 131 6 110 5 127 6 112 5 121 6 110 5 194 6 159 5 198 6 150 6 128 8 192 6 72 8 142 5 -51 6 278 5 0.9 6 282 E. Cathode Pin No. Volts 6 0 6 0 6 0 6 0 - 8 8 1.1 - 3 133 to 3 138 E. Grid Pin No. Volts - 7 -2.8 to 7 -3.5 - 2 -3.0 to 2 -5.1 - 7 - 7 - 2 - 2 Notes on Measurements Depending on channel Depending on channel Depending on channel Depending on channel 7 0.3 7 0.8 1 -3.8 1 -0.2 7 0.19 1 -21 7 0.22 'Unreliable measuring point. 1 '-2.5 Voltage depends on noise. - - 1 16.8 7.5 kc deviation at 400 cycles - - 1 '9.35 *Unreliable measuring point. Voltage depends on noise. 2 0 1 -0.6 At min. volume 2 0 1 -0.6 At min. volume 2 18.2 7 0 At min. volume 2 18.2 7 0 At min. volume 7 0.06 7 1.03 1 -7.6 1 0 Unreliable measuring point. Make measurement at T104 -D. 2 0.2 1 -7.6 2 0.9 1 0 2 0.92 1 0 2 0.96 1 0 2 2.4 1 0 2 2.2 1 1.12 1 1.48 2 116 2 100 1 0 2 -3.5 2 t-0.9 1 108 1 54 'See Figure 79 for socket connections tDepends on noise AGC control set for normal operation AGC control set for normal operation 22 VOLTAGE CHART ("3 17T250DE, 17T261DE gTtthhrhoeeeuprnfeiodccltealuoinrvwedeirswnyaginnthcmteetendhaneasanruedtrceeertmhmiveeiennArtasoGlpsrCe.epVrcaroeotisnlntetgarngotoelntswp1rsoo1hp7soeewvrtslonylotaasfr,dec6jour0nesdctaeydidtci.woleTnistsh,h.eaIasn-ecttyc.hopenefdWircsVot nc9do7inAtidoisntieownnia,osar o-5Vb0to0a0litnOmedhicmbryoyvsrteo-mltboteevtswitnepgeantthtetehranensitniegdnnincaaal tlweedaadstsefreamdndiinnsatholoatrhntedcrierccchueaiitvsisenirgs, Tube No. Tube Type Function Operating Condition E. Plate Pin No. Volts Hor. Sync. V112 6SN7GT Amplifier 5300 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal Hor. Sync. V113 6SN7GT Separator 5000 Mu. V. Signal No Signal Vert. Sync. V113 6SN7GT Separator 5000 Mu. V. Signal No Signal Vert. Sync. V114A 6SN7GT Amplifier 5000 Mu. V. Signal Vertical V114B 6SN7GT Oscillator No Signal 5000 Mu. V. Signal V115 6AQ5 Vertical Output No Signal 5000 Mu. V. No Signal Horizontal 5000 Mu. V. V116 6SN7GT Osc. Control Signal No Signal 5000 Mu. V. Signal Horizontal V116 6SN7GT Oscillator 5000 Mu. V. Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal 5000 Mu. V. Signal Horizontal V117 6BQ6GT Output 5000 Mu. V. Signal No Signal 1B3GT H. V. V118 /8016 Rectifier 5000 Mu. V. Signal No Signal V119 6W4GT Damper 5000 Mu. V. Signal No Signal V120 17QP4 Kinescope 5000 Mu. V. Signal No Signal 2 162 2 152 5 84 5 98 2 290 2 285 5 115 5 59 5 45 5 43 2 72 2 70 5 270 5 267 2 237 2 228 2 104 2 246 5 200 5 197 5 193 5 198 Cap Cap Cap Cap 5 287 5 280 Cone 15,150 Cone 15,300 E. Screen Pin No. Volts ------------- E. Cathode Pin No. Volts 3 1.4 3 0.52 6 0 6 0 3 95 3 56 6 0 6 0 6 0 6 0 3 0 3 0 6 290 2 27 6 285 -- -- -- -- -- -- -- -- 2 26 3 -10 3 -18 3 -36.3 3 -11.5 6 0 6 0 6 0 6 0 4 190 8 19.2 4 190 8 19.2 - - 2 & 7 15,150 - - 2 & 7 15,300 -- 3 -- 3 10 568 11 178 10 560 11 151 E. Grid Pin No. Volta Notes on Measurements 1 -40 'Unreliable measurement 1 -24 point. Voltage depends on ncise. 4 -1.38 4 '1.08 'Voltage depends on noise. 1 50 Unreliable measuremen' 1 38 points. Voltage depends on noise. 4 -58 4 -11 4 0.03 4 0 1 -15.3 Depends on setting of Vert. hold control. Voltages shown are synced pix adjustment. 1 -15 1 0 1 0 1 -28.5 1 -29.5 1 -44 1 -26 4 -75 4 -78 4 -93 4 -74 5 -16 5 -15.3 ----- Hor. hold counter -clockwise Hor. hold clockwise Hor. hold counter -clockwise Hor. hold clockwise High Voltage Pulse Present High Voltage Pulse Present *High Voltage Pulse Present 2 117 2 101 At average Brightness 23 1 64 17T250DE, 17T261DE 11561.10.4 t 1-41 t R -F UNIT WIRING DIAGRAM SWITCH CONNECTIONS AS SHOWN ARE VIEWED FROM DIRECTION OF ARROWS. SIC- REAR ; L. L54 rx 6 L55 L -171 ti L42 US RM SID -FRONT C3s io SIC -REAR SIC -FRONT SIB -REAR SIB -FRONT SIA -FRONT Le [y L2 7 N J -311111111 BRN Figure 77-RF Unit Wiring Diagram C 5 j-= L63 C21 D-413534- 0 CRITICAL LEAD DRESS 1. Keep all wiring in the pix i-f, sound i-f and video circuits as short as possible. 2. Keep the leads on C110, C111, C112, R108, R139, R150, R111, R109, R110 and R233 as short and direct as possible. 3. Do not change the bus wire connection to pin 2 of V101 and V102. Sleeving is used on these wires to insure length and to prevent shorting. 4. Dress C115 down between R114 (volume control) and wafer S101-13. 5. Ground R126 to pin 3 of V106 and R134 to pin 7 of V107. 6. Do not change the grounding of R136, R140 and R143. 7. Keep the bus wire from T109 -A to C144 (plug in capacitor) short and direct. 8. Ground the filaments of sockets V107, V108 and V109 independently of the socket center pin. Use ground lances proved near each socket. 9. Dress C148 straight up to act as a shield between T101 -A and V110-2. 10. Dress C155 and R160 (kine cathode) up in the air above the terminal board. 12. Do not reroute any wires betWeen T104 and the terminal board alongside it. Keep all leads on the foot side of the terminal board. 13. Dress all wires routed past T104, shielded wires W102 and W103 under the big lances near T104. 14. Dress all a -c leads to S102 under the large lances on the front apron. 15. Dress R113 close to the chassis with leads as short as possible. 16. Dress C158 and C122 up in the air and away from all other leads and components. 17. The lead from pin 5 of V111 to the terminal board under the high voltage cage should be routed between V117 socket and the rear apron. 18. Dress all 2 watt resistors away from each other and all other wires and components. 19. Dress all wires away from damper tube V119. 20. The wire from pin 5 V116 to T113 -A should not be more than 5 inches long. 21. Dress all peaking coils up and away from the base. 11. Keep the leads connected to T113 -C and T113 -D (syncho- guide) down so that they will not short out when the chassis is placed in the cabinet. 22. Dress all leads in the high voltage compartment away from each other and away from the high voltage trans- former. 24 171 17T250DE, 17T261DE REPLACEMENT PARTS (Continued) STOCK No. DESCRIPTION 76642 503047 502056 34763 502082 502110 503110 503118 503122 503133 503147 513147 503168 502210 503210 503212 503222 523222 503233 513233 502239 503239 513247 502256 503256 14659 513268 503282 503310 513310 523310 503312 513312 503315 503318 513322 503333 503339 513339 512343 30787 503347 513347 502356 523356 503368 513368 513382 503410 512410 30180 503415 3046 503422 502427 503427 503433 512433 503439 503447 503456 Resistor -Wire wound, 6750 ohms, 10 watts (H156) Resistor -Fixed, composition: 47 ohms, ±10%, 1/2 watt (R108, R154, R233) 56 ohms, ±5%, I/2 watt (R134) 68 ohms, ±5%, I/2 watt (R140) 82 ohms, ±5%, I/2 watt (R101) 100 ohms, ±5%, 1/2 watt (R126) 100 ohms, ±10%, 1/2 watt (R122, 11129) 180 ohms, ±-10%, 1/2 watt (R144) 220 ohms, ±10%, V2 watt (R153) 330 ohms, ±10%, V2 watt (R213) 470 ohms, ±10%, 1/2 watt (R123) 470 ohms, ±10%, 1 watt (RI20, R212) 680 ohms, ±10%, V2 watt (R157) 1000 ohms, ±5%, V2 watt (R150) 1000 ohms, ±10%, 1/2 watt (R107, R121, 11125, 11131, 11133, 11137, R142, R145, 8175) 1200 ohms, ±10%, V2 watt (R178) 2200 ohms, ±10%, V2 watt (R159) 2200 ohms, ±10%, 2 watts (R164) 3300 ohms, ±10%, I/2 watt (R218) 3300 ohms, ±10%, 1 watt (R102) 3900 ohms, ±5%. Vs watt (R151) 3900 ohms, ±10%, V2 watt (R225) 4700 ohms, ±10%, 1 watt (R155) 5600 ohms, ±5%, I/2 watt (R136) 5600 ohms, ±10%, V2 watt (R172) 6800 ohms, ±5%, V2 watt (R109, R110) 6800 ohms, ±10%, 1 watt (R147) 8200 ohms, ±10%, I/2 watt (R210) 10,000 ohms, ±10%, 1/2 watt (R115, R205) 10,000 ohms, ±10%, 1 watt (R141) 10,000 ohms, ±10%, 2 watts (R236) 12,000 ohms, ±10%, 1/2 watt (R171, 11173) 12,000 ohms, -±-10%, 1 watt (R176) 15,000 ohms, ±10%, 1/2 watt (R219) 18,000 ohms, -±- 1 0 °/. , V2 watt (R105, 8184, R190, 11228) 22,000 ohms, ±10%, 1 watt (R227) 33,000 ohms, ±10%, 1/2 watt (R132, 11183, R192) 39,000 ohms, ±10%, 1/2 watt (R111) 39,000 ohms, ±10%, 1 watt (R180) 43,000 ohms, ±5%, 1 watt (R209) 47,000 ohms, ±5%, V2 watt (R193) 47,000 ohms, ±10%, V2 watt (R103, R169) 47,000 ohms, -±-10%, 1 watt (RI27, R135, R191, R232) 56,000 ohms. ±5%, I/2 watt (R143) 56,000 ohms, ±10%, 2 watts (R106) 68,000 ohms, ±10%, V2 watt (R195, 11201, 11202) 68,000 ohms, ±10%, 1 watt (R226) 82,000 ohms, ±10%, 1 watt (R224) 100,000 ohms, -.±:10%, V2 watt (R203, R217) 100,000 ohms, ±5%, 1 watt (R230) 120,000 ohms, ±5%, V2 watt (R206) 150,000 ohms, ±10%, V2 watt (R160, R179, R215, R220) 200,000 ohms, ±5%, 11/2 watt (R194) 220,000 ohms, ±10%, 1/2 watt (R214) 270,000 ohms, ±5%, V2 watt (R162) 270,000 ohms, ±10%, 11/2 watt (R185) 330,000 ohms, ±10%, I/2 watt (R116, 8221) 330,000 ohms, ±5%, 1 watt (R223) 390,000 ohms, ±10%, 11/2 watt (R196) 470,000 ohms, ±10%, 1/2 watt (RI17, R148, 11168, 11234) 560,000 ohms, ±10%, V2 watt (R198) STOCKNo. DESCRIPTION 503482 503510 11769 39063 503522 503539 503582 503610 71456 76455 73584 75718 74834 75222 31251 50367 71508 73117 73115 76453 76971 76636 76428 77215 76463 77198 77197 '76435 76433 76436 76795 76440 76997 76429 76438 76437 76439 76431 77225 76616 820,000 ohms, ±10%, 1/2 watt (R188, R200, 11222, 11231) 1 megohm, ±10%, V2 watt (R177) 1.8 megohm, ±5%, 1/2 watt (R161) 1.8 megohm, ±5%, 1 watt (R229) 2.2 megohm, ±10%, V2 watt (R189, R204, 11207) 3.9 megohm, ±10%, 11/2 watt (R174) 8.2 megohm, ±10%, V2 watt (R163) 10 megohm, ±10%, I/2 watt (R113) Screw -No. 8-32 x 7/16" wing screw for mounting de Section yoke Shaft -Connecting shaft (nylon) for picture and brightness controls Shield -Tube shield for V101, V102, V103, V106, V107, V109 Socket -Channel indicator lamp socket Socket -Kinescope socket Socket -Tube socket, octal, ceramic, plate mounted for V116 Socket -Tube socket, octal, wafer, for V112, V113, V114, V117 Socket -Tube socket, 6 pin, moulded, saddle -mounted for V119 Socket -Tube socket, 6 pin, moulded for V118 Socket -Tube socket, 7 pin, wafer, miniature, for V101, V102, V103, V104, V105, V106, V107, V108, V109, V111 Socket -Tube socket, 7 pin, moulded, miniature, plate mounted for V115 Socket -Tube socket, octal, moulded, saddle -mounted for V110 (6AG7) for KCS47M1 Socket -Tube socket, 9 pin, wafer, miniature, for V110 (6CL6) for KCS74 Stud -Adjusting stud complete with guard for focus magnet Support -Bakelite support only -part of hi -voltage shield Switch -Tone control and phono switch (S101) Terminal -Screw type grounding terminal Transformer -First pix i-f grid transformer complete with adjustable cores (T104, C125, R124) Transformer -First pix i-f plate transformer complete with adjustable cores (T105, C132, CI33, 11130) Transformer -Second pix i-f grid transformer complete with adjustable core (T106, C134) Transformer -Third or fourth pix i-f transformer (T107, T108) Transformer -Fifth pix i-f transformer (T109, C143, 0146, L102, 11146, CR101) Transformer -Hi -voltage transformer (T114) Transformer -Horizontal oscillator transformer complete with adjustable cores (T113) Transformer -Output transformer (T103) Transformer -Power transformer, 117 volt, 60 cycle (T112) Transformer -Sound i-f transformer complete with adjustable cores (T101, C103, C104) Transformer -Sound take -off transformer complete with adjustable cores (T110, C147) Transformer -Ratio detector transformer complete with adjustable cores (T102, C108, C109) Transformer -Vertical output transformer (T111) Trap -4.5 MC trap (L105, C149) Yoke -Deflection yoke complete with 6 contact male connector (L111, L112, L113, L114, C208, P103, R239, 11240, 11241) 75024 75022 SPEAKER ASSEMBLIES 971490-3W RL-105E6 RMA-274 (For Model 17T250DE) Cone -Cone and voice coil (3.2 ohms) Speaker -8" P.M. speaker complete with cone and voice coil (3.2 ohms) 31 172 17T250DE, 17T261DE REPLACEMENT PARTS (Continued) HOCK ST o. DESCRIPTION SPEAKER ASSEMBLIES 92569-12W RL-111A1 AMA -274 (For Model 17T261DE) 75682 Cone -Cone and voice coil (3.2 ohms) 76389 Speaker -12" P.M. speaker complete with cone and voice coil (3.2 ohms) NOTE: If stamping on speaker in instruments does not agree with above speaker number, order replacement parts by referring to model number of instrument, number stamped on speaker and full description of part required. 77213 77214 76184 76590 77028 76599 77029 77030 X1756 X3222 X3199 75474 39153 71457 77031 76698 77034 76512 77244 77245 77487 77012 75456 72113 77026 37396 76596 76595 MISCELLANEOUS Back -Cabinet back complete with terminal board and power cord for Model 17T250DE Back -Cabinet back complete with power cord for Model 17T261DE Board -Antenna terminal board Bracket -Hanger bracket for deflection yoke hood as - sembly Bracket -Support bracket ("L" shape) for kinescope masking panel (2 required) Bracket -"U" shape bracket for deflection yoke hood support rod Clip -Retaining clip (top or bottom) for safety glass retainer Clip -Retaining clip (sides) for safety glass retainer Cloth -Grille cloth for mahogany or walnut instruments for Model 17T250DE Cloth -Grille cloth for blonde mahogany instruments for Model 17T261DE Cloth -Grille cloth for mahogany or walnut instruments for Model 17T261DE Connector -Single contact male connector for antenna cable Connector -4 contact male connector for antenna cable Cord -Power cord and plug Cushion -Adhesive cushion (sponge rubber -3/s" dia.) for masking panel Cushion -Rubber cushion for kinescope masking panel support bracket Decal -Control function decal for mahogany or walnut instruments Decal -Control function decal for blonde mahogany in - struments Emblem -"Deluxe" emblem for mahogany or walnut instruments for Model 17T250DE Emblem -"Deluxe" emblem for blonde instruments for Model 17T250DE Emblem -"Deluxe" emblem for Model 17T261DE Emblem -"RCA Victor" emblem Escutcheon -Channel marker escutcheon Foot -Rubber foot (4 required) for Model 17T250DE Glass -Safety glass Grommet -Rubber grornimet for mounting speaker for Model 17T261DE Knob -Brightness control or vertical hold control knobbeige-for blonde mahogany instruments (outer) Knob -Brightness control or vertical hold control knob -maroon-for mahogany or walnut instruments (outer) STOCK No. DESCRIPTION 76594 76593 76592 76591 74963 75464 76598 76597 11765 76589 75459 77022 77013 73634 76177 76601 77027 77024 76632 76808 73643 76020 77025 77006 30330 72845 76837 77032 36580 76600 77023 75500 75458 75457 Knob -Channel selector knob -beige -for blonde mahogany instruments (inner) Knob -Channel selector knob -maroon -for mahogany or walnut instruments (inner) Knob -Fine tuning control knob -beige -for blonde mahogany instruments (outer) Knob -Fine tuning control knob -maroon -for mahogany or walnut instruments (outer) Knob -Picture control, horizontal hold control or volume control and power switch knob -maroon -for ma hogany or walnut instruments (inner) Knob -Picture control, horizontal hold control or volume control and power switch knob -beige -for blonde mahogany instruments (inner) Knob -Tone control and phono switch knob -beige -for blonde mahogany instruments (outer) Knob -Tone control and phono switch knob -maroon for mahogany or walnut instruments (outer) Lamp -Channel marker escutcheon lamp -Mazda 51 Mask -Channel marker escutcheon light mask -beige - for blonde mahogany instruments Mask -Channel marker escutcheon light mask -bur - Bundy -for mahogany or walnut instruments Mask -Polystyrene masking panel Nut-Speednut for fastening "RCA Victor" emblem to cabinet (3 required) Nut-Speednut for speaker mounting screws for Model 17T261DE Nut -No. 10-32 special nut for deflection yoke hood sup port rods Pad -Kinescope edge support pad (2 required) Retainer -Safety glass retainer Rod -"L" shape threaded rod to support deflection yoke hood assembly Screw -No. 8 x %" hex head wood screw for mount - ing hanger bracket Sleeve -Polyethylene sleeve for insulating high voltage lead -on support rod Spring -Channel marker escutcheon spring clip Spring -Formed spring for glass retainer clips (6 re - quired) Spring -Formed spring for kinescope masking panel Spring -Retaining, spring (coil) for deflection yoke hood support rod nut Sprin g -Retaining spring for knobs 74963, 75464 Spring -Retaining spring for knobs 76591, 76592 Spring -Retaining spring for knobs 76593, 76594, 76595, 76596, 76597, 76598 Spring -Suspension spring clip (formed) for ground braid Spring -Suspension spring (coil) for ground braid Strap --Grounding strap (upper strip -1/2" x 18") Washer -Cellulose washer -gold -for knobs Washer -Felt washer for masking panel or cabinet buck mounting screws Washer -Felt washer -beige -between knob and chan- nel marker escutcheon for blonde mahogany instru- ments Washer -Felt washer -dark brown -between knob and channel marker escutcheon for mahogany or walnut instruments APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS. 32 CHASSIS WIRING DIAGRAM KCS74, KCS74M1 6101 /IIO 4 REAR C158 0114 02 off -r 15 V104 c le L 0 I V107 V109 F Tio4 Mq 05 II O. Trol 'a i14 - V102 F .r,02 5 (446 4 J101 ad i'mvlocis I% aEr°74_ 0115 V103 1111 HOLE 5414141440 1. I III 11 0 S 20 1152 7 112 02 47,44,24 MaillfW,4111 4417 ,40LE 21 0 V106 T '04 vs 5 g C177 I-- 60 710 07 0.60 A c212 1.6.113° diI I. eL . "C ROLE cieL 01401.1 I 1110 GR 141011.410 21 C W044 4010441 MP" TI11 JIII Fr V117 IRN dig fie_ 0 4. C191 C1915 12441 C19 117 45 CR 8 eAu rC 144 --1.. q.1 illj C C 145 t .10164 0196 4.-41.000.1T RILD460. imeow .vioLE -c, MOLE 450 lee 04 Figure 78-Chassis Wiring Diagram, KCS74, KCS74M1 25 165-166 17T250DE, 17T261DE 26 KCS74 CIRCUIT SCHEMATIC DIAGRAM ( *KCS74M1) 1 67- 1 68 17T250DE, 17T261DE TO ART ANT TB. 30011. BAL 4 ANT MATCHING UNIT LAO I -F TRAP 41.25 MC. L59 L58 I -F TRAP F -M 45.75 MC. TRAP PI B REAR VIEW PIA -51 REAR VIEW J1 -F FRONT VIEW F UNIT KRK IIA It ,00 04 0: 908° ; 5 R7 1000 SIC FRONT I T2 ANT. TRANS C27 18 C25 C24 C19 R12 R13 22 3300 150 L54 L37 L42 L43 L44 L45 L55 L34 L52. o o L33 L32 LOS SIC REAR 1C-148 L49 68VS07 R -F AMPL . C20 3 .11500 R11 - 3300 510 FRONT R8 470K R14 1000 7 40720106 E1161 j 1.8 MEG 4285V. v lot 6 AU 6 IST SOUND I -F AMPL. +112V C 10IA R101 82 T 101 SOUND I- F TRANS. 4. 5 MC rip C103 17g' 15 C104 47 C 10 5 56 0103 47K 10 2 ? 3300 yloz 6 AU 6 2 NO. SOUND I -F AMPL. s +255V T102 RATIO DET TRANS. 4.5 MC V103 GALS RATIO DETECTOR. 55 C109 100 C1074 C 107B 1-01 101 R107 1000 R108 47 2R310390 RATIO DET. BALANCE C I 15 .0047 3 RI50 Rill 100c, 39 K 12114 I MEG. VOL. CONTR. R1I0 6800 T0C012137. CtiE, 0113 10 MEG R115 10K, FUNCTION SWITCHES VIEWED FROM FRONT, AND SHOWN IN P03.1 ( MAK COUNTER- CLOCKWISE) P05. 1 -TV MiN. wiGHS 2 -TV NORMAL . 3 -TV MiN LOWS 4 -P+10No. MIN. HIGHS 5-PHONO. NORMAL . 6-PHONO. MIN LOw5. + 285V. 5101-5 5101-8 REAR 12 4 J101 PHONO INPUT -.- C117 1.039 + C 114 V 104 GAV6 1ST. AUDIO AMPL. V105 6A 0.5 AUDIO OUTPUT TIO3 AUDIO -1-.001120 5 262V. 1.0:012:1:1-01 > C271108 I7 OV. R 117 4.706 6! 4 3 )1- f. 3R 31 01 GK Re, 81 109 1.17.+C2 Iml 74, 2V RED I 5' R120 9 470 t1994. _LA I 10C2M1lFC. +285 V. 1-g*A-407 5101- A FRONT a p.m SPEAKER 5101- A I 1 1 REAR C13 11500 L27 L28 L26 L29 L25 CI5 0.53.8 03 30 L24 L23 4 -G- 7 6 C14 C17 RIO C23 L57 270- 15001 82 1500T TP1 jR5 - 100K SIB FRONT 220I A C32 cto _10C311 1rv SIB 7.55-80 22 T REAR osclmixER TP2 LI7 LI6ry no , 04 05 L13 15001 15001* R -F A G C T104 1ST. PIX I -F GRID TRANS. 3975- -C125 Mc. t 20 C126 47oo V106 6AU 6 IST Pix. I -F AMPL Tio5 1ST PiX I -F PLATE TRANS T 10G 2ND. PiX. I -F GRID TRANS. 5 NO SIGNAL a I 100 R130 4700 C1434 CI29 4700 13 E 1 5 4N1 p,4 _ a, R131 1000 ".' r IR 153 R 364 1 1000 v107 6CB6 2ND PtK. I -F AMPL. T107 310. PIX. I- F TRANS. 41.5 MC. 5 131 V. -NO SIGNAL A R136 C 137A CI375 4 B 4700 4700 5600V: C136 4700 RI37 RI40 1000 68 L47 LIZ STRAIGHT WIRE 15001 11500 9 R138 5600 C9 0.8-3.8 C2 j FINE r TUNING, L11. L10 LS1 Las 51 A FRONT -1 ca C 3 ri RI 1" 100K R2 I 4 C6 ""- C30 I 1500I 15001! j RI62 RI94 270K 200K 157 C1568 TO.47 470o C124 047 IC41,203: I -F AG C 1.4285 V. $, 8821808K R184 18 K LEIN L7s L6 L5 C7 CHANNEL SELECTOR SWITCHES VIEWED FROM FRONT AND SHOWN IN CHANNEL - - - - - - - NO. 2 (54 -Go 61C.) POSITION . .047 RI63 8.2 MEG. vitz 65N7-GT 71R21K71 HOR SYNC. AMPL. R 176 +152V 12 K +98V --II 2 CI64 .001 +285V +59V. 0170 0.1 4-11V VII4A C33I606 65N7-61' VERT. SYNC AM PL C.014717 PRODUCTION CHANGES IN KCS74, KCS74M1 The schematic is shown in the latest condition. The notes below tell how early receivers differed from the schematic shown above. In some receivers R136, across the secondary C159 - .01315 RI81 25K A G -C CONTR. 12177 8180. IMES 39K tc. 1200 ? +285V. R189 2.2 MEG R190 15 K C165 .01 of TI07, third picture I -F transformer; was 6,800 ohms. In some receivers R228, across terminals "A" and "C" of T113, horizontal oscillator transformer; was 12,000 ohms. R 227 22 K + 285 V. .001 R19713 75 K NOR. HOLD CONTR. 3 C163 82 6R52K26 -TC.014977 -29.5V. vil6 65N7- GT NOR.SWEEP 05C AND CONTR. 5+197V. R228 18 K T 113 HT° RR A °N SS C. 1 ft $12231 820K 28 0 0 VII7 65 46-GT NOR. SWEEP OUTPUT R233 47_,5.3v R236 +1900°K RMA COLOR CODE, FIXED MICA CAPACITORS WHITE INDICATES RMA STD BLACK INDICATES JAN STO DIGITS wHITE INDICATES RMA STD BLACK INDICATES JAN STD DIGITS C 191A 10-160 HOR1Z LOCKING r RANGE CONTR. 0193 12 R230 100K R12.829 MEG. C-1191-.9j11 01 C1915 10 160 R234 HOR12. 470 K j 7.- DRIVE CONTR. C 201 .0012 c 193 5 Mr. C203 0.1 5 235 -I- C.202 150 I° '7 + 285V. p 101 .25 Amp crto-- VI08 6CB6 3RD. PIX. I -F AMPL 12IV. T 108 4TH. PIX. 1-F TRANS. 45.5 MC. A 5143 6 CIE 6 4TH. PIX 1-F AMPL . 1-F I98V. .1 R146 10 K 3 4 9." 0414°70 c,1 roDOB C 5'f>6°KV EV" 3 R144 180 C1418 - T 109 5TH. PIX. I -F TRANS. L102 D A 30 -(TOPT -ITO) "U'R T110 SOUND TAKE -OFF TRANS. L105 L 103 4.5 MC 120 mu -N +RAP RED -RED OR-YEL Of V110 6CL6 VIDEO AMPL 2R210604 C143 A 0144 1500 C146CI 1 10 R147 6500 C1413 .01 C141;71. .01 +285 V. C147 8149 3300 8151 39oo B__J L104 o Ria8 25 0 MY- 640: 470K GRN 91 2-9 R154? 47 _ .0C016518 27-1 F-4" *.> J 102 .Z.". ---70-1-5-t- +I42V. R153 220 0167 180 ... L110 : 1000 3 39 RI57 680 0 8158 1 15 K PICTURE coNTR. C2I15 RI56 MF 6750 +285V. c154 15 .1 R159 2200 R L108 180 MU -H WH.YEL c 155 RIS I 47K PC 101 22K 8R2I0G0S R 1671 C172. 13200 .001 Ig2.17K4 VERT. HOLD CONTR. V114 8 65N 7-6T VERT SwEEP 05C DISCH 0174 390 R2o2 R203 C178 CI79 6136 100K 0O2Z 022 F-4-1 CI75 2.2 0.1 CI76 Ci77Vlic;'(9 1002210022 mEG. 6AV1105 .5 VERT. SWEEP OUTPUT 267V 7 C181 0.1 0205 10K R2oot Cleo C 173 820 Kj .033 R198 1.0022 JIA":19^9^A'j-Wri 2.5 ME G. HEIGHT CONTR. R206f 120K R207 2.2 MEG C182 .068 R2I0 8200 3 1R5200it3 VER.7 LINE CONTR mamma R212 470 V 118 153-6T 14- V RECT. R237.5.1 c 184 220 °EFL. YOKE P102-14 PIN VIEW R214 220 K R2I6 2.20K 1 BRHatTNS CmONoToFLr. R2I5 150K C186 .047 11 vo. R2I8 3300 .C0108477.1/ +15,300V. CHANNEL IND. LAMP +360V. rliiZF; KINESCOPE C2I1A_ loo h1F1 L 115 FILTER CHOKE 008 J 102-F REAR VIEW BLU-YEL +8 BOOST V119 L 109 6W4-GT 1.5 MU -I, DAMPER 0206= C207.,- on L107 2.80V. NOR. LIN CoNTR R240 1 560 I YEL BLK- RED +285V. SUPPLY GE- 47921- I C189 C168 .047 .047 - - T-12- WI03 5102 3109 INTERLOCK 115V. SUPPLY OuALiTy Cf) MULTIPLIER TOLERANCE QUALITY MULTIPLIER TOLERANCE Figure 79 -Circuit Schematic Diagran All resistance values in ohms. K 1000. All capacitance values less than 1 in MF and above 1 in MMF unless otherwise noted. Direction of arrows at controls indicates clockwise rotation. anAdllwviothltangoessimgneaalsuinrepduwt. iVtho"lVtaogletOs hshmoyusltd" hold within 20% with 117 v. a -c supply. In some receivers, a 6AG7 tube was em ployed in place of the 6CL6 video amplifiei and was connected as shown in inset abovG 27 28 1 69 17T250DE, 17T261DE REPLACEMENT PARTS STOCK No. DESCRIPTION 76539 76531 76845 76965 93056 70597 55326 54207 76557 76558 70935 76739 77460 75199 75166 75610 73748 71088 77151 75184 76532 76527 76143 73591 73477 76763 77206 76562 77153 76537 76538 76529 38853 76559 76460 77202 76543 76521 73453 77203 76728 503047 503082 503115 503210 503233 503247 503410 503447 14343 75164 76547 76549 R -F UNIT ASSEMBLIES KRKI1A Board -Antenna matching transformer terminal board less coils L58, L59, L60 and less capacitors C24, C25, C26, C27 Board -Terminal board, 5 contact and ground Bracket -Vertical bracket for holding VI tube shield Capacitor -Ceramic, variable, for fine tuning -plunger type (C2) Capacitor -Ceramic, 5 mmf. (C26, C32) Capacitor -Ceramic, 8 mmf. (C29) Capacitor -Ceramic, 10 mmf. (C3) Capacitor -Ceramic, 18 mmf. (C27) Capacitor -Ceramic, 22 mmf. (C19, C31) Capacitor -Ceramic, 22 mmf. (C5) Capacitor -Ceramic, 27 mmf. (C25) Capacitor -Ceramic, 33 mmf. (C24) Capacitor -Ceramic, 220 mmf. (C10) Capacitor -Ceramic, 270 mmf. (C12, C14) Capacitor -Ceramic, 1500 mmf. (stand-off) (C13, C17, C21, C22, C28, C30) Capacitor -Ceramic, 1500 mmf. (C6) Capacitor -Ceramic, 1500 mmf. (C16, C20, C23) Capacitor -Ceramic, 0.68 mmf. (C7) Capacitor -Tubular, steatite, adjustable, 0.8-3.0 mmf. (C8) Capacitor -Ceramic, adjustable, 0.80-3.8 mmf, complete with adjusting stud (C9) Capaci:or-Adjustable trimmer, steatite, 1.-4. mmf. (C16) Capacitor -Mica trimmer, 55-80 mmf. (C11) Clip -Tubular clip for mounting stand-off capacitors matching coil (2 required) Coil -Choke coil (L57) Coil -Filament choke coil (L63, L64) Coil -Filament choke coil (L56) Coil -R -F amplifier coupling coil (L51) Coil -R -F choke coil (L66) Coil -Shunt coil complete with adjustable core (L61) Coil -Shunt coil complete with adjustable core (L62) Coil -Trimmer coil (3 turns) with adjustable inductance core and capacitor stud (screw adjustment) for r -f section (L49, C15) Connector -4 contact female connector -part of match- jag transformer (J1) Connector -Oscillator grid connector Contact -Test point contact Core -Adjustable core for fine tuning capacitor Core -Adjusting core for FM trap Detent-Detent mechanism and fibre shaft Fgrm-Coil form for coils L48, L50, L53 Link -Link assembly for fine tuning Nut-Speednut for mounting adjustable trimmer 76532 Resistor -Fixed, composition: 47 ohms, ±10%. 1/2 watt (R9) 82 ohms, ±10%, 1/2 watt (R10) 150 ohms, ±10%, 1/2 watt (R13) 1000 ohms, -±10%. Vs watt (R7, 1114) 3300 ohms, -±-10%, V2 watt (114, 11 1 I, 1112) 4700 ohms, ±10%, 1/2 watt (112) 100,000 ohms, -±-10%, Vs watt (RI, 115, 116) 470,000 ohms, ±10%, Vs watt (118) Retainer -Fine tuning shaft retaining ring Rod -Actuating plunger rod (fibre) for fine tuning link Screw -No. 4-40 x 1/4" adjusting screw for coils L6, L7, L8, L9, LIO, L11 Screw -No. 4-40 x 3/8" adjusting screw for coil L5 STOCK No. DESCRIPTION 76548 76519 76134 77147 76534 76530 76336 77149 75163 30340 75068 77204 76554 77353 77205 76553 76556 76561 76525 76526 76544 75446 75447 76740 77152 76536 77148 76540 76535 76542 76541 75190 Screw -No. 4-40 x 5/16" adjusting screw for coils LI, L2, L3, L4, L46 Shaft -Channel selector shaft and plate Shaft -Fine tuning shaft and cam Shield -Front shield complete with shaft bushing and bracket Shield -Tube shield Socket -Tube socket, 9 pin, miniature, ceramic, saddle mounted for VI Socket -Tube socket, 9 pin, miniature, bakelite, saddle mounted for V2 Spacer -Metal spacer for front plate Spring -Friction spring (formed) for fine tuning cam Spring -Hairpin spring for fine tuning link Spring -Retaining spring for tube shield Spring -Return spring for fine tuning control Stator -Antenna stator complete with rotor, coils, ca - pacitors and resistor (S5, C20, L42, L43, L44, L45, L54, L55, R13) Stator -Convertor stator complete with rotor, coils, Ca pacitor and resistors (S2, C10, C12, L12, L13, L14, L15, 116, L17, L18, L19, L20, L21, L47, L48, 114, R5, 116) Stator -Oscillator stator complete with rotor, coils and capacitors (Si, C3, C7, LI, L2, L3, L4, 15, L6, L7, L8, L9, L10, L11, L46) Stator -R -F plate stator complete with rotor, coils, ca pacitor and resistor (S3, C14, L22, L23, L24, L25, L26, 1,27, L28, L29, L30, L31, L50, R7) Stator -R -F grid stator complete with rotor, coils, ca pacitor and resistors (S4, C19, L32, L33, L34, L35, L36, L37, L38, L39, L40, L41, L53, Ell, R12) Strap -Channel No. 13 r -f grid strap (L52) Strip -Coil segment mounting strip-RH center Strip -Coil segment mounting strip-LH lower Strip -Coil segment mounting strip - LH upper - less trimmer Stud -Capacitor stud for trimmer coil L49, C15 (uncoded and coded "ER") Stud -Capacitor stud for trimmer coil L49, C15 (coded numerically and "Hi Q") Stud -No. 6-32 x 1" adjusting stud for adjustable ca - pacitor Terminal -Terminal for mounting C8 trimmer Transformer -Antenna matching transformer complete (T2, C24, C25, C26, C27, L58, L59, L60, L61, L62, 11) Transformer -Convertor transformer (T1. 113) Trap -FM trap complete with adjustable core (L58) Trap -I -F trap (L65) Trap -I -F trap (41.25 MC) complete with core (L60) Trap -I -F trap (45.75 MC) complete with core (L59) Washer -Insulating washer (neoprene) for adjustable capacitor 76956 76454 71496 ' 75217 33380 39044 73664 71924 76475 76474 39396 75437 51416 CHASSIS ASSEMBLIES KCS74 Bracket -Channel indicator lamp bracket Bracket -Mounting bracket complete with insulator for picture control Capacitor -Adjustable trimmer, 5-70 mmf. (C122) Capacitor -Mica trimmer, dual 10-160 mmf. (C191A, C191B) Capacitor -Ceramic, 12 mmf. (C193) Capacitor -Ceramic, 15 mmf. (C154) Capacitor -Ceramic, 39 mmt. (C153) Capacitor -Ceramic, 56 mint (C105) Capacitor -Mica, 68 mmf. (C192) Capacitor -Mica, 82 mmf. (C163) Capacitor -Ceramic, 100 mmf. (C114. C162) Capacitor -Ceramic, 100 mmf. (C152) Capacitor -Mica, 180 mmf. (C167) 29 170 17T250DE, 17T261DE REPLACEMENT PARTS (Continued) STOCK No. DESCRIPTION 76673 73091 47617 39640 76476 73094 54003 75166 73473 76470 73960 75877 74521 28417 75218 76451 75220 76479 75249 76995 73802 73595 73599 73818 73795 73920 73789 73561 73594 73562 73798 73810 73811 73596 73790 73558 73553 75071 73592 73597 73792 Capacitor -Ceramic, 220 mmf. (C184) Capacitor -Mica, 270 mmf. (C207) Capacitor -Ceramic, 270 mmf. (C118) Capacitor -Mica, 330 mmf. (C166) Capacitor -Mica, 330 mmf. (C198) Capacitor -Mica, 390 mmf. (C174) Capacitor -Mica, 470 mmf. (C110, C111) Capacitor -Ceramic, 1500 mmf. (stand-off) (C144) Capacitor -Ceramic, 4700 mmf. (C126, C127, C128, C129, C130, C131, C135, C136, C139, C142, C216) Capacitor -Ceramic, dual, 4700 mmi. (C123A, C123B, C137A, C137B, C140A, C140B, C141A, C141B, C156A, C156B) Capacitor -Ceramic, 10,000 mmf. (C145, C148) Capacitor -Ceramic, dual, 10,000 mmf. (C101A, C101B, C107A, C107B) Capacitor -Electrolytic, 5 mfd., 50 volts (C112) Capacitor -Electrolytic, 5 mid., 450 volts (C183) Capacitor -Electrolytic, comprising 1 section of 10 mid., 350 volts, 1 section of 5 mid., 350 volts and 1 section of 150 mfd., 50 volts (C212A, C212B, C212C) Capacitor -Electrolytic, comprising 1 section of 100 mfd., 350 volts, 2 sections of 10 mfd., 350 volts and 1 seclion of 20 mfd., 50 volts (C211A, C211B, C211C, C211D) Capacitor -Electrolytic, 150 mid., 200 volts (C209, C210) Capacitor -Tubular, moulded, oil impregnated, .00068 mid., 600 volts (C200) Capacitor -Tubular, paper, oil impregnated, .001 mfd., 600 volts (C164, C172, C190). Capacitor -Tubular, moulded, oil impregnated, .0012 mid., 600 volts (C201) Capacitor -Tubular, paper, oil impregnated, .0015 mfd., 600 volts (C159) Capacitor -Tubular, paper, oil impregnated, .0022 mfd., 600 volts (C113, C161, C173, C176, C177, C178) Capacitor -Tubular, paper, oil impregnated, .0027 mfd., 600 volts (C119) Capacitor -Tubular, paper, oil impregnated, .0027 mid., 1600 volts (C121) Capacitor -Tubular, paper, oil impregnated, .0033 mfd., 600 volts (C160) Capacitor -Tubular, paper, oil impregnated, .0047 mfd., 600 volts (C115, C187) Capacitor -Tubular, paper, oil impregnated, .0068 mid., 400 volts (C151) Capacitor -Tubular, paper, oil impregnated, .01 mfd., 400 volts (C116, C120, C165) Capacitor -Tubular, moulded, oil impregnated, .01 mid., 600 volts (C199) Capacitor -Tubular, paper, oil impregnated, .022 mfd., 400 volts (CI95) Capacitor -Tubular, paper, oil impregnated, .022 mid., 600 volts (C179) Capacitor -Tubular, paper, oil impregnated, .022 mfd., 1000 volts (C206) Capacitor -Tubular, paper, oil impregnated, .027 mid., 1000 volts (C205) Capacitor -Tubular, paper, oil impregnated, .033 mid., 1000 volts (C180) Capacitor -Tubular, paper, oil impregnated, .039 mfd., 400 volts (C117) Capacitor -Tubular, paper, oil impregnated, .047 mid., 200 volts (C171) Capacitor -Tubular, paper, oil impregnated, .047 mid., 400 volts (C158, C197) Capacitor -Tubular, moulded, .047 mfd., 400 volts (C188, C189) Capacitor -Tubular, paper, oil impregnated, .047 mfd., 600 volts (C124) Capacitor -Tubular, paper, oil impregnated, .047 mid., 1000 volts (C186) Capacitor -Tubular, paper, oil impregnated, .068 mfd., 400 volts (C182) STOCK No. DESCRIPTION 73784 73551 73557 73786 73787 76498 76143 73477 76442 76441 76640 77195 76647 71526 77194 71789 35787 75474 75482 74594 50367 75542 77200 76444 76448 77201 76445 77199 76449 77010 76986 76985 74956 74839 73600 76459 37396 76830 76168 76141 76633 18469 76464 77196 76675 76452 76796 76639 77193 34473 76390 Capacitor -Tubular, paper, oil impregnated, 0.1 mfd., 200 volts (C155, C175) Capacitor -Tubular, paper, oil impregnated, 0.1 mid., 400 volts (C170, C185, C194) Capacitor -Tubular, paper, oil impregnated, 0.1 mfd., 600 volts (C181, C203) Capacitor -Tubular, paper, oil impregnated, 0.27 mid.. 200 volts (C202) Capacitor -Tubular, paper, oil impregnated, 0.47 mfd., 200 volts (C157, C168, C196) Choke -Filter choke (L115) Clip -Tubular clip to mount stand-off capacitor Coil -Choke coil (1101) Coil -Horizontal linearity coil complete with adjustable core (L107) Coil -Width coil complete with adjustable core (L106) Coil -R -F choke coil (1.5 muh) (L109) Coil -Peaking coil (120 muh) (L103, R149) Coil -Peaking coil (180 muh) (L108, R152) Coil -Peaking coil (250 muh) (L104) Coil -Peaking coil (1000 muh) (L110) Connector -Anode connector Connector-Phono input connector (J101) Connector -Single contact male connector for speaker cable (2 required) Connector -Video connector (J102) Connector -2 contact male connector for power cord Connector -6 contact female connector for yoke leads (J103) Connector -6 contact male connector -part of deflection yoke (P103) Control-AGC control (R181) Control -Brightness control (11216) Control -Height control (11199) Control -Horizontal and vertical hold control (R197A, R197B) Control -Picture control (R158) Control -Ratio detector balance control (R139) Control -Vertical linearity control (11211) Control -Volume control and power switch (11114, 5102) Cover -Back cover for hi -voltage compartment Cover -Side cover for hi -voltage compartment Cushion -Rubber cushion for deflection yoke hood Fastener -Push fastener for mounting tube socket for V116 and tube socket 76453 Fuse -0.25 amps. (F101) Grommet -Rubber grommet for 2nd anode lead exit Grommet -Rubber grommet for mounting tube socket for V116 and tube socket 76453 Hood -Deflection yoke hood less rubber cushions Magnet -Focus magnet Magnet -Ion trap magnet (P.M. type) Magnet -Pin cushion correction magnet complete with support arm Plate -Bakelite mounting plate for electrolytic 75220 Plate -Hi -voltage plate-bakelite--complete with tube socket and corona ring Printed Circuit -Consisting of 1 section of 22,000 ohms, 2 sections of 8200 ohms, 1 section of .002 mid., and 2 sections of .005.mfd. PC101 (C213, C214, C215, R165, R166, R167) Rectifier -Picture detector crystal rectifier (CR101) Rectifier -Selenium rectifier (CR102, CR103) Resistor -Wire wound, 5.1 ohms, 1/3 watt (R237) Resistor -Wire wound, 180 ohms, 2 watts (R235) Resistor -Wire wound, 680 ohms, 1 watt (R119) Resistor -Wire wound, 20Q0 ohms, 10 watts (11128) Resistor -Wire wound, 5600 ohms, 5 watts (R138) 30 Models 21T159, 21T159DE, Walnut. Mahogany, Limed Oak Model 21T165 "Meredith" Walnut. Mahogany, Limed Oak Mode1.21T 166DE "Farmington Walnut. Mahogany, Blond Mahogany Model 21T 1'401 Zhu r Walnut. 11ahogan. 1 Itne d Oak RCA VICTOR 7 3 TELEVISION RECEIVERS -MODELS 21T159, 21T159DE, 21T165, 21T166DE, 21T174DE, 21T175DE, 211176, 211171, 21T178, 21T178DE, 21T179, 21T179DE Chassis Nos. KCS68C, KCS68E or KCS68F - Mfr. No. 274 - SERVICE DATA - 1951 No. T8 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. Model z 11, 5DE "Benton" Model z 1T176 -Suffolk" Model 2 IT177 "Donley" Models 2IT178, 21T178DE, Models 21T179, 21T179DE Walnut. Mahogany, Limed Oak Walnut. Mahogany, Limed Oak Walnut, Mahogany, Limed Oak "Rockingham" "Clarendon" Walnut, Mahogany Walnut, Mahogany, Maple GENERAL DESCRIPTION Features of these receivers are: full twelve channel coverage; -totem" r -f amplifier; intercarrier FM sound system; ratio detector; 40 mc picture i-f; improved picture brilliance; pulsed picture A -G -C; A -F -C horizontal hold; stabilized vertical hold; compensated video gain control; noise saturation circuits; improved sync. separator and clipper; four mc. band width for picture channel and reduced hazard high voltage supply. An auxiliary audio input jack is provided to permit the use of an external record playing attachment. ELECTRICAL AND MECHANICAL SPECIFICATIONS PICTURE SIZE 227 square inches on a 21AP4 Kinescope TELEVISION R -F FREQUENCY RANGE All 12 television channels, 54 mc. to 88 mc., 174 mc. to 216 mc. Picture I -F Carrier Frequency 45.75 mc. Sound I -F Carrier Frequency 41.25 mc. and 4.5 mc. POWER SUPPLY RATING 115 volts, 60 cycles, 300 watts AUDIO POWER OUTPUT RATING 5 0 watts max. CHASSIS DESIGNATIONS KCS68C In Models 21T176, 21T177, 21T178, 21T179 KCS68E KCS68F In Models 21T159, 21T165 In Models 21T159DE, 21T166DE, 21T174DE, 21T175DE, 21T178DE, 21T179DE Model Weight 21T159, 21T159DE 21T165 21T166DE 21T174DE 21T175DE 21T176 21T177 21T178, 21T178DE 21T179, 21T179DE Chassis with Tubes in Cabinet 104 lbs. III lbs 120 lbs 140 lbs 152 lbs 128 lbs. 143 lbs. 148 lbs 153 lbs Shipping Weight 125 lbs. 149 lbs. 152 lbs. 172 lbs. 184 lbs. 159 lbs. 174 lbs. 182 lbs. 187 lbs. RECEIVER ANTENNA INPUT IMPEDANCE Choice: 300 ohms balanced or 72 ohms unbalanced. RCA TUBE COMPLEMENT Tube Used Function (1) RCA 6BQ7 R -F Amplifier (2) RCA 6X8 R -F Oscillator and Mixer (3) RCA 6AU6 1st Picture I -F Amplifier (4) RCA 6BC6 2nd Picture I -F Amplifier (5) RCA 6CB6 3rd Picture I -F Amplifier (6) RCA 6CB6 4th Picture I -F Amplifier (7) RCA 6AG7 Video Amplifier (8) RCA 6AU6 1st Sound I -F Amplifier (9) RCA 6AU6 2nd Sound I -F Amplifier (10) RCA 6AL5 Ratio Detector (11) RCA 6AV6 1st Audio Amplifier (12) RCA 6AQ5 Audio Output (13) RCA 6CB6 AGC Amplifier (14) RCA 6SN7GT Sync Separator (15) RCA 6SN7GT Vert Sync Amplifier and Vert Sweep Osc. (16) RCA 6AQ5 Vertical Sweep Output (17) RCA 6SN7GT Horizontal Sync Amplifier (18) RCA 6SN7GT Horizontal Sweep Oscillator and Control (19) RCA 6CD6G Horizontal Sweep Output (20) RCA 6W4GT (2 tubes) Dampers (21) RCA 1B3-GT/8016 High Voltage Rectifier (22) RCA 5U4G (2 tubes) Rectifiers (23) RCA 21AP4 Kinescope 174 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE ELECTRICAL AND MECHANICAL SPECIFICATIONS (Continued) LOUDSPEAKERS OPERATING CONTROLS (Front Panel) Models 21T159, 21T159DE (971490-2) 8" PM dynamic, 3.2 ohms Models 21T165, 21T166DE, 21T174DE, 21T175DE, 21T178DE, 21T179DE (92561-14W) 12" PM Dynamic, 3.2 ohms Models 21T176, 177, 178 and 179 (971494-1W) 12" PM Dynamic, 3.2 ohms PICTURE INTERMEDIATE FREQUENCIES Picture Carrier Frequency Adjacent Channel Sound Trap Accompanying Sound Traps Adjacent Channel Picture Carrier Trap 45.75 mc. 47.25 mc. 41.25 mc. 39.25 mc. SOUND INTERMEDIATE FREQUENCIES Sound Carrier Frequency 41.25 nic. and 4.5 mc. VIDEO RESPONSE To 4 mc. FOCUS Magnetic SWEEP DEFLECTION Magnetic SCANNING Interlaced, 525 line HORIZONTAL SWEEP FREQUENCY 15,750 cps VERTICAL SWEEP FREQUENCY 60 cps FRAME FREQUENCY (Picture Repetition Rate) 30 cps Channel Selector Fine Tuning Picture t Brightness Picture Horizontal Hold t Picture Vertical Hold Sound Volume and On -Off Switch Tone Control and Phono Switch Dual Control Knobs Dual Control Knobs Dual Control Knobs Dual Control Knobs NON OPERATING CONTROLS (not including r -f and I -f adjustments) Picture Centering Width Height Horizontal Linearity top chassis adjustment rear chassis adjustment rear chassis adjustment rear chassis screwdriver adjustment Vertical Linearity rear chassis adjustment Vertical Peaking Control rear chassis adjustment Horizontal Drive rear chassis screwdriver adjustment Horizontal Oscillator Frequency rear chassis adjustment Horizontal Oscillator Waveform bottom chassis adjustment Horizontal Locking Range rear chassis adjustment Focus top chassis adjustment Ion Trap Magnet top chassis adjustment Deflection Coil top chassis wing nut adjustment AGC Control rear chassis adjustment HIGH VOLTAGE WARNING OPERATION OF THIS RECEIVER OUTSIDE THE CABINET OR WITH THE COVERS REMOVED, INVOLVES A SHOCK HAZARD FROM THE RECEIVER POWER SUPPLIES. WORK ON THE RECEIVER SHOULD NOT BE ATTEMPTED BY ANYONE WHO IS NOT THOROUGHLY FAMILIAR WITH THE PRECAUTIONS NECESSARY WHEN WORKING ON HIGH VOLTAGE EQUIPMENT. DO NOT OPERATE THE RECEIVER WITH THE HIGH VOLTAGE COMPARTMENT SHIELD REMOVED. BE SURE THE GROUND STRAP, BETWEEN THE YOKE ASSEMBLY AND THE CHASSIS, IS SECURELY FASTENED BEFORE TURNING THE RECEIVER ON. KINESCOPE HANDLING PRECAUTIONS DO NOT REMOVE THE RECEIVER CHASSIS, INSTALL, REMOVE OR HANDLE THE KINESCOPE IN ANY MANNER UNLESS SHATTERPROOF GOGGLES ARE WORN. PEOPLE NOT SO EQUIPPED SHOULD BE KEPT AWAY WHILE HANDLING KINESCOPES. KEEP THE KINESCOPE AWAY FROM THE BODY WHILE HANDLING. The kinescope bulb encloses a high vacuum and, due to its large surface area, is subjectea to considerable air pressure. For this reason, the kinescope must be handled with more care than ordinary receiving tubes. The large end of the kinescope bulb-particularly that part at the rim of the viewing surface-must not be struck, scratched or subjectc i to more than moderate pressure at any time. During service if the tube sticks or fails to slip smoothly into its socket, or deflecting yoke, investigate and remove the cause of the trouble. Do not force the tube. Refer to the Receiver Installation section for detailed instructions on kinescope installation. All RCA replacement kinescopes are shipped in special cartons and should be left in the cartons until ready for installation in the receiver. 2 OPERATING INSTRUCTIONS 21T159, 21T159DE, 21T165 175 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE The following adjustments are necessary when turning the receiver on for the first time. 1. See that the TV -PH switch is in the "TV" position. 2. Turn the receiver "ON" and advance the SOUND VOLUME control to approximately mid -position. 3. Set the STATION SELECTOR to the desired channel. 4. Adjust the FINE TUNING control for best pix and the SOUND VOLUME control for suitable volume. 8. Adjust the PICTURE and BRIGHTNESS controls for suitable picture contrast and brightness. 9. In switching from one channel to another, it may be necessary to repeat steps 4 and 8. 10. When the set is turned on again after an idle period it should not be necessary to re- peat the adjustment if the posi- tions of the controls have not been changed. If any adjustment is necessary, step number 4 is generally sufficient. 5. Turn the BRIGHTNESS control fully counter -clockwise, then clockwise until a light pattern appears on the screen. 6. Adjust the VERTICAL hold control until the pattern stops vertical movement. 7. Adjust the VERT CAL HORIZONTAL HOLD hold control until a picture is HORIZONTAL obtained and centered. HOLD ,..4....j....1---._____. BRIGHTNESS ON -OFF TONE .5.." SOUND & PHONO VOLUME SWITCH PICTURE STATION SELECTOR 11. If the positions of the controls have been changecli it may be necessary to repeat steps 2 through 8. CHANNEL NO. FINE TUNING 12. To use a record player, plug the record-player output cable into the PHONO jack on the rear apron, and set the TV -PH switch to "PH." Figure 1-Receiver Operating Controls INSTALLATION INSTRUCTIONS UNPACKING.-These receivers are shipped complete in cardboard cartons. The kinescope is shipped in place in the receiver. Take the receiver out of the carton and remove all packing material. Install the control knobs on the proper control shafts. Make sure that all tubes are in place and are firmly seated in their sockets. Check to see that the kinescope high voltage lead clip is in place. Plug a power cord into the 115 volt ac power source and into the receiver interlock receptacle. Turn the receiver power switch to the "on" position, the brightness control fully clockwise, and the picture control coun- ter -clockwise. ION TRAP MAGNET ADJUSTMENT.-Set the ion trap magnet approximately in the position shown in Figure 2. Starting from this position immediately adjust the magnet by moving it forward or backward at the same time rotating it slightly around the neck of the kinescope for the brightest raster on the screen. DEFLECTION YOKE ADJUSTMENT.-If the lines of the raster are not horizontal or squared with the picture mask, rotate the deflection yoke until this condition is obtained. Tighten the yoke adjustment wing screw. PICTURE ADJUSTMENTS.-It will now be necessary to obtain a test pattern picture in order to make further adjustments. Connect the antenna transmission line to the receiver. If the Horizontal Oscillator and AGC System are operating properly, it should be possible to sync the picture at this point. However, if the AGC control is misadjusted, and the receiver is overloading, it may be impossible to sync the picture. If the receiver is overloading, turn R175 on the rear apron (see Figure 3) counter -clockwise until the set operates normally and the picture can be synchronized. CHECK OF HORIZONTAL OSCILLATOR ALIGNMENT.Turn the horizontal hold control to the extreme counter -clockwise position. The picture should remain in horizontal sync. Momentarily remove the signal by switching off channel then back. Normally the picture will be out of sync. Turn the control clockwise slowly. The number of diagonal black bars will be gradually reduced and when only 2 bars sloping downward to the left are obtained, the picture will pull into sync upon slight additional clockwise rotation of the control. Pull -in should occur before the control has been turned 120 degrees from the extreme counter -clockwise position. The picture should remain in sync for approximately 90 degrees of additional clockwise rotation of the control. At the extreme clockwise position, the picture should remain in sync and should not show a black bar in the picture. If the receiver passes the above checks and the picture is normal and stable, the horizontal oscillator is properly aligned. Skip "Alignment of Horizontal Oscillator" and proceed with "Centering Adjustment." CENTERING ADJUSTMENT LOCK SCREW FOCUS CONTROL ION TRAP MAGNET OCUS MAGNET MOUNTING SCREW KINESCOPE SOCKET \CENTERING ADJUSTMENT LEVER DEFLECTION YOKE PUNE CUSHION DEFLECTION YOKE ADJUSTMENT SINE R203 R214 HEIGHT VERTICAL CONTROL LINEARITY CONTROL 12207 VERTICAL PEAKING CONTROL R209 HORIZONTAL LINEARITY CONTROL (OMITTED IN SOME RE MYERS ) J102 YOKE SOCKET L106 WIDTH CONTROL mr L 107 HORIZONTAL LINEARITY CONTROL WIDTH LINKr COMPARTMENT J103 OR INPUT 5175 01810 HORIZONTAL DRIVE AGC CONTROL CONTROL l& C18IA J104_ VIDEO JACK OR ZONTAL LROACKNINGGE1/4 T114 HORIZONTAL OSCILLATOR FREQ. ADJ. Figure 2 -Ion Trap and Centering Magnet Adjustments 3 Figure 3-Rear Chassis Adjustments 176 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 211178DE, 21T179, 21T179DE INSTALLATION INSTRUCTIONS ALIGNMENT OF HORIZONTAL OSCILLATOR.-- If in the above check the receiver failed to hold sync with the hold control at the extreme counter -clockwise position or failed to hold sync over 90 degrees of clockwise rotation of the control from the pull -in point, it will be necessary to make the following adjustments. Horizontal Frequency Adjustment.-Turn the horizontal hold control to the extreme clockwise position. Tune in a television station and adjust the T114 horizontal frequency adjustment at the rear of the chassis until the picture is just out of sync and the horizontal blanking appears as a vertical or diagonal black bar in the raster. Then turn the T114 core until the bar moves out of the picture leaving it in sync. Horizontal Locking Range Adjustment. -Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T114 rear core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 2 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C181 A slightly clockwise. If less than 2 bars are present, adjust C181A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 bars are present. Repeat the adjustments under "Horizontal Frequency Adjustment" and "Horizontal Locking Range Adjustment" until the conditions specified under each are fulfilled. When the horizontal hold operates as outlined under "Check of Horizontal Oscillator Alignment" the oscillator is properly adjusted. If it is impossible to sync the picture at this point and the AGC system is in proper adjustment it will be necessary to adjust the Horizontal Oscillator by the method outlined in the alignment procedure on Page 11. For field purposes paragraph "B" under Horizontal Oscillator Waveform Adjustment may be omitted. FOCUS MAGNET ADJUSTMENTS.-The focus magnet should be adjusted so that there is approximately three -eighths inch of space between the rear cardboard shell of the yoke and the flat of the front face of the focus magnet. This spacing gives best average focus over the face of the tube. The axis of the hole through the magnet should be parallel with the axis of the kinescope neck with the kinescope neck through the middle. CENTERING ADJUSTMENT.-No electrical centering controls are provided. Centering is accomplished by means of a separate plate on the focus magnet. The centering plate includes a locking screw which must be loosened before centering. Up and down adjustment of the plate moves the picture side to side and sidewise adjustment moves the picture up and down. If a corner of the raster is shadowed, check the position of the ion trap magnet. Reposition the magnet within the range of maximum raster brightness to eliminate the shadow and recenter the picture by adjustment of the focus magnet plate. In no case should the ion trap magnet be adjusted to cause any loss of brightness since such operation may cause immediate or eventual damage to the tube. In some cases it may be necessary to shift the position of the focus magnet in order to eliminate a corner shadow. WIDTH, DRIVE AND HORIZONTAL LINEARITY ADJUSTMENTS.-Adjustment of the horizontal drive control affects the high voltage applied to the kinescope. In order to obtain the highest possible voltage hence the brightest and best focused picture, adjust horizontal drive trimmer C181B for maximum drive (minimum capacity) consistent with a linear raster. Compression of the raster due to excessive drive can be seen as a white vertical bar or bars in the right half of the picture. Besides compression caused by excessive drive, another item to watch for is the change in linearity at the extreme left with changes of brightness control setting. By proper adjustment of the linearity coil, the changes in linearity with changes in brightness can be made negligible. In general, to achieve this condition, the linearity coil should be set slightly on the high inductance side (core slightly clockwise) of the optimum position and the linearity rheostat R209 should be as far clockwise as possible. Note: In late production receivers, R209 has been omitted since it normally was operated at zero resistance. Preset the following adjustments as directed: A.-Place the width plug (P105) in the minimum width position (top). B.-Set the width control coil L106 in approximately mid position. C.-Set the linearity control coil L107 near minimum inductance (counter -clockwise). D.-Set the linearity control rheostat near zero resistance (clockwise). E.-Set the drive capacitor C181B in the maximum drive position (counter -clockwise). If the raster is cramped or shows compression bars on the right half of the picture turn C181B clockwise until this condition is just eliminated. Adjust the linearity control coil L107 clockwise until best linearity and maximum deflection or best compromise are obtained then turn one quarter turn clockwise from this position. Retouch the drive trimmer C181B if necessary to obtain best linearity and maximum width. Check the horizontal linearity at various settings of the brightness control R218. There should be no compression of the right half and no appreciable change of linearity especially at the extreme left of the picture. If objectional change does occur, turn linearity coil L107 slightly clockwise and repeat the test. Adjust the width control L106 to fill the mask. If the left side of the picture appears stretched, turn the linearity control rheostat R209 counter -clockwise. If the left side of the picture is cramped, turn R209 clockwise. Whenever possible, correct nonlinearity by adjustment of R209 rather than by reduction of drive. If the line voltage is low and it becomes impossible to fill the mask, move the width plug P105 to the bottom position. The width coil L106 is inoperative in this position. HEIGHT AND VERTICAL LINEARITY ADJUSTMENTS.Adjust the height control (R203 on chassis rear apron) until the picture fills the mask vertically. Adjust vertical linearity (R214 on rear apron), until the test pattern is symmetrical from top to bottom. Adjustment of either control will require a readjustment of the other. If the top few lines of the picture are stretched or squeezed, adjust the vertical peaking control 8207 until this condition is corrected. FOCUS.-Adjust the focus magnet for maximum definition in the test pattern vertical "wedge" and best focus in the white areas of the pattern. Recheck the position of the ion trap magnet to make sure that maximum brightness is obtained. If necessary readjust centering to align the picture with the mask. CHECK OF R -F OSCILLATOR ADJUSTMENTS.-Tune in all available stations to see if the receiver r -f oscillator is adjusted to the proper frequency on all channels. If adjustments are required, these should be made by the method outlined in the alignment procedure on page 7. The adjustments for channels 2 through 12 are available from the front of the cabinet by removing the station selector escutcheon as shown in Figure 4. Adjustment for channel 13. is on top of the chassis. STATION SELECTOR FINE TUNING TO REMOVE ESCUTCHEON, SLIDE SPRING CLIP TO LEFT --OSCILLATOR ADJUSTMENT FOR CHANNEL NUMBER Figure 4--H-F Oscillator Adjustments 4 INSTALLATION INSTRUCTIONS 177 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE AGC THRESHOLD CONTROL.-The AGC threshold control R175 is adjusted at the factory and normally should not require readjustment in the field. To check the adjustment of the AGC Threshold Control, tune in a strong signal and sync the picture. Momentarily remove the signal by switching off channel and then back. If the picture reappears immediately, the receiver is not overloading due to improper setting of R175. If the picture requires an appreciable portion of a second to reappear, or bends excessively, R175 should be readjusted Turn R175 fully counter -clockwise. The raster may be bent slightly. This should be disregarded. Turn R175 clockwise until there is a very, very slight bend or change of bend in the picture. Then turn R175 counter -clockwise just sufficiently to remove this bend or change of bend. If the signal is weak, the above method may not work as it may be impossible to get the picture to bend. In this case, turn R175 clockwise until the snow in the picture becomes more pronounced, then counter -clockwise until the best signal to noise ratio is obtained. The AGC control adjustment should be made on a strong signal if possible. If the control is set too far clockwise on a weak signal, then the receiver may overload when a strong signal is received. FM TRAP ADJUSTMENT.-In some instances interference may be encountered from a strong FM station signal. A trap is provided to eliminate this type of interference. To adjust the trap tune in the station on which the interference is observed and adjust the L58 core on top of the antenna matching transformer for minimum interference in the picture. CAUTION.-In some receivers, the FM trap L58 will tune down into channel 6 or even into channel 5. Needless to say, such an adjustment will cause greatly reduced sensitivity on these channels. If channels 5 or 6 are to be received, check L58 to make sure that it does not affect sensitivity on these two channels. Replace the cabinet back and connect the receiver antenna leads to the cabinet back. Make sure that the screws holding it are up tight, otherwise it may rattle or buzz when the receiver is operated at high volume. CABINET ANTENNA.-A cabinet antenna is provided in these receivers and the leads are brought out near the antenna terminal board. The cabinet antenna may be employed in place of the outdoor antenna in areas where the signals are strong and no reflections are experienced. KINESCOPE HANDLING PRECAUTION.-Do not install, remove, or handle the kinescope in any manner, unless shatter. proof goggles and heavy gloves are worn. People not so equipped should be kept away while handling the kinescope. Keep the kinescope away from the body while handling. Handle this tube by the metal rim at the edge of the screen. Do not cover the glass bell of the tube with fingermarks as it will produce leakage paths which may interfere with reception. If this portion of the tube has inadvertently been handled, wipe it clean with a soft cloth moistened with "dry" carbon tetrachloride. To remove the kinescope from the cabinet, loosen the two nuts and disengage the rods alongside the kinescope. Remove the wing screw which holds the yoke frame to the cabinet. Remove the kinescope, the yoke frame with yoke and focus or centering magnet as an assembly. INSTALLATION OF KINESCOPE.-Handle this tube by the metal rim at the edge of the screen. Do not cover the glass bell of the tube with fingermarks as it will produce leakage paths which may interfere with reception. If this portion of the tube has inadvertently been handled, wipe it clean with a soft cloth moistened with "'dry" carbon tetrachloride. Wipe the kinescope screen surface and front panel safety glass clean of all dust and fingermarks with a soft cloth moistened with "Windex" or similar cleaning agent. Turn the tube so that the key on the base of the tube will be down and insert the neck of the kinescope through the deflection coil and focus magnet. If the tube sticks or fails to slip into place smoothly, investigate and remove the cause of the trouble. Do not force the tube. Replace the kinescope and yoke frame assembly in the cabinet. Insert the wing screw and tighten. Engage the two side rods into the yoke frame and tighten the two nuts. Slide the deflection yoke as far forward as possible. If this is not done, difficulty will be encountered in adjusting the ion trap and focus magnet because of shadows on the corner of the raster. Slide the chassis into the cabinet, then insert and tighten the four chassis bolts. Slip the ion trap magnet over the neck of the kinescope. Connect the kinescope socket to the tube base and connect the high voltage lead from the rim of the kinescope into the high voltage bushing on the high voltage compartment. Reconnect all other cables. Do not forget to replace the yoke frame grounding strap. Perform the entire set-up procedure beginning with the Ion Trap Magnet Adjustment. ANTENNAS.-The finest television receiver built may be said to be only as good as the antenna design and installation. It is therefore important to select the proper antenna to suit the particular local conditions, to install it properly and orient it correctly. If two or more stations are available and the two stations are in different directions, it may be possible to make a compromise orientation which will provide a satisfactory signal on all such channels. mminIoesftaraeniltscl hfaioassnrienmtpuepalrsnro,aisntseigitbamtlhneeatetyaonnbnoteaebcntfoanoimarnowesnahneteeinscoferasswmcstaiootrcrlyyehiecrniehgtshaucnehlrntasetnolonsneplrsaoonnovderidttoooer switch antennas when switching channels. In some cases, the antenna should not be installed perma- nently until observed on the quality a television of the picture reception has been receiver. A temporary transmission line can be run sufficient slack between receiver to permit moving athnedatnhteenannate. nTnhae,n,alwlowithinag telephone system connecting an observer at the receiver and an assistant at the antenna, the antenna can be positioned to give the most satisfactory results on the received signal. A shift of direction or a few feet in antenna position may effect a tremendous difference in picture reception. REFLECTIONS.-Multiple images sometimes known as echoes or ghosts, are caused by the signal arriving at the antenna by two or more routes. The curs when a signal arrives at second or subsequent image octhe antenna after being reflected off a building, a hill or other object. In severe cases of reflec- tions, even the sound may be distorted. In less severe cases, reflections may occur that are not noticeable as reflections but that will instead cause a loss of definition in the picture. Under certain extremely unusual conditions, it may be pos- sible to rotate or position the antenna so that it receives the cleanest antenna picture should obveesroaproefslieticotendedp.aHtho. wIefvseurc, hsiuscthhea case, the position may give variable results as the nature of reflecting surfaces may vary with weather conditions. known to have different reflecting Wet surfaces have been characteristics than dry surfaces. Depending upon the circumstances, it may be possible to eliminate the reflections by rotating the antenna or by moving it to a new location. In extreme cases, it may be impossible to eliminate the reflection. INTERFERENCE.-Auto chinery and diathermy iagpnpitaiorna,tusstrmeeat yccaarsu, seeleicnttreicrfaelremnac-e lwochaictihonspsohiolsutlhdebepircetmuroe.vedWahsenfeavrearsppoossssibiblele, the antenna from high- wfkfeeeraeeeytnp)sc,aeth.whoeasyIpaninftramtoelsmno, nudoanottchritoneordgrssatnhatetoefnlafenniacatsesets,nman1nae/d,t4acslwaimrareoivlomeafrslues,songtugurttbchteeer(ssatoatofklreieonanttshettero6-r metal objects. Short-wave radio transmitting and receiving equipment may cause interference in the rthipeplienst.erfIenresnocmeebiynsthtaenucsees picture in it may be of a trap in the form of moving possible to eliminate the antenna transmis- sion line. frequency However, it the interfering as the television station, a signal is on the same trap will provide no improvement. WEAK PICTURE.-When the installation is near the limit of btshteeeasadpryeecaoknsleetrhdve,eshdcarbveyienntgh. eaTtr"hasinnssocmwoint"tdiinteigoffnsetcaits,tidoaunne,dttohmleaapcykicnotuofrteshimgonlaadyl strength from the transmitter. 5 178 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE TO ANTENNA TERMINALS JEWEL LIGHT CHASSIS TOP VIEW T2 ANTENNA MATCHING TRANSFORMER 68V32 7 R -F AMR V1 6 X 8 OSC. & MIXER ts, T1 1 CONVERTER I 1kV7,, TRANSFORMERI SPEAKER CABLE FINE TUNING CONTROL CHANNEL SELECTOR SWITCH R203 HEIGHT CONTROL 7102. RATIO 0DET. It 172,7A VERT. PEAKIN TRANS. 6A1L0 5 R214 RATIO DET v111 6CB6 R20 AGC FE NOR MP LIN 1109 5TH PIX I -F V101 6A U6 IS SND.1-F -1110 L107 HORIZ. LIN. TEST POINT TP102 LI 06 WIDTH VI12 6SN7GT HOR.SYNC AMP. TEST POINT TP101 T108 4TH PIX I -F TRANS. . 6C06 HOR1Z. I I.vSuWrEpEuPy 65VN171G6 T swHcOsRr IoZ.sci 4ONTR9L r- vita 6DWAvMi4tpaGETRIIIlIivoHuIrGAHGElI'i!,D6WvAi4MtPoGERT , 1 III II V113 6SN7GT SYNC. EPARATOR R167 PICTURE CONTROL C197 1 I = = =4 T113 POWER TRANSFORMER T107 3RD PIX I -F TRANS. r--fjar SIOI TONE CONTROL & PHONO SWITCH lI I, _ J6_::-1.417,17.4i1l R243 BLEEDER 5102- R117 ON -OFF SWITCH & VOL.CONTROL FC71 2ND ,IXO GRAD TRANS. 1-176-15 1ST PM() I -F PLT/It.TLRAANS. O 105 6A05 AUDIO UT PU T104 1ST PIX C) GRID TRANS. R218 R218 9RIGHT NESS CONTROL T112 VERTICAL SWEEP OUTPUT TRANSFORMER L108 FILTER CHOKE (V715. HAGS VERT. SWP. OUTPUT V114 65147GT VERT SYNC I1MAP 5V SWP OSC. T111 VERTICAL OSCILLATOR TRANSFORMER R167 PICTURE CONTROL R 201 A VERTICAL HOLD CONT ROL R20IB HORIZONTAL HOLD CONTROL KINESCOPE SOCKET Figure 5-Chassis Top View 6 POWER CORD CHASSIS BOTTOM VIEW 179 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE FINE TUNING CONTROL C-11 CHANNEL SELECTOR SWITCH R -F UNIT 5101 TONE CONTROL 6. PHONO SWITCH T2 ANTENNA MATCHING TRANSFORMER TO ANTENNA TERMINALS JEWEL LIGHT SPEAKER CABLE 5102, 12t17 ON -OFF SWITCH 6, VOLUME CONTROL R218 BRIGHTNESS CONTROL F-1 R167 PICTURE CONTROL R201A VERTICAL HOLD CONTROL R2 0113 HORIZONTAL HOLD CONTROL P243 BLEEDER L108 FILTER CHOKE T111 VERTICAL OSCILLATOR TRANS. TIO7 TIO8 3RD PIX I -F 4TH PIX I -F TRANS. TRANS. VIO ELBE 2ND PI I -F C10 AMP. 108 6C B6 3RD Pot I -F AMP 6vA10055 AUDIO OUTPUT Vt04 64V6 AUDIO AMP. V61A0u6 1ST PIX F M. V110 6AG7 VIDEO AMP. 101 SNOB I -F viOI 6AU6 1ST SND I -F MP. 6vA10U26 2605ND I -F AMP v103 RA6ATILO5 DET V1I2 6 5N7GT HORIZ. SYNC V111 6CB6 A GC AMP. v123 5U4G RECTIFIER 6VA10155 SWEEP UTP VI14 65N7GT VERT. SYNC. AMR &VERT SWEE OSC VI22 5 U4G RECTIFIE R167 PICTURE CONTROL v113 65N7GT SYNC. SEPARATO T113 POWER TRANSFORMER VHG 6SN7GT HORIZ. SWEEP OSC. AND V117 6C D6 HORIZ SWEEP OUTPU ONTRO 1k--1 IBV311G8 V. i,----... ' " --1301611 HIGH 1, VOLTAGEii 6W4GT RECT. IIDAMPER It 11 POWER CORD KINESCOPE ROCKET Figure 6-Chassis Bottom View 7 180 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE ALIGNMENT PROCEDURE TEST EQUIPMENT. -To properly service the television chassis of this receiver, it is recommended that the following test equipment be available: R -F Sweep Generator meeting the following requirements: (a) Frequency Ranges 35 to 90 mc., 1 mc. to 12 mc. sweep width 170 to 225 mc., 12 mc. sweep width (b) Output adjustable with at least .1 volt maximum. (c) Output constant on all ranges. (d) "Flat" output on all attenuator positions. Cathode -Ray Oscilloscope. - For alignment purposes, the oscilloscope employed must have excellent low frequency and phase response. For video and sync waveform observations, the oscilloscope must have excellent frequency and phase response from 10 cycles to at least two megacycles in all positions of the gain control. Signal Generator to provide the following frequencies with crystal accuracy. (a) Intermediate frequencies 4.5 mc., 39.25 mc., 41.25 mc., 45.75 mc., 47.25 mc. (b) Radio frequencies Channel Number 2 3 4 5 6 7 8 9 10 11 12 13 Picture Carrier Freq. Mc. 55.25 61.25 67.25 77.25 83.25 175.25 181.25 187.25 193.25 199.25 205.25 211.25 Sound Carrier Freq. Mc. 59.75 65.75 71.75 . 81.25 87.75 179.75 185.75 191.75 197.75 203.75 209.75 215.75 Receiver R -F Osc. Freq. Mc. 101 107 113 123 129 221 227 233 239 245 251 257 (c) Output of these ranges should be adjustable and at least .1 volt maximum. Heterodyne Frequency Meter with crystal calibrator if the signal generator is not crystal controlled. Electronic Voltmeter of Junior or Senior "VoltOhmyst" type and a high voltage multiplier probe for use with this meter to permit measurements up to 20 kv. ORDER OF ALIGNMENT. -When a complete receiver align- ment is necessary, it can be most conveniently performed in the following order: (1) Ant. Matching Unit ( 6 ) Picture I -F Traps (2) R -F Unit (7) Picture I -F Trans. (3) Ratio Detector (8) Sweep Alignment of I -F (4) Sound I -F Trans. (9) Horizontal Oscillator (5) Sound Take -Off Trans. (10) Sensitivity Check ANTENNA MATCHING UNIT ALIGNMENT. - The antenna matching unit is accurately aligned at the factory. Adjustment of this unit should not be attempted in the customer's home since even slight misalignment may cause serious attenuation of the signal especially on channel 2. The r -f unit is aligned with a particular antenna matching transformer in place. If for any reason, a new antenna matching transformer is installed, the r -f unit should be realigned. The F -M Trap which is mounted in the antenna matching unit may be adjusted without adversely affecting the alignment of the unit. To align the antenna matching unit disconnect the lead from the F -M trap L58 to the channel selector switch S1E or S5. With a short jumper, connect the output of the matching unit through a 1000 mmf. capacitor to the grid of the second pix i-f amplifier, pin 1 of V107. Replace the cover on the matching unit while making all adjustments. Remove the first pix i-f amplifier tube V106. Connect the positive terminal of a bias box to the chassis and the potentiometer arm to the junction of R143 and R144. Set the potentiometer to produce approximately -6.0 volts of bias at the junction of R143 and 11144. Connect an oscilloscope to the video test point TP102 or pin 4, V110 and set the oscilloscope gain to maximum. Connect a signal generator to the antenna input terminals. Modulate the signal generator 30% with an audio signal. Tune the signal generator to 45.75 mc. and adjust the generator output to give an indication on the oscilloscope. Adjust L59 in the antenna matching unit for minimum audio indication on the oscilloscope. Tune the signal generator to 41.25 mc. and adjust L60 for minimum audio indication on the oscilloscope. Remove the jumper from the output of the matching unit. Connect a 300 ohm ,,/2 watt composition resistor from L58 to ground, keeping the leads as short as possible. Connect an oscilloscope low capacity crystal probe from L58 to ground. The sensitivity of the oscilloscope should be approximately 0.63 volts per inch. Set the oscilloscope gain to maximum. Connect the r -f sweep generator to the matching unit antenna input terminals. In order to prevent coupling reactance from the sweep generator into the matching unit, it is advisable to employ a resistance pad at the matching unit terminals. Figure 11 shows three different resistance pads for use with sweep generators with 50 ohm co -ax output, 72 ohms co -ax output or 300 ohm balanced output. Choose the pad to match the output impedance of the particular sweep employed. Connect the signal generator loosely to the matching unit antenna terminals. Set the sweep generator to sweep from 45 mc. to 54 mc. With RCA type WR59A sweep generators, this may be accomplished by retuning channel number 1 to cover this range. With WR59B sweep generators this may be accomplished by retuning channel number 2 to cover the range. In making these adjustments on the generator, be sure not to turn the core too far clockwise so that it becomes lost beyond the core retaining spring. Adjust L61 and L62 to obtain the response shown in figure 12. L61 is most effective in locating the position of the shoulder of the curve at 52 mc. and L62 should be adjusted to give maximum amplitude at 53 mc. and above consistent with the specified shape of the response curve. The adjustments in the matching unit interact to some extent. Repeat the above procedure until no further adjustments are necessary. Remove the 300 ohm resistor and crystal probe connections. Restore the connection between L58 and SlEor S5. Replace V106. R -F UNIT ALIGNMENT. -An r -f unit which is operative and requires only touch up adjustments, requires no presetting of adjustments. For such units, skip the remainder of this paragraph. For units which are completely out of adjustment, preset all adjustments to the approximate center of their range with the following exceptions. Set C18 so that the screw head is approximately three -eighths of an inch above chassis. Set C11 near maximum capacity (one -quarter turn from tight). Do not change any of the adjustments in the antenna matching unit. Disconnect the link from terminals "A" and "B" of T104 and terminate the link with a 39 ohm composition resistor. The r -f unit is aligned with zero A -G -C bias. To insure that the bias will remain constant, take a clip lead and short circuit the r -f unit power terminal board terminal 3 to ground. Connect the oscilloscope to the test point TP1 on top of the r -f unit. Set the oscilloscope gain to maximum. Turn the receiver channel selector switch to channel 2. Connect the output of the signal generator to the grid of the r -f amplifier, V2. To do this, remove the tube from the socket and fashion a clip by twisting one end of a small piece of wire around pin number 7. Replace the tube in the socket leaving the end of the wire protruding from under the tube. Connect the signal generator to this wire through a 1,500 mmf. capacitor. Tune the signal generator to 43.5 mc. and modulate it 30% with a 460 cycle sine wave. Adjust the signal generator for maximum output. Adjust L65 on top .of the r -f unit for minimum 400 cycle indication on the oscilloscope. If necessary, this adjustment can be retouched in the field to provide additional rejection to one specific frequency in the i-f band pass. However, in such cases, care should be taken not to adjust it so as to reduce sensitivity on channel 2. 8 ALIGNMENT PROCEDURE 181 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE Remove the wire clip from pin 7 of V2 and replace the tube and tube shield. Set the channel selector switch to channel 8. Turn the fine tuning control 30 degrees clockwise from the center of its mechanical range now and at all times when adjusting the oscillator frequency. Adjust CI in KRK11 or C2 in KRK11A for proper oscillator frequency, 227 mc. This may be done in several ways. The easiest way and the way which will be recommended in this procedure will be to use the signal generator as a heterodyne frequency meter and beat the oscillator against the signal generator. To do this, tune the signal generator to 227 mc. with crystal accuracy. Insert one end of a piece of insulated wire into the r -f unit through the hole provided for the adjustment for C11. Be careful that the wire does not touch any of the tuned circuits as it may cause the frequency of the r -f unit oscillator to shift. Connect the other end of the wire to the "r -f in" terminal of the signal generator. Adjust Cl in KRK11 or C2 in KRK11A to obtain an audio beat with the signal generator. Note-If, on some KRK11A units, it is not possible to reach the proper channel 8 oscillator frequency by adjustment of C2, switch to channel 13 and adjust L46 to obtain proper channel 13 oscillator frequency as indicated in the table on page 10. Then switch to channel 12 and adjust L11 to obtain proper channel 12 oscillator frequency. Continue down to channel 8 adjusting the appropriate oscillator trimmer to obtain the proper frequency on each channel. Then again on channel 8 adjust C2 to obtain proper channel 8 oscillator frequency. Switch back to channel 13 and adjust L46 and back to channel 8 and adjust C2. Set the T1 core for maximum inductance (core turned counter -clockwise). Connect the sweep generator th rough a suitable attenuator as shown in Figure 11 to the input terminals of the antenna matching unit. Connect the signal generator loosely to the antenna ter- minals. Set the sweep generator to cover channel 8. Set the oscilloscope to maximum gain and use the minimum input signal which will produce a usable pattern on the oscilloscope. Excessive input can change oscillator injection during alignment and produce consequent misalignment even though the pattern on the oscilloscope may look normal. Insert markers of channel 8 picture carrier and sound carrier, 181.25 mc. and 185.75 mc. Adjust C9, C11, C15 and C18 for approximately correct curve shape, frequency, and band width as shown in Figure 13. The correct adjustment of C18 is indicated by maximum amplitude of the curve midway between the markers. C15 tunes the r -f amplifier plate circuit and affects the frequency of the pass band most noticeably. C9 tunes the mixer grid circuit and affects the tilt of the curve most noticeably (assuming that C18 has been properly adjusted). C11 is the coupling adjustment and hence primarily affects the response band width. Set the receiver channel switch to channel 6. Adjust the signal generator to the channel 6 oscillator frequency 129 mc. Turn the fine tuning control 30 degrees clockwise from the center of its mechanical range. Adjust L5 for an audible beat with the signal generator as before. Set the sweep generator to channel 6. From the signal generator, inset, channel 6 sound and picture carrier markers, 83.25 mc. and 87.75 mc. Adjust L48, L50 and L53 for proper response as shown in Figure 13. L50 tunes the r -f amplifier plate circuit and primarily affects the frequency of the pass band. L53 tunes the r -f amplifier grid and is adjusted to give maximum amplitude of the curve between the markers. L48 affects the tilt of the curve but not quite the same as C9 adjustment. When the circuits are correctly adjusted and L48 is rocked on either side of its proper setting, the high frequency (sound carrier) end of the curve appears to remain nearly fixed in amplitude while the picture carrier end tilts above or below this point. Turn off the sweep and signal generators. Connect the "VoltOhmyst" to the r -f unit test point TP1. Adjust the oscillator injection trimmer C8 for -3.5 volts or at maximum if -3.5 volts cannot be reached. This voltage should fall between -2.5 and -5.5 volts on all channels when the alignment of all circuits is completed. Turn the sweep generator and signal generator back on and recheck channel 6 response. Readjust L48, L50 and L53 if necessary. Set the receiver channel selector switch to channel 8 and readjust CI in KRK11 or C2 in KRK11A for proper oscillator frequency, 227 mc. Set the sweep generator and signal generator to channel 8. Readjust C9, C11, C15 and C18 for correct curve shape, frequency and band width. Turn off the sweep and signal generators, switch back to channel 6 and check the oscillator injection voltage at TP1 if C9 was adjusted in the recheck of channel 8 response. If the initial setting of oscillator injection trimmer C8 was far off, it may be necessary to adjust the oscillator frequency and response on channel 8, adjust the oscillator injection on channel 6 and repeat the procedure several times before the proper setting is obtained. Turn off the sweep generator and switch the receiver to channel 13. Adjust the signal generator to the channel 13 oscillator fre- quency 257 mc. Set the fine tuning control 30 degrees clockwise from the center of its mechanical range. Adjust L46 to obtain an audible beat. Slightly overshoot the adjustment of L46 by turning the slug a little more in the same direction from the original setting, then reset the oscillator to proper frequency by adjusting Cl in KRK11 or C2 in KRK11A to again obtain the ,beat. Check the response of channels 7 through 13 by switching the receiver channel switch, sweep generator and marker oscillator to each of these channels and observing the response and oscillator injection obtained. See Figure 13 for typical response curves. It should be found that all these channels have the proper shaped response with the markers above 80% response. If the markers do not fall within this requirement, switch to channel 8 and readjust C9, C11, C15 and C18 as necessary. Turn off the sweep generator and check the channel 8 oscillator frequency. If CI or C2 was readjusted for channel 8, the principle of overshooting the adjustment and then correct- ing by adjusting L46 should be followed in order to establish the L/C ratio for the desired oscillator tracking. Turn off the sweep generator and check the channel 6 oscillator frequency. Adjust L5 for correct oscillator frequency, 129 mc. Turn the sweep generator on and to channel 6 and observe the response curve. If necessary readjust L48, L50 and L53. For KRK11A units switch to channel 2 and tune T1 clockwise to a point where there is no change in the channel 2 response as T1 is turned. Switch the receiver through channel 6 down through channel 2 and check for normal response curve shapes and oscillator injection voltage. If excessive tilt in the same direction occurs on channels 2, 3 and 4, adjust C18 on channel 2 to overshoot the correction of this tilt, then switch to channel 6 and adjust L53 for maximum amplitude of curve between carrier markers. This adjustment should produce "flat" response on the low channels if the other adjustments, especially L48, are correct. Likewise check r -f response and oscillator injection on channels 7 through 13, stopping on 13 for the next step. With the receiver on channel 13, check. the receiver oscillator frequency. Correct by adjustment of Cl in KRK11 or C2 in KRK11A if necessary. Adjust the oscillator to frequency on all channels by switching the receiver and the frequency standard to each channel and adjusting the appropriate oscillator trimmer to obtain the audible beat. It should be possible to adjust the oscillator to the correct frequency on all channels with the fine tuning control in the middle third of its range. When employing WR39 calibrators to adjust the receiver oscillator, tune the calibrator to one half the receiver oscillator frequency on channels 4, 5 and 6 and to one fourth the receiver oscillator frequency on channels 11, 12 and 13. 9 182 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE ALIGNMENT PROCEDURE Channel Number Picture Carrier Freq. Mc. Sound Carrier Freq. Mc. Receiver Channel R -F Osc. Oscillator Freq. Mc. Adjustment 2 55.25 59.75 101 LI 3 61.25 65.75 107 L2 4 67.25 71.75 113 L3 5 77.25 81.75 123 L4 6 83.25 87.75 129 L5 7 175.25 179.75 221 L6 8 181.25 185.75 227 L7 9 187.25 191.75 233 L8 10 193.25 197.75 239 L9 11 199.25 203.75 245 L10 12 205.25 209.75 251 L11 13 211.25 215.75 257 CI Remove the 39 ohm resistor from the link and reconnect the link to terminals "A" and "B.' of T104. RATIO DETECTOR ALIGNMENT. -In order to obtain good ratio detector alignment an AM modulated signal generator that is exceptionally free from FM modulation must be employed. Set the signal generator at 4.5 mc. and connect it to the second sound i-f grid, pin 1 of V102. Set the generator for 30% 400 cycle modulation. As an alternate source of signal, the RCA WR39B or WR39C calibrator may be employed. If used, connect it to the grid of the 4th pix i-f amplifier, pin 1, V109. Set the frequency of the calibrator to 45.75 (pix carrier) and modulate with 4.5 mc. crystal. Also turn on the internal AM audio modulation. The 4.5 mc. signal will be picked off at T110A and amplified through the Sound i-f amplifier. Connect the "VoltOhmyst" to the junction of R110 and R114. Connect the oscilloscope across the speaker voice coil and turn the volume control for maximum output. Adjust C226 on the bottom of the V103 socket for minimum capacity. Tune the ratio detector primary, T102 top core for maximum DC output on the "VoltOhmyst." Adjust the signal level from the signal generator for minus 10 volts on the "VoltOhmyst" when finally peaked. This is approximately the operating level of the ratio detector for average signals. Connect the "VoltOhmyst" to the junction of R112 and C113. Adjust the T102 bottom core for zero d -c on the meter. Then, turn the core to the nearest minimum AM output on the oscilloscope. Repeat adjustments of T102 top for maximum DC and T102 bottom for minimum 'output on the oscilloscope making final adjustment with the 4.5 mc. input level adjusted to produce 10 volts d -c on the "VoltOhmyst" at the junction of R110 and R114. Connect the "VoltOhmyst" to the junction of R112 and C113 and note the amount of d -c present. If this voltage exceeds ±1.5 volts, adjust C226 by turning it in until zero d -c is obtained. Readjust the T102 bottom core for minimum output on the oscilloscope. Repeat adjustments of C226 and T102 bottom core until the voltage at R112 and C113 is less than ±1.5 volts when T102 bottom core is set for minimum output on the oscilloscope. Connect the "VoltOhmyst" to the junction of R110 and R114 and repeak T102 top core for maximum d -c on the meter and again reset the generator so as to have -10 volts on the meter. Repeat the adjustments in the above two paragraphs until the voltage at R112 and C113 is less than ±1.5 volts when the T102 top core is set for maximum d -c at the junction of R110 and R114 and the T102- bottom core is set for minimum indica- tion on the oscilloscope. SOUND I -F ALIGNMENT. -Connect the sweep generator to the first sound i-f amplifier grid, pin 1 of V101. Adjust the generator for a sweep width of 1 mc. at a center frequency of 4.5 mc. Insert a 4.5 mc. marker signal from the signal generator into the first sound i-f grid. With the WR39B or WR39C calibrators the 4.5 mc. crystal signal may be obtained at the R -F out terminal by turning the variable osc. switch off, the calibrate switch to 4.5 mc. and the volume control with mod. off. Connect the oscilloscope in series with a 10,000 ohm resistor to terminal A of T101. Adjust T101 top and bottom cores for maximum gain and symmetry about the 4.5 mc. marker on the i-f response. The pattern obtained should be similar to that shown in Figure 14. The output level from the sweep should be set to produce approximately 2.0 volt peak -to -peak at terminal A of T101 when the final touches on the above adjustment are made. It is neces- sary that the sweep output voltage should not exceed the specified values otherwise the response curve will be broadened, permitting slight misadjustment to pass unnoticed and possibly causing distortion on weak signals. Connect the oscilloscope to the junction of R112 and C113 and check the linearity of the response. The pattern obtained should be similar to that shown in Figure 15. SOUND TAKE -OFF ALIGNMENT. -Connect the 4.5 mc. gen- erator in series with a 1000 ohm resistor to terminal "C" of T110. The input signal should be approximately 0.5 volt. Short the fourth pix i-f grid to ground, pin 1 V109, to prevent noise from masking the output indication. As an alternate source of signal the RCA WR39B or WR39C calibrator may be used. In such a case, disregard the above two paragraphs. Connect calibrator across link circuit, T104 A, B, and modulate 45.75 with 4.5 mc. crystal. Connect the crystal diode probe of a "VoltOhmyst" to the plate of the video amplifier, pin 8 of V110. Adjust the core of T110 for minimum output on the meter. Remove the short from pin 1 V109 to ground, if used. PICTURE I -F TRAP ADJUSTMENT. -Connect the i-f signal generator across the link circuit on terminals A and B of T104. Connect the "VoltOhmyst" to the junction of RI43 and R144. Obtain a 7.5 volt battery capable of withstanding appreciable current drain and connect the ends of a 1,000 ohm potentiometer across it. Connect the battery positive terminal to chassis and the potentiometer arm to the junction of R143 and R144. Set the bias to produce approximately -1.0 volt of bias at the junction of R143 and R144. Connect the "VoltOhmyst" to pin 4 of V110, the 6AG7 video amplifier. Set the signal generator to each of the following frequencies and adjust the corresponding circuit for minimum d -c output at pin 4 of V110. Use sufficient signal input to produce 1.0 volt of d -c on the meter when the final adjustment is made. 39.25 mc. 41.25 mc. 47.25 mc. T104 top core T105 bottom core T106 bottom core PICTURE I -F TRANSFORMER ADJUSTMENTS. -Set the sig- nal generator to each of the following frequencies and peak the specified adjustment for maximum indication on the "VoltOhmyst." During alignment, reduce the input signal if necessary in order to produce 1.0 volt of d -c at pin 4 of V110 with -1.0 volt of i-f bias at the junction of R143 and R144. 43.7 mc. T109 45.5 mc. 41.8 mc. T108 T107 To align 1105 and T106, connect the sweep generator to the first picture i-f grid, pin 1 of V106 through a 1000 mmf. ceramic capacitor. Shunt R141, R149 and terminals "A" and "F" of T109 with 330 ohm composition resistors. Set the i-f bias to -1.0 volt at the junction o4. R143 and R144. Connect the oscilloscope to pin 4 of V110. Adjust 1105 and 1106 top cores for maximum gain and curve shape as shown in Figure 16. For final adjustment set the output of the sweep generator to produce 0.5 volt peak -to -peak at the oscilloscope terminals. To align T1 and T104, connect the sweep generator to the mixer grid test point TP2. Use the shortest leads possible, with not more than one inch of unshielded lead at the end of the sweep cable. Set the channel selector switch to channel 4. Connect a 180 ohm composition resistor from terminal B of T105 to the junction of R135 and C132. Connect the oscilloscope diode probe to terminal B of 1105 and to ground. Couple the signal generator loosely to the diode probe in order to obtain markers. In some receivers, C220 is variable and is provided as a bandwidth adjustment. Preset C220 to minimum capacity. Adjust Ti (top) and T104 (bottom) for maximum gain at 43.5 mc. and with 45.75 mc. at 70% of maximum response. 10 ALIGNMENT PROCEDURE 183 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE Adjust C220 until 41.25 mc. is at 85% response with respect to the low frequency shoulder at approximately 41.9 mc. as shown in Figure 17. In receivers in which C220 is fixed, adjust T1 (top) and T104 (bottom) for maximum gain and the response shown in Figure 17. Disconnect the diode probe, the 180 ohm and three 330 ohm resistors. SWEEP ALIGNMENT OF PIX I-F.-Connect the oscilloscope to pin 4 of V110. Adjust the bias potentiometer to obtain -6.0 volts of bias as measured by a "VoltOhmyst" at the junction of R143 and R144. Leave the sweep generator connected to the mixer grid test point TP2 with the shortest leads possible and with not more than one inch of unshielded lead at the end of the sweep cable. If these precautions are not observed, the receiver may be unstable and the response curves obtained may be unreliable. Adjust the output of the sweep generator to obtain 3.0 volts peak -to -peak on the oscilloscope. Couple the signal generator loosely to the grid of the first pix i-f amplifier. Adjust the output of the signal generator to produce small markers on the response curve. Retouch T108 and T109 to obtain the response shown in Figure 18. Do not adjust T107 unless absolutely necessary. If T107 is adjusted too low in frequency it will raise the level of the 41.25 mc. sound i-f carrier and may create interference in the picture. It will also cause poor adjacent channel picture rejection. If T107 is tuned too high in frequency, the level of the 41.25 mc. sound i-f carrier will be too low and may produce noisy sound in weak signal areas. Remove the oscilloscope, sweep and signal generator con- nections. Remove the bias box employed to provide bias for alignment. HORIZONTAL OSCILLATOR ADJUSTMENT. - Normally the adjustment of the horizontal oscillator is not considered to be a part of the alignment procedure, but since the oscillator waveform adjustment may require the use of an oscilloscope, it can not be done conveniently in the field. The waveform adjustment is made at the factory and normally should not require readjustment in the field. However, the waveform adjustment should be checked whenever the receiver is aligned or whenever the horizontal oscillator operation is improper. Horizontal Frequency Adjustment.-Tune in a station and sync the picture. If the picture cannot be synchronized with the horizontal hold control R201B, then adjust the T114 frequency core on the rear apron until the picture will synchronize. If the picture still will not sync, turn the T114 waveform adjustment core (under the chassis) out of the coil several turns from its original position and readjust the T114 frequency core until the picture is synchronized. Examine the width and linearity of the picture. If picture width or linearity is incorrect, adjust the horizontal drive control C181B, the width control L106 and the linearity control L107 until the picture is correct. Horizontal Oscillator Waveform Adjustment.-The horizontal oscillator waveform may be adjusted by either of two methods. The method outlined in paragraph A below may be employed in the field when an oscilloscope is not available. The service shop method outlined in paragraph B below requires the use of an oscilloscope. A.-Turn the horizontal hold control completely clockwise. Place adjustment tools on both cores of T114 and be prepared to make simultaneous adjustments while watching the picture on the screen. First, turn the T114 frequency core (on the rear apron) until the picture falls out of sync and one diagonal black bar sloping down to the right appears on the screen. Then, turn the waveform adjustment core (under the chassis) into the coil while at the same time adjusting the frequency core so as to maintain one diagonal black bar on the screen. Continue this procedure until the oscillator begins to motorboat, then turn the waveform adjustment core out until the motorboating just stops. As a check, turn the T114 frequency core until the picture is synchronized then reverse the direction of rotation of the core until the picture begins to fall out of sync with the diagonal bar sloping down to the right. Continue to turn the frequency core in the same direction. Additional bars should not appear on the screen. Instead, the horizontal oscillator should begin to motorboat. Retouch the adjustment of the T114 waveform adjustment core if necessary until this condition is obtained. B.-Connect the low capacity probe of an oscilloscope to terminal C of T114. Turn the horizontal hold control one -quarter turn from the clockwise position so that the picture is in sync. The pattern on the oscilloscope should be as shown in Figure 19. Adjust the waveform adjustment core of T114 until the two peaks are at the same height. During this adjustment, the picture must be kept in sync by readjusting the hold control if necessary. This adjustment is very important for correct operation of the circuit. If the broad peak of the wave on the oscilloscope is lower than the sharp peak, the noise immunity becomes poorer, the stabilizing effect of the tuned circuit is reduced and drift of the oscillator becomes more serious. On the other hand, if the broad peak is higher than the sharp peak, the oscillator is overstabilized, the pull -in range becomes inadequate and the broad peak can cause double triggering of the oscillator when the hold control approaches the clockwise position. Remove the oscilloscope upon completion of this adjustment. Horizontal Locking Range Adjustment.-Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T114 frequency core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 2 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C181A slightly clockwise. If less than 2 bars are present, adjust C181A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 bars are present. Turn the horizontal hold control to the maximum clockwise position. Adjust the T114 frequency core so that the diagonal bar sloping down to the right appears on the screen and then reverse the direction of adjustment so that bar just moves off the screen leaving the picture in synchronization. SENSITIVITY CHECK.-A comparative sensitivity check can be made by operating the receiver on a weak signal from a television station and comparing the picture and sound obtained to that obtained on other receivers under the same conditions. This weak signal can be obtained by connecting the shop antenna to the receiver through a ladder type attenuator pad. RESPONSE CURVES.-The response curves shown on page 14 are typical, though some variations can be expected. The response curves are shown in the classical manner of presentation, that is with "response up" and low frequency to the left. The manner in which they will be seen in a given test set-up will depend upon the characteristics of the oscilloscope and the sweep generator. NOTES ON R -F UNIT ALIGNMENT.-Because of the frequency spectrum involved, many of the r -f unit leads are critical in some respects. Even the power supply leads form loops which couple to the tuned circuits, and if resonant at any of the frequencies involved in the performance of the tuner, may cause serious departures from the desired characteristics. In the design of the receiver these undesirable resonant loops have been shifted far enough away in frequency to allow reasonable latitude in physical arrangement without being troublesome. When the r -f unit is aligned in the receiver, no trouble from resonant loops should be experienced. However, if the unit is aligned in a jig separate from the receiver, attention should be paid to insure that unwanted resonance does not exist which might present a faulty representation of alignment. A resonant circuit exists between the r -f tuner chassis and the outer shield box, which couples into the antenna and r -f plate circuits. The frequency of this resonance depends on the structure of the shield box. This resonance is controlled by using insulating washers of proper thickness in the front plate to tuner chassis mounting. Obviously, if the r -f unit is removed for service, the washers should be replaced in the correct order. 11 184 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE ALIGNMENT TABLE THE DETAILED ALIGNMENT PROCEDURE BEGINNING ON PAGE 8 SHOULD BE READ BEFORE ALIGNMENT BY USE OF THE TABLE IS ATTEMPTED ., CONNECT SIGNAL CONNECT SWEEP CONNECT HET. CONNECT MISCELLANEOUS Step SIGNAL GEN. SWEEP GEN. HETERODYNE METER OSCILLOSCOPE CONNECTIONS ADJUST REFER No. GENERATOR FREQ. GENERATOR FREQ. FREQ. METER FREQ. TO AND TO TO MC. TO MC. TO MC. INSTRUCTIONS ANTENNA MATCHING UNIT ALIGNMENT 1 Do not adjust this unit unless fairly certain that it requires adjustment. Disconnect lead from L58 to S1E. Connect output of matching unit through 1000 mmf. to pin 1 of - - - V107 Replace cover on matching unit. Remove V106 from socket. Connect bias box to junction of R143 and R144 and set to produce -6 volts. 2 Antenna fermi- 45.75 mc. Not used Not used Pin 4, V110 Scope L59 for min. audio on Fig. 7 nals 30% mod. 3 " 41.25 mc. " - " - gain to max. - scope L60 for min. audio on Fig. 7 -30% mod. 4 Antenna termi- Antenna fermi- 45 to " - scope Scope a xtal probe Connect 300 ohms L61 and L62 to obtain Fig. 7 nals loosely nals through pad 54 mc. to gnd. from L58 to god. response of Fig. 12 Fig. 11 . Fig. 12 R -F UNIT ALIGNMENT 5 If unit is completely out of adjustment, preset all adjustments to center of range with following exceptions. Set C18 so .that head is 3/8" above chassis. Set C 1 1 IA turn from max clockwise Disconnect link from T104 and terminate with 39 ohms. Short r -f unit power terminal 3 to ground. Set fine tuning 30 degrees clock- - wise from mechanical center of its range for all oscillator adjustments. 6 Grid, pin 7 of 43.5 mc. Not used Not used V2 through 1500 30% mod, - TP1. Gain to maxi- Set r -f unit on chan- L65 for min. indication Fig. 7 mum net 2 on scope Fig. 10 mmf. 7 Not used - Not used - Loosely to r -f 227 mc. Not used unit oscillator R -F unit on channel 8 CI-KRKI 1, or C2-KRK- Fig. 7 11A for beat on freq. 8 Antenna termi- 181.25 Antenna fermi- Channel Not used nals loosely and nals through pad 8 - meter TP1. Gain to maxi- R -F unit on channel 8 C9, C11, C15 and C18 Fig. 7 mum Set Ti max. counter- for response shown in Fig. 13 9 Not used -185.75 Not used - Loosely to r -f 129 mc. Not used clockwise in Fig. 13 R -F unit on channel 6 L5 for beat on het. freq. Fig. 8 10 Antenna fermi- 83.25 nals loosely and unit oscillator Antenna termi- Channel Not used nals through pad 6 - TP1. Gain to maxi- mum " meter L48, L50 and L53 for Fig. 7 response shown in Fig. Fig. 13 11 Not used -87.75 Not used - Not used - Not used 13 On channel 6. Con- C8 for -3.5 volts on Fig. 7 nect "VoltOhmyst" meter 12 Antenna termi- 83.25 Antenna termi- Channel Not used - to TP1 TP1. Gain to maxi- R -F unit on channel 6 Check response. Read- Fig. 7 nals loosely 13 Not used and nails through pad 6 mum -87.75 Not used - Loosely to r -f 227 mc. Not used unit oscillator just L48, LSO and L53 if Fig. 13 necessary R -F unit on channel 8 Cl-KRK11, or C2-KRE- Fig. 7 11A for beat on freq. 14 Antenna termi- 181.25 Antenna termi- Channel Not used nals loosely and nals through pad 8 185.75 - TP1. Gain to maxi. ,, mum meter Check response adjust Fig. 7 C9 C11, C15 and C18 if necessary 15 16 - - If C9 was readjusted in step 14, repeat step II, step 13 and step 14 until the conditions specified in each step are fulfilled without additional adjustments. Not used Not used Loosely to r -f 267 mc. Not used unit oscillator Rec. on channel 13 L46 for beat on het. Fig. 7 (req. meter. Overshoot L46 slightly and adjust Cl-KRK11 or C2-KRK- 17 Antenna fermi- 211.25 Antenna termi- Channel Not used nals loosely 215.75 nals through pad 13 - 11A for beat TP1. Gain to maxi- Rec. on channel 13 Check to see that re- Fig. 13 mum "VoltOhmyst" on TP1 sponse is correct and -3.0 volts of osc. injec- tion is present - 18 " 205.25 " Channel Not used 209.75 12 - 19 " 199.25 " Channel " 203.75 11 - 20 " 193.25 " Channel " 197.75 10 ,, Rec. on channel 12 ,, Rec. on channel 11 ,, Rec. on channel 10 Fig. 13 " Fig. 13 " Fig. 13 - 21 " 187.25 " Channel " 191.75 9 " Rec. on channel 9 " Fig. 13 2218"1.25" - 185.75 Channel " 8 - 23 " 175.25 " Channel " 179.75 7 " Rec. on channel 8 " Rec. on channel 7 " Fig. 13 ,, Fig. 13 24 If the response o any channel (steps 17 through 23) is below 80% at either marker, adjust C9, C11, C15 and C18 as necessary to pull response up on the low channel yet maintain correct response on channel 8. 25 Repeat step 13. If the oscillator is off frequency overshoot the adjustment of CI in KRK11 or C2 in KRKI IA and correct by adjusting L46. 26 Repeat steps 16 hrough 25 until all adjustments are obtained. - - 27 Not used Not used Loosely to r -f 129 mc. Not used unit oscillator Rec. on channel 6 L5 for beat on het. freq. Fig. 7 meter - 28 Antenna fermi- 55.25 Antenna fermi- Channel Not used nals loosely 59.75 nals through pad 2 TP1. Gain to maxi- Rec. on channel 2 mum Adjust T1 core clock- Fig. 7 wise to a point at which channel 2 response does not change - 29 " 83.25 " Channel Not used 87.75 6 " Rec. on channel 6. Check to see that re- Fig. 7 "VoltOhmyst" onTPl sponse is correct and Fig. 13 -3.0 volts of osc. injec- tion is present - 30 " 77.25 " Channel " 81.75 5 " Rec. on channel 5 Fig. 13 Chan"nel- " 31 " 67.25 " ' Rec. on channel 4 Fig. 13 71.75 4 12 1 87 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE TEST PATTERN PHOTOGRAPHS Figure 20-Normal Picture Figure 21-Focus Magnet and Ion Trap Magnet Misadjusted Figure 22- -Horizontal Linearity Control Misadjusted (Picture Cramp4e-d4in*M*iddle) Figure 23-Width Control Misadjusted 14410 -0 - Figure 24 ---Horizontal Drive Contro4l 4M1is4a4djusted Figure 25-Transients Figure 26-Test Pattern Showing Out of Sync Condition When Horizontal Hold Control Is in a Counter -clockwise Position-Just Before Pulling Into Sync Figure 27-Test Pattern Showing Out of Sync Condition When Horizontal Hold Control Is at the Maximum Clockwise Posi- tion 15 188 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE SERVICE SUGGESTIONS Following is a list of symptoms of possible failures tin,d an indication of some of the possible faults: NO RASTER ON KINESCOPE: (1) Incorrect adjustment of ion trap magnet. Magnet reversed either front to back or top to bottom. (2) V116 or V117 inoperative. Check waveforms on grids and plates. (3) No high voltage-if horizontal deflection is operating as evidenced by the correct waveform on terminal 1 of high voltage transformer, the trouble can be isolated to the 1B3GT circuit. Either the T115 high voltage winding is open, the 1B3GT tube is defective, its filament circuit is open or C197 is shorted. (4) V110 circuit inoperative-Refer to schematic and waveform chart. (5) Damper tubes (V119 or V120) inoperative. (6) Defective kinescope. (7) R218 open. (8) No receiver plate voltage-filter capacitor shorted-or filter choke open. NO VERTICAL DEFLECTION: (1) V114B or V115 inoperative. Check voltage and waveforms on grids and plates. (2) T111 or T112 open. (3) Vertical deflection coils open. SMALL RASTER: (1) Low Plus B or low line voltage. (2) V117 defective. POOR VERTICAL LINEARITY: (1) If adjustments cannot correct, change V115. (2) Vertical output transformer T112 defective. (3) V114B defective-check voltage and waveforms on grid and plate. (4) C170, C171, C201D or C202B defective. (5) Low plate voltage-check rectifiers and capacitors in supply circuits. (6) If height is insufficient try changing V114. POOR HORIZONTAL LINEARITY: (1) If adjustments do not correct, change V117, V119 or V120. (2) T115 of L107 defective. (3) C195 or C219 defective. WRINKLES ON SIDE OF RASTER: (1) C193 defective. (2) Defective yoke. PICTURE OUT OF SYNC HORIZONTALLY: (1) T114 incorrectly tuned. (2) R226, R227 or R201B defective. TRAPEZOIDAL OR NON SYMMETRICAL RASTER: (1) Improper adjustment of focus magnet or ion trap magnet. (2) Defective yoke. RASTER AND SIGNAL ON KINESCOPE BUT NO SOUND: (1) T110 defective. (2) Sound i-f, ratio detector or audio amplifier inoperativecheck V101, V102, V103 and their socket voltages. (3) Audio system defective. (4) Speaker defective. SIGNAL AT KINESCOPE GRID BUT NO SYNC: (1) AGC control R175 misadjusted. (2) V111, inoperative. Check voltage and waveforms at its grid and plate. SIGNAL ON KINESCOPE GRID BUT NO VERTICAL SYNC: (1) Check V114B and associated circuit-C165, etc. (2) Integrating network inoperative-Check. (3) V113 or V114A defective or associated circuit defective. (4) Gas current grid emission or grid cathode leakage in V114. Replace. SIGNAL ON KINESCOPE GRID BUT NO HORIZONTAL SYNC: (1) T114 misadjusted-readjust as instructed on page 11. (2) V112 or V113 inoperative-check socket voltages and wave- forms. (3) T114 defective. (4) C215, C157, C181A, C182, C183. C184, C185, C186 or C187 defective. (5) If horizontal speed is completely off and cannot be adjusted check R226, R227, R201B, R229, R230 and R231. SOUND AND RASTER BUT NO PICTURE OR SYNC: (1) Picture, detector or video amplifier defective --check CR101 and V110-check socket voltages. (2) Bad contact to kinescope cathode. PICTURE STABLE BUT POOR RESOLUTION: (1) CR101 or V110 defective. (2) Peaking coils defective --check resistance. (3) Make sure that the focus control operates on both sides of proper focus. (4) R -F and I -F circuits misaligned. PICTURE SMEAR: (1) R -F or I -F circuits misaligned. (2) Open peaking coil. (3) This trouble can originate at the transmitter-check on another station. PICTURE JITTER: (I) AGC control R175' misadjusted. (2) If regular sections at the left picture are displaced change V117. (3) Vertical instability may be due to loose connections or noise. (4) Horizontal instability may be due to unstable transmitted sync. RASTER BUT NO SOUND, PICTURE OR SYNC: (1) Defective antenna or transmission line. (2) R -F oscillator off frequency. (3) R -F unit inoperative-check V1, V2. DARK VERTICAL LINE ON LEFT OF PICTURE: (1) Reduce horizontal drive and readjust width and horizontal linearity. (2) Replace V117. LIGHT VERTICAL LINE ON LEFT OF PICTURE: (1) C193 defective. (2) V119 or V120 defective. CRITICAL LEAD DRESS: 1. Keep all wiring in the pix i-f, sound and video circuits as short as possible. 2. Keep the leads on C110, C111, C112, C200, R109, R110, R111, R112, R114, R115 and R233 as short and direct as possible. 3. Do not change the bus wire connection to pin 2 of V101 and V102. Sleeving is used on these wires to insure length and to prevent shorting. 4. Dress C114 down between R117 volume control) and wafer S101-2. 5. Ground R130 to pin 3 of V106 and R138 to pin 7 of V107. 6. Du not change the grounding of 11141, 11146 and R149. 7. Keep the bus wire from T109 -A to C146 (plug in capacitor) short and direct. 8. Ground the filaments of sockets of V107, V108 and V109 independently of the socket center pin. Use ground lances provided near each socket. 9. Dress C198 straight up to act as a shield between T101 -A and V110-4. 10. Dress C153 and R170 (kine cathode) up in the air above the terminal board. 16 ALIGNMENT TABLE 185 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179. 21T179DE Step No. 32 33 CONNECT SIGNAL GENERATOR TO " SIGNAL GEN. FREQ. MC. CONNECT SWEEP GENERATOR TO 61.25 - 65.75 55.25 I 59.75 L " SWEEP GEN. FREQ. MC. Ch an nel 3 -- Channel 2 CONNECT HETERODYNE FREQ. METER TO _" HET. METER FREQ. -MC. CONNECT OSCILLOSCOPE TO " MISCELLANEOUS CONNECTIONS AND INSTRUCTIONS Rec. on channel 3 _____ Rec. on channel 2 ADJUST REFER TO Fig. 13 Fig. 13 34 If excessive tilt in the same direction occurs on channels 2 3 and 4, adjust C18 on channel 2 to overshoot the correction of this tilt then switch to channel 6 and adjust L53 for max. amplitude of response between carrier markers. _._ _ . 35 36 - - Check r -f response and oscillator injection on channels 7 through 13 steps 23 back up through stepl7 stopping on channel 13 for the next step. Not used Not used Loosely coupled 257 mc. TP1. Gain to maxi- Rec. on channel 13 Cl-KRIM or C2-KRK- Fig. 7 to r -f oscillator mum 11A for beat on het. ,, 37 38 " 39 " 40 " 41 " 42 " 43 ,, 44 " 45 " 46 47 I I --------- " - " --------- " 251 mc. 24S mc. 239 mc. 233 mc. 227 mc. _ " 221 mc. " 129 mc. 123 mc. 113 mc. 1 1 107 mc. 101 mc. freg. meter " Rec. on channel 12 LI1 as above " Rec. on channel 11 L10 as above Rec. on channel 10 L9 as above Rec on channel 9 L8 as above Rec. on channel 8 L7 as above Rec. on channel 7 L6 as above " Rec. on channel 6 L5 as above " Rec. on channel 5 L4 as above Rec. on channel 4 L3 as above " Rec. on channel 3 L2 as above Rec. on channel 2 LI as above Fig. 7 Fig. 7 Fig. 7 Fig. 7 Fig. 7 Fig. 7 Fig. 7 Fig. 7 Fig. 7 Fig. 7 Fig. 7 48 Repeat steps 35 through 46 as a check. On completion, remove 39 ohm resistor and reconnect link to terminals A and B of T104. RATIO DETECTOR, SOUND I -F AND SOUND TAKE -OFF ALIGNMENT 49 Grid. 2nd Snd. 4.5 mc. Not used I -F (pin 1, V102) 400 cy. or WR39B or C mod. or connect to grid 45.75 mc. 4th pix I -F (pin mod. by 1, V109) 4.5 mc. and 400 cy. 50 - Not used - Across speaker voice coil. Volume control set for max. volume "VoltOhmyst" to junction of R110 and 8114. Set C226 for min. capacity. Set signal gen. to give -10 V on meter. T102 top core for max. d -c on meter. T102 bottom core for min. audio on the oscilloscope. Fig. 9 Fig. 10 - " "VoltOhmyst" to junction 8112 and C113. If Fig. 9 the meter reads more than ± 1.5 volts, adjust Fig. 10 C226 for zero on the meter and readjust T102 (bot.) for min. output on scope. Repeat steps 48 - 51 Sig. Gen. to 1st 4.5 mc. Snd. I -F 1gsrt idS(opunidn 1I ,-F 4.5 mc. ,, V101) - 52 " - - 53 Sig. Gen. in se- " Not used " ries with 1000 ohms to T110 -C or WR39 across T104 A and B In series with 10,000 ohms to terminal A, of T101 Junction of R112 and C113 and 49 until all conditions are satisfied. Sweep output re- T101 top and bot. cores Fig. 9 duced to provide 2 v for max. gain and sym- Fig. 10 p -p on scope. metry at 4.5 mc. Fig. 14 Check for symmetrical response wave -form Fig. 15 (positive and negative). "VoltOhmyst" xtal Adjust T110 for mini- Fig. 9 probe to pin 8, V110. mum reading on "Volt If sig. gen. is used Ohmyst" short pin 1, V109 to ground. PICTURE I -F AND TRAP ADJUSTMENT - - 54 Not used Not used - 55 Sig. Gen. across 39.25 mc T104 A and B - - 56 " 41.25 mc. " - - 57 47.25 mc. " 58II gi- v- e 43.7mc. " Not used " Not used . " " Connect bias box and "VoltOhmyst" to junction of 8143 and R144 and to gnd. Adjust bias box to give -1.0 v on "VoltOhmyst". "VoltOhmyst" to pin T104 top core to give Fig. 9 4, V110. Gen. output min. d -c on meter. to give -1.0 volt d -c. " T105 bot, for min. Fig. 10 T106 bot. for min. Fig. 10 Sig. G-e1n..0oVutpduct taot T109 for max. Fig. 7 59 " 45.5 mc. ,, 60 " 41.8 mc. " -- " 61 First pi: i-f grid (pin 1, V 106) loosely Various See Fig. 16 Fpiirnst 1pi,xVi-fIg0ri6d through 1000 40 to 48 mc. mmf. ' 62 C o n n e c t e d loosely to diode Various See Mixer grid test point TP2 with 40 to 48 mc. probe Fig. 17 short lead --- ,, To pin 4 of V110 Pin 4, V110. Shunt 8141, 8149 and terminals A and T108 for max. T107 for max. Adjust T105 and T106 top cores Eor max. gain Fig. 9 Fig. 9 Fig. 9 Fig. 16 F of T109 with 330 and response shown in ohms, 0.5 v p -p on - scope. Scope diode probe Rec. on than. 4. Con- Set C221 to min. Adjust Fig. 9 to T105 -B and to gnd. nett 180 ohms from T105 -B to junction R135 and C132. Upon T1 top and T104 bot. for max. gain at 43.5 mc. and 45.75 mc. at 70%. Fig. 17 completion distort- Adjust C221 until 41.25 nett scope and shunt- mc. is at 80%. 63 Connected Various loosely to grid of See 1st pix i-f Fig. 18 " " - ing resistors. Connect scope to pin 4 of V110 "Volt 0 hmy st" to pin 4,V110. Set bias box for -6.0 volts on RtoetooubcthaTin10r8easnpdoTn1s0e9 shown in Fig. 18. Do Fig. 18 the meter. Set sweep not adjust T107 unless output to produce 3.0 absolutely necessary. 8 volts p -p on scope. 13 CI OSC. FR Edit. -n C9 MIXER MIXER TRANS. GRID TP2 TEST POINT C15 R -F PLATE C FINE TUNING L46 LI THROUGH L11 INDAnDuAL CPAINEL 05C. ADJUSTMENTS Ce. 05C. INJECTION ADJUSTMENT ON OTHER SIDE OF L NIT ALIGNMENT DATA C le L55 LXI L62 R -F F -m GRID TRAP PAD FOR SO n. COAX. 186 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 2IT179, 21T179DE PAD FOR 72 A_ COA PAD FOR 3004. BAL. INPUT LGO 41.25 MC. I -F TRAP L59 45.75 MC. I -F TRAP C II BANDWIDTH NS 116 3 L46 CHAN. 6 MIXER GRID L 53 CHAN. 6 R -F GRID L 50 CHAN. 6 R -F PLATE 470 300n. BALANCED OUTPUT 3oon. BALANCED OUTPUT 4TR M51164 Figure 11 -Sweep Attenuator Pads SHOULDER AT 52 MC 60 MC. C 53 MC 100% RESPONSE CV 123 Figure 7 -R-F Unit Adjustments 50 MC. AT 60% ± 15% RESPONSE POINT Figure 12 -Antenna Matching Unit Response CM AN 4 GRAN 5 L5 CHAN. S L6 CHAN.] Figure 8 -R -F Oscillator Adjustments TO NOEMNA TERMINALS JEWEL LIMIT MTATEilRmCAByLEymaym, Mar ri RATIO TR. SOUND . Fr TR. 50PIX I -F TR. I TI08.4.1111 T'10-rPIA F 77. 411 MC 411MC `\=f . 2E, PIE FF -VP TSNAKTR17.4F GRWITtlit7-1X 14 FL TR. 6:(-74; Fn. IRP17 I -F USN, GRID TR -ithic Figure 9 -Top Chassis Adjustments atmiZmo..t6 STir RV 126 Figure 13 -R-F Response 4.5 MC L. 42.0 MC. AT 90 % r45. TS M9G0A.T EMITS 46.5 M2C0A.T."1 41 25MC 4725Mdc. Figure 14 Sound I -F Response 41.9 /4C," 41.25 MC7' 55% Figure 15 Ratio Det. Response !45.75 MC 70% Figure 16 T105 and T106 Response TIOT MS MT PM EI ANNIL M RAMi Zm, DPlr.raF.6F(.4.2.'6.;4..).6-,R('C"M" ItSOURS - DREATTIO us 14 MAX TRAN. NE ""4 (15 GRID TIAVWI C:72.: Cm ym Fal 4s. ans rig ...,\9_ ,T.27 MC ,--, .. mram. ER IfiArn'' uy4NOR. 11! FIX 14,4/25 KATE MA eilli diSe..T171>) .1...4. YVE 1....., AMMO 1ER Figure 10 -Bottom Chassis Adjustments cv 124 -1 Figure 17 T1 and T104 Response (11 INCORRECT Figure 18 Over-all I -F Response INCORRECT cv. CORRECT Figure 19 Horizontal Oscillator Waveforms 14 SERVICE SUGGESTIONS 1 89 21T159, 21T159DE, 2IT165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE 11. Keep the leads connected to T114 -C and T114 -D (synchro- guide) down so that they will not short out when the chassis is placed in the cabinet. 12. Do not reroute any wires between T104 and the terminal board along side it. 13. Dress all wires routed past T104, shielded wires W102 and W103 under the big lances near T104. 14. Dress all a -c leads to 5102 under the large lances on the front apron and away from R243. 15. Dress R116 close to the chassis using short leads. 16. Dress C206, C221 and C212 up in the air and away from all other leads and components. 17. Dress all leads away from bleeder resistor 13243. 18. The blue lead from pin 5 of V111 to the terminal board under the high voltage cage should be routed between V117 socket and the rear apron. 19. Keep leads on C214 as short and direct as possible. 20. Dress 11206 away from all other wires and components to prevent excessive heating. 21. Keep the wire from the vertical output transformer T114 away from the 5U4G rectifier tubes. 22. Dress all 2 watt resistors away from each other and all other wires and components. 23. Dress all wires away from damper tubes V119 and V120. 24. Keep blue wire from pin 5 V116 to T114 -A under 5" long. 25. Dress all peaking coils up and away from the base. PICTURE I -F RESPONSE It may be desirable to observe the individual i-f stage response. To do this use the following method: For T107, T108 or T109, shunt all i-f transformers with a 330 ohm carbon resistor except the one to be observed. Connect a wide band sweep generator to the second pix i-f grid and adjust it to sweep from 38 mc. to 48 mc. Connect the oscilloscope to TP102 and observe the overall response. It will essentially be that of the unshunted stage. To see the response of transformers T1, T104 and T105, T106, follow the instructions given on page 10. Figures 28 through 36 show the response of the various stages obtained in the above manner. The curves shown are typical although some variation between receivers can be expected. RESPONSE PHOTOGRAPHS Taken from RCA W058A Oscilloscope Figure 28-Overall Pix I -F Response Figure 29-Response of TI -T104 Pix I -F Transformers Figure 30-Response of T105 -T106 Pix Transformer Figure 31-Response of T107 Pix I -F Transformer Figure 32-Response of T108 Pix I -F Coil Figure 33-Response of T109 Pix I -F Coil Figure 34-Video Response at Average Contrast =1 .4 Cv 143 E3 Figure 35-Video Response (100 KC Square Wave) 17 Figure 36-Video Response (60 Cycle Square Wave) 190 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Grid of 1st Video Amplifier (Pin 4 of V110) (6AG7) Figure 37-Vertical (Oscilloscope Synced to % of Vertical Sweep Rate) (5.5 Volts PP) -.1-01141 Figure 38 --Horizontal (Oscilloscope Synced to % of Horizontal Sweep Rate) (5.5 Volts PP) Plate of 1st Video Amplifier (Pin 8 of V110) (6AG7) Voltage depends on picture Figure 39-Verticat (110 Volts PP) e .444 Figure 40-Horizontal (110 Volts PP) 10410 -0 - ole CV 144E Grid of Sync Separator (Pin 4 of V113) (6SN7) Voltage depends on picture Figure 41-Vertical (75 Volts PP) E 44 Figure 42-Horizontal (75 Volts PP) Figure 43-Plate of Sync Separator (Pin 5 of V113) (6SN7) (35 Volts PP) Voltage depends on picture 4--44111 Figure 44-Cathode of Sync Separator (Pin 6 of V113) (6SN7) (10 Volts PP) Figure 45-Grid of Vert. Sync Amplifier (Pin 4 of V114A) (6SN7) (12 Volts PP) Figure 46-Plate of Vert Sync Amplifier (Pin 5 of V114A) (6SN7) (100 Volts PP) WAVEFORM PHOTOGRAPHS Taken from RCA WO5BA Oscilloscope Figure 47-Grid of Vertical Oscillator (Pin 1 of V1148) (6SN7) (135 Volts PP) 1 9 1 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE Figure 48-Plate of Vertical Oscillator (Pin 2 of V114B) (6SN7) (105 Volts PP) I 100110 -0 - 1., Figure 49-Grid of Vertical Output (105 Volts PP) (Pin 1 of V115) (6AQ5) I L Figure 50-Plate of Vertical Output (900 Volts PP) (Pin 5 of V115) (6AQ5) 10110.--0. '7.V I Figure 51-Cathode of Vertical Output (1.0 Volts PP) (Pin 2 of V115) (6AQ5) .4---41144 , Figure 52-Grid of Kinescope (Pin 2 of V121) (12 Volts PP) 41410.--o. CV 14G, Cathode of Sync Separator (Pin 3 of V113) (6SN7) Figure 53-Vertical (15 Volts PP) Figure 54-Horizontal (8 Volts PP) -00410-0- Grid of Sync Separator (Pin 1 of V113) (6SN7) Figure 55-Vertical (110 Volts PP) Figure 56-Horizontal (110 Volts PP) 19 192 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Plate of Sync Separator (Pin 2 of V.113) Figure 57-Vertical (30 Volts PP) Figure 58-Horizontal (30 Volts PP) 441110**1,0 CV 14-7 E Grid of Hor Sync Amp (Pin 4 of V112) (6SN7) Figure 59 --Vertical (30 Volts PP) Figure 60-Horizontal (30 Volts PP) 3400 -0 - 1111111.111111181111111111, CV 148 A Plate of Hor Sync Amp (Pin 5 of V112) (6SN7) Figure 61-Vertical (85 Volts PP) -s-444 Figure 62-Horizontal (85 Volts PP) 300.10. -0 - Grid of Hor Sync Amp (Pin 1 of V112) (6SN7) Figure 63 --Vertical (75 Volts PP) *---41(4 Figure 64-Horizontal (75 Volts PP) Cathode of Hor Sync Amp (Pin 3 of V112) (6SN7) Figure 65- -V.1er-ti4ca4l 4(18 Volts PP) Figure 66-Horizontal (18 Volts PP) 20 CV 14.8 WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope 193 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE Figure 67-Grid of Horizontal Oscillator Control (25 Volts PP) (Pin 1 of V116) (6SN7GT) C Figure 68-Cathode of Horizontal Oscillator Control (1.3 Volts PP) (Pin 3 of V116) (6SN7GT) 4111* -10. Figure 69-Grid of Horizontal Oscillator (550 Volts PP) (Pin 4 of V11o) (6SN7GT) Figure 70- -Plate of Horizontal Oscillator (290 Volts PP) (Pin 5 of V116) (6SN7GT) Figure 71 --Terminal "C" of T114 (150 Volts PP) 4--4011 Figure 72-Grid of Horizontal Out- put Tube (140 Volts PP) (Pin 5 of V117) (6CD6G) 10100.--0- Figure 73-Plate of Horizontal Output (Approx. 5400 Volts PP) (Measured Through a Capacity Voltage Divider Connected from Top Cap of V117 to Ground) Figure 74-Cathode of Damper (2300 Volts PP) (Pin 3 of VI19) (6W4GT) 401000 -0 - 474 GV 14c/iF Figure 75-Plate of Damper (100 Volts PP) (Pin 5 of V119) (6W4GT) -4--4401 Figure .76-Plate of ACC Amplifier (Pin 5 of V111) (6C86) (700 Volts PP) CV 150D 21 194 21T159, 21T159DE, 21T165 21T166DE, 21T174DE, 21T175DE 21T176, 21T177, 21T178 21T178DE, 21T179, 21T179DE VOLTAGE CHART TtcchhihreaecspufsiioictslitlnugogrrwoetiuhnsneygdnrmecachneerdaiosvwnueirirzetheamdntehtaenenntsrdneractehetpeeirvreAmesreGinonCapt letscwr.oaoVtnintsoreglottlsaogpnoerf1osc1pso7ehnrovdlwyoitlniatosda,njr6use.0stIrecnedyatc.dhlTeewhsfi,ietrahsst-eaccc.tooynnpddeitcWioonnVd,9iat7i5Ao0n0swe0namisoirocrb"oVtavoionlltetOdtehbsmtyyprasettm"tebornevtiswniggenetanhlethweaanisntefdenidcnaaitneltedoatdtehsremarniendcaeslihvaoenrrdt, Tube No. Tube Type VI 6X8 VI 6X8 V2 6BQ7 V2 6BQ7 V101 6AU6 V102 6AU6 V103 6AL5 V104 6AV6 V105 6AQ5 V106 6AU6 V107 6CB6 V108 6CB6 V109 6CB6 V110 6AG7 Function Mixer R -F Oscillator R -F Amplifier R -F Amplifier 1st Sound I -F Amp. 2d Sound I -F Amp. Ratio Detector 1st Audio Amplifier Audio Output 1st Pix. I -F Amplifier 2nd Pix. I -F Amplifier 3d Pix. I -F Amplifier 4th Pix. I -F Amplifier Video Amplifier Operating Condition 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal E. Plate Pin No. Volts 9 160 9 145 3 95 3 90 6 170 6 133 1 270 1 260 E. Screen Pin No. Volts 8 160 8 145 ------- E. Cathode Pin No. Volts 6 0 6 0 6 0 6 0 8 0.1 8 1.1 3 170 3 133 E. Grid Pin No. Volts -2.4 to 7 -3.0 -2.8 to 7 -3.5 -3.8 to 2 -5.5 -3.0 to 2 -5.1 7 70 - 2 - 2 5 127 6 124 7 0.7 1 -0.4 5 126 6 123 7 0.5 1 -1.2 5 132 6 60 7 0.14 1 -10 5 131 6 65 7 0.14 1 -5 - - - - 7 1.0 1 9.2 - - - - 7 0 1 8.0 7 - - 90 2 0 1 -0.7 7 - 86 - 2 0 1 -0.7 5 350 6 360 2 150 7 116 5 346 6 356 2 145 7 114 5 180 6 230 7 0.15 1 -6.5 5 97 6 129 7 1.0 1 0 5 236 6 233 2 0.1 1 -6.5 5 226 6 138 2 0,85 1 0 5 149 6 144 2 0.9 1 0 5 129 6 133 2 0.8 1 0 5 178 6 163 2 2.2 1 0 5 165 6 150 2 2.0 1 0 8 130 6 172 5 1.2 4 *-5.0 8 130 6 107 5 0.8 4 *-2.0 I Plate (ma.) - 6.0 5.0 2.8 2.0 - 0.45 0.45 30.0 30.0 1.5 7.0 1.5 12.0 11.0 10.0 8.9 7.9 22.5 15.0 I Screen (ma.) - - Notes on Measurements - Depending on channel 3.0 3.0 1.2 1.0 - - - At min. - volume 2.0 At min. volume 2.0 0.3 3.0 0.14 3.0 3.0 2.0 2.1 2.1 *Depends 5.5 on picture *Depends 4.0 on picture 22 VOLTAGE CHART 195 217159, 21T159DE, 21T165 21T166DE, 21T174DE. 21T175DE 217176, 217177, 211178 21T178DE, 217179, 21TI79DE Tube Tub. N. Type Function VIII 6CB6 AGC Amplifier Hoy Sync V112 6567G7 Amplifier Ho. Sync V113 6SN1GT Separator Vert. Sync V113 6.4147GT Separator Vert. Sync V114A 6.9N7G7 Amplifier Vertical V114B 6SN7GT Oscillator Operating Condition 5000 Mu. V. Signal No Signal 5000 M. V. Signal No Signal 5000 Mu. V. Signal Signal 5000 Mu. V. Signal No Signal 5860 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal E. Plate Pin No. Volt. 5 -27 5 4.5 2 152 2 139 9 86 5 30 2 374 2 372 5 34S 5 340 5 7.0 5 07.0 2 176 2 176 E. Screen Pin No. Volts 6 238 6 218 --- -- ---------- E. Cathode Pin No. Volts 2 152 2 135 3 0.9 3 0.4 6 0 6 0 3 216 3 155 6 205 6 160 6 0 6 0 3 0 3 0 E. Grid Pin N. Volts 1 155 1 118 1 -44 1 0-38 4 -2.0 4 -LB 1 155 1 134 4 135 4 130 4 -0.2 4 1 1 -27 V115 V116 V116 V117 V118 VI19 V120 V121 V122 V123 6AQS VO.ruftpi0ut Horizontal 6SN7GT 0... Control Horizonte! 6.3167G7 Oscillator Horizontal 6CD6G Output 1B3GT H. V. /8016 Rectifier 6W4GT Dampers 21AP4 Kineecope 51.14G Rectifier. WSigMunal V. No Signal No Signal 5000 Mu. V. Signal HMO Mu. V. Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signal 9000 Mu. V. Signal No Signal 9000 Mu. V. Signal No Signal 5000 Mu. V. Signal No Signd 5 359 6 5 357 6 - 2 188 - 2 145 - 2 230 - 5 258 - 5 256 Cap 8 0.P 8 Cap - Cap - - 5 355 - 5 353 Cone 16,000 10 Cone 16,400 10 - 4 fi 6 388 - 486 386 359 2 30 1 0 357 2 29 1 0 - 3. -24 1 -42 - 3 -18 1 -42 - 3 -18 1 -42 -6 0 4 0-91 - 6 0 4 0-94 165 3 12.5 5 -30 165 3 12.5 5 -30 - - - 287 16,000 - - - 287 16,400 -3 -- -3 555 11 140 2 82 550 11 132 2 76 - - - 288 389 - - - 288 387 I Plate (ma.) 0.1 0 1.1 0.5 5.5 4.6 1.2 0.8 <0.1 <0.1 0.0 0.5 0.2 17.3 17.3 0.37 0.4 0.4 2.0 2.0 110 110 0.2 0.2 37 0.2 0.2 .139 .145 I Screen (en.) 3.4 0 - - - - - 1.2 1.2 - - - 13.0 15.0 - - - Notes on Measurements AGC control set for normal 'Verdi°. .0on.Pneonisdes eDepends on noise Hoy hold coin. ter -clockwise Hoe. hold clockwise Depends on Oscillator Adjustment °High Voltage Pulse Present *High Voltage Pulse Present "High Voltage Pulse Present At average Brightness Per Tube CHASSIS WIRING DIAGRAM. KCS68F 196- 197 21T159DE, 21T166DE 21T174DE, 21T175DE 211178DE, 21TI79DE Figure 77-C &mit IFiring Diagram, KCS6IIF 24 25 198r- I 99 211159. 211165 211176, 211177 211178, 21/179 CHASSIS WIRING DIAGRAM, KCS68C. ICCS68E rt_ °Ltd Arm Ri V109 m - V102 Rioliffp pidso P.101111111 rim .41F1.:11.6'In'1 - .11 4tiiI1110 I EMI I 11 71" rialill111 Pah1:11141 r 1111 i IFUnms oritift-EIDL-01,,Lo-im 14 1171111I1t-11MrirOildi 41-414 1-- - [N2.0e4w= Figure 78-Cheumie Wiring Diagram, KCS68C, KCS686 27 700 211159, 211159DE, 21T165 211166DE. 2111744E, 21T175DE 21/176. 211177. 21T178 211178DE, 211179, 21T179DE R -F UNIT WIRING DIAGRAMS Figure 79-KRK II R -F Unit Wiring Diagram Figure 80-KRKI IA R -F Unit Wiring Diagram 28 SUIT KR*11A,..,'- 'e Ooo ANT ativ,wittu 62. Taro CIRCUIT SCHEMATIC DIAGRAM, RCS68F RJRo 200-202 2IT159DE, 21T166DE 2IT174DE, 21T175DE 21T178DE 2IT179DE .61 V. YINDE 47. L. FliTrE.F,'...1;f7c374'31- PRODUCTION CHANGES IN RCS68F The schematic is shown in the latest condition. The notes below tell how early receivers differed from the schematic shown above. In some receiver. R191 was 6800 ohms. In some receivers 0010 was 1000 ohms. COLOR CODES MOULDED PAPER CAPACITORS T... mum.. NODS DENTS TOLERANCE g.M70. XJ4 mar 105.7 6.42T DCFL YOKE Sit a TOLERANCE ENATIPLIER W.:1,77w nrz rrrrir The schematic le snown in the latest All capacitance values less than 1 in MF condition at the lima of printmg. and above 1 It MMF unless otherwise noted. Direction of arrows at controls Malice.* clockwise rotation. All voltages measured with "VollOhmyst" Figure 8I-Circuit Schematic and with no signal Input. Voltages should Diagram. KCS68F 09 All resistance values in ohnts. K = 1000. 30 hold within :kW% with 117 v. ac supply. CIRCUIT SCHEMATIC DIAGB RCS68C, KCS68E 2'93-204 21T159. 211165 21T176, 21T177 21T178. 21T179 fri.r"w inra. in ggo71.0 WO ISO Br Fa% 11Mm ;AOen Rmi Zit Mg' TOE 51. Wal We . 51'7 sr, Vtg 211 tt 00 71.1 yJit ssK ° Ioosi 6516V. 613. Vol.°T auSt abut SAILS .3734 1.3 R. R23 MS REAR RNA .r. .t. .2. C..3A- 5IF CRD A -35 DE The schematic is shown in the latest All capacitance value. less than I In FM Direction of arrows at controls indicates All with Figure 82-Circuit Schematic condition at the time of prirding. and above 1 in UHF unless otherwise clockwise rotation. and with no signal input. Voltages should Diagram, KCS68C, KCS68E All resistance value In ohms. K = 1000. 31 noted. no hold within -.20% with 117 v. on supply. 20> 21T159 21T159DE, 21T165 217166DE, 217174DE, 217175DE 21T176 217177, 21T178 217178DE 217179, 21T179DE REPLACEMENT PARTS STOCK Na DESCRIPTION STOCK No, DESCRIPTION 7"" 76531 76522/ RF UNIT ASSEMBLIES K0K11, minx '7g:t.0"8"g. israhlrletertrganTrtV."t25, C2,,6n..sC, 2la7se Board -Terminal board, 5 contact and ground BazZa-.I yolftgaialleket for holding 608 tuba s . (early 76446 7.66 76965 ''':=0.0,0.t:L'I.gf°',.PIZIT7 '" "'` ""'d (Pr' cOmaciriCeramic, variable for fte tuning -plunge 1/208 Cargi37,7,,Cse,ralc. variable Mr fine tuning-Pl.g. 00. 504410 504447 14343 nisa 76547 76549 745.1° 70. 100.003 olds, -8 20%. Vs watt (01. R5, 116) 470,000.s, M20%, Vs watt 010) Retainer -Fine tuning shaft retaining ring Rod -Actuating plunger rod (fibre) for foe tuning fink 6.000-#4.40 z 1/2" adjusting ,crew for coils 1.6, 17, LB, 19. s.L.1,,,017..., .1..... ..s... roueto, Scr.:44;w1r#4.40 x 1/2" adjusting screw for cos LS Lhai,t,":=LosJ,ase171.shslts.snso,101ate con,00,,, ,efo, sbso btrshmg and 93056 70597 0800 76550 54207 76557 76558 70935 76739 76527 77460 75199 76552 75198 11. 75166 73748 75610 71008 '''" 76'5 787" 77151 76531 76143 73531 76560 73C7 76769 77206 76582 77153 76537 76538 76519 76556 00.0 76460 75187 77202 76549 76521 nno 76524 77203 70728 503017 503082 04115 504210 503293 503247 50010 Capacitor -Ceramic, 5zornf. (COO) (C33.. KAM.) Capacitor -Ceramic, 8 mmi. (C29) 77147 .ielcl-Front ahield complete with shalt bush.6 and bracket, K0011/1 calirSillTrj 20 "' (c0) (5'04"(06 marked CaggnrCera.c, 16 trunf. (C3) (early production '7'6.5'3 Th.e8l`1cl=1r)iaube rhiVIdcl fXaa'cl2 (':'Z'l o'r tf'1"('::rpr'trlotraction Capacitor -Ceramic, 18 mmL (C17) Capacitor -Ceramic, 12 mmf. (C19) (col, 1.1811/) Capacit.-Ceramic, 22 ... (0) .pacitor-Ceramic, 27 nunf. (C25) CapacItor-Cerarniz not.. (C24) Capacitor -Mica trimmer, 55-20 m.. (C11) Capacitor-Cera.c, 220 .0. (CIO) (KAKI IA) Capacitor-Cdra.c. 170 nunf. (C12. C14) 76336 76530 75191 77119 75163 30340 76523 Socket-T.a socket, 9 pm, mimaturd bakeltre, saddle mounted So.. -Tube socket 9 p., ...re, ceramic, saddle mounted Spacer -Insulating spacer for front plate (4 regA) Spacer -Metal spacer for front plate, KRKI1A Spring -Friction spring (formed) for Mae tuning cam Spring -Heap. spring for fte tuning Unk SprZsg,,;:ataininir3 spring for 608 tube shie. (earl? PM. Calginr)-Ura.c. 330 fjc,.. . (010) 0wri7 15.1°... Capaclitoaarric, 470 mini, (C10) (produMion marked Ca.8pa0c1ito8r)-C. eramic, 1500 mml. (etandm11) (C13, Cm, cc, Capacitor -Ceramic, 1500 mml. (CI6, COO, C23) CapacitormCaramic, 1500 mml. (CS) c.p.....-c....i., 0.58 ..... (C7) c7cficl7r-csenZed IV"I'' '7'4 muff'em'm ''''' c'eCrr(oTarrrPro5U=rnm,t3.113"''' 08-0'5 "'" 75068 Sp5M801,13.1Mn00ing,,,..Parilutz.,,f.5KRKt-Ir. 1.3 ...m Spring -Return 7.04 Spring -Return spring Mr 1..0 tuning co.., KRICIIA 76554 Stator -Antenna stator comp. with rotor, coils. capacitor "trz.1-Co'Mr. 7es" and resfitor (01E, 1.42, L43, 144, 1.45. 1.64, 155, C20) ,,TP'ilTili .19. 1.20. #..., I., .0...2.'04, in, in (early joroohiotrm; 76780 .6%7r "c,-..., 01100, -, . 'iV tg,rn?."1.?0Gc0°,111021,1P71,11'11.e)Sr%Ftll'i4 'rellI.T.Itlf:fo ri:1=1.'MV'tVI'P) °2s ""' Cargia,-Ttrbul., steatite, adjustable, 0.8-3.0 mini. (08) Carccmitor-Adjustable trimmer. stoatite, 1.0-4.0 m., Clip -Tubular clip for mounting stand-off capacitors coil-a....s nutchin,, mil (2 raga) Coil -Channel #13 converter coil (LC) (early production K11) Coil-Ch.e cod 0.57) Con -Filament choke coil (163, L64) Coil -Filament choke coil (156) (KRKI1A) COB-nr amplifier coupling mti (.1) con-nr choke coil (LOS) (101011A) Coil -Shunt coil complete with adios... core (161) Coilhunt coil complete with adjustable core (102) 77353 76546 11) Stator:o ZvererTtat win eta with rotor Hs, ad. gg';° gll, ilrtg, irrig,i18.1: (KRKI1A) Stator__0.0ator etitim. trnmpeto s, ro,or ,mus ,p,a,olt,ti..SSI(t,S,2,,.7,;.1..des .5, , 17, 18, 1a6n,d1g1s0,. 77" 'a.1g.r.0..)..("O1r"foadlorrkft'igotrnm'IratrkVahd d"M°7I".K,riz1i01lt)d"a" 77205 Stato,-scillator stator complete with rotor. mils and CO 7'5'0 ' " ' " ' 40.0,6L.i!FiclLot(cm.1,pa3lekjt''eL,2 , , . 16. rvh,. V%.1.1.1.10"Zil- Sta1't:eCr-9".riilFl. l1o171r28)0, 1.3' -grt2rWIT,03.1g. 75"0 'L5.566110; Coil-Ttimm. mil (3 turns) vrith adjustable indu.anco tioremc.1, a,tosa)citor stud (suety adj....) . r-1 aom 7.61 Strap -CM #13 r4 grid strap (152) 76526 Strip -Coil segment mounting strip -1.0. lower Connector -Oscillator grid connector 76544 Strip -Coil mom. moon tinti strip -1.H. upper -less trim, Corom,astV.,.=,00515 0.535°. -Part M atit.I. 76525 Strip-C.1.qm.. mounting strip-R.H. center Contact -Test pointcontact Core -Adjustable core for fine tuning capacitor, 00011 75446 Stud -Capacitor stud -brass -#4-40 x 13/ 6' 0/64" smaze dilpfr slot Mr trimmer coil 199, CIS nc.ed and Core -Adjustable core for fine tuMng capacitor (KRRIIA) Core -Adjusting core for FM trap Detent-Detent mechanism a. fibre shaft Form -Coil form lor coils L48,150 6 153 75007 ''`,;17,:,'=`,.rgoTt'tfg=f1-1? Lls,'3dg''.7.1°.,!1';' ically and "Hi tir 76740 Sh=r:.11;'.aclgto! stud for capacitor No. 76545 Link -link assembly fox line tunMg. KRKII Link -Link assembly /or tine tuning (KRKIIA) NTgent. ,or mounting M... trim. 75032 77152 76536 Terminal -Terminal for mounting C8 trimmer 800. Transformer-.tertras matching transformer complete ('tit, co:, cos, C26, C27.158. 159, .0. 161, 102. 11) 47 ohms, M 10%. 1/2 wattTransformer-Converter Resietor-Fixecl compoeionz:- 76528 Transformer-Convarter transformer (KRKII) transformer T1, R3 (80(11A) 82 ohms, 10%. 1/2 watt (RIO) 76540 Trap -F. trap complete with adjustable core (160) 150 ohms. -, 20%. 1/2 watt (8,6) 76535 Trap-I.F trap (165) 1000 ohms, M 20%. Vs watt (17. 1I4) 76542 Trap-LF trap (C.25 note) complete with core (L.) 3300 oh., -8 10%. Vs watt (.. 011. 012) 4700 ohm, -6-10%. V, wed (ft for .8 f ff. 10,000 ohms, -820%, 1/2 wad (01. 00011) 76541 75190 Trap -18 trap (45.75 mc.) complete with core (.0) Washer-Msulating washer (neoprene) for mounftg ca pacitor on coil strip 33 206 217159, 217159DE, 21T165 REPLACEMENT PARTS (Continued) 217166DE, 217174DE, 217175DE 21T176. 21T177, 217178 217178DE, 21T179, 21T179DE SNTOaCK DESCRIPTION '72" DESCRIPTION ....6 76490 ions 75800 76507 7.96 75217 3900 76577 76574 39041 71924 76474 71514 38396 76578 76576 44202 76576 76575 47617 76579 76473 54003 76488 75166 73748 734" 76470 73960 7"77 76742 74531 38417 75510 ."" " ' " 75'' 73801 76" 7595 73803 7358 73930 A 73808 7''' . vas,. 73797 73562 73790 CHASSIS ASSEMBLIES 1.5080 in Models 217176, 211177, 310178. 211179 1. 3 68E in Modals 21T159, 211165 KCS68F . Mode. 21;r41M:11,6,,egalT17910. 2IT175DE, ErtkeetsTZoorting bracket complete with insula i p-ocon ..b.......: cop Capacl.-Adjustable trimmer steatite 1.4 muff. (01.20) .pactror-Ceramic. 3 muff. (CI52) Capacitor -Adjustable, 5.70 .. (0120) Capacitor -Mica trimmer. a... miso ...I. (clout, mom) Capacitor-Cdramic, 15 ro.. (CI51) '0000 -Ceramic, 33160.0, (C106) Capacitor -Ceramic. 39 nurd. (0177) Capacitor -Ceramic, 47 muff. (C150) Capactior-Ceramic, 56 ranoL (C105) I Capacitor-Mim, so .... (0157, 0103) Capacitor -Ceramic. 81 re. (C225) Ccmcitor-Caramic. ioo .... (moo, CIS) Capacitor-Idim, 100 .. (0176) Capacitor -Ceramic, 150 mml. (C212) Capacitor -Ceramic. 150 mini. (C168. 0215) CapacItor-Cera.d 150 0000 2000 volts (C2I2) (KCS.F) Capacitor -Ceramic. 180 mal. (C211) Capacitor -Ceramic, 170 ro.. (0117) Capacitor -Mica, 270 nusti. (C187) Capacitor-Mim. 330 snot. (0I10) Capacitor -Mica, 470 mini, (C111. 0112) Capacitor -Ceramic, 500 mmf., 30600 volts (0197) Capacitor -Ceramic, 1500 no.. (stand-off) (C146) Cageitor-Ceraic, 1500 mini. (0221) 0U0m8sWitrg2A',°ra`,g,ndfrl.izt:aL'1I7T0'02A.mJliael423: Ag,iCz1)2''3'1''9'', 'C'''1'3'5A,' Cangforcignrego,,,. 10.000 rn.. (0.01. 006, CI26, CI39, C'tigtor.i'Oit"i" 00°1 1080 ""' .(0004A c''''' capacitor -Electrolytic, 1 mfd.. 10 volt. (C114. cure) Capacitor -Electrolytic, 5 000.. 50 volts (C200) Capacitor-Electrolylic. 5 000.. 00,volts (C20) Capacitor-Electro1ytic, comprising 2 sm0com of 05.m. Pftrg.T50'foltreGig3k, ggilo,t'3351,C1f3V)""" ' clatitTLTV'ec lOrOfer=.11 vtliattli 7,ros"liVati 200 v.. (020A, C00210, 02.0. G00./ ' ' "'" cIre vt°Li. ,7t;: gg ' :IT= 401F fi:.Z.f.,..i °C2"ffit: CallraOIC,a0'275`i'" ... c.:AV7E,Ttel.gri, .1'175 . il .1'""..t'd °" "00" "' Cavpoatctit.o(r0-T.u)bular, pap.. oil impregnated. .001 .d., 1000 -edr,tvegN'o.;. -0-0. 0" ,-----a.."" m0d" `IcIt"(`Ereetri)"Per' '" '"5"""ed ."' m"." s' 0tracitor-Tribular, paper, oil impregnated. .0023 mia., moo :win (0169) Capacitor -Tubular, pap. oil impregnated, .0037 0.00., soo volts (0118) Clax,,f,to(rF,T,oetraillilo,paz:81,1,:.tlurt.. .0047 mid- 600 Cavp,,a,c,.i.lo,r,-,T,.u.b) ulaz paper. oil impregnated, .00az :ma, so° ',,,'AttoZW.VM,M7: 012!`"e2M"'d"°1 '''" 400 Capacitor -Tubular. mould., . impregnated, .01 mid., 600 volts (C165, C168) .Tubular,. pap. oil .tregnated, .0. m1/2., 000 16) 0.1,,,ar,rantiV,,, gr,Tr, ife.pnizegnated, .002 m1/2.. 18 Capacitor-T.ular, paper, oil impregnated. .022 mid., 600 volts (0216) 73553 75071 73592 73615 73551 73557 737. 719v 73787 76498 76140 73477 76672 T-- 78483 76484 76646 76647 75152 76640 76510 35787 76863 76157 74594 5040 s., 750,,s 73,17 Capacitor -Tubular, paper, oil impregnated, 647 .1. 400 C183) Cami .ular, mou.d. .047 .0., 400 welts (C178. CarLito<rE1abrairsri.v.,gzcoij.2fmpregnated. .047 0000., 600 Cafotto(rArettromper, oil impregnated, .068 rad., 1000 Clo,e,,,tto,raltegiymper, oil impregnated, 0.1 cola., .00 C0Pati1/20-T.ular. paper, oil impregnated, 01 .0., 600 volts (0173) i.-tubular,Capac paper, oils mpregnated, 0.12 mw., 400 volt (C011530) Palm, 00111imPregnated. 0.12 cold. 600 Cazozito(rEr cular,si, cpipari . impregnated, 0.47 0.10., ow Choke -Filter choke (1608) 00 -Tubular clip Mr mounting sta.. cepa.. #75166 Coil -Choke coil (1101) Coll-Filamont winding o.y for ivoltage transformer (L.) Coil-No.0M linearity coil complete with adjustable core Coil -Width coil complete with adjustable core (1106) Con -Peaking coil (72 muh) (1103, 0161) Coil -Peaking coil (180 muh) (1114, 0166) Coil-1/2.MT mil (510 rood.) 0605, 1110) Coil -0.F choke coil (1.5 muh) (L117,1.118) -mu Coil-R.F choke (4.7 mu) (.5) Connector-Phono input connector 0103) Connector -Anode connector complete with terminal and contact Coangneecctaorm-n.d. anode lead connector -mounted on ...lb Connector -2 contact male connector for power cord Connector -4 contact female c.a. for epeak. cable co(''.°L) . meme connector ,...... (n.2) '7:1'4; 7640 76448 76493 "` 7,::: 76803 77223 31387 7085 74956 74839 73e36° 76459 76654 77035 nun 76460 noso 751. 7°700 76500 76649 76875 76468 79015 o7drTI=ZGc.:r7tr7(V75) Control-BrighMess control (0218) Control -Height control (0203) Control -Horizontal and control (02010. _ 20M) occsoac, 0000.) `11111008Vjga) "0 "r0"' hold""" (5001' =.:'7P'.trz:=.:17cos.7)..(2.4) Control -Volume control .00 power switch (13117, sioa) (ICCS680, moan) Control -Volume control and power mei. (0117. S101) Co"nctsr061°-V').0ml peaking control (0207) Cover-Back cover for bl.voltage compartment Cover-Sfile cover for1/2.volt.g. compartment Curseltroatr-Rulaber cu.ion for deflection yoke flood (2 Fast:ne'-ftsh fastener /or mounting tube sockets rGIR'uTb'er27r='rO")ountMg Mhe so.els Grommet -Rubber grommet for 2..od. naa .w. Hood -Deflection yoke hood 1..e rubber cushions (K0S68C, 80368E) Hood -Deflection yoke hood le. rubber cushions (KCS68F) lack -Video lack (noo 1.md.-Anode lad complete with eyelet agnet mom18=f-Foco complete (screW drIver adjustment ,..,.--." 0100 magna! (P... tE.) 05t-SPeedntit for mousing trimm1r .0e01. 0020 Plate-11Lvoltage plate (bakelite) complete less transformer socket a. Mad Radiator -Heat dissipating radiator for 6CD6 t.e Rectifier -Picture detector crystal rectifier (CRI01) Resistor -Wire wound, 1.5 ono., 1/3 watt (0141) Resistor -Wire wound, 100 ohm.. 2 watt. con.) 34 207 21T159. 217159DE, 21T165 21T166DE, 217174DE, 217175DE 21T176 21T177, 217178 217178DE 21T179. 21T179DE REPLACEMENT PARTS (Continued) SIZE DESCRIPTION STO No. DESCRIPTION 76682 =76485 ftais00-Wire wound 200 ohms. 5 watts (0100) Resistor -Wire W011110, 330 obms. I watt (PIM (KCS680, 00300E) ::::::=7::;:. wc.7.dii eco7tgr."i:::"igi"oli,(Ral)B. Run. 02011, 0343E, 112430): s: oerl` cclo° n: ool 4,5s5'0° o* h'hn a sl, '6:wwa:t t 502013 503047 502056 34753 502082 502110 503110 503118 503122 503147 513147 50310 503168 503181 502210 s.... 519210 502112 11122122 50.22 503227 503133 503235 513256 190" 503268 513268 502282 503282 523282 50.'0 513310 513310 513312 503318 503322 503327 503333 503939 503347 513347 501.6 503356 513356 512368 513368 513382 502410 503410 504410 503412 503415 512418 502 50341202 503427 509133 503439 503447 503468 503982 503510 503515 503533 512533 I section of 1200 ohms, I watt 1 section of 10.000 ohms. 5 watts. and ...action of 700 ohms, 5 watts Resistor -Fix. composition: 43 ohms. ±5% Vs watt (Imo) (1.06.. KCS660 47 ohms. -3 10%. 1/2 watt (R100.11158. 0233) 56 ohms. ±5%, 1/2 wad (11100) 60 ohms, To 5%. 1/2 watt (0105. 5110) ic ohm., =0% n watt )1110) 100 ohrn.. 8 5%. 1/2 watt (RIM) 100 ohm, ±M%. 1/2 watt (31S2.1126, 0133) no on., = lox. ii watt (3152) 220 ohms. 1.1, 10%. 1/2 watt (0174) 470 ohms, -3- M%.1,5 wad (112.15) (K.68F) 170 ohms. ± 10%. I wad (0123. 7146) 530 ohrns, -8 10%. 1/2 watt (0216) (.068C. 00.80) 690 ohms, -8 10%. 1/2 watt (0102) 820 ohms. -8 10%. Vs watt (0180 1000 ohms. -6- 5%, Vs watt (Si!!) .°20Tionea.l;leg"2. ''". "" '""' mss 1000 ohms. -3- 10%, I watt (R215 for 0.680, KC368E) 1200 ohms. -8 5%. 1/2 watt (0110) MO cOi=ti -- At 11/2=572.0 10081) 2200 ohms, M 10%. 1/2 watt (010) 2700 ohms, =00,6.14 watt (11208) (K0S613C) KCS680) 3300.0 = io96. Si nn (inn) Oicscor) IR: J.1 ::::: (Tailor If CS680 3900 ohms, 10%. 12 ...3 OMB) 5600 ohms, -3 10%. I wad (11169) "Egirg; if1511';g1111:or(PALIT'"-- 00" "d ono ohms. 6- 10%. 1/2 watt (11158) (005080, 00000 MOO ohms, -8 10%, 1 watt (R155) 0200 ohms. -,.- .6%. I.Ig watt (R141) (8.0.. 0.680) 8200 Mins. -6- 10%. 14 Watt (R150.11147) 8200 ohms. -6- DM. 2 watts (1130..753) "'M.P.' '10%. 1/2 wen (012..143. 10.000 ohms. -3-10%. I watt (0168) (5.68F) 10.000 ohme, M 10%. 2 watts (RI51) 12.000 ohms, -3 10%. 1 watt (0191) 18600 ohrns. -3 10%. Vs watt (RIM HIM 3351) 23000 ohms. M 1.. 1/2 watt (11110. 0194.0195. 0196) 27.0 ohms. at 10%. 1/2 watt (anti 11170) 33,000 ohms, -6- 10%. 1/2 watt (0107. 0132, RI39, 0258) 39,000 ohms, ±10%. 1/2 Watt (11112. 11153) 41.000.ms, 6 10%. th watt (8104. RI31) 47,000 ohms, -6 10%. I welt 1.27) (500 55600 ohms. ± I.. 1/2 wad (0144, 0110)) 50,000 ohms ± 10%. 10 wad (0106) 56,000 ohmS, ±10%. 1 watt 01226, 0231) 68.000 ohmk 6- 5%. I w ., (0210. 0230) 68.000 ohrns. ± Irk, I watt (112.2.5. 8227) 62,000 ohme, -3 10%. I wart 10226.0257) 100000 ohms, M 5%. 1/2 watt (0170) nocoo 00.., = irm. V: wet (0110) nocoo ohow. ±20% 15 Watt (010) (0csooc, licsuc) 120000 01000, 610%. 1/2 Wad (0170) 15= rArs-6- 10%. Lk watt (11145, 0170. 0172, 0187, 11217, no,000 ob.., ±0%. i watt (.34) 110,000 ohm.. ±5% LS watt (HIM 120.000 ohms, -8 10%. 1/2 watt (5185, 0193, 0207) 270.000 ohms, -8 10%. K watt (0184) 330000 ....., = cm. % watt (OH., 0211) (0156 sc..) 39K0.60080Eo)hms. -6- I.. 1/2 watt (71255) (0256. 5.68C. no,oao oh... ± ion. 1/2 wail (0121. 0160,1171, R108,3190) 680600 Mins, -3 10%, V2 watt (01001 T 8202,030) 0 ohms, ± 10%. 14 watt (MO in 10068F) (R202. I megohm. -3 10%. 1/2 watt (0182, azo2. am. II230) - 1.5 meg., -6- 10%. Vs watt (RI.) 3.3 megohm. -8 10%, 1/2 watt .1/21°) 3.3 memo... 5%, 1 W. (027) 50358 503582 nano 503610 7.0,0 71456 7.87 73584 76.1 75718 74034 31364 7320 76453 31.1 71508 50367 71494 73117 76651 76636. 75173 76418 7603 77222 76463 76501 76490 Zg: 76438 7.37 76494 74144 76"2 77"0 76434 "'" 76435 76433 710% 76482 76600 75021 5030 75022 75520 75682 5039 7.33 75530 76296 5039 76389 75520 8.4 ...goes. = 10%. n watt (0170) 41,;,;r1,),,,,, ,, 86 megohm, M 10%. Vs watt (0177. 0180) io megohm, m 10%. 1/2 wan (0140) (00,268G Km. 1 e hm ±i 0 watt 0116 , Screw -Z8-31 x 7/16" wing screw tomount deflection yoke Shia.. ftacfto-Coolsnnecting shaft -nylon -for picture and brightness Shientr shield Shield -7.e shield for vertical oecillator. V114 Socket -Channel indicator lamp socket Socket-KMencope wok. So.. -Pilot light socket Socket -To. socket, octal, centre, plate mount. Socket -Tuba socket. octal, mould. bakelite, plate mounted Socket -7.e aocket. octal, wafer So.. -Tube socket. 6 contact, mould. bakelite Socket -Tube socket, 6 p., moulded, saddle mounted Socket-T.e rocket, 7 pin, moulded. saddle mount., ature Socket -T.8 socket. 7 pin, vv... miniature spring -Springs for securing 6000 radiator (3 0201/2) Stud -Adjusting stud complete with guars nor focus magnet Stud -Adjusting stud for trimmer capacitor Support -Bakelite support only -pit of hi -voltage We. Switch -Tone control and phono switch (SI01) Switch -Tone control and 00100 switch less volume control and power switch (0101) TermMal-Screve type grounding terminal Transformer -Hi -voltage tr.sform. lei filament wino. (2115) Transformer -Horizontal osci1/2tor transformer complete with adjust. cores (TI14) Trimr:t:Z:1:°:7`o"T°"re-s-ro'&710r2d, '&Oart.7c"ltor'ortrrmel" ":'171:1: Vrind Traanbsleforcmoerer -sS(o7u1n0d11,4CItOra.nCsf.o)rmer complete with adjust Transformer -30.d takemlf transformer complete with ad- hietable cores (7110. 0148) sformer-Vertical output transformer (7112) Transtonner-gertical oscillator tramformer (T111) T`,IXtr's`tfaltl: /11`01!0Vil, A74.). NC6.71(8tV,"0 r"It°sTdolre-cry'es°21t1i. trygrm.711010 ''''h First pix Li plate transformer complete with .cnnj ..)r cores (0105, C130, C131, 5134) (000680, ":=7.-!,:'.PrT. A ciao, gggVngi 'Mgt?) ''''' Tramlormer-Second plz Li gild transformer complete with adjustable cores (TIN. CI.) not or Murth plx transformer (T107, 7108) Tro.rmar,,,,r,81,11f00 (.1 transformer (0109, C146 C147. Trap -9.5 mc. trap (1116. C215) Ve'n'sro].?.'r.09°.nl.117171.11°17En 0193,co'r nor/Ni° SPEAKER ASSEMBLIES 071190-2W, AL 105018 For Modele 117159, 21515915.2 Cone -Cone and voice coil (3.2 ohms) Connector -4 prong male plug for Speaker (MI) Speaker -8- P.M. speaker comp. with cone and. voice coil (3.2 ohms) less transformer and plug Transformer -Output transformer (7103) SPEAKER .SE.L1E3 971490.20 Ia osso_c......°,,Z...1el,s 117156, 21T15912 SPEAKER ASSCABLI. 92560-11-W. 01.111All Cone-Cone-Conea. voMe coil (3.2 ohms) Connector -4 contr. maM connector Speaker -02- P.M. sp ark Dr comp am with 0566 an voice coil lees transformer and plug Transformer-OuMut trna sformer SPEAKER ASSEMBLIES 971494.1 W. AL III 111 Cone -Cone and voice coil (3.2 ohms) Connector 9 contact male connector (1101) Spmker--12" PM speaker complete with cone and voice coil (3.2 ohms, less traneformer and plug Transformer -Output transformer (7103) 208 21T159 217159DE, 217165 217166DE, 217174DE, 217175DE 21T176 21T177. 21T178 217178DE, 21T179. 21T179DE STs$1,7 DESCRIPTION REPLACEMENT PARTS (Continued) .STOCK DESCRIPTION X325I 76794 77254 21039 CABINET BASE (For use with Model 215159) Pull -Dew pull 11.CELLANEOU6 illE.....i back complete with pow. 1000 tor Model Back -Cabinet backozngelsor power cord a. ter, --- - '- '''''' 7" ' ' '''''''C '4717' ir41 75 ;7 V NI 7711 7m- 0000 000 '02.12 .77"' 'aiiT2:?:°7H2,1°°L,'?4ri°44rith 76184 Board -Antenna terminal hoard 766. Brylee;,,Hamr Ma.el from cabinet lop panel to del. 76697 ;1500 800 76699 13103 71591 77047 1...... Masking panel eUPPort bracket (1 mcIA) .....u... Bracket -Pilot lamp bracket jj jj fttarocdkset(-2"Ure" g.1A/)2.0, bracket mr balding 1. Bumpr-Ru.er bumper for kineampe (as regfi) Cap -Pilot lamp MP Catch -Bullet catch and strike for doors CII.pg?r,,burental clip (metal) for mfit. ham for 0000.1 X1317 Cl=file,goth . mahogany or ...Mt ...use.. O. r 81918 Cloth -0. cloth ler oak instrum. for Modal 211159 51756 Cloth -Grille cloth for mahogany or walnut inetrumente lor .del 217159DE 0"10 ''"X3089 75474 38153 71457 76631 76827 76698 78568 76567 77049 71984 c"2"17:c?1:"1": 1g8Ta1l660°LiT,V17,°5,70,E1,62-10.V1.700°`0"1'!""'""`-"°.V. tr' Cloth -Grille cloth for oak instruments for Model 211.178 CIFici;1712T1a.7r2012'.11117.7rn8g. .21g1Y1777611121or11nZoIrIVmIaTpAle umtruments for Models 21.79, 21117910 c°i1o'.iw..i-'sd)ing1/2 53.13"5.5 .5... ...1/25 °5b1/2 Connector -4 contact male connector for antenna cable Cora -Pow. cord ..a plug Cushion-R.ber cushion Mr dust sealing the kineecope CCuusshhioino-nR-.b0e0r bmeerhi.o.n.ofowr.s.a.f.e.t.y..g..lomsp(e4.r.e. g:Au)01....... (2 rated) Decal -Con. /unction decal for maloolony or walnut in.trnmen. .......'1. Decal -Control function decal for blonde mahogany, esk or Decal -Control nue.. decal for mahogany. abut or maple instruments Decal-Tracla ma. decal ;lg.. a:=.11A',71..".:="foa: codes 11T1740E. 211175DE, 211.1780E, 2111790E 74809 E.lem-"RCA Victor" emblem 77000 01'`I'Vr14111.7Zr" " '61' ''''''"'"' 7704"°"11T.-22'tieoffs`211r3Z17;11777 00.'"0"1 '"0". 77487 EmasT;sisitiellig'ogiblern for 2520 2IT17410, 778' 7012 .E.m.b.l.e.m-R."CAvV.i.c'to.r"..f.o.r '..........."E Models 21,1590E, 2171740E. 211178013 75456 Escutcheon -Channel marker escutcheon 72113 Fmt-Rubber foot for Meal 210159 cabinet (4 re8c1) 76622 Class -Safety glass 37396 Grommet -ft.. grommet for mounting .0.0. (0 regkl) 74308 Hinge--Cablnet door hinga (1 set) 7"" '"m'-ar5.n-rfoir"mta"h"og"an"y'o'r w"a-ln1ut ,.L1=,.13°- 76615 Knob -Brightness control or vertical hold control -I. -for maple instruments (M.) 76586 Kno:r. Brigtn.r, ,,,c,,,a=1..% hold control knob- (outer) °"" ".r.T.SVtt:T:t7.17;1°-°'''°°^-'" "°""°°' - 7614 '71bn7srr ''''' ..'ect" 'rn-0"L-'00 m"' i"0'.0" 76564 Knob -Channel selector knob -beige -for ink ...Mae.. (inner) 76591 8. -Fine tunMg con. knob-m..n-lit maftganY or walnut instrument. (outer) 78" 'Ttfarri° t"'""utr°' k''''''-'"--'` '''''''' """""" 7'60 00:titr'eOuttrZ10"0"0' "00-'"0"-'00 0.5 '""' 7486' 'fl=11",ne or walnut p!otoriLestoairl(on"gna.o) LLIt'so`or.171r or 74001 .08 -Picture control, horizontal how c.a.. or volume control jandrpower switch knob-tin-formaple Mstru. ,,,,,, ,,,fMtl.jl: ).,,,,,,,, :::.,,.:40rwer .°°" k bDT f. .3 NM. ''*'' ''''''''''Z'ar4 ?01:1'"?I'P'PL2:n171.:02:3°'-'"''''-' 7",,,,: 'IrKvobe-ic:o1n-tr7ol:a:n;*d:p:h1o)n°o"s'w`'itc'7h -kn'o''b''-'b-e'.i°ge°--f°o`r oaak. metrumente (outer) 765 Larg.78bannej. marker escutcheon or stint bms_kfintrb 75459 '''''" 76696 77247 77246 Mask -Channel marker escutcheon -light mask -bur.. -I. mahogany or walnut instrument. '12.7c5r-,..T.11%, 'trZZ:n7satrTrretis ""k-r"d"" klask-Poly.t.ene masking Pam. foz 1/25.500. Medallion -Phonograph and dol medallion Mr maple In. struments, Model 21T179DE Medallt:Vt.o.tr=p1 and Vg..41.41.trn for mahogany 76730 ,.,.,,, N,,o,,7,.0,,p,e.a. d,,n,u,t,,fo, r.t,r,im,,M,,e,r, mp,a,c.i.to..r,C,r2o16w. 7I4. Nut -20.33 wino nut to mount yoke hood to hanger [...et 7111. N=I10,1,!,,,1550. 00 1. 065°1/2m 7.5 i1/25d .1.0 7'..77.010" .,,. ...55.....1. 3.5.5...... ut-fteednut for fastening 'RCA Victor" emblem. "De - ',PP1_l/,a2a,e,.,a5-,ao"-cr.k.,p.(.la20ter.e1foc.rj1dce)..nf0oter0r md.o1aohr0op.ug1lal fno,yr..Iod."or)dwela2ln1u11t7M0odel COU_2,10 , , Moan s,,,,,ss 77045 76756 76571 76569 76580 76198 76196 76197 11.702 Pll-Door pulls for low.: wwws for mod. 21,17913E Pull-Dmr pull (2 ...fin for oak mod. 217176 Pull -Door pull for 14.. 217177 Pull -Center door pull M.el 117178 (2 reg'ol) Pull -Upper dmr pull. Model 21T178 (4 regA) .11 . Pull -Door pull for low. door for Model 11179 Pull -Poor ntioner 1.y. how Mr 1.04 2117° Pull -Door A.-'L' pull. uspspe..r2R.0.H...d.oor for Modeal s.3s1.5.1s7o6s assembly (2 regA) 55° r rl-,; `""utr-100est"."1015041 r`rg'cli°1 'h'atler47ckrt P5 74""crdror-A:asu D.:.:erA,V;!4:070,:r,!15: 2101,,,76 7.". scr,rsillit.n....mit ..a "".`v '00 .°° ... ° 74113 Scp,o7,3111-32 x11" trimit head screw for door pull for Model 74007 750" ,ess0 nan 72045 77006 14270 73643 55°0° 74936 7006 75459] "040 75458 76300 7"" 770" s77M1414P" '''''' '"a '`'w 000 000100 0000 ''' s'itrZ,;r% idViOdl,o..lms3,.I.T.i.g..d. 's''", '''' 0"` "' "' reed) spring -Retaining spring for knob. #74001. mos 6 75464 Spring -Retaining spring for knob. #76501. 76591 676623 Spring -Retaining opting for deflection yoke hood support od nut igg0:5V794e'ZIE69'.10;ar 4.6E2Zej"e' '""' Spring -Spring clip for Mann. marker escutcheon OPAIIM'srwsrVa24774rg,-7ere'"°, °"". 7""' Spring -Spring RI! kinescope ...leads 50.0binroant nd,omor:r.s.n. (capper sn,,,,... ",.. ,,,,, z=z,""" --- ''' -'°°- °' ash -Felt washer -dark brown -between knob atrz w.'""' WMIrreTrtg'et"r;toL4rinerumkenctl' '''' char''' Washer-Falt washer -beige -between knob a. Mama. marker e.utcheon for oak instruments Washer -Felt washer for cab... back mounting screws (4 mti'd) "114f1;TIVi3r2ITT7tIfFiVd271g8ATiI; "` "°"" "tIgii,c.°"I'gn',ortri'51.°A7Ige° 00' 0004°6 APPLY TO YOUR RCA DISITIMUTOR FOR PRICES OF REPLACEMENT PARTS. 36 RCAVI C TO R TELEVISION, AM -FM RADIO, PHONOGRAPH COMBINATION Model 21-T-197DE "Sunderland" Mahogany MODEL 21-T-197DE Chassis Nos. Television Chassis KCS68H Radio Chassis RC1111A, Audio Amplifier RS141 A Record Changer 930409-5 - Mfr. No. 274 - SERVICE DATA - 1952 No. T10 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. GENERAL DESCRIPTION Model 21-T-197DE is a deluxe television-AM-FM radio phonograph combination. The receiver employs 29 tubes plus 4 rectifiers and a 21 inch kinescope. A three speed record changer is provided to play 331/2, 45 and 78 RPM records. The receiver is provided with cabinet antennas for AM, FM and television where local conditions permit their use. ELECTRICAL AND MECHANICAL SPECIFICATIONS PICTURE SIZE 227 square inches on a 21AP4 Kinescope TELEVISION R -F FREQUENCY RANGE All 12 television channels, 54 mc. to 88 mc., 174 mc. to 216 mc. Fine Tuning Range..± 250 kc. on chan. 2, ± 650 kc. on chan. 13 Picture Carrier Frequency . Sound Carrier Frequency 45.75 mc. 41.25 mc. RADIO TUNING RANGE Broadcast Frequency Modulation Intermediate Frequency-AM Intermediate Frequency-FM 540-1,600 kc. 88-108 mc. 455 kc. 10.7 mc. POWER SUPPLY RATING 115 volts, 60 cycles, 410 watts max. AUDIO POWER OUTPUT RATING 10 watts max. CHASSIS DESIGNATIONS Television Chassis KCS68H Radio Chassis RC1111A Audio Chassis RS141A Record Changer 930409-5 Refer to Service Data 930409 for record changer information LOUDSPEAKER -92569-12 Voice Coil Impedance 12 inch PM Dynamic 3 2 ohms at 400 cycles WEIGHT Chassis with Tubes in Cabinet Shipping Weight DIMENSIONS (inches) Cabinet (outside) 222 lbs. 281 lbs. Width Height Depth 43% 391/4 271/4 RECEIVER ANTENNA INPUT IMPEDANCE Choice: 300 ohms balanced or 72 ohms unbalanced. RCA TUBE COMPLEMENT Tube Used Television Chassis Function (1) RCA 6BQ7 R -F Amplifier (2) RCA 6X8 R -F Oscillator and Mixer (3) RCA 6AU6 (4) RCA 6CB6 1st Picture I -F Amplifier 2nd Picture I -F Amplifier (5) RCA 6CB6 (6) RCA 6CB6 3rd Picture I -F Amplifier 4th Picture I -F Amplifier (7) RCA 6AG7 (8) RCA 6AU6 Video Amplifier 1st Sound I -F Amplifier (9) RCA 6AU6 (10) RCA 6AL5 2nd Sound I -F Amplifier Ratio Detector (11) RCA 6AV6 1st Audio Amplifier (12) RCA 6CB6 AGC Amplifier (13) RCA 6SN7GT Sync Separator (14) RCA 6SN7GT . Vert Sync Amplifier and Vert Sweep Osc. (15) RCA 6AQ5 Vertical Sweep Output (16) RCA 6SN7GT Horizontal Sync Amplifier (17) RCA 6SN7GT.Horizontal Sweep Oscillator and Control (18) RCA 6CD6G (19) RCA 6W4GT (2 tubes) Horizontal Sweep Output Dampers (20) RCA 1B3-GT/8016 High Voltage Rectifier (21) RCA 5U4G (2 tubes) Rectifiers (22) RCA 21AP4 Kinescope Radio Chassis RCIII1A (1) RCA 6CB6 R -F Amplifier (2) RCA 6J6 Mixer and Oscillator (3) RCA 6BA6 I -F Amplifier (4) RCA 6AU6 F -M Driver (5) RCA 6AL5 Ratio Detector (6) RCA 6AV6 AM Detector AVC and Audio Amplifier Audio Chassis RS141A (1) RCA 6C4 Phase Inverter (2) RCA 6V6GT (2 tubes) Audio Output (3) RCA 5Y3GT Rectifier 210 21-T-197DE ELECTRICAL AND MECHANICAL SPECIFICATIONS (Continued) PICTURE INTERMEDIATE FREQUENCIES Picture Carrier Frequency Adjacent Channel Sound Trap Accompanying Sound Traps Adjacent Channel Picture Carrier Trap 45.75 mc. 47.25 mc. 41.25 mc. 39.25 mc. SOUND INTERMEDIATE FREQUENCIES Sound Carrier Frequency 41.25 mc. and 4.5 mc. VIDEO RESPONSE To 4 mc. FOCUS Magnetic SWEEP DEFLECTION Magnetic SCANNING Interlaced, 525 line HORIZONTAL SWEEP FREQUENCY 15,750 cps VERTICAL SWEEP FREQUENCY 60 cps FRAME FREQUENCY (Picture Repetition Rate) 30 cps OPERATING CONTROLS (Front Panel) Channel Selector Fine Tuning Picture Brightness Picture Horizontal Hold t Picture Vertical Hold Sound Volume and On -Off Switch Tone Control Dual Control Knobs Dual Control Knobs Dual Control Knobs Dual Control Knobs NON -OPERATING CONTROLS (not including r -f and i-f adjustments) Picture Centering top chassis adjustment Width rear screwdriver chassis adjustment Height rear chassis adjustment Horizontal Linearity rear chassis screwdriver adjustment Vertical Linearity rear chassis adjustment Vertical Peaking Control rear chassis adjustment Horizontal Drive rear chassis screwdriver adjustment Horizontal Oscillator Frequency rear chassis adjustment Horizontal Oscillator Waveform Horizontal Locking Range bottom chassis adjustment rear chassis adjustment Focus Ion Trap Magnet top chassis.adjustment top chassis adjustment Deflection Coil AGC Control top chassis wing nut adjustment rear chassis adjustment HIGH VOLTAGE WARNING OPERATION OF THIS RECEIVER OUTSIDE THE CABINET OR WITH THE COVERS REMOVED, INVOLVES A SHOCK HAZARD FROM THE RECEIVER POWER SUPPLIES. WORK ON THE RECEIVER SHOULD NOT BE ATTEMPTED BY ANYONE WHO IS NOT THOROUGHLY FAMILIAR WITH THE PRECAUTIONS NECESSARY WHEN WORKING ON HIGH VOLTAGE EQUIPMENT. DO NOT OPERATE THE RECEIVER WITH THE HIGH VOLTAGE COMPARTMENT SHIELD REMOVED. BE SURE THE GROUND SPRING, BETWEEN THE YOKE ASSEMBLY AND THE CHASSIS, IS SECURELY FASTENED BEFORE TURNING THE RECEIVER ON. KINESCOPE HANDLING PRECAUTIONS DO NOT REMOVE THE RECEIVER CHASSIS, INSTALL, REMOVE OR HANDLE THE KINESCOPE IN ANY MANNER UNLESS SHATTERPROOF GOGGLES ARE WORN. PEOPLE NOT SO EQUIPPED SHOULD BE KEPT AWAY WHILE HANDLING KINESCOPES. KEEP THE KINESCOPE AWAY FROM THE BODY WHILE HANDLING. The kinescope bulb encloses a high vacuum and, due to its large surface area, is subjected to considerable air pressure. For this reason, the kinescope must be handled with more care than ordinary receiving tubes. The large end of the kinescope bulb-particularly that part at the rim of the viewing surface-must not be struck, scratched or subjected to more than moderate pressure at any time. During service if the tube sticks or fails to slip smoothly into its socket, or deflecting yoke, investigate and remove the cause of the trouble. Do not force the tube. Refer to the Receiver Installation section for detailed instructions on kinescope installation. All RCA replacement kinescopes are shipped in special cartons and should be left in the cartons until ready for installation in the receiver. 2 OPERATING INSTRUCTIONS 21 1 21-T-197DE The following adjustments are necessary when turning the receiver on for the first time. 10. In switching from one channel to another, it may be necessary to repeat steps numbers 4 and 9. L Turn the radio FUNCTION switch to TV. 2. Turn the receiver "ON" and advance the SOUND VOLUME control to approximately mid -position. 3. Set the CHANNEL SELECTOR to the desired chan- n el. 11. When the set is turned on again after an idle period, it should not be necessary to repeat the adjustments if the positions of the controls have not been changed. If any ad- justment is necessary, step number 4 is generally suffi- cient. 4. Adjust the FINE TUNING control for best sound fidelity and SOUND VOLUME for suitable volume. 5. Turn the BRIGHTNESS control fully counterclockwise, then clockwise until a light pattern appears on the screen. 6. Adjust the VERTICAL hold control until the pattern VERTICAL HOLD HORIZONTAL HOLD RECORD CHANGER CONTROL SWITCH ON -OFF SOUND VOLUME TV TONE SWITCH RADIO PH -TV FUNCTION SWITCH TUNING TREBLE BASS 12. If the positions of the controls have been changed, it may be necessary to repeat steps numbers 1 through 9. 13. For radio operation turn the radio FUNCTION switch to AM or FM and tune in station with the radio TUNING control. stops vertical movement. 7. Adjust the HORIZONTAL hold control until a picture is obtained and centered. 8. Turn the BRIGHTNESS control counterclockwise until the retrace lines just disappear. 9. Adjust the PICTURE con- trol for suitable picture contrast. PICTURE FINE TUNING BRIGHTNESSII CHANNEL NO. RADIO OFF -ON VOLUME CHANNEL SELECTOR S.1459 Figure 1-Receiver Operating Controls 14. For phono operation, turn the function switch to PH. Set the stylus on the phono tone arm to 78 or 33-45 whichever applies. Set speed control to the desired speed. Place a record on the turntable (for 45 RPM records place 45 RPM centerpost over spindle) and tarp phono to "ON" position. REFER TO PAGES 180 TO 193 FOR TELEVISION ALIGNMENT PROCEDURE AND WAVE FORM PHOTOGRAPHS INSTALLATION INSTRUCTIONS ION TRAP MAGNET ADJUSTMENT.-Set the ion trap magnet approximately in the position shown in Figure 2. Starting from this position immediately adjust the magnet by moving it forward or backward at the same time rotating it slightly around the neck of the kinescope for the brightest raster on the screen. Reduce the brightness control setting until the raster is slightly above average brilliance. Turn the CENTERING ADJUSTMENT LOCK SCREW FOCUS CONTROL ION TRAP MAGNET ',CENTERING ADJUSTMENT LEVER DEFLECTION YOKE 0 FOCUS MAGNET MOUNTING SCREW KINESCOPE SOCKET .411. 0 KI NE CUSHION KI NE Figure 2-lon Trap and Centering Magnet Adjustments focus control (shown in Figure 2) until the line structure of the raster is clearly visible. Readjust the ion trap magnet for maximum raster brilliance. The final touches of this adjustment should be made with the brightness control at the maximum clockwise position with which good line focus can be maintained. DEFLECTION YOKE ADJUSTMENT.-If the lines of the raster are not horizontal or squared with the picture mask, rotate the deflection yoke until this condition is obtained. Tighten the yoke adjustment wing screw. PICTURE ADJUSTMENTS.-It will now be necessary to obtain a test pattern picture in order to make further adjustments. Connect the antenna transmission line to the receiver. If the Horizontal Oscillator and AGC System are operating properly, it should be possible to sync the picture at this point. However, if the AGC control is misadjusted, and the receiver is overloading, it may be impossible to sync the picture. If the receiver is overloading, turn R175 on the rear apron (see Figure 3) counter -clockwise until the set operates normally and the picture can be synchronized. CHECK OF HORIZONTAL OSCILLATOR ALIGNMENT.-Turn the horizontal hold control to the extreme counter -clockwise position. The picture should remain in horizontal sync. Momentarily remove the signal by switching off channel then back. Normally the picture will be out of sync. Turn the control clockwise slowly. The number of diagonal 3 212 21 -T-197DE INSTALLATION INSTRUCTIONS black bars will be gradually reduced and when only 2 bars sloping downward to the left are obtained, the picture will pull into sync upon slight additional clockwise rotation of the control. Pull -in should occur before the control has been turned 120 degrees from the extreme counter -clockwise position. The picture should remain in sync for approximately 90 degrees of additional clockwise rotation of the control. At the extreme clockwise position, the picture should remain in sync and should not show a black bar in the picture. If the receiver passes the above checks and the picture is normal and stable, the horizontal oscillator is properly aligned. Skip "Alignment of Horizontal Oscillator" and proceed with "Focus Magnet Adjustment." R203 5214 HEIGHT VERTICAL CONTROL LINEARITY CONTROL R207 VERTICAL PEAKING CONTROL .1102 TORE SOCKET - L106 WIDTH CONTROL L107 HORIZONTAL LINEARITY CONTROL J103 @AUDIO OUTPUT CIMIa HORIZONTAL DRIVE AGC CONTROL CONTROL C S1A RANG J104 VIDEO® NOR ZONTAL LOCKING JACK 7114 HORIZONTAL OSCILLATOR FREQ. ADJ. Figure 3-Rear Chassis Adjustments ALIGNMENT OF HORIZONTAL OSCILLATOR. -If in the above check the receiver failed to hold sync with the hold control at the extreme counter -clockwise position or failed to hold sync over 90 degrees of clockwise rotation of the control from the pull -in point, it will be necessary to make the following adjustments. Horizontal Frequency Adjustment. -Turn the hori- zontal hold control to the extreme clockwise position. Tune in a television station and adjust the T114 horizontal frequency adjustment at the rear of the until the picture is just out of sync and the horizontal blanking appears as a vertical or diagonal black bar in the raster. Then turn the T114 core until the bar moves out of the picture leaving it in sync. Horizontal Locking Range Adjustment.-Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T114 rear core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 2 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C181A slightly clockwise. If less than 2 bars are present, adjust C181A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 bars are present. Repeat the adjustments under "Horizontal Frequency Adjustment" and "Horizontal Locking Range Adjustment" until the conditions specified under each are fulfilled. When the horizontal hold operates as outlined under "Check of Horizontal Oscillator Alignment" the oscillator is properly adjusted. If it is impossible to sync the picture at this point and the AGC system is in proper adjustment it will be necessary to adjust the Horizontal Oscillator by the method outlined in the alignment procedure. For field purposes para- graph "B" under Horizontal Oscillator Waveform Adjustment may be omitted. FOCUS MAGNET ADJUSTMENTS. -The focus magnet should be adjusted so that there is approximately three -eighths inch of space between the rear cardboard shell of the yoke and the flat of the front face of the focus magnet. This spacing gives best average focus over the face of the tube. The axis of the hole through the magnet should be parallel with the axis of the kinescope neck with the kinescope neck through the middle. CENTERING ADJUSTMENT. -No electrical centering controls are provided. Centering is accomplished by means of a separate plate on the focus magnet. The centering plate includes a locking screw which must be loosened before centering. Up and down adjustment of the plate moves the picture side to side and sidewise adjustment moves the picture up and down. If a corner of the raster is shadowed, check the position of the ion trap magnet. Reposition the magnet within the range of maximum raster brightness to eliminate the shadow and recenter the picture by adjustment of the focus magnet plate. In no case should the ion trap magnet be adjusted to cause any loss of brightness since such operation may cause immediate or eventual damage to the tube. In some cases it may be necessary to shift the position of the focus magnet in order to eliminate a corner shadow. WIDTH, DRIVE AND HORIZONTAL LINEARITY ADJUSTMENTS.-Adjustment of the horizontal drive control affects the high voltage applied to the kinescope. In order to obtain the highest possible voltage hence the brightest and best focused picture, adjust horizontal drive trimmer C181B for maximum drive (minimum capacity) consistent with a linear raster. Compression of the raster due to excessive drive can be seen as a white vertical bar or bars in the right half of the picture. Besides compression caused by excessive drive, another item to watch for is the change in linearity at the extreme left with changes of brightness control setting. By proper adjustment of the linearity coil, the changes in linearity with changes in brightness can be made negligible. In general, to achieve this condition, the linearity coil should be set slightly on the high inductance side (core slightly clockwise) of the optimum position. Preset the following adjustments as directed: A.-Place the width plug (P105) in the minimum width position (top). B.-Set the width control coil L106 in approximately mid position. C.-Set the linearity control coil L107 near minimum induc- tance (counter -clockwise). D.-Set the drive capacitor C181B in the maximum drive position (counter -clockwise). If the raster is cramped or shows compression bars on the right half of the picture turn C181B clockwise until this condition is just eliminated. Adjust the linearity control coil L107 clockwise until best linearity and maximum deflection or best compromise are obtained then turn one quarter turn clockwise from this position. Retouch the drive trimmer C181B if necessary to obtain best linearity and maximum width. Check the horizontal linearity at various settings of the brightness control R218. There should be no compression of the right half and no appreciable change of linearity especially at the extreme left of the picture. If objectional change does occur, turn linearity coil L107 slightly clockwise and repeat the test. Adjust the width control L106 to fill the mask. If the line voltage is low and it becomes impossible to fill the mask, move the width plug P105 to the bottom position. The width coil L106 is inoperative in this position. HEIGHT AND VERTICAL LINEARITY ADJUSTMENTS.-Adjust the height control (R203 on chassis rear apron) until the picture fills the mask vertically. Adjust vertical linearity (R214 on rear apron), until the test pattern is symmetrical from top to bottom. Adjustment of either control will require a readjustment of the other. If the top few lines of the picture are stretched or squeezed, adjust the vertical peaking control R207 until this condition is corrected. FOCUS.-Adjust the focus magnet for maximum definition in the test pattern vertical "wedge" and best focus in the white areas of the pattern. Recheck the position of the ion trap magnet to make sure that maximum brightness is obtained. If necessary readjust centering to align the picture with the mask. CHECK OF R -F OSCILLATOR ADJUSTMENTS. - Tune in all available stations to see if the receiver r -f oscillator is adjusted to the proper frequency on all channels. If adjust- 4 INSTALLATION INSTRUCTIONS 2 1 3 21 -T-197DE ments are required, these should be made by the method outlined in the alignment procedure on page 9. The adjustments for channels 2 through 12 are available from the front of the cabinet by removing the station selector escutcheon as shown in Figure 4. Adjustment for channel 13 is on top of the chassis. STATION SELECTOR FINE TUNING TO REMOVE ESCUTCHEON, SLIDE SPRING CLIP TO LEFT -OSCILLATOR ADJUSTMENT -FOR CHANNEL NUMBER Figure 4-R -F Oscillator Adjustments AGC THRESHOLD CONTROL.-The AGC threshold control R175 is adjusted at the factory and normally should not require readjustment in the field. To check the adjustment of the AGC Threshold Control, tune in a strong signal and sync the picture. Momentarily remove the signal by switching off channel and then back. If the picture reappears immediately, the receiver is not overloading due to improper setting of R175. If the picture requires an appreciable portion of a second to reappear, or bends excessively, R175 should be readjusted. Turn R175 fully counter -clockwise. The raster may be bent slightly. This should be disregarded. Turn R175 clockwise until there is a very, very slight bend or change of bend in the picture. Then turn R175 counter -clockwise just sufficiently to remove this bend or change of bend. If the signal is weak, the above method may not work as it may be impossible to get the picture to bend. In this case, turn R175 clockwise until the snow in the picture becomes more pronounced, then counter -clockwise until the best signal to noise ratio is obtained. The AGC control adjustment should be made on a strong signal if possible. If the control is set too far clockwise on a weak signal then the receiver may overload when a strong signal is received. FM TRAP ADJUSTMENT.-In some instances interference may be encountered from a strong FM station signal. A trap is provided to eliminate this type of interference. To adjust the trap tune in the station on which the interference is observed and adjust the L58 core on top of the antenna matching transformer for minimum interference in the picture. CAUTION.-In some receivers, the FM trap L58 will tune down into channel 6 or even into channel 5. Needless to say such an adjustment will cause greatly reduced sensitivity on these channels. If channels 5 or 6 are to be received check L58 to make sure that it does not affect sensitivity on these two channels. Replace the cabinet back and connect the receiver antenna leads to the cabinet back. Make sure that the screws holding it are up tight otherwise it may rattle or buzz when the receiver is operated at high volume. CABINET ANTENNA.- A cabinet television antenna is provided in these receivers and the leads are brought out near the antenna terminal board. The cabinet antenna may be employed in place of the outdoor antenna in areas where signals are strong and no reflections are experienced. However, if reception is unsatisfactory, it Will be necessary to employ an outdoor antenna or an indoor antenna which can be oriented. RADIO OPERATION.-Turn the receiver function switch to the AM and FM positions and check the radio for proper operation. RECORD CHANGER OPERATION.-Turn the receiver function switch to the phcaio position and check the record player for proper operation,. KINESCOPE HANDLING PRECAUTION.-Do not install, remove, or handle the kinescope in any manner, unless shatter -proof goggles are worn. People not so equipped should be kept away while handling the kinescope. Keep the kinescope away from the body while handling. Handle this tube by the metal rim at the edge of the screen. Do not cover the glass bell of the tube with fingermarks as it will produce leakage paths which may interfere with reception. If this portion of the tube has inadvertently been handled, wipe it clean with a soft cloth moistened with "dry" carbon tetrachloride. To remove the kinescope from the cabinet, loosen the two nuts and disengage the rods alongside the kinescope. Remove the wing screw which holds the yoke frame to the cabinet. Remove the kinescope, the yoke frame with yoke and focus or centering magnet as an assembly. INSTALLATION OF KINESCOPE.-Handle this tube by the metal rim at the edge of the screen. Do not cover the glass bell of the tube with fingermarks as it will produce leak- age paths which may interfere with reception. If this portion of the tube- has inadvertently been handled wipe it clean with a soft cloth moistened with "dry" carbon tetrachloride. Wipe the kinescope screen surface and front panel safety glass clean of all dust and fingermarks with a soft cloth moistened with "Windex" or similar cleaning agent. Turn the tube so that the key on the base of the tube will be down and insert the neck of the kinescope through the deflection coil and focus magnet. If the tube sticks, or fails to slip into place smoothly investigate and remove the cause of the trouble. Do not force the tube. Replace the kinescope and yoke frame assembly in the cabinet. Insert the wing screw and tighten. Engage the two side rods into the yoke frame and tighten the two nuts. Slide the deflection yoke as far forward as possible. If this is not done, difficulty will be encountered in adjusting the ion trap and focus magnet because of shadows on the corner of the raster. Slide the chassis into the cabinet, then insert and tighten the four chassis bolts. Slip the ion trap magnet over the neck of the kinescope. Connect the kinescope socket to the tube base and connect the high voltage lead from the rim of the kinescope into the high voltage bushing on the high voltage compartment. Reconnect all other cables. Do not forget to replace the yoke frame grounding spring. Perform the entire set-up procedure beginning with the Ion Trap Magnet Adjustment. r law '1--s . ....k....---1.:52..imen,lat's TIE .g. orimm nv:. fc-1- it ."-- -- - 2-- 1 - Ele..,7 Figure 5-Instrument Cable Diagram 5 214 21-T-197DE CHASSIS TOP VIEW T2 ANTENNA MATCHING TRANSFORMER 66V027 R -F I Lt VI 6X8 OSC. MIXER /,."J T1 I .:, CONVERTER I TRANSFORMER! I I FINE TUNING CONTROL If CHANNEL SELECTOR SWITCH 5102 & R117A ON -OFF SWITCH & VOLUME CONTROL R203 4HEIGHT CONTROL T102 RATIO 0DET. TRANS. 1 IS VIII 6CB6 AAGMCP L107 -L- (."",./ LHINOR.IZ. 01...111(33T6H V112 65N7GT EE HOR.SYNC AMP. V116 6SN7GT HORIZ. SWEEP OSC CONTROL/ wile 6WV"49GT II 1ES/3tG0T1/ 6 ( III[VOHLIGTAHGE V120 6W4 GT I DAMPERI1 RECT liDAMPERII II I II II I II II I T105 5TH P IX 1-F O TRANS. 11 SND.0 OW ITRANS.J T I 08 4TH PIX I -F TRANS. V113 6SN7GT SYNC. EPARATOR R167 PICTURE CONTROL C197 T113 POWER TRANSFORMER T107 3RD PIX I -F TRANS. R243 BLEEDER -1-11-111-117-lilinr-liri fi7c76 2. o o O O 2ND IX C) I F TRANS. FIC7-1 1 ST C) 11F PL "IPANS. T104 1sT PORC) 11F Gd10 TRANS. R218 T112 VERTICAL SWEEP OUTPUT TRANSFORMER L108 FILTER CHOKE (cTr5 6405 VERT SWP. OUTPUT V114 6SN7GT VERT. SYNC yW P 6V Tin VERTICAL OSCILLATOR TRANSFORMER R1178 TONE CONTROL R218 BRIGHTNESS CONTROL R167 PICTURE CONTROL R201 A VERTICAL HOLD CONT ROL R2018 HORIZONTAL HOLD CONTROL Figure 6-Chassis Top View 6 CHASSIS BOTTOM VIEW 215 21-T-197DE FINE TUNING CONTROL CHANNEL SELECTOR SWITCH R -F UNIT O T2 ANTENNA MATCHING TRANSFORMER SIO2 $ R117A ON -OFF SWITCH &VOLUME CONTROL R1178 TONE CONTROL R218 BRIGHTNESS CONTROL R167 PICTURE CONTROL R201A VERTICAL HOLD CONTROL R201B HORIZONTAL HOLD CONTROL R243 BLEEDER L108 FILTER CHOKE TI11 VERTICAL OSCILLATOR TRANS. T107 3RD PIX I -F TRANS. CO T108 41N PIX I -F TRANS. 2m3IL7106 IS GRID TRANS. TIOS tsr /Ix® I -F PLATE TRANS. V104 6AV O IV AUDIO AMP T 104 IST PIXS I -F GdID TRANS. 6VA10i55 V ERT. SWEEP UTP V114 65N7GT VERT. SYNC. AMP &VERT OSCSWEEP V112 6SN7GT HORIZ. SYNC IFIEji R167 PICTURE CONT ROL V113 6SN7GT SYNC. SEPARATO r V116 6SN7GT HORIZ. SWEEP O SC. AND ONTRO V 118 1133G3,' 1 1 I V120 I I 6W4GT 801611 HIGH I! "1..9 VOLTAGEI; 6W`00 I 'DAMPER I RECT. 1 1 Figure 7-Chassis Bottom View 7 RADIO VOLTAGE CHART Voltages shown are as read with "VoltOhmyst" between indicated terminal and chassis, with receiver operating on 117 volts, and with no signal input. Voltages should hold within ±20% with 117 v. a -c supply. Tube VI 6CB6 R -F Amp V2 6J6 Oen & Mixer V3 6BA6 I -F Amp V4 6AU6 Driver Pin No. AM 5 215 6 74 2 0.4 1 -0.8 FM 180 62 0.4 0.4 --Phono. -- 2 55 58 5 -1.2 -1.3 1 43 46 6 -1.2 -1.2 ---- 5 210 210 6 126 115 7 0.9 0.7 1 -0.8 -0.2 ---- 5 216 216 6 150 150 7 1.5 1.5 1 0 0 ---- - - - - V5 6ALS Ratio Det. V6 6AV6 Audio Amp 7 88 88 104 1 -0.7 -0.7 -0.8 V102 6C4 Phase Invert. 5 88 88 120 7 -11 -11 -13 6 -16 -16 -19 V103 & V104 3 300 300 298 6V6GT 4 224 224 292 Audio Output 8 0 0 0 9 -17 -17 -21 V101 5Y3GT Rect. 8 305 305 307 EXT. AIN FM ANT ANT 11' ANT COIL 4 CI.F a.- 7-25 /P. 7'. _IP Li LOOP 496 Tr 51.13 r6CB6 R -F AMPL. CS 100 F -m RECOIL 124 (.1 15010C CI -C 1.* 7-28 14700 2-17 L2 L R it 120 K 994 R6 68C R5 8200 C9 14700 51-C FRONT V2 6 Lj 6 AMER G 05C COUPLED MIR IRIS A-14 OSC. COIL C C L5 68 7.161 6 FM Le CIA 0-115 17 CI -A 75-22.5 rot T1- 10.) MC rA cfl RI2 A -M RECOIL L7 C1-0 7 f 8.5-272 41.8 FRONT 12 1.31 T2- 455 KC 13 V 113 tt 13 2 cu3 c19 4700 .047 Si -0 REAR 1000 10 5 5 5 51-C REAR R7 M2 EG. .1c, 10 5 -/C41 TS 51-8 REAR 12 VYI T4700 7VG L SHIELD C20 4700 2'2gK 024 ISOK PG 2.2 MEG 11A. V3 6BA6 I -F AMPL. 021 r7A 18 023 1 R22 4700 22K 6AU6 DRIVER TS RATIO DEC TRANS. 10.7 MC. ri VS 6A L5 RAT R3 °ET. R36 1200 - - 3I3 7.37 61 330 T3 '57300{ P10M33 a 10_7 MC. '.P,___.-C1 1I :ft 33 Li 4700 }la 0 VI-. 22 K# Lei 7 A 1 _J 034 100 -.11t .C°30135= - R35 3300 - t R33 17.34 4700 608302 T4- 455 KC MF 3R93K7 44'03a no=f :II C24 _._ 4700 5I -A REAR 10 R25 680 250 125 026 56K WG - C35 14700 51A, w2 FRONT 2 5 W4( C30 0047 029 2 MEG. KETONE ONTR w5 7.31 .0c20533 a vv7 V6 6AV6 OET.-A vc A -F AMPL 3 RIO 1.5 MEG VOL CONTR C26 .022 5 0 K 250K 020 MEG RI7 18 IL - = 2R.IB, C21 C22 7 t .OTS I RIG 2 MEG. L.F TONE CONTROL C29 .01 T 0228 _L C 2 8 , 27001150 P102 .J2 AUDIO OUTPUT rg4E. w' CY. 1° WS FUNCTION SWITCH 51 VIEWED FROM FRONT AND SHOWN IN POSITION I. (MAX COUNTER. CLOCKWISE) P05. 1 - PH000. 33',45,78 R PM 2 - A -N1 RADIO. 43--FT-M RADIO POWER SWITCHES 53 AND 54 (MOUNTED ON FUNCTION SW.)5NOwN IN FUNCTION SWITCH POSITIONS 1.24003. RESISTANCES IN OHMS. 0- 1000 CAPACITANCES LESS THAN I IN MF. AND ABOVE 1 IN MMF UNLESS OTHERWISE NOTED 17-17T Sw. G AnToR 61,10 PICKUP C420 01 ,,, 3 3 -SPEED CHANGER Tv 52 ON -OFF Sw. (ON VOL. CONTR) JI-M PIN VIEW VG Va VS V2 vI V3 'IC "tQtr:*: ',C.14. 1.10 L9 C 10 1 C 27 LAMPSD V P0000 INPUT Iv,....L05 J45 0 fro. -.1,0. R10 " p,o, TV AUDIO FG Oco% OICI° PI -N P103 -F VEL P107 P104 M PIN 3 VIEW r T0-103 To JI0E-F TO TV CHASSIS C60 4700 v103 6V6 -6T OUTPUT 3 T101 V101 5Y3 -GT RECT R101 2200 02 ,,oz GC4 PHASE INV x x 3LJ4 0068 4701L 7 X R103 82K 2 R108 100 CIOM g 30 i-t C310018 1.5 C102 022 C 104 .001 TIO2 SPEAKER 1 mg 12105 < 8106 6811 1470K C103 .001 JEWEL LAMP C 101C 40 ME Rica 270 V106 6V6-GT OUTPUT 529 CRITICAL LEAD DRESS 1 The 1st FM i-f plate lead should be dressed away from the r -f amp plate. 2. Dress the lot AM i-f plate lead to the S2 wafer away from the AM r -f coil. 3. Dress the a -c power switch wires away from all audio components. 4. Dress C26 down toward the base between the terminal board and the side apron. 5. The C18 bypass ground should be as clawe to the r -f shelf ground strap as possible. 6. Dress C25 away from the arm contact of the volume control. 8. All leads from the r -f shelf leaving through the shields must be kept as short as possible. 9. All leads for FM should be kept short especially on the r -f shelf. 10. Dress the a -c leads in the RS141 chassis away from the audio input leads and components. 11. Dress all leads away from R101 in RS141. Figure 8 -Radio Schematic Diagram All resistance values in ohms. IC = 1000. All capacitance values less than 1 in MF and above 1 in MMF unless otherwise noted. Direction of arrows at controls indicates clockwise rotation. 217 RADIO ALIGNMENT PROCEDURE 21- T- 197DE Before aligning set, completely mesh the gang and set the dial pointer to the mechanical max. calibration point at extreme left end of dial. When mak_ng a complete alignment follow the table below in sequence. Connect the output meter across the speaker voice coil, and turn the receiver volume control to max. Turn tone controls for maximum highs and maximum lows. "AM" I -F ALIGNMENT Test-Oscillator.-Connect low side of the test-osc. to the chassis, and keep the output as low as possible to avoid a -v -c action. Steps 1 2 Connect the High Side of the Test Osc. to- Pin No. 1 of (43) in series with .01 mfd. Stator of C 1-D in series with .01 mfd. Tune Ttoe-st Osc. 455 kc. Modulated 455 kc. Modulated Function Switch AM AM Turn Radio Dial to- Low Freq. end of Dial Low Freq. end of Dial Adjust the following tTop and bot. cores of T4 For max. voltage across voice coil. ',Top and bot. cores of T2 For max. voltage across voice coil. tFor proper adjustment of the i-f cores start with the cores all the way out. The first peak obtained will be the correct one. "FM" ALIGNMENT PROCEDURE Connect probe of "VoltOhmyst" to negative side of C39 and low side to chassis. Top shield must be on and the bottom shield off Steps 3 Connect the High Side of the Test Osc. to- Pin No. 1 of V4 in series with .01 mid. Tune Test Osc. to- 103 mc. Function Switch FM Turn Radio Dial to- Adjust the following Top of Ratio d-ct Trans. T5 for maximum DC on "VoltOhmyst." 4 Pin No. 1 of V4 in series Modulated FM with .01 mfd. Bottom of Ratio d-ct Trans. T5 for minimum audio output on meter. S Repeat steps 3 and 4 as necessary making final adjustment with input set to give approx. -4.0 v. on "VoltOhmyst." 6 Pin No. 1 of V3 in series 10.7 mc. FM 88 mc. tTop and bottom cores of T3 for with .01 mfd. maximum d -c across C39. 7 Stator of Cl-C in series 10.7 mc. FM 88 mc. tTop and bottom cores of Ti for with .01 mfd. maximum d -c across C39. 8 90 mc. FM Connect sweep generator 22.5 kc. FM mod. 9 cable to antenna termi- 106 mc. FM nals through 120 ohms in 22.5 kc. FM mod. 90 mc. Tune to signal OSC, L8 for max. audio,output. ANT, Cl-FT and R -F Cl-CT for max. voltage across C39. 10 each side of line. 90 mc. FM 22.5 kc. FM mod. Tune to signal ANT, Ll and R -F L2 for max. voltage across C39. 11 Repeat steps 8, 9 and 10 as required. 12 Connect a scope to junct. R33 and C35. Check response and linearity. Peak separation should be at least 180 kc. tFor proper adjustment of the i-f cores start with the cores all the'way out. The first peak obtained will be the correct one. "AM" R -F ALIGNMENT Steps 13 14 15 Connect the High Side of the Test Osc. to- External radiating loop and couple loosely to receiver loop. Tune Test Osc. to- 1,620 kc. 1,400 kc. 600 kc. Function Switch AM AM AM Turn Radio Dial toMin. capacity Tune to signal Tune to signal Adjust the following *Osc. Cl-BT for maximum output. C1 -DT and Cl-ET for max. output. t Osc. LS for max. output while rocking gang. 16 600 kc. AM Tune to signal ***R -F L7 for max. output. 17 Repeat steps 13, 14, 15 and 16 until no additional gain in sensitivity is obtained. Clip a 10,000 ohm resistor across Cl-D when making this adjustment. ***Be sure the resistor employed in step 15 is removed for this adjustment. R -F shields must be in place. P0(000 CORO TO RADIO CHASSID F morm Naxos.* MOM* AM WAIT ) C )1c NOTE 12 - FAA OF COIL AND 10 F., OSC COIL ARE LocAT. UNDERSIDE OF CHASSIS. CIF-, 101. RC. Ak1121 C (TOP AAMMOU 500005) TA fiD/...c ASS MC (TOP 0 BOTTOM) Figure 10-Audio Chassis Top View F OM VOL Vida lb SS FT.( TONE 1,1141.10 Figure 9-Radio Top View Figure II- Dial Cord 9 218 21-T-197DE TELEVISION VOLTAGE CHART The following measurements represent two sets of conditions. In the first condition, a 5000 microvolt test pattern signal was fed into the receiver, the picture synchronized and the AGC control properly adjusted. The second condition was obtained by removing the antenna leads and short circuiting the receiver antenna terminals. Voltages shown are read with a type WV 97A senior "VoltOhmyst" between the indicated terminal and chassis ground and with the receiver operating on 117 volts, 60 cycles, a -c. Tube No. VI VI V2 V2 V101 V102 V103 V104 V106 V107 V108 V109 V110 Viii Tube Type Function Operating Condition E. Plate E. Screen E. Cathode E. Grid Pin Pin Pin Pin No. Volts No. Volts No. Volts No. Volts I I Plate Screen (ma.) (ma.) 5000 Mu. V. -2.4 to Signal 9 160 8 160 6 0 7 -3.0 - 6X8 Mixer No Signal -2.8 to 9 145 8 145 6 0 7 -3.5 - 5000 Mu. V. R -F Signal 3 95 6X8 Oscillator No Signal 3 90 -3.8 to 0 2 -5.5 - - -3.0 to 0 2 -5.1 - 6BQ7 R -F Amplifier - 5000 Mu. V. Signal 6 170 No Signal - 6 133 0.1 7 1.1 7 0 -- 6BQ7 R -F Amplifier - 5000 Mu. V. Signal 1 270 No Signal - 1 260 170 2 - - - - - 133 2 5000 Mu. V. 1st Sound Signal 5 127 6 124 7 0.7 1 -0.4 6.0 3.0 6AU6 I -F Amp. No Signal 5 126 6 123 7 0.5 1 -1.2 5.0 3.0 5000 Mu. V. 2d Sound Signal 5 132 6 60 7 0.14 1 -10 2.8 1.2 6AU6 I -F Amp. No Signal 5 131 6 65 7 0.14 1 -5 2.0 1.0 6AL5 Ratio Detector 5000 Mu. V. Signal 7 1.0 No Signal 70 9.2 - - 8.0 - - 6AV6 5000 Mu. V. 1st Audio Signal 7 90 Amplifier No Signal 7 86 - -0.7 0.45 - 0 1 -0.7 0.45 5000 Mu. V. 1st Pix. I -F Signal 5 180 6 230 7 0.15 1 -6.5 1.5 0.3 6AU6 Amplifier No Signal 5 97 6 129 7 LO 1 0 7.0 3.0 5000 Mu. V. 2nd Pix. I -F Signal 5 236 6 233 2 0.1 1 -6.5 1.5 0.14 6CB6 Amplifier No Signal 5 226 6 138 2 0.85 1 0 12.0 3.0 5000 Mu. V. 3d Pix. I -F Signal 5 149 6 144 2 0.9 1 0 11.0 3.0 6CB6 Amplifier No Signal 5 129 6 133 2 0.8 1 0 10.0 2.0 5000 Mu. V. 4th Pix. I -F Signal 5 178 6 163 2 2.2 1 0 6CB6 Amplifier No Signal 5 165 6 150 2 2.0 1 0 8.9 2.1 7.9 2. 1 Video 5000 Mu. V. Signal 8 130 6 172 5 1.2 4 *-5.0 22.5 5.5 6AG7 Amplifier No Signal 8 130 6 107 5 0.8 -2.0 15.0 4.0 AGC 5000 Mu. V. Signal 5 -27 6 238 2 152 1 155 6CB6 Amplifier No Signal 5 4.5 6 218 2 135 1 118 0.1 3.4 0 0 Notes on Measurements Depending on channel At min. volume *Depends on picture *Depends on picture AGC control set for normal operation 10 TELEVISION VOLTAGE CHART 219 21-T- 197DE Tube No. Tube Type Function Operating Condition E. Plate E. Screen E. Cathode E. Grid Pin Pin , Pin 1 Pin i No. Volts No. Volts No. j Volts No. Volts I Plate (ma.) 5000 Mu. V. Signal 2 152 I j 3 0.9 , 1 -44 1.1 I Hor. Sync No Signal - 2 135 3 *0.4 1 *-30 0.5 V112 6SN7GT Amplifier 5000 Mu. V. Signal 5 86 - I 6 0 4 -2.0 5.5 No Signal 5 50 - 4' 1 6 0 , -1.8 4.6 5000 Mu. V. Hor. Sync Signal 2 374 3 216 1 155 1.2 - No V113 6SN7GT Separator Signal - - 2 372 3 155 1 134 0.8 - 5000 Mu. V. Vert. Sync Signal 5 345 6 205 4 153 <0.1 V113 6SN7GT j Separator No - Signal - 5 340 160 4 130 <0.1 5000 Mu. V. Vert. Sync Signal 5 7.0 -0.2 0.6 V114A 6SN7GT Amplifier No Signal - - 5 *7.0 604 *0 0.5 V114B 5000 Mu. V. Vertical Signal 2 176 6SN7GT Oscillator No Signal - 2 176 -27 0.2 -27 0.2 5000 Mu. V. Vertical Signal 5 359 6 359 2 30 1 0 17.3 V115 6AQ5 Output No Signal 5 357 6 357 2 29 1 0 17.3 - 5000 Mu. V. Signal 2 145 V116 - Horizontal 5000 Mu. V. 6SN7GT Osc. Control Signal 2 230 No Signal - 2 188 -18 1 -42 0.4 -18 1 -42 0.4 -24 1 -42 0.37 5000 Mu. V. Horizontal Signal 258 V116 6SN7GT Oscillator No Signal - 5 256 *-91 2.0 -94 2.0 5000 Mu. V. Horizontal Signal Cap Vii? 6CD6G Output No Signal Cap 165 12.5 -30 110 8 165 3 12.5 5 -30 110 1B3GT V118 /8016 H. V. Rectifier 5000 Mu. V. Signal Cap No Signal Cap * - - - 2& 7 16,000 0.2 - - - 2&7 16,400 0.2 V119 - 5000 Mu. V. Signal 5 355 V120 6W4GT Dampers No Signal - 5 353 * 57 - 57 5000 Mu. V. Signal Cone16,000 10 555 11 140 2 82 0.2 V121 21AP4 Kinescope No Signal Cone16,400 10 550 11 132 2 76 0.2 V122 - - 5000 Mu. V. Signal 4&6 388 2&8 389 V123 5U4G Rectifiers No Signal 4 &6 386 - 2&8 387 - *139 - '145 1 11 I Screen (ma.) - - Notes on Measurements *Depends on noise *Depends on noise 1.2 1.2 Hor. hold counter clockwise - Hor. hold clockwise - - * Depends on - Oscillator Adjustment *High 15.0 Voltage Pulse 15.0 Present - *High Voltage - Pulse Present - *High Voltage - Pulse Present - At average Brightness - *Per - Tube 220 21-T- 197DE 151104 5A SIC- REAR R -F UNIT WIRING DIAGRAM 'eN SIC -FRONT SWITCH CONNECTIONS AS SHOWN ARE ViEwFD FROM DIRECTION OF ARROWS 518 -FRONT C,3 I - Sin - FRONT '6 111111111`. C 2 I D 48834-0 Figure 12-KRKI1A R -F Unit Wiring Diagram CRITICAL LEAD DRESS : 1. Keep all wiring in the pix i-f, sound i-f and video circuits as short as possible. 2. Keep the leads on C110, C111, C112, C200, R109, R110, R111, R112, R114, R115 and R233 as short and direct as possible. 3. Do not change the bus wire connections to pin 2 of V101 and V102. Sleeving is used on these wires to insure length and to prevent shorting. 4. Dress C114 down between R117 (volume control) and wafer S101-2. 5. Ground R130 to pin 3 of V106 and R138 to pin 7 of V107. 6. Do not change the grounding of R141, 8146 and R149. 7. Keep the bus wire from T109 -A to C146 (plug in capacitor) short and direct. 8. Ground the filaments of sockets of V107, V108 and V109 independently of the socket center pin. Use ground lances provided near each socket. 9. Dress C198 straight up to act as a shield between T101 -A and V110-4. 10. Dress C153 and R170 (kine cathode) up in the air above the terminal board. 11. Keep the leads connected to T114 -C and T114 -D (synchro- guide) down so that they will not short out when the chassis is placed in the cabinet. 12. Do not reroute any wires between T104 and the terminal board alongside it. Keep all leads on the foot side of the terminal board. 13. Dress all wires routed past T104, shielded wires W102 and W103 under the big lances near T104. 14. Dress all a -c leads to S102 under the large lances on the front apron and away from R243. 15. Dress R116 close to the chassis with leads as short as possible. 16. Dress C206, C221 and C212 up in the air and away from all other leads and components. 17. Dress all leads away from bleeder resistor R243. 18. The blue lead from pin 5 of V111 to the terminal board under the high voltage cage should be routed between V117 socket and the rear apron. 19. Keep leads on C214 as short and direct as possible. 20. Dress R206 away from all other wires and components to prevent excessive heating. 21. Keep the wire from the vertical output transformer T114 away from the 5U4G rectifier tubes. 22. Dress all 2 watt resistors away from each other and all other wires and components. 23. Dress all wires away from damper tubes V119 and V120. 24. Blue wire from pin 5 V116 to T114 -A should not be more than 5 inches long. 25. Dress all peaking coils up and away from the base. 12 CHASSIS WIRING DIAGRAM KCS88H 221 222 21-T-197DE UNIT KR1411A .n ANT ATCH,. UNIT ".* ae = TELEVISION SCHEMATIC DIAGRAM KCS98H tat 6ALS sttlerou L.2 Yoamo 223 - 221 21-T-197DE 13 Figare 13-Cbatsu Wiring Diagram KCS6811 14 1.71,140 01 ?...aritziF,42zfzzi to lc' PRODUCTION CHANGE IN KCS88H The schematic is shown in the latest condition. The note below 011s how early receivers differed from the schematic shown above. In some receivers, 0215, at pin 2 of VI15, was 1000 ohms. ao T.1,10 65N7 -6T ';" GAO5 000 Ingl."`" .550V PAO REFER TO PAGES 180 TO 193 FOR TELEVISION ALIGNMENT PROCEDURE AND WAVE FORM PHOTOGRAPHS All resistance values in ohms. K-1000. All capacitance values less than I in MI and above in I MMF uolese ogre, wise noted. 15 6W4-GT Direction of arrows at controls indicates clockwise rotation. All voltages measured with "VoltOh. royst and with no signal input. Voltages should hold within ±20% with 117 v. see supply. 16 10104 IMP. Figure 14-Tairrition Schematic Diagram 225 21-T-197DE REPLACEMENT PARTS 30701 :1 STafiK DESCRIPTION DESCRIPTION KRKIIATilt 17-F UNIT ASSEMBLIES 7"" "11-An1r.''"'1''1r85'sati1.1rinf1;1;firtilrr59 76535 Board -Antenna matching transformer teremminal board 77353 Stator -Cony ..... Tamp& eltharyi, ths. ca4, card err, ficrtIg7 L'11711717.1t. ISO; L21,147. La. lith R. RS/ 76845 Bracket -Vertical bracket for holding VI tube shield 76633 Cog:ilm.Carramic, variable for fine tuning-p1onger 53056 Capacitor -Ceramic 5 mraf. (C28. C32) 70.7 Capacitor -Ceramic. 5 rnmf. (8.3) 5328 Capacitor-Ceromic. 10 mint. (CH 54207 Capacitor -Ceramic. 18 en,. (CM 772" '11'''"-°.°1118trrjn; TrtIrt,ItrallLe, 76.3 7'36 " stiortt1oOr-7-UF1pil.oLt9s6/stator complete with coils, arfreg112111710. itl. Eg..,1'72,2. '3. 129. L33. 41ticl'1-res'r ols°764'1'61;11:32'11133't39 tk5 fArt37 L38. 1.39.40, LH% L33, RILR12i 76358 copacitor-Ceramic. 22 malt. (CS) 701335 Capacitor -Ceramic. 27 mmf. (cm 76526 Strip -Coil moment mounting strip-LH lower 76544 Strip -Coil segment mounting strip-LH upper -less 77460 Capacitor -Ceramic 220 mmt. (C10) MIN Capacitor-Ceromic. 270 :mt. 0612, C14) 75446 Stud-Cazacitor stud for trimmer coil.. CIS (uncodad (C6)]8740 "'" cseir,1127Ctra., '5°0 --'. '-'-") '`'' C17. 'solo Capacitor -Ceramic, 1.30) al. 73743 Capacitor -Ceramic. 1500 mini. (C16. C20. 623) ""7 'nUrnarti/Tin.1litli2ii--- "" '"' cls (""`' aria. Ceao4ner-Cro66ic. O. 6666(. 1611 n"' 'Iter."--.'""""' .." . i ''' "'"'"''' °' -3.° "" f 75189 Capplaatceiwtoi-thCaedrajumncin,gadMjuidsa(Cbl)e. 0.80-3.8 mmt. corn-' 79632 CW.t.ti-Atittitt.M. ttiintm... .1.°1114. 1. -ii. tttnt'. '`FUcrattirlrfrtrririll 7"33 7:61°1713 .r-. ,,,,, ,,, ,u..., v., .... jj, 77148 Tr aa;f orrar-donveVter tr1ansfermee (ThR3) 53. co ,.,.,,..,.. rap -I -F trap (L65) 76542 Trap -4-6 tr,,141.2.5 me) complete with core (L.) .26987 mf. (6111 78991 Trap -17F trop (45.75) complete with core (7.99) 7.91 73477 76783 789. 77153 7.37 Coll -Antenna matching coil (2rag,' Coil -Choke coil (L57) Coil -Filament choke coil (L63, L64) Cart choke coil IL.) -6.6 amplifier coupling roil (L51) Coil -Rh. choke coil (L66) Coil -Shunt coil complete with adjustable core (L6)) Leal TELEVISION CHASSIS ASSEMBLIES KCS:38H picture control motion 61.09. CIS) .853 Connector -4 contact female connector -part of match - 76800 Capacitor -Adjustable trimmer...vane.. malf. (6226) 7.96 Capacitor -Adjustable trimmer. 670 ram!. (C2201 73453 '" 303047 503082 .113 504210 .3233 503247 504410 504447 m1 Coil form for coils L48. L50, L53 aft "°±^:37:,g,Iztu'"`"' tr'""n- "'" 47 ohms. _10%. Vs watt (R5) 82 ohms. ± 10%. 1/2 watt (RIO) 180 ohms. 7 20%. 1/2 watt (R13) 1030 ohms. -20%. th watt (67, R.) 3.0 ohms. 710%, is wan (64. RBI,),RIM 4700 ohms. ±-)0%, t6 watt f62) 100030 ohms. .7 20% 1/2 watt (RI. RS, (6) 470.000 ohms. 2 20%. Vs watt (R8) 75164 7.97 Rod-ctuatng Plunger rod (libro) Ht. (tn. titntn5 Itnit L5. 1.10, LII 76595 76.8 Screw -v4-40 2 AV adjusting s.a..7,11: x ,,, adjusting screwc. coirloll foe rolls 11, L2, 76139 Shaft-lne tuning shaft and corn yyjsy shish complete with shaft bushing and M334 Shield -Tub shield 78377 76574 39042 76479 .93. 76.6 44202 ml. 161311 Capacitor-Caramic, 33 ntinh. 1:13. volts -M.0 Capacitor -Ceramic 39 nun!. (0I77) Cm:metier-Ceramic. 47 meta. (C153) Cav4ator-G1,66:4,. ,0F. 061.1 Capacitor -Mica 82 mmf. (C157, C182) apoottor-Ceramic, 100 mmf. (C156. CI66) CCatptiatcstti.oirt-°Cr-atr.atm...ici.i.150 f. (Coe) rnmf. (0168, 0215) 76579 Capacitor -Mica, 270mafi. (MIR) 54003 Capacitor -Mica, 370 mrtif. (CM. 04)2) 73473 7"" 73911 73960 76742 7021 .2jv 77474 CI25 CI27 CI28 CT3V,%6Z.6176.V.10"6171101PC122. 'FI'3Vr.'16fit., tillA, cl2us. CI.A. c142B. C224A, Carotr,Fmmic. dual 10,000 minf. (C1046. 010421. Comited.,Fierarnic. 10,000 mmf. (C126. 6139, 0143, Caacitor-Electrolytic, 1 mid.. 10 vol. (C124, C138) Canoe:Mr-Electrolytic, 5 rritch. 50 volts (C2013) camtor-Elrotrolytic, s rad.. 03 volt. (020.0 -Electrolytic cmptising Bation o ltrt' 3 .. 5" m'1"nVlne2OTrC201B7VIOWf 76336 Sockal -Tube rocket. a 7).. miniature. bakalite, saddle- 11'11"" ":1 " (1*7 ") 11. `":""'" 4 "- 75068 Spring - Retaining spring for tube shield 77.4 6M MY Return ...Mg foe fine Vi vi, control 75610 C itt`hhtt7". 92866t76 .C2020, C2.02C, clOg. cirri.. , D) 00." 01t,VZ:Tes'eCiATT6f,U;T""'"' ''') '110- 7"" cTIV40-72.18;borula". ''" 1m'''''''''' 6613 17 226 21-T-197DE REPLACEMENT PARTS (Continued) STaCK DESCRIPTION 'TkP7 DESCRIPTION T/468 Coomils:.-Zrlzlar, pops, oil impregnated..0018 mid.. 735" CT,'-leiar-r.."'-06,84.". -0°' 6610, 73803 Clyztsr.-Zitilor. P.P., .a ,rnO2,11(....002.2 mfd.. 7" C*57t11g9-(Zrt611.i441.71.101411r.11"1". '117 m". 73"1 e"atTr.-jrrXireai. `811i0"."""a' ' "'" 73.4 Clattg.-,Zinntii43.012M, 571 MI...mote, .01 mill.. 73797 Coatif.-Zr?s7lar, paper. oil impregnated. .019 rilfeh. 7/632 en-tor:W. wound 200 ohms. 9 wet. (MCC Z.uo.z.zrol 970217n:LbiTs:LeTer1"3110 .11vAln Ur ohms, 3 watts (R243A13.243B, R243C, T.24ss"R°,==',17.i..'oco=.°17.7.212'243) 503047 502056 63.47.63a 4.71'orit7171 TA"1, (h7orl17708.171.. R233) se ca...n.. ssx. % watt (6137) Iti,:::: !.... 88,1: :',1::11n ():)::11 733" -1nraii478r4'i.V,T.087,71.0. .022 m"" "7" eur0Vge-IIVIer 76061. " 1"11r""1" 033 "1" 733" C.0)-11A141till.'6763)" ''''1""'.' "7 m'. 7'71 CM;1917'Chflgr"'"'"'" "7 '""- "3 y*. "3132 ';as3117T. (Zrtthr- ' -°`"'"°'-' .**7 "11' "°1' clstztl:TA,V°641- °' '"-°"'"' 'ea r"" 400 volts (C172. CI78) pe 600 volts (01731 '3"4 Nntv-.-,11'1°' -- " irn'r.'"'". '' rny, .. 74857 Cazgo=.-Zpre. pope r. MI impregnated. 0.22 mfd.. 5:311'0 3.3011LS 6tiai. "50311r2 ..."303.23"11 1100 ?h11. *i 011A17.11018(121'1216. 6133) 2g :h"::: =::',:::::;:',:11, 476 htm9. h in. 1/2 watt tR3tet 32.3°.s: VI°Itit. ::11:11(IT1:)) .* 111.1: 1 A,111n7a1101(RR111013,108, 6I25. RI35. R137, 12.:0"'';4,.'L'A 2,2,,, 021166 8032. 3307 ohms, .10%. Vs won (R.81. 3000.h.,.. ,.%. % W... (..) 9.0339 3900 :.ha..: ;.107.,1/2,.=4R2/3211 73727 CY0=1;1.Zrittlrgel'" 1m".9221.0. 047 rn"" 76405 Cholm-Filter cholla (L108) 7524j Hoti_6ntanna ahunj coo H.202)rte 76672 Co41..-2;,!ligr:1 winding only tor hi -voltage transformer 73477 Coil -Choke coil (11011 76983 Co1,1,1zraoral linearity coil complete wtih adjustable 63.69 14659 513268 503282 523282 503310 513310 76848 Coil -Peaking coil (72 muh)1.1.103. RI61) 76847 Coil -Peaking coil 080 mull) (IA.. 13188) 75252 Coil-eaking coil (500 muh) (LI05, LI13) .) 76640 Coil -R-7. choke coil .5 LI18/ 76510 Coil -R, choke coil 0.7 mesh' (1.113) cor. 513312 503315 503318 503322 503327 74594 Connector -2 contact. male connector for power coin 7747"'1:1: tiger m° """t" 7,6 6"" 76"" .38 CW:rt.-6 mhtlt. 'Amt. mtm.°H.t. 2°7 imifit 1°mi. 503333 50'33334327 513347 yak. (002) 502356 913358 76863 Connector -Anode connector complete with terminal and 512368 813368 76457 - (3)04)503410 tgeri-voltage capacitor 'ter Id)031 ,d coono'er-,0avnaa on ror 813382 .3410 603412 7718.1179 .'ern1121:111316Ch't=o1117711R218) 503415 78448 Control -Height control (8203) 77201 77473 -503435 CoagtHorixontal ..a ....two hold control fR201A, Coektrg ,,,,nto, val.) v....... c...-, 22a 2.....2- 2w2.1 S.161421 503927 S03933 70487 903447 74639 73603 Fuse -0.25 invy 250 551, (F101) 761138 Magnet-Focu magnet ,......-e,s 803482 503510 503515 512533 503539 503582 503610 '66860609ohhtmh.s., .11.09%%., Vt ws wttatttt1(46)161.41. RNs) .00 ohrns. ±1055. 1 wan (1114.1 8200 ohms. 2 10%. .4 ay. (R)M, 6190) 8200 ohm., ±10%. 2 watts (11233. 8253) 10,RIAnhoo), 10%. 1/2 watt (R128. 6)43. 8147, 8209, 10.000 ohm, 7 10%. I woti (R1681 12.003. ohms. 710%. I watt (61811 16000 ohms. ±-10%. 1/2 a.1'(2]19) lemo otm,.. z los. 1/2 watt (R165, R.) 22.000 ohms, ± 109, 1/2 watt 02I94. RI93. RIM 27000 ohms. 110%. 1/2 watt 02119. RIM) 33,000 ohms. ± 10%. Vs 666'1 (2102. 11132, 2139 R2581 3474"0000 fci7ns16. ;11131. Y61 ::11111 1661042. 68193311) 47,000 ohms. ± 10%. I watt (6227) 56.000 ohm, 2- 5%. th watt (71)49, RI.) N.. ohms. 1.10%. 1 watt (RIK 6226. 823I) 68.000 ohm.. ±s%. I watt (8230) 68.030 ohms, 2 10%. I won 06210. 17225) 82,000 0.11, L. 10%., I watt (R257) ... ohms, 7 596. % watt (6I73) Iwo«, ohm, 7 05%. th watt (7215) 120.0 ohrns. .7 10%.1/2 watt 03.108) 15M, stzs,R416. tit watt 07145, R170, 0172, 6187, 1,:it,.....0..hh..79: .S%. 1, 'eft (123a 2193. R23]I 270.000 ohms 710%%.. 1/2 watt 031841 230.000 ohms, ± 10%. th mat (6222, 132.36) 396000 ohms. b 10%. Vs watt (8255) 470600,1ms, 66.1) (17180. 1111. R188. 21901 710%.S4 820.000 ohms:, 7 10%.'2 w.11 12201,, 6323) 1 metiohrn, : 10, 1/2 want 17182. R202. R204, 1232) 1.5 megohro, . 10%. 1/2 watt MIN) 3.3 megohm, '3%, I wattan03127) 3.9 enepohrn, v10%. 02 svalt (R)M) 8.2 mpohen, 210%, tn watt (RI77. 6186) 10 3nm/oho, ± 10%. 1/2 watt (71)6) 76g 11:11=11:11i=e1riret7c;at1:1cMar1(ZR101) 76468 R sistor-w...2.a. 1s ohms, 1(3 watt (R242) 74019 76487 Sh4L-Coticzting Matt (ylon) for picture and brght- 73584 Shield -Tube shield for VI01. V102. VI03. VI08. VI07. VIII 76741 Shield -Tube shield for VI. 18 227 21-T-197DE REPLACEMENT PARTS (Continued) SW K DESCRIPTION ST.0CK DESCRIPTION 7'33 ScIt.n-tItitr f/111r '''.1. m*urn.d ""1. '1'1. 732" es:VIT8'" ''''.1 ''''' '.rc.'n' ''1. rn°"1" I. VH7, VI22. e4"L 66ater fee V111. V)13. VI14. 77314 Coil -R -F coil -FM (16) 33914 Connector -Dnol 01, nontact female connector for .1"1. "*"" ** " * 33787 Corn**11.111'S 711111 1'11. "I 1 7131:TS2 1.'''. '1*111"1 to f di 74879 Ci7nnector-2 contact tamale connector for antenna lead. 7906E (J)) r-9 sonar' mat eonn«ror for power p t .361 5°itTItti,n2srit4t. 6 Mn. mtutdsd. 97tddi m..2'. 71994 Socket -Tuba rocket. 7 pin, moulded...a.. mounted, co -L.F. (R)6) 75537 Contre1Iftlii.me control and power switch 0716 SM 7.63 79564 CCa.rZdg-itgit-rStp..r.i.nrgd c(oMupMlin..g...fo(ri''fu..n..c.t.i.o.initewitch extension 73117 76651 nos 764. 76501 76400 76495 8439 7348 "437 74.4 774" 771" 7"3' 7134336 76482 79.3 Sc7firr0137;l1)111116PfrkPrOlarVIOVnr 111". 74339 Spring -Coil spring e... ...., VII7 ..... (3 rev,) 73640 mr4;!!,22,.,2 2,.. 21,2.0.. w. ,2u.rd ic2. 2,2.2 180.48 6.PPort-BahAM.MPon °nit' -h.tt t.i hi...tn....M.' 717711 to( T114 r Al it r-01,66.1 1." 1'1' "341 (01131166 1'1::1711:TaTi7:761:?(T0r,017a5Tn."'""71.1, .."1 57'3,10 T RrnliicZtt.t °gm` °°mPt.t. with so2,12 .. ,... 303139 '1'. er;t1/11)E.kza,trc.'"41rn..(r0c1'''1'''2' 1nh90225s0m13126.8 Td to '-1:S f17'1041, Vigl'..R1111751 1',temple'1'1111 t abl':-c.f.1:s WIcg!811re,tro.,--01," 70, '.1.t:(4,1.78317-'--- "-°''' TTroneformar-501. pia hf transformer (5109, 0.48. 0147, LI02, P159, CR01) Trop -4.5 MC trap (1.118. 0213) Voke-DeDectir. trococolott,vjtl,6__contoct ;Iola ". P.126160121 1 11'. 1-'1", 1'1'1' 2", RADIO CHASSIS ASSEMBLIES 601111A 35003323.32 5s.,11: .3.5 503358 503412 503415 =37 503497 503510 503515 503522 Eli...or-Push tostener to lane. RF .1.11 (9 re7,1) 0, ,..,.,) LL:1:11.17;e1t1r1e;r1:1:c111: ' 7=°.i7erctfri"6122;1Y41"' 16, r07..t::..0,10,,,i,V:.01:7,)11, 8341 122 0,..,... , los.% w., (222) 390 ohms. 1/2 watt ()IM 680 ohms. ± 10%. 'h vookt (RO. MS. R32) 1003 ohm.. 7 10%. Vs watt (62) 1200 ohms. 75%. Vs watt 16.) 3332".:1,1 51C1r.i,1141111n16(63351 )1::rog :".:::: )00Z: :2 ,w.:014 1#63133.)R17) * 6%. Vt vit. 029.,131) ......th°. 4)0%. ifi wMt (..) 58600 ohms, th watt (R26) 126000 ohms, ± 10%. 1/2 watt (RN, R15) 150,0(10 ohms. 0 10%. 44 watt (124. 824) r7110:TO *o1.17s: :11g., 12 1;t1: (13'283) 470.000 ohms. _10%. Vs Vi011 MU) 1 rnegolvv. 2 10. th watt (R39) 1.5 megohm. ± 10%. th watt 0710) 2.2 magohm. ± watt (61. 137. R8) 77303 77332 9099 CoS1*!'FI18I7.5)1'16 11m1r18 .""11" 101' 0113 010, Capacitor --Ceramic, s.s mf. ICI'. Con74813 ml (C13/ 6141 5"034362"2 75540 73584 79192 2210 7rt1:ro'h:::: 2 273:: ://s1 16.:11111 16174270) Shaft -Tuning knob shaft Shield -Tube ehield for VI V6 Shield -Tube shield for V2 m (2 ntr5 39640 Capacitor - no am, (036, C37) 2.2s. Capacitor -Moo. 470 moil. (C.) 73973 CTIr.%737a1178: arge.a0110Ce C". 73707 Capacitor-Electrolytc, 2 mt., 90 volts (638) 77468 Capactiov-Tubular. paper, %ma mid.. eoo vol. (C3) 737. Capacitor -Tubular, paper. .0033 read., eao 4.04 (029) y3yyjj oaoacitor_Tabahti. ppe, .0347 mid., 600 vol. (C.) 73561 Capacitor -Tubular, paper. .01 mid.. 400 vol. (C25) *474:57 CCZ:=11r7T=1:111. 111r. .1011: :Ill.: r10 *et 1CCM 73358 Capacitor -Tubular, paper, .047 mid., 200 vo tIe(CM) 733" 77315 Coil -Oscillator coil -FM (18) (1.2. L7) - V4. VS 73117 Socket -Tube socket, 7 contact, miniature water for Ve 76332 SprMg-Drive con, amino shaft 76422 Spring -Retaining ...MP He Mae meohanie. stOP Pin 77304 SuPPort-PonwHeene ...PP.,. tor FM ...Motor mi1amtv 77476 Switch -Function switch (5.1. 33. 94) 737" .r"1 .r ttT51.''''' t''''''''''... c'''''''. with ' bl . rrai all «6601.'..1,111 T1 transformer-F32-complate with ..tid P.'. 228 21-T-197DE REPLACEMENT PARTS (Continued) wren DESCRIPTION ROLL.OUT MECHANISM ASSEMBLY' FOR RADIO CHA.IS RC -BABA 332 77318 Bracket -Dial lomp socket brocket-R.H. 722" 01TrIVTOTenn7et ''''''''''' '''''. '*rin.'''' 2.'"' 77477 Diol-Polystymne dial scale T/3.21 .cunheon-Diol scale amunlmon less dial 77"3 '17trincl.-'12to,;;Irt'-' -*---^-f*r '"'"1. STOCK No. DESCRIPTION 71955 78955 76689 .00401-P11ot lamp bracket Bracket -7U" shape bracket for daffactIon yoke. hood ..fiPtt(ht.°7i Bumppaer -Rubber bumper for kinmcope Ms mg,/ 13103 71.2 X3130 3'7°4752 Cape Pfiot tinny can Catch -Bullet catch and strike CHM-Orille cloth =ro:::::=11:11:11==.11***to:1;;;;1*c*al:1:11* AUDIO AMPLIFIER ASSEMBLIES R6141A 742" eltt-oTtfelre'inee11?nrcttle'*m1.1. "'"1' P' t''''- 73947 CaMe-Shiefiled oodio cable complete 400. twa (4) ain "'" rt,T^,t/r7gd, 77.7r,7V P.z!!;: of M mid.. 23 .81210101A. ciai B. cnac, 749" CroW=Teot'6187°'.." '''''''''''..°?' m'.' 73789 Capacilor -Tubular. paper. .00. mfil.. 400 volts (C105) (6]1011 "6" 't.i1=4MV:21:1:qgz'°-"°r"' '*".L. n ." csi2,71Z7,:t =. (Worn' "". , 1457 CO71111.1.1tireader and plug 70262 ...mon-Rubber ...Mon for ntoeking panel aupport bracket 7727'3473 nee4 n°, 74273 .:22 75456 18822 113" 73420 74300 CO:a11'11;It11611.1:117.1:11.1.7 7,17:'''' peel --RCA Victor. a...1 Decal- Victrol, decal E.1.2. -..m. vkt.2......... .cutohron-Channal marker escutcheon a-86leb glad C13117::?(IT1' 11111,'11 m.,-Flult tan.. for L.H. upp1er 1d1o*o"rP.1131181..7' 6)m*1111111' Hinge -Door hinge H set) 503110 522127 502233 503363 503342 503447 31364 15589 Res.toe-Fned, composition:- vision volume control and power switch knob -maroon Onnee) 100 ohms, n10%, 1/2 watt (13108) no ohms, ti3%, 2 watts (8107) 3300 ohm.. 53%. 'A wan 011021 ec000 06,04.,0%. ,6 4,a0 (RIOS/ 61,000 ohms, v10%. 1/2 watt (2103) 76563 Knob-Televistonchannelmlector knob-mare...Anse) NMI Knob -Television fine tuMng control knob -maroon connemorMazda: 470.000 ohms, x10%,'' watt (6104. 6)06) )e 11765 Larop-Pilot or channel marker moutcheon lamp - SI Socket-Pik...lamp 0a40 aaaa4 - firti, f o1fTtOn nate 18107 76854 Medallion-k10'32 mid dog modoltion eka had .up - Nut -Spring nut for changer mountlng screws SPEAICER ASSEMBLY 52.569-12W RL.111A1 RMA.274 73"3 e1o111136'11...j.j. ''..'s.'ccimi''. 't ''''..'fla v'''. :Vt. i:4 44e.'44,a3 s, pen ea , dwc ni 77450 Boo.- MISCELLANEOUS nit ...Mort...mit book cover covon1ne 'nth 76601 77348 7.. 311" 283r5 7.37 74734 75902 72536 76663 76853 MOM 77244 and emblem 7033 398, emb Pad -Kinescope edge suppon pad (4 ritird) Pull -Door pull-uppee eepd) Boded19810 hood assembly Screw -68,n. meow- tor door pull n348 ,) 16..2. 17.1"nry=121Z71P1:1.1.11711g17.=c76717=cig1tanal 4e Feed evp- 2 jelne.:::::=: :;*:1.3" Sna-Ratatning spring :1:; for k1n:1o:11b1.: *26;71361 353 and 7.95 Spring -Spring clip for radio knobs 277328 and 77353 ka) Iwd Spring-Suepanslon eating He amplifier cable Stop -Door stop 80.0-o44665156. 4544a 1.0095 35. 4 055 500 .0544) staa-10-32, 1.6.5402 for mounting 44444,1 anima... Wkansohbesr -Cellulooe wosker-gold-for tele...Ion control assembly 78657 Bracket -Masking panel support bracket (antra) te 75500 Wahar -Felt washer for kinescope mask or back cover mounting warm, APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES or REPLACEMENT PARTS. 20 Models 21T207, 21T207G "Crandall" Mahogany - Model 21T208 "Lambert" Walnut, Mahogany Model 21T217 "Brookfield" Walnut, Mahogany 229 RCA VICTOR TELEVISION RECEIVERS MODELS 21T207, 2112076 211208, 2112171 211218, 211227, 211228, 211229 Chassis No. KCS72A -Mfr. No. 274- SERVICE DATA -1952 No. T4- PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. Model 21T218 "Lansford" Walnut, Mahogany, Blonde Model 21T227 "Lindale" Walnut, Mahogany, Blonde U ivlodel 21T228 "Brandon" Model 21T229 "Be!grove" Walnut, Mahogany, Maple Walnut, Mahogany, Limed Oak ELECTRICAL AND MECHANICAL SPECIFICATIONS PICTURE SIZE.. 227 square inches on a 21AP4 Kinescope TELEVISION R -F FREQUENCY RANGE All 12 television channels, 54 mc. to 88 mc., 174 mc. to 216 mc. Picture I -F Carrier Frequency... 25.50 mc. Sound I -F Carrier Frequency .21.00 mc. and 4.5 mc. POWER SUPPLY RATING 115 volts, 60 cycles, 190 watts AUDIO POWER OUTPUT RATING 4 0 watts max. VIDEO RESPONSE To 3.2 mc. SWEEP DEFLECTION FOCUS. Magnetic Magnetic LOUDSPEAKERS Models 21T207, 207G. (971636-1) 5" PM Dynamic, 3.2 ohms Models 21T208, 217, 229. (971490-3) 8" PM Dynamic, 3.2 ohms Models 21T218, 227, 228. (92569-12) 12" PM Dynamic, 3.2 ohms WEIGHT AND DIMENSIONS (inches) Model 21T207. Net Shipping Weight Weight Width 94 115 281/2 Height 2914 21T207G . .105 126 28% 281/4 .. . 21T208 94 115 251A3 243/4 21T217 104 132 26 39% 21T218 112 144 27% 391/4 21T227. 130 162 271/2 401/8 21T228.. . .132 164 27% 39% 21T229 139 173 271/8 40 Depth 271/2 28% 251/2 251/8 24 271/8 265/8 26% RECEIVER ANTENNA INPUT IMPEDANCE Choice: 300 ohms balanced or 72 ohms unbalanced. RCA TUBE COMPLEMENT Tube Used Function ( 1) RCA 6CB6 R -F Amplifier ( 2) RCA 6)6..R -F Oscillator and Mixer ( 3) RCA 6CB6 1st Picture I -F Amplifier ( 4) RCA 6CB6 2nd Picture I -F Amplifier ( 5) RCA 6CB6 3rd Picture I -F Amplifier ( 6) RCA 12AU7 ..Picture 2nd Detector and Vert. Sync. Sep. ( 7) RCA 6AG7 (6AC7, 6CL6) Video Amplifier ( 8) RCA 6AU6 1st Sound I -F Amplifier ( 9) RCA 6AU6 2nd Sound I -F Amplifier (10) RCA 6AL5 Ratio Detector (11) RCA 6AV6 1st Audio Amplifier (12) RCA 6K6GT Audio Output (13) RCA 6AU6 AGC Amplifier (14) RCA 6SN7GT Horizontal Sync. Sep. and Sync. Output (15) RCA 6J5 Vertical Sweep Oscillator (16) RCA 6K6GT Vertical Sweep Output (17) RCA 6SN7GT . Horizontal Sweep Oscillator and Control (18) RCA 6BQ6GT Horizontal Sweep Output (19) RCA 6W4GT Damper (20) RCA 1B3-GT/8016 High Voltage Rectifier (21) RCA 21AP4 (21EP4) Kinescope (22) RCA 5U4G Rectifier (23) RCA 5Y3GT Rectifier 230 21T207, 21T207G, 21T208, 21T217 21T218, 21T227, 21T228, 21T229 ELECTRICAL AND MECHANICAL SPECIFICATIONS (Continued) PICTURE INTERMEDIATE FREQUENCIES Picture Carrier Frequency 25.50 mc. Adjacent Channel Sound Trap 27.00 mc. SOUND INTERMEDIATE FREQUENCIES Sound Carrier Frequency Sound I.F. Frequency 21.00 mc. 4 5 mc. VIDEO RESPONSE To 3.2 mc. FOCUS Magnetic SWEEP DEFLECTION Magnetic SCANNING Interlaced, 525 line HORIZONTAL SWEEP FREQUENCY 15,750 cps VERTICAL SWEEP FREQUENCY 60 cps FRAME FREQUENCY (Picture Repetition Rate) 30 cps OPERATING CONTROLS (Front Panel) Channel Selector Fine Tuning Picture Brightness c Picture Horizontal Hold t Picture Vertical Hold S Sound Volume and On -Off Switch TV Tone & Phono Switch c Dual Control Knobs Dual Control Knobs Dual Control Knobs Dual Control Knobs NON -OPERATING CONTROLS (not including r -f and i-f adjustments) Picture Centering top chassis adjustment Width rear chassis adjustment Height rear chassis adjustment Horizontal Linearity.. rear chassis screwdriver adjustment Vertical Linearity rear chassis adjustment Horizontal Drive rear chassis screwdriver adjustment Horizontal Oscillator Frequency . . rear chassis adjustment Horizontal Oscillator Waveform bottom chassis adjustment Horizontal Locking Range rear chassis adjustment Focus top chassis adjustment Ion Trap Magnet top chassis adjustment Deflection Coil top chassis wing nut adjustment AGC Control rear chassis adjustment Pin Cushion Correction Magnets (21T207G only) top chassis adjustment HIGH VOLTAGE WARNING OPERATION OF THIS RECEIVER OUTSIDE THE CABINET OR WITH THE COVERS REMOVED, INVOLVES A SHOCK HAZARD FROM THE RECEIVER POWER SUPPLIES. WORK ON THE RECEIVER SHOULD NOT BE ATTEMPTED BY ANYONE WHO IS NOT THOROUGHLY FAMILIAR WITH THE PRECAUTIONS NECESSARY WHEN WORKING ON HIGH VOLTAGE EQUIPMENT. DO NOT OPERATE THE RECEIVER WITH THE HIGH VOLTAGE COMPARTMENT SHIELD REMOVED. KINESCOPE HANDLING PRECAUTIONS DO NOT REMOVE THE RECEIVER CHASSIS, INSTALL, REMOVE OR HANDLE THE KINESCOPE IN ANY MANNER UNLESS SHATTERPROOF GOGGLES ARE WORN. PEOPLE NOT SO EQUIPPED SHOULD BE KEPT AWAY WHILE HANDLING KINESCOPES. KEEP THE KINESCOPE AWAY FROM THE BODY WHILE HANDLING. The kinescope bulb encloses a high vacuum and, due to its large surface area, is subjected to considerable air pressure. For this reason, the kinescope must be handled with more care than ordinary receiving tubes. The large end of the kir.sscope bulb-particularly that part at the rim of the viewing surface-must not be struck, scratched or subjected to more than moderate pressure at any time. During service if the tube sticks or fails to slip smoothly into its socket, or deflecting yoke, investigate and remove the cause of the trouble. Do not force the tube. Refer to the Receiver Installation section for detailed instructions on kinescope installation. All RCA replacement kinescopes are shipped in special cartons and should be left in the cartons until ready for installation in the receiver. 2 OPERATING INSTRUCTIONS 231 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 The following adjustments are necessary when turning the receiver on for the first time. 8. Adjust the CONTRAST and BRIGHTNESS controls for suitable picture contrast and brightness. 1. See that the TV -PH switch is in the "TV" position. 2. Turn the receiver "ON" and advance the SOUND VOLUME control to approximately mid -position. 3. Set the STATION SELECTOR to the desired channel. 4. Adjust the FINE TUNING control for best pix and the SOUND VOLUME control for suitable volume. 9. In switching from one channel to another, it may be necessary to repeat steps 4 a nd 8. 10. When the set is turned on again after an idle period it should not be necessary to repeat the adjustment if the positions of the controls have not been changed. If any adjustment is necessary, step number 4 is generally sufficient. 5. Turn the BRIGHTNESS control fully counter -clockwise, then clockwise until a light pattern appears on the screen. 6. Adjust the VERTICAL hold control until the pattern stops vertical movement. 7. Adjust the HORIZONTAL hold control until a picture is obtained and centered. VERTICAL HOLD HORI?ONTAL HOLD BRIGHTNESS ON -OFF SW. SOUND VOLUME CONTRAST TV TONE & PHONO SWITCH STATION SELECTOR CHANNEL NO. FINE TUNING 11. If the positions of the controls have been changed, it may be necessary to repeat steps 2 through 8. 12. To use a record player, plug the record-player output cable into the PHONO jack on the rear apron, and set the TV -PH switch to "PH" Figure 1-Receiver Operating Controls INSTALLATION INSTRUCTIONS UNPACKING. -These receivers are shipped complete in cardboard cartons. The kinescope is shipped in place in the receiver. Take the receiver out of the carton and remove all packing material. Make sure that all tubes are in place and are firmly seated in their sockets. Check to see that the kinescope high voltage lead clip is in place. Plug a power cord into the 115 volt a -c power source and into the receiver interlock receptacle. Turn the receiver power switch to the "on" position, the brightness control fully clockwise, and the picture control counter -clockwise. ION TRAP MAGNET ADJUSTMENT.-Set the ion trap magnet approximately in the position shown in Figure 2. Starting from this position immediately adjust the magnet by moving it forward or backward at the same time rotating it slightly around the neck of the kinescope for the brightest raster on the screen. Reduce the brightness control setting until the raster is slightly above average brilliance. Turn the focus control (shown in Figure 2) until the line structure of the raster is clearly visible. Readjust the ion trap magnet for maximum raster brilliance. The final touches of this adjustment should be made with the brightness control at the maximum clockwise position with which good line focus can be maintained. DEFLECTION YOKE ADJUSTMENT. -If the lines of the raster are not horizontal or squared with the picture mask, rotate the deflection yoke until this condition is obtained. Tighten the yoke adjustment wing screw. PICTURE ADJUSTMENTS.-It will now be necessary to obtain a test pattern picture in order to make further adjustments. Connect the antenna transmission line to the receiver. If the Horizontal Oscillator and AGC System are operating properly, it should be possible to sync the picture at this point. However, if the AGC control is misadjusted, and the receiver is overloading, it may be impossible to sync the picture. If the receiver is overloading, turn R149 on the rear apron (see Figure 3) counter -clockwise until the set operates normally and the picture can be synced. CHECK OF HORIZONTAL OSCILLATOR ALIGNMENT.-Turn the horizontal hold control to the extreme counter -clockwise position. The picture should remain in horizontal sync. Momentarily remove the signal by switching off channel then back. Normally the picture will be out of sync. Turn the control clockwise slowly. The number of diagonal black bars will be gradually reduced and when only 2 or 3 bars sloping downward to the left are obtained, the picture will pull into sync upon slight additional clockwise rotation of the control. Pull -in should occur before the control has been turned 120 degrees from the extreme counter -clockwise position. The picture should remain in sync for approximately 90 CENTERING ADJUSTMENT LOCK SCREW ENTERING ADJUSTMENT LEVER FOCUS CONTROL ION TRAP MAGNET ".1 YOKE CUSHION OCUS MAGNET MOUNTING SCREW KINESCOPE SOCKET DEFLECTION,OKE ADJUSTMENT R -F UNIT R173 HEIGHT CONTROL R181 VERTICAL LINEARITY CONTROL R149 AGC CONTROL T110 HORIZONTAL OSCILLATOR FREQ. ADJ. L109 HORIZONTAL LINEARITY CONTROL C1(.15 HORIZONTAL DRIVE L 104 WIDTH CONTROL J101 0 FHONO INPUT J 10Z "k9.) "61A VIDEO JACK 0 LHOCCMKINIZG RANGE Figure 2-Yoke and Focus Magnet Adjustments 3 Figure 3-Rear Chassis Adjustments 232 21T207, 21T207G, 21T208, 21T217 21T218, 21T227 21T228, 21T229 INSTALLATION INSTRUCTIONS degrees of additional clockwise rotation of the control. At the extreme clockwise position, the picture should remain in sync and should not show a black bar in the picture. If the receiver passes the above checks and the picture is normal and stable, the horizontal oscillator is properly aligned. Skip "Alignment of Horizontal Oscillator" and proceed with "Focus Magnet Adjustment." ALIGNMENT OF HORIZONTAL OSCILLATOR. -If in the above check the receiver failed to hold sync with the hold control at the extreme counter -clockwise position or failed to hold sync over 90 degrees of clockwise rotation of the control from the pull -in point, it will be necessary to make the following adjustments. Horizontal Frequency Adjustment. -Turn the horizontal hold control to the extreme clockwise position. Tune in a television station and adjust the T110 horizontal frequency adjustment at the rear of the chassis until the picture is just out of sync and the horizontal blanking appears as a vertical or diagonal black bar in the raster. Then turn the T110 core until the bar moves out of the picture leaving it in sync. Horizontal Locking Range Adjustment.-Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T110 rear core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync If more than 3 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C161A slightly clockwise. If less than 2 bars are present, adjust C161A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 or 3 bars are present. Repeat the adjustments under "Horizontal Frequency Adjustment" and "Horizontal Locking Range Adjustment" until the conditions specified under each are fulfilled. When the horizontal hold operates as outlined under "Check of Horizontal Oscillator Alignment" the oscillator is properly adjusted. If it is impossible to sync the picture at this point and the AGC system is in proper adjustment it will be necessary to adjust the Horizontal Oscillator by the method outlined in the alignment procedure on page 11: For field purposes paragraph "B" under Horizontal Oscillator Waveform Adjustment may be omitted. FOCUS MAGNET ADJUSTMENT. -The focus magnet should be adjusted so that there is approximately three -eighths inch of space between the rear cardboard shell of the yoke and the flat of the front face of the focus magnet. This spacing gives best average focus over the face of the tube. The axis of the hole through the magnet should be parallel with the axis of the kinescope neck with the kinescope neck through the center of the opening. PIN -CUSHION CORRECTION. -Two pin -cushion correc- tion magnets are employed to correct a small amount of pin -cushion of the raster due to the lens effect of the face of the kinescope. These magnets are mounted on small arms, one on each side of the kinescope as shown in Figure 2. The arms hinge in one plane on self tapping screws which act both as a hinge and an adjustment locking screw. When the magnets are swung towards the tube, maximum correction is obtained. Minimum correction is obtained when the arms are swung away from the tube. To adjust the magnets, loosen the two self tapping screws and position the magnets until the sides of the raster appear straight. Tighten the screws without shifting the position of the magnets. In some cases it may be necessary to twist or bend the magnet support arms to obtain the appearance of straight raster edges. CENTERING ADJUSTMENT.-No electrical centering controls are provided. Centering is accomplished by means of a separate plate on the focus magnet. The centering plates include a locking screw which must be loosened before centering. Up and down adjustment of the plate moves the picture side to side and sidewise adjustment moves the picture up and down. If a corner of the raster is shadowed, check the position of the ion trap magnet. Reposition the magnet within the range of maximum raster brightness to eliminate the shadow and recenter the picture by adjustment of the focus magnet plate. In no case should the magnet be adjusted to cause any loss of brightness since such operation may cause immediate or eventual damage to the tube. In some cases it may be necessary to shift the position of the focus magnet in order to eliminate a corner shadow. WIDTH, DRIVE AND HORIZONTAL LINEARITY ADJUSTMENTS. -Adjustment of the horizontal drive control affects the high voltage applied to the kinescope. In order to obtain the highest possible voltage hence the brightest and best focused picture, adjust horizontal drive trimmer C161B counter -clockwise until the picture begins to "wrinkle" in the middle then clockwise until the "wrinkle" disappears. Turn the horizontal linearity control L108 clockwise until the picture begins to "wrinkle" on the right and then counterclockwise until the "wrinkle" disappears and best linearity is obtained. Adjust the width control L106 to obtain correct picture width. A slight readjustment of these three controls may be necessary to obtain the best linearity. Adjustments of the horizontal drive control affect horizontal oscillator hold and locking range. If the drive control was adjusted, recheck the oscillator alignment. HEIGHT AND VERTICAL LINEARITY ADJUSTMENTS.-Adjust the height control (R173 on chassis rear apron) until the picture fills the mask vertically. Adjust vertical linearity (R181 on rear apron), until the test pattern is symmetrical from top to bottom. Adjustment of either control will' require a readjustment of the other. Adjust centering to align the picture with the mask. FOCUS.-Adjust the focus magnet for maximum definition in the test pattern vertical "wedge" and best focus in the white areas of the pattern. Recheck the position of the ion trap magnet to make sure that maximum brightness is obtained. Check to see that the yoke thumbscrew and the focus magnet mounting screws are tight. STATION SELECTOR FINE TUNING TO REMOVE ESCUTCHEON, SLIDE SPRING CLIP TO LEFT -OSCILLATOR ADJUSTMENT FOR CHANNEL NUMBER Figure 4-R -F Oscillator Adjustments CHECK OF R -F OSCILLATOR ADJUSTMENTS. - Tune in all available stations to see if the receiver r -f oscillator is adjusted to the proper frequency on all channels. If adjust. ments are required, these should be made by the method outlined in the alignment procedure on page 9. The adjustments for channels 2 through 12 are available from the front of the cabinet by removing the station selector escutcheon as shown in Figure 4. Adjustment for channel 13 is on top of the chassis. AGC THRESHOLD CONTROL. -The AGC threshold control R149 is adjusted at the factory and normally should not require readjustment in the field. To check the adjustment of the AGC Threshold Control, tune in a strong signal and sync the picture. Momentarily remove the signal by switching off channel and then back. If the picture reappears immediately, the receiver is not overloading due to improper setting of R149. If the picture requires an appreciable portion of a second to reappear, or bends excessively, R149 should be readjusted. 4 233 21T207, 21T207G, 21T208, 21T217, INSTALLATION INSTRUCTIONS 21T218, 21T227, 21T228, 21T229 Turn R149 fully counter -clockwise. The raster may be bent slightly. This should be disregarded. Turn R149 clockwise until there is a very, very slight bend or change of bend in the picture. Then turn R149 counter -clockwise just sufficiently to remove this bend or change of bend. If the signal is weak, the above method may not work as it may be impossible to get the picture to bend. In this case, turn R149 clockwise until the snow in the picture becomes more pronounced, then counter -clockwise until the best signal to noise ratio is obtained. The AGC control adjustment should be made on a strong signal if possible. If the control is set too far clockwise on a weak signal, then the receiver may overload when a strong signal is received. FM TRAP ADJUSTMENT.-In some instances interference may be encountered from a strong FM station signal. A trap is provided to eliminate this type of interference. To adjust the trap tune in the station on which the interference is observed and adjust the L203 core on top of the antenna matching transformer for minimum interference in the picture. CAUTION.-In some receivers, the FM trap L203 will tune down into channel 6 or even into channel 5. Needless to say, such an adjustment will cause greatly reduced sensitivity on these channels. If channels 5 or 6 are to be received, check L203 to make sure that it does not affect sensitivity on these two channels. Replace the cabinet back and connect the receiver antenna leads to the cabinet back. Make sure that the screws holding it are up tight, otherwise it may rattle or buzz when the receiver is operated at high volume. KINESCOPE SCREEN CLEANING.-The kinescope safety glass is held in place by four spring clips which may be removed from the back of the front panel. This permits removing the safety glass for cleaning without the necessity of removing the chassis and kinescope. CHASSIS REMOVAL. -To remove the chassis from the cabinet for repair or installation of a new kinescope, remove the control knobs, the cabinet back, unplug the speaker cable, the kinescope socket, the antenna cable, the yoke and high voltage cable. Take out the chassis bolts under the cabinet. Withdraw the chassis from the back of the cabinet. KINESCOPE HANDLING PRECAUTION.-Do not install, remove, or handle the kinescope in any manner, unless shatterproof goggles and heavy gloves are worn. People not so equipped should be kept away while handling the kinescope. Keep the kinescope away from the body while handling. REMOVAL OF KINESCOPE. -To remove the kinescope from the cabinet, loosen the two nuts and disengage the rods alongside the kinescope. Remove the screw which holds the yoke frame to the cabinet. Remove the kinescope, the yoke frame with yoke and focus magnet as an assembly. Handle this tube by the portion at the edge of the screen. Do not cover the glass bell of the tube with fingermarks as it will produce leakage paths which may interfere with reception. If this portion of the tube has inadvertently been handled, wipe it clean with a soft cloth moistened with "dry" carbon tetrachloride. INSTALLATION OF KINESCOPE.-Wipe the kinescope screen surface and front panel safety glass clean of all dust and fingermarks with a soft cloth moistened with "Windex" or similar cleaning agent. Replace the kinescope and chassis by reversal of the removing process. The kinescope should be installed so that the high voltage contact is to the right when looking at it from the rear of the cabinet. The magnet of the ion trap magnet should be to the left. CABINET ANTENNA. -A cabinet antenna is provided in some receiver models and the leads are brought out near the antenna terminal board. The cabinet antenna may be employed in place of the outdoor antenna in areas where the signals are strong and no reflections are experienced. ANTENNAS. -The finest television receiver built may be said to be only as good as the antenna design and installation. It is therefore important to select the proper antenna to suit the particular local conditions, to install it properly and orient it correctly. If two or more stations are available and the two stations are in different directions, it may be possible to make a compromise orientation which will provide a satisfactory signal on all such channels. If it is impossible to obtain satisfactory results on one or more channels, it may become necessary either to provide means for turning the antenna when switching channels or to install a separate antenna for one or more channels and to switch antennas when switching channels. In some cases, the antenna should not be installed permanently until the quality of the picture reception has been observed on a television receiver. A temporary, ,transmission line can be run between receiver and the antenna, allowing sufficient slack to permit moving the antenna. Then, with a telephone system connecting an observer at the receiver and an assistant at the antenna, the antenna can be positioned to give the most satisfactory results on the received signal. A shift of direction or a few feet in antenna position may effect a tremendous difference in picture reception. REFLECTIONS.-Multiple images sometimes known as echoes or ghosts, are caused by the signal arriving at the antenna by two or more routes. The second or subsequent image occurs when a signal arrives at the antenna after being reflected off a building, a hill or other object. In severe cases of reflections, even the sound may be distorted. In less severe cases, reflections may occur that are not noticeable as reflections but that will instead cause a loss of definition in the picture. Under certain extremely unusual conditions, it may be possible to rotate or position the antenna so that it receives the cleanest picture over a reflected path. If such is the case, the antenna should be so positioned. However, such a position may give variable results as the nature of reflecting surfaces may vary with weather conditions. Wet surfaces have been known to have different reflecting characteristics than dry surfaces. Depending upon the circumstances, it may be possible to eliminate the reflections by rotating the antenna or by moving it to a new location. In extreme cases, it may be impossible to eliminate the reflection. INTERFERENCE. -Auto ignition, street cars, electrical machinery and diathermy apparatus may cause interference which spoils the picture. Whenever possible, the antenna location should be removed as far as possible from highways, hospitals, doctors' offices and similar sources of interference. In mounting the antenna, care must be taken to keep the antenna rods at least 1/4 wave length (at least 6 feet) away from other antennas, metal roofs, gutters or other metal objects. Short-wave radio transmitting and receiving equipment may cause interference in the picture in the form of moving ripples. In some instances it may be possible to eliminate the interference by the use of a trap in the antenna transmission line. However, if the interfering signal is on the same frequency as the television station, a trap will provide no improvement. WEAK PICTURE. -When the installation is near the limit of the area served by the transmitting station, the picture may be speckled, having a "snow" effect, and may not hold steady on the screen. This condition is due to lack of signal strength from the transmitter. RECEIVER LOCATION.-The owner should be advised of the importance of placing the receiver in the proper location in the room. The location should be chosen- Away from bright windows and so that no bright light will fall directly on the screen. (Some illumination in the room is desirable, however.) -To give easy access for operation and comfortable viewing. - To permit convenient connection to the antenna. - Convenient to an electrical outlet. - To allow adequate ventilation. 5 234 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 TO ANTENNA TERMINALS CHASSIS TOP VIEW ANTENNA MATCHING TRANSFORMER CHANNEL SELECTOR SWITCH FINE TUNING CONTROL SPEAKER CABLE 7102 RATIO DET. TRANS. V103 GALS RATIO DET. V102 SAU6 SNO AMP T101 SOUND I -F TRANS V101 6AUG IVSND I -F AMP. T107 4TH PIX I -F V109 12AU7 PIX DET. & VERT. TRANS O V108 GC BG 3SRPix AMP SYNC SEP. VIII 6AU6 AGC AMP. V112 G5N7GT NOR SYNC SEP. VERT SYNC. OUTPUT VII0 GAG7 VIDEO AMP. T106 38.2 PIX I -F 0TRANS. V107 6CBG 2 -PPM I -F AMP T105 PIX I -F TRANS. V1 6C6066 ST DI% I -F AMP. T104 IN! PIX I -F TRANS V104 GAVE. AUDIO AMP. V105 6K6GT AUDIO OUTPUT TIO3 AUDIO OUTPUT TRANS. / ,..... ---"'''-, V116 \ I 68Q6GT I tHORIZONTALI OUTPUT / ......_,, r- \ ---- --. / v115 i 65N7GT i 1 KIEL OSC. ' A CONTROL,/ ,..=1 --, '' - ---' I 1 i 1 i (..-- - - - \ 1183'1617780161 ' IN.V. RECT. I1 I V118 I 1 I 6W4 GT DAMPER I I d ----- I -11 I i rL - - - - -IL _,_..1 T109 POWER TRANSFORMER VI14 GKGGT VERTICAL SWEEP OUTPUT T108 VERT. SWP. OUTPUT TRANS. V120 5U4G RECT. V121 SY3GT RECT. V113 6-15 VERT SWP OSC. 5101 TV- PHONO SWITCH 5102 - R109 ON -OFF SWITCH &VOL. CONTROL R184 BRIGHTNESS CONTROL RI 37 PICTURE CONTROL 1170B 51705 R170 A VERTICAL HOLD CONTROL 0.81307 P.170 8 HORIZONTAL HOLD CONTROL KINESCOPE SOCKET Figure 5-Chassis Top View 6 POWER CORD C CHANNEL SELECTOR SWITCH FINE TUNING CONTROL CHASSIS BOTTOM VIEW 235 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 R -F UNIT ANTENNA MATCHING TRANSFORMER TO ANTENNA TERMINALS 5101 TV- PHONO SWITCH 5102 - R109 ON -OFF SWITCH & VOL CONTROL RI84 BRIGHTNESS CONTROL R137 PICTURE CONTROL 12170A VERTICAL HOLD CONTROL RI70A R1705 R170 B HORIZONTAL HOLD CONTROL SPEAKER CABLE Y104 6AV6 AUDIO MP TIO5 2111) PIX I -F TRANS 0 GCBS ESP FIX I -F AMP VI 6CB6 IN PIX I -F 141, 7106 3192 PIX I -F TRANS. 100 6CB6 SE,PIX I -F AMP 7107 ATLI PIX 1-F TRANS. 109 I2AU7 FIX SET & VERT. SYNC SEP., 7101 SOUND FF TRANS V 10 6AU6 IN SND I- F MP 102 SAU6 209 SND I -F AMP 7102 RATIO DET. TRANS. 7104 197 PIX TRANS. VIIO 6AG7 VIDEO AM P. V112 65N7GT HOR SYNC SEP VERT SYNC OUTPUT VIII AU6 AGC AMP. VII4 6K6GT VERT SWP OUT. V115 6SN7GT HOR OSC CONTRO V116 6846 GT HORIZONTAL OUTPUT 7110 HOR. SWEEP 05C. TRANS. VII3 GJS VERT. SWP. OSC. VI 21 SY3GT RECT. V120 SLAG RECT. D4SSOS POWER CORD KINESCOPE SOCKET Figure 6-Chassis Bottom View 7 236 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 ALIGNMENT PROCEDURE TEST EQUIPMENT. -To properly service the television chassis of this receiver, it is recommended that the following test equipment be available: R -F Sweep Generator meeting the following requirements: (a) Frequency Ranges 20 to 30 mc., 1 mc. and 10 mc. sweep width 50 to 90 mc., 10 mc. sweep width 170 to 225 mc., 10 mc. sweep width (b) Output adjustable with at least .1 volt maximum. (c) Output constant on all ranges. (d) "Flat" output on all attenuator positions. Cathode -Ray Oscilloscope. -For alignment purposes, the oscilloscope employed must have excellent low frequency and phase response, and should be capable of passing a 60 -cycle square wave without appreciable distortion. For video and sync waveform observations, the oscilloscope must have excellent frequency and phase response from 10 cycles to at least two megacycles in all positions of the gain control. Signal Generator to provide the following frequencies with crystal accuracy. (a) Intermediate frequencies 22.25 and 25.5 mc. cony. and first pix i-f trans. 22.75 mc. second picture i-f transformer 24.25 mc. fourth picture i-f transformer 25.5 mc. third picture i-f transformer 25.50 mc. picture carrier 27.00 mc. adjacent channel sound trap (b) Radio frequencies Channel Number 2 3 4 5 6 7 8 9 10 11 12 13 Picture Carrier Freq. Mc. 55.25 61.25 67.25 77.25 83.25 175.25 181.25 187.25 193.25 199.25 205.25 211.25 Sound Carrier Freq. Mc. 59.75 65.75 71.75 81.75 87.75 179.75 185.75 191.75 197.75 203.75 209.75 215.75 (c) Output of these ranges should be adjustable and at least .1 volt maximum. Heterodyne Frequency Meter with crystal calibrator which covers the frequency range from 80 mc. to 109 mc. and from 200 mc. to 237 mc. Electronic Voltmeter of Junior or Senior "VoltOhmyst" type and a high voltage multiplier probe for use with this meter to permit m asurements up to 15 kv. Service Precautions. -If possible, the chassis should be serviced without the kinescope. However, if it is necessary to view the raster during servicing, it would be a great convenience to have a bench mounted kinescope and speaker complete with a set of extension cables. CAUTION: Do not sho,t the kinescope second anode lead. Its short circuit current presents a considerable overload on the high voltage rectifier V117. Adjustments Required. -Normally, only the r -f oscillator and mixer lines will require the attention of the service technician. All other circuits are either broad or very stable and hence will seldom require readjustment. ORDER OF ALIGNMENT. -When a complete receiver alignment is necessary, it can be most conveniently performed in the following order: (1) R -F unit (2) Picture i-f transformers (3) Picture i-f trap (4) Sweep of picture i-f (5) Ratio detector alignment ( 6) Sound i-f alignment ( 7) 4.5 Mc Trap Adjustinent ( 8) Check of overall response ( 9) AGC control adjustment (10) Horizontal oscillator alignment R -F UNIT ALIGNMENT. -Disconnect the co -ax link from terminal 2 of the r -f unit terminal board and connect a 39 ohm composition resistor between lugs 1 and 2. Detune Tl by backing the core all the way out of the coil. Back the L44 core all the way out. Back the L203 core all the way out. In order to align the r -f tuner, it will first be necessary to set the channel -13 oscillator to frequency. The shield over the bottom of the r -f unit must be in place when making any adjustments. The oscillator may be aligned by adjusting it to beat with a crystal -calibrated heterodyne frequency meter. Couple the meter probe loosely to the receiver oscillator. Set the channel selector switch to 13. Adjust the heterodyne frequency meter to the correct frequency (236.75 mc). Set the fine tuning control 30 degrees clockwise from the mechanical center of its range. Adjust Cl for an audible beat on the heterodyne frequency meter. Now that the channel -13 oscillator is set to frequency, we may proceed with the r -f alignment. Turn the AGC control fully clockwise. Obtain a 7.5 volt battery capable of withstanding appreciable current drain and connect the ends of a 1,000 ohm potentiometer across it. Connect the battery positive terminal to chassis and the potentiometer arm to terminal 3 of the r -f unit. Adjust the bias box potentiometer to produce -3.5 volts of bias at the r -f unit terminal board. Connect the oscilloscope to the test point TP1 on top of the r -f unit. Connect the r -f sweep oscillator to the receiver antenna terminals. The method of connection depends upon the output impedance of the sweep. The P300 connections for 300 -ohm balanced or 72 -ohm single -ended input are shown in the circuit schematic diagram. If the sweep oscillator has a 50 -ohm or 72 -ohm single -ended output, 300 -ohm balanced output can be obtained by connecting as shown in Figure 9. Connect the signal generator loosely to the receiver antenna terminals. Set the receiver channel switch to channel 8. Set the sweep oscillator to cover channel 8. Insert markers of channel 8 picture carrier and sound carrier, 181.25 mc. and 185.75 mc. Adjust C9, C11, C16 and C22 for approximately correct curve shape, frequency, and band width as shown in Figure 11. The correct adjustment of C22 is indicated by maximum amplitude of the curve midway between the markers. C16 tunes the r -f amplifier plate circuit and affects the frequency of the curve most noticeably. C9 tunes the converter grid circuit and affects the tilt of the curve most noticeably (assuming that C22 has been properly adjusted). C11 is the coupling adjustment and hence primarily affects the response band width. Set the receiver channel switch to channel 6. Adjust the heterodyne frequency meter to the correct frequency (108.75 mc.). Set the fine tuning control 30 degrees clockwise from the mechanical center of its range. Adjust L5 for an audible beat on the heterodyne frequency meter. 8 ALIGNMENT PROCEDURE 237 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 Set the sweep generator to channel 6. From the signal generator, insert channel 6 sound and picture carrier markers, 83.25 mc. and 87.75 mc. Adjust L42, L45 and L49 for proper response as shown in Figure 12. L42 is adjusted to give maximum amplitude of the curve between the markers. L45 primarily affects the tilt of the curve. L49 primarily affects the frequency of response. Connect the "VoltOhmyst" to the r -f unit test point TP1. Adjust C7 for -3.0 volts at the test point. Retouch L42, L45 and L49 for proper response if necessary. If necessary, retouch C11 for proper band width on channel 6. Continue these retouching adjustments until proper response is obtained and -3.0 volts of oscillator injection are present at the test point, TP1. Set the receiver channel selector switch to channel 8 and readjust Cl for proper oscillator frequency. Set the sweep oscillator and signal generator to channel 8. Readjust C9, C16 and C22 for correct curve shape, frequency and band width. Readjust C11 only if necessary. Switch the receiver, the sweep oscillator and signal generator to channel 13. Adjust L52 for maximum amplitude of the curve midway between markers and then overshoot the adjustment by turning the slug in the same direction from the initial setting a little more than the amount of turning required to reach maximum amplitude of response. Adjust C22 for maximum amplitude of response. Turn off the sweep generator. Adjust the L43 core for correct channel 13 oscillator frequency, then overshoot the adjustment by turning the slug a little more in the same direction from the initial setting. Reset the oscillator to proper frequency by adjustment of Cl. Turn the sweep oscillator back on. Check the response of channels 7 through 13 by switching the receiver channel switch, sweep oscillator and marker oscillator to each of these channels and observing the response and oscillator injection obtained. See Figure 11 for typical response curves. It should be found that all these channels have the proper shaped response with the markers above 80',/c response. If the markers do not fall within this requirement, switch to channel 8 and readjust C9, C11, C16 and C22 as necessary. If C22 required adjustment, the adjustment should be overshot a small amount and corrected by adjustment of L52 to give maximum amplitude of response between the sound and picture carrier markers. The antenna circuit (L52, C22) is broad so that tracking is not particularly critical. If the valley in the top of the selectivity curves for the high channels is deeper than normal, the curve can be flattened somewhat by decreasing the inductance of L44 by turning the core stud in. Be sure to check for undesirable resonant suck outs on channels 7 and 8 if this is done. Turn the sweep oscillator off and check the receiver channel 8 r -f oscillator frequency. If the oscillator is off frequency overshoot the adjustment of Cl and correct by adjusting L43. Turn the receiver channel selector switch to channel 6. Adjust L5 for correct oscillator frequency. Turn the sweep oscillator on and to channel 6 and observe the response curve. If necessary readjust L42, L45 and L49. It should not be necessary to touch C11. Check the oscillator injection voltage at the test point TP1. If necessary adjust C7 to give -3 volts injection. If C7 is adjusted, switch to channel 8, and readjust C9 for proper curve shape, then recheck channel 6. Switch the receiver through channel 6 down through channel 2 and check for normal response curve shapes and oscillator injection voltage. Likewise check channels 7 through 13, stopping on 13 for the next step. With the receiver on channel 13, check the receiver oscilla- tor frequency. Correct by adjustment of Cl if necessary. Adjust the oscillator to frequency on all channels by switching the receiver and the heterodyne frequency meter to each channel and adjusting the appropriate oscillator trimmer to obtain a beat on the freq. meter. It should be possible to adjust the oscillator to the correct frequency on all channels with the fine tuning control 30 degrees clockwise from the mechanical center of its range. Picture Sound Receiver Channel Channel Carrier Carrier R -F Osc. Oscillator Number Freq. Mc. Freq. Mc. Freq. Mc. Adjustment 2 55.25 59.75 80.750 Ll 3 4 61.25 67.25 6751.7.75 5..928.67.75500 L2 L3 5 77.25 81.75 102.750 L4 6 83.25 87.75 .108.750 L5 7 175.25 179.75. 200.750 L6 8 181.25 185.75 206.750 L7 9 187.25 191.75 212.750 L8 10 193.25 197.75. 218.750 L9 11 199.25 203.75 224.750 L10 12 205.25 209.75..230.750 L11 13 211.25 215.75 236.750 Cl Switch to channel 8 and observe the response. Adjust Ti clockwise while watching the change in response. When Ti is properly adjusted, the selectivity curve will be slightly wider with a slightly deeper valley in its top. Switch through all channels and observe response, oscillator injection and r -f oscillator frequency. Minor touch-ups of adjustments may be made at this time. However, if C7 or C9 are changed appreciably, then a recheck of the oscillator frequency on all channels should be made. Reconnect the link from T101 to terminal 2 of the r -f unit terminal board. Since T1 was adjusted during the r -f unit alignment it will be necessary to sweep the overall i-f response. R -F UNIT TUBE CHANGES. -Since most of the circuits are low capacitance circuits the r -f unit may require readjustments when the tubes are changed. If the 6CB6 r -f amplifier tube is changed, it may be necessary to readjust C16 and C22. If the 616 oscillator and mixer tube is changed, then more extensive adjustments are required. For good conversion efficiency, the oscillator injection to a triode mixer must be held reasonably close to the optimum value. Although there is some latitude in this level, it is nearly expended in the normal variation in injection from channel to channel. Consequently, the adjustment of C7 is limited primarily to establishing the conditions for good conversion. Since changes in oscillator injection affect conversion gain, it also affects the input capacity of the mixer, thus also affecting tracking of the mixer grid circuit. These tube variations with their consequent effect on circuit alignment thereby require readjustment of the r -f unit if maximum conversion efficiency is to be retained after the 616 tube is changed. It may be possible, however, to try several 6J6 tubes and select one which gives satisfactory performance without realignment. PICTURE I -F TRANSFORMER ADJUSTMENTS. Connect the "VoltOhmyst" to the junction of R142 and R143. Turn the AGC control fully clockwise. Obtain a 7.5 volt battery capable of withstanding appreciable current drain dad connect the ends of a 1,000 ohm potentiometer across it. Connect the battery positive terminal to chassis and the potentiometer arm to the junction R142 and R143. Adjust the potentiometer for -5.0 volts indication on the "VoltOhmyst". Set the channel switch to channel number 9, 10 or II. Connect the "VoltOhmyst" to pin 4 of V110 (pin 2 if 6CL6 is used) and to ground. Connect the output of the signal generator to the mixer grid test point TP2 in series with a 1500 mmf ceramic capacitor. Connect a separate -5 volt bias supply to TP1 with the positive terminal to ground. Set the generator to each of the following frequencies and with a thin fiber screwdriver tune the specified adjustment for maximum indication on the "VoltOhmyst". In each instance the generator should be checked against a crystal calibrator to insure that the generator is on frequency. 9 238 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 ALIGNMENT PROCEDURE Adjust the signal generator output to give 3 volts on the "VoltOhmyst" as the final adjustment is made. (1) 24.25 mc.-T107 (3) 22.75 mc.-T105 (2) 25.5 mc.-T106 PICTURE I -F TRAP ADJUSTMENT. -With the same connections as above, tune the generator to 27.00 mc. and adjust the T104 top core for minimum d -c on the "VoltOhmyst". Set the generator output so that this minimum is about 3 volts when final adjustment is made. If necessary, the i-f bias may be reduced in order to obtain the 3 volt reading on the "VoltOhmyst". SWEEP ALIGNMENT OF PIX I -F. -To align T1 and 'T104, connect the sweep generator to the mixer grid test point TP2. In series with a 1500 mmf ceramic capacitor use the shortest leads possible, with not more than one inch of unshielded lead at the end of the sweep cable. Connect the sweep ground lead to the r -f unit outer shield. Connect a separate -5.0 volt bias supply to TP1 with the positive terminal connected to ground and by-pass TP1 to ground with a 1500 mmf. ceramic capacitor. Set the channel selector switch between channels 2 and 13. Clip 330 ohm resistors across terminals A and B of T106 and T107. Preset C115 to minimum capacity. Adjust the bias box potentiometer to obtain -5.0 volts of bias as measured by a "VoltOhmyst" at the junction of R142 and 8143. Leave the AGC control fully clockwise. Connect a 180 ohm composition resistor from pin 5 of V106 to terminal A of T105. Connect the oscilloscope diode probe to pin 5 of V106 and to ground. Couple the signal generator loosely to the diode probe in order to obtain markers. Adjust T1 (top) and T104 (bottom) for maximum gain and with 25.5 mc. at 70' of maximum response. Set the sweep output to give 0.3 volt peak -to -peak on the oscilloscope when making the final touch on the above adjustment. Adjust C115 until 22.25 mc. is at 70',; response with respect to the low frequency shoulder of the curve as shown in Figure 12. Disconnect the diode probe, the 180 ohm and two 330 ohm resistors. Connect the oscilloscope to pin 4 (pin 2 if 6Ci6 is used) of V110 socket. Leave the sweep generator connected to the mixer grid test point TP2 with the shortest leads possible. AdjUst the output of the sweep generator to obtain 3.0 volts peak -to -peak on the oscilloscope. Couple the signal generator loosely to the grid of the first pix i-f amplifier. Adjust the output of the signal generator to produce small markers on the response curve. Retouch T105, T106 and T107 to obtain the response shown in Figure 13. It is especially important that the 22.4 mc. marker should fall at 55% on the overall i-f response curve. If the marker should fall appreciably higher than 55%, trouble may be experienced with sound in the picture. If the marker should fall appreciably below 55% response, the sound sensitivity may be reduced and may cause the sound to be noisy in weak signal areas. RATIO DETECTOR ALIGNMENT. -Set the signal generator at 4.5 mc. and connect it to the first sound i-f grid, pin 1 of V101. As an alternate source of signal, the RCA WR39B or WR39C calibrator may be employed. In such a case, connect the calibrator to the grid of the third pix i-f amplifier, pin 1 of V108. Set the frequency -of the calibrator to 25.50 mc. (pix carrier) and modulate with 4.5 mc. crystal. The 4.5 mc. signal will be picked off at L102 and amplified through the sound i-f amplifier. Connect the "VoltOhmyst" to pin 2 of V103. Tune the ratio detector primary, T102 top core for maximum d -c output on the "VoltOhmyst". Adjust the signal level from the signal generator for 6 volts on the "VoltOhmyst" when finally peaked. This is approximately the operating level of the ratio detector for average signals. Connect the "VoltOhmyst" to the junction of R106 and C108. Tune the ratio detector secondary T102 bottom core for zero d -c on the "VoltOhmyst". Repeat adjustments of T102 top for maximum d -c at pin 2 of V103 and T102 bottom for zero d -c at the junction of R106 and C108. Make the final adjustments with the signal input level adjusted to produce 6 volts d -c on the "VoltOhmyst" at pin 2 of V103. SOUND I -F ALIGNMENT. -Connect the signal genera. tor to the first sound i-f amplifier grid, pin 1 of V101. As an alternate source of signal, the RCA WR39B or WR39C calibrator may be employed as above. Connect the "VoltOhmyst" to pin 2 of V103. Tune the T101 top core for maximum d -c on the "VoltOhmyst". The output from the signal generator should be set to produce approximately 6.0 volts on the "VoltOhmyst" when the final touches on the above adjustment are made. 4.5 MC. TRAP ADJUSTMENT. -Connect the signal generator in series with a 1,000 ohm resistor to pin 2 of V109. Set the generator to 4.5 mc. and modulate it 30' , with 400 cycles. Set the output to approximately 0.5 volts. Short the third pix i-f grid to ground, pin 1, V108, to prevent noise from masking the output indication. Connect the crystal diode probe of an oscilloscope to the plate of the video amplifier, pin 8 (pin 6 if 6CL6 is used) of V110. Adjust the core of L103 for minimum output on the oscilloscope. Remove the short from pin 1, V108 to ground. As an alternate method, this step may be omitted at this point in the alignment procedure and the adjustment made "on the air" after the alignment is completed. If this is done, tune in a station and observe the picture on the kinescope. If no 4.5 mc. beat is present in the picture, when the fine tuning control is set for proper oscillator -frequency, then L103 requires no adjustment. If a 4.5 mc. beat is present, turn the fine tuning control slightly clockwise so as to exaggerate the beat and then adjust L103 for minimum beat. CHECK OF OVERALL RESPONSE. -If desired, the overall response of the receiver can be checked on each channel. Connect the r -f sweep generator to the receiver antenna input terminals. If necessary, employ one of the pads shown in Figure 9 to match the sweep output cable to the r -f unit. Connect the signal generator loosely to the first pix i-f amplifier grid. Adjust the bias potentiometer to obtain -5.0 volts of bias as measured by a "VoltOhmyst" at the junction of R142 and R143. Connect the oscilloscope to pin 4 (pin 2 if 6CL6 is used) of V110. Check the response of channels 2 through 13 by switching the receiver channel switch and sweep oscillator to each of these channels and, observing the response obtained. On each channel, adjust the output of the sweep generator to obtain 3.0 volts peak -to -peak on the oscilloscope. I -F markers at 22.4 mc., 24.75 mc. and 25.5 mc. should be provided by the signal generator. The response obtained in this manner should be very similar to that shown in Figure 13. Some curves may show a 10% sag in the top between 22.75 mc. and 24.75 mc. while others may show a 10% peak in this region. This may be considered normal. If the picture carrier is consistently high or low on all channels, T106 may be adjusted slightly. Do not adjust T105. AGC CONTROL ADJUSTMENT. -Disconnect all test equipment except the oscilloscope which should be connected to pin 8 (pin 6 if 6CL6 is used) of V110. Connect an antenna to the receiver antenna terminals. Turn the AGC control fully counter -clockwise. Tune in a strong signal and adjust the oscilloscope to see the video waveform. Turn the AGC control clockwise until the tips of sync begin to be compressed, then counter -clockwise until no compression is obtained. 10 239 21T207, 21T201G, 21T208, 21T217, ALIGNMENT PROCEDURE 21T218, 21T227, 21T228, 21T229 HORIZONTAL OSCILLATOR ADJUSTMENT.-Normolly the adjustment of the horizontal oscillator is not considered to be a part of the alignment procedure, but since the oscillator waveform adjustment may require the use of an oscilloscope, it can not be done conveniently in the field. The waveform adjustment is made at the factory and normally should not require readjustment in the field. However, the waveform adjustment should be checked whenever the receiver is aligned or whenever the horizontal oscillator operation is improper. Horizontal Frequency Adjustment. -Tune in a station and sync the picture. If the picture cannot be synchronized with the horizontal hold control R17013, then adjust the T110 frequency core on the rear apron until the picture will synchronize. If the picture still will not sync, turn the T110 waveform adjustment core (under the chassis) out of the coil several turns from its original position and readjust the T110 frequency core until the picture is synchronized. Examine the width and linearity of the picture. If picture width or linearity is incorrect, adjust the horizontal drive control C161B, the width control L106 and the linearity control L108 until the picture is correct. Horizontal Oscillator Waveform Adjustment.-The horizontal oscillator waveform may be adjusted by either of two methods. The method outlined in paragraph A below may be employed in the field when an oscilloscope is not available. The service shop method outlined in paragraph B below requires the use of an oscilloscope. A.-Turn the horizontal hold control completely clockwise. Place adjustment tools on both cores of T110 and be prepared to make simultaneous adjustments while watching the picture on the screen. First, turn the T110 frequency core (on the rear apron) until the picture falls out of sync and three or four diagonal black bars sloping down to the right appear on the screen. Then, turn the waveform adjustment core (under the chassis) into the coil while at the same time adjusting the frequency core so as to maintain three or four diagonal black bars on the screen. Continue this procedure until the oscillator begins to motorboat, then turn the waveform adjustment core out until the motorboating just stops. As a check, turn the T110 frequency core until the picture is synchronized then reverse the direction of rotation of the core until the picture falls out of sync with the diagonal bars sloping down to the right. Continue to turn the frequency core in the same direction. No more than three or four bars should appear on the screen. Instead, the horizontal oscillator should begin the motorboat. Retouch the adjustment of the T110 waveform adjustment core if necessary until this condition is obtained. B.-Connect the low capacity probe of an oscilloscope to terminal C of T110. Turn the horizontal hold control one quarter turn from the clockwise position so that the picture is in sync. The pattern on the oscilloscope should be as shown in Figure 14. Adjust the waveform adjustment core of T110 until the two peaks are at the same height. During this adjustment, the picture must be kept in sync by readjusting the hold control if necessary. This adjustment is very important for correct operation of the circuit. If the broad peak of the wave on the oscilloscope is lower than the sharp peak, the noise immunity becomes poorer, the stabilizing effect of the tuned circuit is reduced and drift of the oscillator becomes more serious. On the other hand, if the broad peak is higher than the sharp peak, the oscillator is overstabilized, the pull -in range becomes inadequate and the broad peak can cause double triggering of the oscillator when the hold control approaches the clockwise position. Remove the oscilloscope upon completion of this adjustment. Horizontal Locking Range Adjustment.-Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T110 frequency core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 3 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C161A slightly clockwise. If less than 2 bars are present, adjust C161A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 or 3 bars are present. Turn the horizontal hold control to the maximum clockwise position. Adjust the T110 frequency core so that the diagonal bar sloping down to the right appears on the screen and then reverse the direction of adjustment so that bar just moves to the left side of the screen leaving the picture in synchronization. SENSITIVITY CHECK.-A comparative sensitivity check can be made by operating the receiver on a weak signal from a television station and comparing the picture and sound obtained to that obtained on other receivers under the same conditions. This weak signal can be obtained by connecting the shop antenna to the receiver through a ladder type attenuator pad. The number of stages in the pad depends upon the signal strength available at the antenna. A sufficient number of stages should be inserted so that a somewhat less than normal contrast picture is obtained when the picture control is at the maximum clockwise position. Only carbon type resistors should be used to construct the pad. RESPONSE CURVES.-The response curves shown on page 14 and referred to throughout the alignment procedure were taken from a production set. Although these curves'are typical, some variations can be expected. The response curves are shown in the classical manner of presentation, that is with "response up" and low frequency to the left. The manner in which they will be seen in a given test set-up will depend upon the characteristics of the oscilloscope and the sweep generator. The curves may be seen inverted and/or switched from left to right depending on the deflection polarity of the oscilloscope and the phasing of the sweep generator. NOTE ON R -F UNIT ALIGNMENT.-Because of the frequency spectrum involved and the nature of the device, many of the r -f unit leads and components are critical in some respects. Even the power supply leads form loops which couple to the tuned circuits, and if resonant at any of the frequencies involved in the performance of the tuner, may cause serious departures from the desired characteristics. In the design of the receiver these undesirable resonant loops have been shifted far enough away in frequency to allow reasonable latitude in their components and physical arrangement without being troublesome. When the r -f unit is aligned in the receiver, no trouble from resonant loops should be experienced. However, if the unit is aligned in a jig separate from the receiver, attention should be paid to insure that unwanted resonances do not exist which might present a faulty repre- sentation of r -f unit alignment. A resonant circuit exists between the r -f tuner chassis and the outer shield box, which couples into the antenna and r -f plate circuits. The frequency of this resonance depends on the physical structure of the shield box, and the capacitance between the tuner chassis and the front plate. In the KRK8 units, this resonance should fall between 120 and 135 mc. and is controlled in the design by using insulating washers of different thicknesses (in the front plate to tuner chassis mounting) to compensate for differences in the shield boxes of different models of receivers. The performance of the tuner, particularly on channels 7 and 8 will be impaired if the proper washers for the particular shield box involved are not used. Obviously then, if the r -f unit is removed for service, the washers should be replaced in the correct order when the unit is replaced. 11 240 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 ALIGNMENT TABLE THE DETAILED ALIGNMENT PROCEDURE BEGINNING ON PAGE 8 SHOULD BE READ BEFORE ALIGNMENT BY USE OF THE TABLE IS ATTEMPTED CONNECT SIGNAL CONNECT SWEEP CONNECT HET. MISCELLANEOUS STEP. SIGNAL GEN. SWEEP GEN. HETERODYNE METER CONNECT CONNECTIONS No. GENERATOR FREQ. GENERATOR FREQ. FREQ. METER FREQ. "VOLTOHMYST" AND TO MC. TO MC. TO MC. TO INSTRUCTIONS ADJUST REFER TO R -F UNIT ALIGNMENT 1 Disconnect the co -ax link from terminal 2 of the r -f unit terminal board and connect a 39 ohm composition resistor between lugs 1 and 2. Detune T1 by backing the core all the way out of the coil. Back the L44 core all the way out. Back the L203 core all the way out. In order to align the r -f tuner, it will first be necessary to set the channel 13 oscillator to frequency. The shield over the bottom of the r -f unit must be in place when making any adjustments. 2 Not used Not used Loosely coupled 236.75 Not used to r -f oscillator MC. Fine tuning 30 de- grees clockwise from CI for an audible beat on het. freq. meter Fig. 7 mechanical center of its range. Receiver on channel 13. 3 " Connect "Volt- Turn AGC control Adjust the bias box Omhinmayls3t" otof ttehre- fully clockwise. Connect bias box to ter- potentiometer for -3.5 volts. r -f unit terminal minal 3 of r -f unit board term. board 4 Antenna 181.25 Antenna Sweep- Not used - Not used Rec. on chan. 8. Connect oscilloscope to TP1. Fig. 7 terminal (loosely) 185.75 terminals ing (see text for channel Adjust C9, C11, C16 and C22 for correct curve shape, frequency and band width. C22 is Fig. 8 precaution) 8 adjusted to give max. amplitude between markers. C9 affects tilt and C16 affects the frequency of response. C11 affects the re- sponse band width. 5 Not used Not used Not used Loosely coupled 108.75 to r -f oscillator Rec. on channel 6 1,5 for audible beat on het. freq. meter. Fig. 8 - 6 Antenna terminal (loosely) 83.25 87.75 Antenna Channel Not used terminals 6 (see text for precaution) " Rec. on chart. 6. Adjust L42, 1,45 and L49 for Fig. 12 proper response. L42 is adjusted to give max. amplitude between markers. L45 primarily affects tilt and 1,49 primarily affects freq. of response. If necessary, retouch C11 for proper width. - - - 7 Not used Not used Not used Connect "Volt- Rec. on channel 6 Ohmyst" to r -f unit test point TP1 Adjust C7 for -3.0 Fig. 7 volts at the test point Fig. 9 8 Repeat above steps until the specified conditions are obtained. - 9 Not used Not used Loosely coupled 206.75 to r -f oscillator Rec. on chan. 8 Cl for audible beat on het. freq. meter Fig. 7 - 10 Antenna terminal (loosely) 181.25 185.75 Antenna Sweep- Not used terminals ing (see te-t for channel precaution) 8 Not used Rec. on chart. 8. Readjust C9, C16 and C22 for correct curve shape, frequency and band Fig. 7 Fig. 12 width. Readjust C11 only if necessary. (8) - 11 211.25 " Sweep- Not used 215.75 ing channel 13 Not used Rtuedce. obnectwhaene.n13m. aArdkjeursst ,1o.5v2efrosrhmooatx.aamlipttllie- Fig. 7 Fig. 12 mAodrjeustht aCn2r2eqtuoirreedgatoinremacahxm. aamx.prleistupodnesoe.f (13) response. - 12 215.75 Not used Loosely coupled 236.75 to r -f oscillator Receiver on chart. 13. Adjust 1.43 for correct channel 13 osc. freq. then overshoot. Reset Fig. Fig. 7 8 the osc. to proper freq. by adjustment of Cl. - 13 " 205.25 209.75 channel Not used 12 Antenna terminals (see text for 17181.25 ""cchhaann""nneell---- """ 14 " 199.25 precaution) 203.75 11 Connect "Volt- Rec. on chan. 12 Ohmyst" to r -f unit test point TP1 Rec. on chan. 11 Check to see that re- Fig. 8 sponse is correct and Fig. 12 -3.0 volts of osc. in jection is present Fig. 12 (11) 15 " 193.25 197.75 channel " 10 Rec. on chan. 10 Fig. 12 (10) 16 187.25 " channel " 191.75 9 " Rec. on chan. 9 " Fig. 12 (9) " " Rec. on chan. 8 " Fig. 12 185.75 8 (8) 18 " 175.25 " channel " - " Rec. on chart. 7 " Fig. 12 179.75 7 (7) 19 If the response of any channel (steps 3 through 18) is below 80% at either marker, repeat step 10 and adjust C9, C11, C16 and C22 as necessary to pull response up on the low channel yet maintain correct response on channel 8. If C22 required adjustment, the adjustment should be overshot a small amount and corrected by adjustment of L52 to give maximum amplitude of response between the sound and picture carrier markers. 20 Repeat step 9. If the oscillator is off frequency overshoot the adjustment of Cl and correct by adjusting 1.43. 21 Repeat steps 13 through 20 until all requirements are obtained. 22 Not used - Not used - Loosely coupled 108.75 to r -f oscillator Rec. on chan. 6 1,5 for zero beat on Fig. 8 het. freq. meter 23 Antenna terminals 83.25 Ant. fermi- Sweeping Not used 87.75 nabs (see text channel (loosely) for precaution) 6 24 Not used - Not used - Not used 25 Antenna 77.25 Ant. fermi- channel " terminals 81.75 nabs (see text 5 (loosely) for precaution, - Not used Observe response. I necessary readjust L42, L45 and L49. It should not be necessary to Fig. 7 Fig. 12 touch C11. - Connect Ohmyst" "toVothlte- r -f unit test point Check ace. injection. If necessary adjust C7 to give -3 volts. If C7 is adjusted, switch to channel 8, and readjust C9 for proper re- Fig. 7 Fig. 12 TP1 spoilse then repeat step 23. - " Rec. on chan. 5 Check to see that re- Fig. 12 sponse is correct and I (5) -3.0 volts of oec. in jection is present 11 12 243 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 TOP AND BOTTOM CHASSIS ADJUSTMENTS L203 FM TRAP L42 L52 0 C7 (*OSCILLATOR INJECTION FINE TUNING CONTROL 3:2 CHANNEL SELECTOR SWITCH 5101 TV-PHONO SWITCH RATIO DET. TRANS. SND TRANS. (4.51,1011,)vmP\1CXAOTsFc"T..i.NIL5Vn3ER°T1.0207861It0*!8F"IX11(90)66C86n2aSbPIXL)T1:1520'2I5.--7F251TMR,2ACPNISX. I -F AMP 6AU6 117 SND I -F 4Th P1%I-F PIX If 6,Tcc\E, TR24.2SMC TRU-SSIC 6C86-111.1 PIX I -F \f(_../(4P [1%14 6AV6-AUDIO 111111N\ 6AAUM6P-AG/C*N/9M71\ HOVILTSYZNYC NSECP V110 6A67 VIDEO AMP 27.0014C Figure 15-Top Chassis Adjustments 5102 R109/ ON -OFF SWITCH A VOL. CONTROL FINE TUNING CONTROL CHANNEL SELECTOR SWITCH 5101 TV-PHONO SW S102 -R109 ON -OFF SWITCH 11. VOL. CONTROL 6AV6 010 AMP! 7105 V107 0 14%) I.TAP (CC 6V6i I.F AMP. Mal 1ST PIX I -F r", 7106 V1011 -CPI r ) C184 TIO7 1139 /1,2AUD, Da AVERT. SYNC -/SER RATTRIAONDSEI T:1,0.41P [T102 4C)22.4.. (SND 14) V1125) .SMCj U6 %'/ SND. I -F AMU s..../ 103) ( DEV 6.111L1-RATIO c7.(K7. 61460T \ AUDIO OUTPUT Figure 16-Bottom Chassis Adjustments 15 244 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 TEST PATTERN PHOTOGRAPHS Figure 17-Normal Picture -4-444 Figure 18-Focus Magnet and Ion Trap Magnet Misadjusted 940111. -0 - Figure 19-Horizontal Linearity Control Misadjusted (Picture Cramped in Middle) Figure 20-Width Control Misadjusted 801100.-10. Figure 21-Horizontal Drive Control Misadjusted Figure 22-Transients Figure 23-Test Pattern Show- ing Out of Sync Condition When Horizontal Hold Control Is in a Counter -clockwise Position-Just Before Pulling Into Sync -e-.91641 Figure 24-Test Pattern Show- ing Out of Sync Condition Whex Horizontal Hold Control Is at the Maximum Clockwise Position 101041-0- 16 STEP No. 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 241 ALIGNMENT TABLE 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 CONNECT SIGNAL GENERATOR TO - Antenna terminals (loosely) SIGNAL GEN. FREQ. MC. CONNECT SWEEP SWEEP GEN. GENERATOR FREQ. TO MC. CONNECT HETERODYNE FREQ. METER 67.25 71.75 Ant. termi channel Not used nals (see text 4 for precaution) HET. FREQ. METER MC. -Rec. " 61.25 channel ' MISCELLANEOUS CONNECT CONNECTIONS "VOLTOHMYST" AND TO INSTRUCTIONS COohnmneycstt" "toVothlte- Rec. on chan. 4 r -f unit test point TP1 " on chart. 3 65.75 3 " 55.25 " channel - " Rec. on chart. 2 59.75 2 ADJUST REFER TO Check to see that response is correct and -3.0 volts of osc. injection is present " " Fig. 12 (4) Fig. 12 (3) Fig. 12 (2) Likewise check channels 7 through 13 as outlined in steps 18 back through 13, stopping on channel 13 for next step Antenna 215.75 Not used terminals - Loosely coupled 236.75 Not used to r -f oscillator Fine tuning 30 de- Cl for zero beat on Fig. 7 grees clockwise from het. freq. meter mechanical center of its range. Receiver on channel 13 " 209.75 " " 203.75 " " 197.75 " 191.75 - -- " " 230.75 224.75 " 218.75 212.75 " Rec. on chan. 12 Rec. on chart. 11 Rec. on chart. 10 Rec. on chan. 9 L11 as above L10 as above L9 as above L8 as above Fig. 8 Fig. 8 Fig. 8 Fig. 8 .. 185.75 - " 206.75 Rec. on chan. 8 L7 as above Fig. 8 179.75 - " 200.75 " Rec. on chan. 7 L6 as above Fig. 8 .. " " 71.75- 87.75 ., 81.75 - " " " " 65.75 - 108.75 102.75 92.75 " 86.75 " Rec. on chan. 6 Rec. on chan. 5 Rec. on chan. 4 Rec. on chart. 3 L5 as above L4 as above L3 as above L2 as above Fig. 8 Fig. 8 Fig. 8 Fig. 8 " 59.75 " - 80.75 " Rec. on chan. 2 LI as above Fig. 8 Repeat steps 30 through 41 as a check Antenna terminals 181.25 Antenna 185.75 terminals Sweep- Not used ing channel - 8 Rec. on chan. 8. Oscilloscope at test point Fig. 12 TP1. Adjust T1 clockwise. When properly (8) adjusted, curve will be slightly wider with a slightly deeper valley in top. Switch through all channels at this time. However, if C7 and observe response, oscillator injection and or C9 are changed appreciably, then a recheck r -f oscillator frequency. Minor touch-ups of the oscillator frequency on all channels sohfoaudldjusbtemmenatdsem. ay be made Remove 39 ohm resistor and reconnect link from T101 to terminal 2 of r -f unit terminal board. PICTURE I -F AND TRAP ADJUSTMENT STEP No. 46 CONNECT SIGNAL GENERATOR TO Not used 47 " 48 Mixer grid test point TP2 in series with 1500 mmf. 49 " 50 51 52 Connected loosely to diode probe SIGNAL GEN. FREQ. MC. 24.25 25.5 22.75 27.00 Various See Fig. 13 CONNECT SWEEP GENERATOR TO Not used " " " Mixer grid teat point TP2 in series with 1500 mmf. SWEEP GEN. FREQ. MC. - - - 20 to 28 mc CONNECT OSCILLOSCOPE TO Not used CONNECT "VOLTOHMYST" TO Junction of R142 & R143 " Test point TP1 " Pin 4 of V110 and to ground " " " Scope diode probe to pin 5 of V106 and to gnd. Connect a 180 ohm resistor from pin 5 of V106 to pin A of T105 " " " Junction of R142 & R143 MISCELLANEOUS CONNECTIONS AND INSTRUCTIONS ADJUST REFER TO Connect biasbox to junction of R142 & Afodrjus-t5p.o0tenvtoioltms etoenr Fig. 3 R143 and to ground meter AGC fully clockwise Connect bias bo"x toFig. 7 TP1 and to ground Bias boxes con- T107 (top) for max. Fig. 9 nected as above T106 (top) for max. " T105 (top) for max. " T104 (top) for min. Shunt terminals A and B of T106 and T107 with 330 ohms. Set C115 to min. Ad- just bot. Tflotropmaanxd. Tg1a0in4 Bias boxes connected with 25.5 mc. at 70%. as above. .3v p -p on C115 for 22.5 at 70% scope Fig. 9 Fig. 9 Fig. 9 Fig. 7 Fig. 10 53 Connected loosely Various " to grid Adjust offloert psimx ai-lfl. See Fig. 14 marker indication. " Connect scope to pin 4 of V110. Remove shunt & diode probe used above Remove shunts from T106 & T107 Retouch T105, T106 raensdpoTn1s0e7sthooowbntaiinn Fig. 14 Fig. 14 RATIO DETECTOR. SOUND I -F AND 4 5 MC TRAP ALIGNMENT 54 Grid let Snd. I -F 25.50mc. (pin 1, V101) or mod. by Not used WR39B or C con- 4.5 mc. rtect to grid 3rd pix I -F (pin 1, V108) 55 .. - Not used - Pin 2 of V103 Set signal gen. to T102 top core for max. Fig. 9 give 6V on meter d -c on meter " "VoltOhmyst" to junction R106 and C108. Fig. 9 Adjust T102 bottom core for zero DC on Fig. 10 meter. Repeat steps 54 and 55 until all conditions are satisfied. 56 Sig. Gen. to 1st 4.5 mc. Snd. I -F grid - " " Signal generator T101 top core for max. Fig. 9 output adjusted to DC on meter provide 6 v on meter 57 Sig. Gen. in series 4.5 mc. " with 1000 ohms to mod.30% pin 2 of V109 with 400 cy. - Diode probe to Not used pin 8 of V110 Short pin 1 of V108 to ground mAdujumst Lo1u03tpfourtmoinni- Fig. 9 oscilloscope ALIGNMENT DATA 242 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 C7 OSCILLATOR INJECTION ON THIS SIDE C25 TEST FINE POINT TUNING TP2 TEST POINT TPI C22 ok R -F GRID CIS R -F PLATE 1.52 CI 05C. Irkt *PI ,AxP4ki4, C9 M/XER GRI L44 IN Vil"1111 BAND oAWIDTH FRECI 0441 I L42 IN BACK !. T1 CONVERTER TRANS. OVVI 0)) : L49 L45 Figure 7 -R -F Unit Adjustments .111.111.6 O foA fiA L3-CHAN. 4 L4 CHAN. LS CHAN. 6 Figure 1 1 -R-1: Response /A/12Vcvlu13 Figure 8 -R -F Oscillator Adjustments PAD FOR 5011 COAX. PAD FOR 7241. COAX. PAD FOR 300n. BAL INPUT 4741 So on BALANCED OUTPUT 300 IL BALANCED OUTPUT 4711 ..431164 4741 300.11. BALANCED OUTPUT Figure 9 -Sweep Attenuator Pads 22.25MC 70% 25.5 MC 70% 27.0 MC Figure 12 T1 and T104 Response Figure 13 Over-all I -F Response SHOULDER ---y AT 52 N.C. C. 160 MC. 100% RESPONSE 50 MC. AT 60% ±15% RESPONSE POINT Cv 123 Figure 10 -Antenna Matching Unit Response 14 INCORRECT cuss CORRECT Figure 14 -Horizontal Oscillator Wave Forms SERVICE SUGGESTIONS 245 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 Following is a list of symptoms of possible failures and an indication of some of the possible faults: NO RASTER ON KINESCOPE: (1) Incorrect adjustment of ion trap magnet. Magnet reversed either front to back or top to bottom. (2) V115 or V116 inoperative. Check waveforms on grids and plates. (3) No high voltage-if horizontal deflection is operating as evidenced by the correct waveform on terminal 1 of high voltage transformer, the trouble can be isolated to the 1B3GT circuit. Either the T111 high voltage winding is open, the 1B3GT tube is defective or its filament circuit is open. (4) V110 circuit, inoperative-Refer to schematic and waveform chart. (5) Damper tube (V118) inoperative. (6) Defective kinescope. (7) R184 open. (8) No receiver plate voltage-filter capacitor shorted-or filter choke open. NO VERTICAL DEFLECTION: (1) V113 or V114 inoperative. Check voltage and waveforms on grids and plates. (2) T108 open. (3) Vertical deflection coils open. SMALL RASTER : (1) Low Plus B or low line voltage. (2) V116, V120 or V121 defective. POOR VERTICAL LINEARITY: (1) If adjustments cannot correct, change V114. (2) Vertical output transformer T108 defective. (3) V113 defective-check voltage and waveforms on grid and plate. (4) C151, C153, C152, C155, or C156 defective. (5) Low plate voltage-check rectifiers and capacitors in supply circuits. (6) If height is insufficient, try changing V113. POOR HORIZONTAL LINEARITY: (1) If adjustments do not correct, change V116, or V118. (2) T108 or L108 defective. (3) C176 or C177 defective. WRINKLES ON SIDE OF RASTER : (1) C181 defective. (2) Defective yoke. PICTURE OUT OF SYNC HORIZONTALLY: (1) T110 incorrectly tuned. (2) R192, R193 or R170B defective. TRAPEZOIDAL OR NON SYMMETRICAL RASTER: (1) Improper adjustment of centering of focus magnet or ion trap magnet. (2) Defective yoke. RASTER AND SIGNAL ON KINESCOPE BUT NO SOUND: (1) L102 defective. (2) Sound i-f, ratio detector or audio amplifier inoperative- check VI01, V102, V103 and their socket voltages. (3) Audio system defective. (4) Speaker defective. SIGNAL AT KINESCOPE GRID BUT NO SYNC: (1) AGC control 8149 misadjusted. (2) Viii, inoperative. Check voltage and waveforms at its grid and plate. SIGNAL ON KINESCOPE GRID BUT NO VERTICAL SYNC: (1) Check V113 and associated circuit. (2) Integrating network inoperative-Check. (3) VIO9B or V112B defective or associated circuit defective. (4) Gas current grid emission or grid cathode leakage in V112. Replace. SIGNAL ON KINESCOPE GRID BUT NO HORIZONTAL SYNC: (1) T110 misadjusted-readjust as instructed on page 11. (2) V112 inoperative-check socket voltages and waveforms. (3) T110 defective. (4) C142, C161A, C163, C165, C167, C166, C168, C187 or C188 defective. (5) If horizontal speed is completely off and cannot be adjusted check R192, R193, R170B, R196, R195 and R198. SOUND AND RASTER BUT NO PICTURE OR SYNC: (1) Picture, detector or video amplifier defective-check V109A and VI10-check socket voltages. (2) Bad contact to kinescope cathode. PICTURE STABLE BUT POOR RESOLUTION: (1) V109A or V110 defective. (2) Peaking coils defective-check resistance. (3) Make sure that. the focus control operates on both sides of proper focus. (4) R -F and I -F circuits misaligned. PICTURE SMEAR. (1) R -F or I -F circuits misaligned. (2) Open peaking coil. (3) This trouble can originate at the transmitter-check on another station. PICTURE JITTER: (1) AGC control R149 misadjusted. (2) If regular sections at the left picture are displaced change V116. (3) Vertical instability may be due to loose connections or noise. (4) Horizontal instability may be due to unstable trans- mitted sync. RASTER BUT NO SOUND, PICTURE OR SYNC: (1) Defective antenna or transmission line. (2) R -F oscillator off frequency. (3) R -F unit inoperative-check Vl, V2. DARK VERTICAL LINE ON LEFT OF PICTURE: (1) Reduce horizontal drive and readjust width and horizontal linearity. (2) Replace V116. LIGHT VERTICAL LINE ON LEFT OF PICTURE: (1) V118 defective. 17 246 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Figure 25-Overall Pix I -F Response .4-444 Figure 26-Response of T1 -T104 Pix I -F Transformers 22.75 MC. CVI62C Figure 27-Response of T105 Pix I -F Transformer Figure 28-Response of T106 Pix I -F Transformer Figure 29-Response of T107 Pix I -F Transformer Figure 30-Video Response at Average Contrast Grid of Video Amplifier (Pin 2 of V110) (6CL6) Voltage Depends on Picture Figure 31-Vertical (Oscilloscope Synced to 1/2 of Vertical Sweep Rate) (1.5 Volts PP) -*-40(4- Figure 32-Horizontal (Oscilloscope Synced to 1/2 of Horizontal Sweep Rate) (1.5 Volts PP) Plate of Video Amplifier (Pin 6 of V110) (6CL6) Voltage depends on picture Figure 33-Vertical (85 Volts PP) Figure 34-Horizontal (85 Volts PP) WAVEFORM PHOTOGRAPHS Taken from RCA W 058A Oscilloscope 247 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 CV163 A Grid of Horizontal Sync Separator (Pin 1 of VI124) (65N7) Voltage depends on picture Figure 35-Vertical (85 Volts PP) Figure 36-Horizontal (85 Volts PP) 3404*--0,- Cathode of Horizontal Sync Sep. (Pin 3 of V1124) (6SN7) Figure 37-Vertical (7.5 Volts PP) CV163 C Figure 38-Horizontal (5 Volts PP) Plate of of Horizontal Sync Separator (Pin 2 of V1124) (6SN7) Figure 39-Vertical (45 Volts PP) 4-444 Figure 40-Horizontal (45 Volts PP) -71 CV163F Grid of Vertical Sync Sep. (Pin 7 of VI09B) (124U7) Figure 41-Vertical (55 Volts PP) -4-444 Figure 42-Horizontal (55 Volts PP) Plate of Vertical Sync Sep. (Pin 6 of VIO9B) (124U7) Figure 43-Vertical (65 Volts PP) -4--4444 Figure 44-Horizontal (65 Volts PP) 19 248 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope Grid of Sync Output (Pin 4 VII2B) (6SN7) Figure 45-Vertical (40 Volts PP) Figure 46-Horizontal (40 Volts PP) Plate of Sync Output (Pin 5 of V112) (6SN7) Figure 47-Vertical (47 Volts PP) Figure 48-Horizontal (47 Volts PP) CV 341.110 -0 - Figure 49-Grid of Vertical Sweep Osc. (Pin 5 of V113) (6J5) (30 Volts PP) -4-44* Figure 50-Plate of Vertical Sweep Osc. (Pin 3 of V113) (100 Volts PP) Figure 51-Grid of Vertical Sweep Output (Pin 5 of V114) (61(6) (100 Volts PP) 4-44* Figure 52-Plate of Vertical Sweep Output (Pin 3 of V114) (6K6) (715 Volts PP) 38400.-1.. Cathode of Kinescope (Pin 11 of V119) (17QP4) Voltage depends on picture Figure 53-Vertical -4--44* Figure 54-Horizontal 104,40.-1. 20 CVIS4111 WAVEFORM PHOTOGRAPHS Taken from RCA W058A Oscilloscope 249 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 Figure 55-Grid of Horizontal Oscillator Control (Pin I of VI15) (6SN7GT) (19 Volts PP) 4 Figure 56-Cathode of Horizontal Oscillator Control (Pin 3 of V115) (6SN7GT) (1.2 Volts PP) -0400.-10. Figure 57-Grid of Horizontal Oscillator (Pin 4 of VI15) (6SN7GT) (330 Volts PP) Figure 58-Plate of Horizontal Oscillator (Pin 5 of V115) (6SN7GT) (140 Volts PP) 111.00.-0. Figure 59- Terminal "C" of T110 (150 Volts PP) 4 Figure 60-Grid of Horizontal Output Tube (Pin 5 of VI16) (68(26) (90 Volts PP) 3/440 -0, - Figure 61-Plate of Horizontal Output (Approx. 4000 Volts PP) (Measured Through a Capacity Voltage Divider Connected from Top Cap of V116 to Ground) .4-4414 Figure 62-Cathode of Damper (Pin 3 of VI18) (6W4GT) (2350 Volts PP) )114411.-4. Figure 63-Plate of Damper (Pin 5 of V118) (6W4GT) (160 Volts PP) .4-444 Figure 64-Plate of AGC Amplifier (Pin 5 of V111) (6A06) (560 Volts PP) CV 165J 250 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 VOLTAGE CHART The following measurements represent two sets of conditions. In the first condition, a 15000 microvolt test pattern signal was fed into the receiver, the picture synced and the AGC control properly adjusted. The second condition was obtained by removing the antenna leads and short circuiting the receiver antenna terminals. Voltages shown are read with a type WV97A senior "VoltOhmyst" between the indicated terminal and chassis ground and with the receiver operating on 117 volts, 60 cycles, a -c. The symbol < means less than. Tube Tube No. Type Function Operating Condition E. Plate No. Volts E. Screen Pin No. Volts VI 616 Mixer 15000 Mu. V. Signal 2 - 153 - No Signal - - 2 135 VI 6J6 R -F 15000 Mu. V. Oscillator Signal 1 - 100 - No Signal - - 1 85 R -F 15000 Mu. V. V2 6CB6 Amplifier Signal 5 260 6 150 No Signal 5 220 6 100 1st Sound 15000 Mu. V. V101 6AU6 I -F Amp. Signal 5 130 6 142 No Signal 5 116 6 129 2d Sound 15000 Mu. V. V102 6AU6 I -F Amp. Signal 5 131 6 148 No Signal 5 110 6 120 Ratio V103 6AL5 Detector 15000 Mu. V. Signal 7 0 -- No Signal - - 7 0.7 1st Audio V104 6AV6 Amplifier 15000 Mu. V. Signal 7 87 - - Audio V105 6K6GT Output No Signal - 7 76 - 15000 Mu. V. Signal 3 260 4 263 No Signal 3 250 4 251 1st Pix. I -F 15000 Mu. V. V106 6CB6 Amplifier Signal 5 246 6 258 No Signal 5 108 6 108 2nd Pix. I -F 15000 Mu. V. V107 6CB6 Amplifier Signal 5 242 6 255 No Signal 5 108 6 108 3rd Pix. I -F 15000 Mu. V. V108 6CB6 Amplifier Signal 5 133 6 172 No Signal 5 115 6 162 Picture V109A 12AU7 2d Det. 15000 Mu. V. Signal 1 -8.4 - - No Signal - - 1 -1.8 Vert. Sync 15000 Mu. V. V109B 12AU7 Separator Signal 6 71 - No Signal *50 6 to 100 - E. Cathode E. Grid Pin Pin No. Volts No. Volts *_3 7 0 5 to -5 --3 7 0 5 to -5 -3 7 0 6 to -5 -3 7 0 6 to -5 Notes on Measurements *Depending on channel *Depending on channel *Depending on channel *Depending on channel 2 1 -5.8 2 1.0 1 -0.1 7 0.8 1 0 7 0.6 1 0 7 0 1 -5.1 *Unreliable measuring point. 7 0 1 *-0.3 Voltage depends on noise. - - 1 12 7.5 kc deviation at 1000 cycles 1 - *5.1 - *Unreliable measuring point. Voltage depends on noise. 2 0 1 -0.7 At min. volume 2 0 1 -0.6 At min. volume 8 19 5 -0.7 At min. volume 8 18.5 5 -0.7 At min. volume 2 <0.1 1 -8.6 *Unreliable measuring point. 2 0.7 1 -0.2 Make measurement at T104 -B 2 <0.1 1 -8.6 2 0.5 1 -0.2 2 2.1 1 0 2 1.9 1 0 3 0 2 -1.3 3 0 2 -0.6 8 0 7 -40 0 7 -15 *Unreliable, depends on noise 22 VOLTAGE CHART 251 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 Tube No. V110 * V111 V112A V112B V113 V114 V115 V115 V116 V117 V118 V119 V120 V121 Tube Type Function Operating Condition E. Plato pin No. Volts E. Screen Pin No. Volts 6AG7 (6AC7, 6CL6) Video Amplifier 15000 Mu. V. Signal 6 130 8 149 Refer to schematic for pin connections No Signal 6 110 8 130 AGC 15000 Mu. V. 6AU6 Amplifier Signal 5 -40 6 250 No Signal 5 +2.3 6 258 Hor. Sync 15000 Mu. V. 6SN7GT Separator Signal 2 - 263 - No Signal - - 2 258 Sync 6SN7GT Output 15000 Mu. V. Signal 5 58 - - No Signal - - 5 48 6J5 Vertical 15000 Mu. V. Oscillator Signal 3 70 - - No Signal - - 3 68 Vertical 15000 Mu. V. 6K6GT Output Signal 3 265 4 270 No Signal 3 253 4 260 Horizontal 15000 Mu. V. 6SN7GT Osc. Control Signal 2 - 165 - No Signal - 2 160 Horizontal 15000 Mu. V. 6SN7GT Oscillator Signal 5 - 185 - No Signal - - 5 170 Horizontal 15000 Mu. V. 6BQ6GT Output Signal Cap 4 180 No Signal Cap 4 170 1B3GT H. V. 8016 Rectifier 15000 Mu. V. Signal Cap -- No Signal Cap -- 6W4GT Damper 15000 Mu. V. Signal 5 - 270 - No Signal - - 5 260 15000 Mu. V. 21AP4 Kinescope Signal Cap 14,000 10 400 No Signal Cap 13,600 10 385 - 5U4G 5Y3GT Rectifiers 15000 Mu. V. Signal 4 & 6 - - - - - No Signal 4 & 6 E. Cathode Pin No. Volts 1 0.2 1 0.5 E. Grid Pin No. Volts 4 -1.3 4 -0.6 Notes on Measurements AGC control set for normal operation *Refer to Fig. 67 for socket connections 7 153 1 151 7 135 1 105 3 190 1 130 3 138 1 110 6 0 4 -2.1 6 0 * 4 +0.6 *Depends on noise *Depends on setting of Vert. 8 0 5 -15 hold control Voltages shown are synced 8 0 5 -14 pix adjustment 8 30 5 -5 8 28 5 -5 3 +1.5 1 -21 3 -10 1 -24 6 0 4 -80 6 0 4 -88 8 21.2 5 -13 8 21.0 5 -13 - 2 & 7 14,000 - - - 2 & 7 13,600 3 -- 3 -- *High Voltage Pulse Present *High Voltage Pulse Present *High Voltage Pulse Present *High Voltage Pulse Present *High Voltage Pulse Present *High Voltage Pulse Present 11 170 2 120 At average Brightness 11 150 2 115 - - 2 & 8 285 - - 2 & 8 275 At average Brightness 23 252 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 R -F UNIT WIRING DIAGRAM TO 0203 C203 ANIINNA M.'"NO UNIT TO TV CHASSIS /DCt TO T104 I 1 t.3., TI L I ) II Q'T 45 nr I 31- D 7 0 3 !.'. /.1 'A .0. 142 U5' 0WITCO CoNNEC0005 AS SHOWN ART (011) FOGO 0142c1..10i ARROWS ORN ROD ; *e 6477 51-C FRONT O C. -J 00 r 1:N -t ** 11.:;* ',a 4.4,1_ I U 1.4 C19 (C--727-1 I.50 1,0 CLAMS) C2a Ib C25 048 OTP1 TOOT C16 CONN. (TOP) C15 C14 046 I Figure 65-KRK-8D R -F Unit Wiring Diagram CRITICAL LEAD DRESS: 1. Keep all wiring in the pix i-f, sound i-f and video circuits as short as possible. 2. Keep the leads on C118, C120, C122, C124, C126, R114, 8121 and R123 as short and direct as possible. 3. Do not run any leads under C115 trimmer capacitor. 4. Dress C118 vertically parallel to terminals A and B of T104. Dress C135 parallel to terminals A and B of T104 close to the chassis. 5. Keep C127 away from chassis with no more than 1/4 inch leads at each end. 6. Dress the lead from T105(C) to the terminal board, close to the chassis. 7. Keep all filament leads dressed close to the chassis. 8. Ground filaments of V106, V107 and V108 independently of tube shields (pin 8). Use ground lances provided near pins of each socket. 9. Dress lead from pin 5 of V110 to 1102-2 close to the chassis. 10. Keep leads to L103 as short as possible. 11. Dress L102, L104, L105, L114, C130, R131, R133, R135, R139 and C132 away from the chassis. 12. Do not tape kinescope cathode lead in with other kinescope leads. 13. Do not change the bus wire connections to pin 2 of V101 and V102. Sleeving is used to insure length and to prevent shorting. 14. Keep leads on C136 short and direct. Dress the lead from C136 to pin 5 of V111 as shown in wiring diagram. 15. Do not dress C170 in such a position that adjustment of T110 is inaccessible. 16. Keep the leads on R201 as short and direct as possible. 17. Dress the lead from pin 3 of V113 to C153 as shown in the wiring diagram. 18. Mount C183 directly on the terminal board provided keeping it as far away from T109 as possible. 19. Dress all leads in the high voltage compartment away from each other and away from the high voltage transformer. 24 CHASSIS WIRING DIAGRAM 253 -259 21T207, 21T207G, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 Ter UNIT ice,r R -F UNIT -1412198D CIRCUIT SCHEMATIC DIAGRAM 255 -256 21.11,72TIM,TRA,217414 GAVE 61IST au 01. Firma 66-Cbassis Wiring Diagrams 25 26 o.cir.- s 101 t yam PRODUCTION CHANGES IN KCS72A The schematic 0 shown in the latest condition. The notes below tell how early receivers differed Prow the schematic shown alocrve. In some receivers, C27 woe omitted. In some receivers, CC130 woe 120 naml. In some receivers, C189 woe omitted. In some receivers, 812 was 8200 ohms. In some receivers, 8126 was 220,000 ohms and wae acted bbeettwweeeenn the junction of V109A pin 1 and C187, and the id AGC buss. In some receivers, 11131 was 3303 ohmd. In some receivers, 11132 was 47,000 ohm.. TfriesoK tt tie W03 Of, Itine In some receivers, 0133 was 27.000 ohms. In some receivers, 11135 was 12,000 ohms. M111` Xt.r,S14.4',(11 In some receivers. 11182 was 970 ohms. In some receivers, /1183 was 100,000 ohms. In some receivers, /1185 was 56,000 ohms. 1,41WAre"cLZ=rliotir/Igt""*". In some receivers, 11185 was 100,000 ohms. In some receivers, 8185 was omitted. In some receivers, 0218 was omitted. In some receiver, 11219 woe omitted. In some receivers, V119-10 was connected to the junction of 5171 and C183. In some receivers, 0110 used 6AC7 tote. All resistance values in ohms. K -. 1000. KCS72A-M1 chassis uses 6AG7 video liher. am1p1 C572A-M2 chassis uses 6CL6 video amplifier. All capacitance values less than 1 in MT and above 1 in MIGunlessothenvisenoted. Model 217207G uses glass KinescoPe 21E24. D.eclions of arrows at controls indicates clockwise rotation. All voltages measured with "Volt. Ohmyst" and with no signal input. Volt. ages should hold within .20% with 117 v. a -c supply. 27 28 Figare 62-Ciramis K672A Cirrail Scbeinisik Diagram 257 21T207, 21T2070, 21T208, 21T217, 21T218, 21T227, 21T228, 21T229 REPLACEMENT PARTS 374K DESCRIPTION 70188 76845 79201 76969 71098 76968 75200 asms 79196 9199 76691 ?SIN 73798 9089 79473 76171 71909 75184 .6amea .174 Rel. UNIT ASSEMBLIES MOOD Board -Terminal boa.. 9 contact and ground Br.an-ertical bracket for holding omUlator tube Cable -76 ohm corm cable ("9') complete with can (wk. MO) variable. for fine *mina -plunger CajwitegiTCerarnic. Capacitor-H..a.a 1..1, 0,6 mmf. (027) caoa61tor-Caramic, 3 rnra. (09) opmftor-Ceramic, la nn!. (C29) c000606. -c.1/26., Is enna. (C9) apacitor-c........ a. 7801. (C0) Capacitor -Ceramic, 270 mral. (C12, C13. Cli. Capacitor -Ceramic, 300 mmf. (CIO) Capaaltor-Gramic, 1900 rmnf. (08, 019.013.10) Capacitor -Gram*, moo 6,6.e. /cm, ca./ Capaoltor-Cerarnic, a..1 Isoo ara. (C17A, C1773) Capacitor-c.rmeni.. a000 6661. (cm) Comiter-Tubular. steatite. adja4tat.14. 0.65-1.2 ramE. Capaciter-Cemunia 0.68 ntrnf. (C.) Oczaz,itos,-,.azlitcaoktable. 0.76-4 ram*. contple1/2 Capacitor -Ceramic. 6.6 mmf. (C8) eapaaitor-Adf vetch's, 7-30 rratlf. maa) Capacitor -Ceramic, trimmer, 00-75 rim[. (C.) 73477 oil -Choke coil (L51) 79102 Coil -Choke col..98 muh (L46) ..ir!:e= 'la-Ott:At" (--- ")778`) 07, 78)"!:T0.1.citio.g.:fi774Fr.=)(1.trtt:TIltitteirnt).;Zint.../ 76460 point contact 76966 COoArod- juetable core for 6ne tuning CapaeLlOr 75162 DetentDetent mechanism and fibre shaft 73453 Form-CMI form for L95. L49 75169 Link -Link assembly for One tuning 78510 Plae-Front plate and shaft bearing 503027 503068 504115 swan 503239 6032.47 939310 608312 604410 1.43 761. 79177 79176 27 ohms. *1096, 1/2 watt IRS) 68 ohms. .10%. 9 watt (R13) 250 eh... +20%. 1/2 ...37 (RIO) 2203 ohms. *10%. 1/2 watt (R6) .0 ohms. *10%. 1/2 watt (R9. R11) 4700 ohm., 310%.'h watt (RI2) 10000 ohms. *5%. 1/2 watt (R3) 10.000 ohms, 820%. 1/2 watt (R2) aa,oco ohm.. *10%. 1/2 waatt Se7) 1110,000 ohms. *110%. 1/2 watt (RI, R4. F. RetainmFine tuning shaft retaining ring Rod-ActuoUng faunae, rod (M em) for fine tuning SM. lell Screw -0440e 1/21 adjusting enema for LI, L1, 4.3, L4, L. Screw-Pl.. %a. adjusting screw for L9 6 70,,C If K DESCRIPTION 73640 Bony -84-40 a Ms' ad1usting screw for 162 7439 Serew-e4.40 a .399. adjusting screw for 141 76910 Shaft -Channel eelector shaft and plate 7mte shao_pocc tccicor occo and °478 7..9 MI'.t.,..-...111.."................ 76067 Shte1/2-Tub eMeld for VI, V2 79191 Spacer-Inwalating moose for front plate 79773 S7r187-FriethenPMng 07776.0 for fine tuning :ant 90340 Spring -Hair pin spring for fine tuning link 74578 Srin-Retaining sp*ng E oo adiaoting woo.. 73457 Spring -Return oaring for fine tuning control 7977* n°' 'tV,3-7-,.84;,zLrZ., TE6,iLtr9e7:,1L138Z, :cVm:I1V.1cR. 1I.V42r,i1-.r6tac)ri' '771.1,.I3?:LrIr4ALnISnLr1m6,rLa1a7l,aLlw16.(RLIO1,1L.2304, L72i1f,iLl1l4a9r) i, 78963 Stator-Osoillator section etater complete with rotor. 184 ' " 78T71.71.1...d.V317.1:67 L;371..;.711.7a71.71(17n3.141 ".E."iZr.iil':iStarLll2n..L:1ir..c.rTrit.i0r0(.igbl..(rL1a.o9i121.il*I.Et. 79170 Strip -Coll segment mounting strip-L.N. lower 79171 Stgrcrlo2 6arnent mounting trip-L.H. Upp....,... 76100 4" Stri-oll segment nIOUnting strip-R.N. center SiE71,Z.:FE:11.r..iiiiIrtiglii14:4.7?Wiidini.clitepitiiitrC.1 7544"11-71C.sralli0".m'iigii...,o0ez,t4J. L.ili.cjindi.onaZt.ost..7 76173 Stud -66.32a J Me...4),...., .dud t,,.. tMmmer C7 7,32, 8-----0.---- .a7 470.. (TI) 75190 76460 713454 71406 33098 333110 75450 73664 79437 76873 75298 47617 39639 73091 76476 Mb 73004 39644 76961 Waeher-Inoulating washer (rmommrm) M. te1Mme. 07 ONASSIS ASSEMBLIES NO072, Bracket -Channel Indicator lamp bracket .c*,. den bracket complete with insulator for apactor-Adjustable. mica, 5.70 tnntf. (C119) Capacitor -Ceramic. 10 mmf. (C127) Capacitor -Ceramic. 12 rnmf. (C162) Capacitor -Ceramic. 92 40402. (0103) Capacitor -Ceramic, 30 mmf. (0191) cif. (02447 Capacitor -Ceramic, 160 menf. (CM.) Capacitor -C....... 220 nu.. (0230)502310 Capacitor -Mica. aso srunf. (0146) Capacitor -Ceramic. 170 mm[. (0108 Capacitor-Mca, 270 mmf. (C130) 6666.6,-11/21/2/.. 270 .....e. (C140. CI.) Capacitor -Mica. 390 mmf. (C189. C175) Capacitor -Mica. 330 .arai. (C143) Capacitor -Mica. 390 ment. (C146) Capacitor -Mica. 470 atm!. (C10% C121) Capacitort-Cerarnic. BOO nnf.. 20.030 volts (0179) 29 258 REPLACEMENT PARTS (Continued) STOCK DESCRIPTION 'i Noc% DESCRIPTION 08220 73473 73960 NM. 7.11 79308 CaetaikvVw811..m2140000..1V,18, cum, 4700 mall. (0118. 0120, C121. 0123, Caslyr4s.a,,g.4tjr.11,4. Capacitor -Ceramic. 10,000 retra. (C104. C187) Capacitor -Ceramic, dual 10,000 nunf. (C101A, C101131 Capacitor-Elec7role717. 9 rn1d...mat (C7.) .0,,,,,c,,,,,,,_k0.,,.t,,,,0,,r0., ,c,,,,c0.0 0, 0 ...30 4ct .1-,,", 4er",74 76241 Coil -Antenna shunt coil maoa) 764. linear., coil complete .th adjustable Cort.11amlaita1 76441 Coll -Width coil complete with adjustable core (1406) 76640 Coil -Peaking cell (1I8 nu.) (.107) 76011 Coil -Peaking 6.1 (30 muh) (L101) 71927 Coil -Peeking coil (93 mull) (1.104) "8' c°"-'"i- °°' ''''' 7840 '7.4) ?St 'alY.:10-44,1t0.8(61A17ti.likrelaeF 75217 C717 -Mica trimmer. dual 10-160 ramf. (0181A. niii'i aeon ' CR.tilitittnl=erMiirgicl.,3t7ort7s70111C Capacitor 400 volt. -Electrolytic 1 motto of c ma isi 10*mfd. An 390 I section of IM d 1 .I.P) rrt8f 7' ao mfd.;50 vol. lC64A C10:11. C176.1C78 "'" tr... 71.t'rkc 00:130::::7:::::Vo rooknie=i)(700k. '7=411-tii1117militt::t.7.2:"."iii'i.t.- 77008 Connamtmrde connector complete with terminal 77977 "nn..ii. 7... Mii....n. i"*.7.7 C737,n1WaefV. 78979 Comao,t,d13,13,r,:.;0ttrZt1 paper. ell 1/266...6.6t.a. ,keck ot0 c.,,c,...,,,,,tca. .000 .,c,.., 01 ,,c0:0,7.,reaced4;,,),,cr. "ii" CWITXr..7..671;V:ie1t.snaliir ....r, .17 ....".."4. 786' 08g7.,11Lirdite". 77777. 7)) "878'8777' .'" 8'4- 95787 Connector-F.0n. i.p.t connector (1101/2 75474 contact male connector for masker Coonzor-Ilingle Z7177;i:''c'e.'ntacc7nnt.al''e"coIn'rec)ter for ,.......... 077" '.787'. "88."7"7"8""8 C7t7.:21:::;te 7(12,24 77133 Cameg,711,rae:,;,0zum101W paper, #11 impregnated, 7"" ,I) .487,.4867.0,'0'4 nini., C.g/t.;174-7Ciltiiiiiglelr.n 7367 oroc,!:47.;.,Tdvalcre, pager., co okgmanated, ...27 rnts., "7" *" i"'.......a. '°°27 ..7... 7"1"%gliit:ief;"(girar ygyg9 co ,p,.....t, kook cr, owc:.4.1.7(.,434,ouixtrcr, 60367 -6 contact female connector for yoke lead Coemar 7"" 787'. 4788.7777-7" ' "7..iii" C717.71...44Wig)7787740 control (R.. 71974: Ccontr,1-ACC 76448 76979 Contro1:RNM9'1. oct.1/2.4 710(717(.7") and vertical hold control (R1708. CortAiltorisontal 73040 717 iiii.."8.0.4, .°°47 "0" 0.603ttielL-;171.0i.i.C.ii8c;7", 79808 Caggztrt-.7(810/r. POpOr. on impregnated, .00aa 6,16.. 7'81 Cligttrf;iir,'Criir8114)'' im°`"n't". "°) ''''''. ?ma c6vrwatoxiA061,4o,6,...., 0:16666,...t.a,.01 74390 C.2.0gtereis.(Zeg)... 'i" .. *7' . 178".".7."7. '7' .7'''' 73797 Cazgtl..-(1101zIar, paper. oil im7r.o6oe.a..019 mod, 79962 Casort,It,g;(7...11Alar, paper. oil impregnated, .023 rnfd.. 77885474"6 77010 'aao"re 11,0. 716. 77e.....0 37305 Co'n'tte'reliVP'eett9le.al. 471in'etarei0ttrn)trol (66181) Control -Volume control and power switch (R109. raioa) 4' c6.......--Aea6'::......m. ca::::::::::::676.71/2"7a 17e hitvoltag coMPartmmat Ote.M.,r0.111/2:oem cod Pas.n:71-.mr1fatt ........................... ..... 76183 a,a1,.. 360 T.1,4 7...44::.:-Rather grommet for and. GoOdO 1.61 mit Or,eart-Rubber grommet for mounting be socket .. 73798 Capacitor -Tubular. ORM O, n MOOMOn... nnn M. .. sok cor. (00570 73810 Camoci!:t.,.(mr, p.,.... , ,.....",...,.:..a..0...... 7'eii °Itzt:w.T042r. 'i"... *'' '"...."'..". '" "7" 77035 Hood -Deflection yoke hood less rubber cushions 76830 yoke hoed. leen rubber ovations Hom11387,ton) wit' ".'t 77e6"°160 Izl-e-Fooue:::::.t. 73698 730. oil impregnated, .093 ntl., ' C3p6 i:nTeNdar, paper, C.V..tor-T'ubul'a 400 .0184 (0146, C10 0apps`eoil m . regnotod ..0.17 mid.. .071 moat.. ImPer. .047 mid., CIO yam "'"76141 nu.... -10. trap magnet (P.M. type) iiii'th "4.4 7i4=it;e;t7.7airin..1.5rdiel.2.144g.r.=..ii"..:.i4.ini".ii.n'''. ii'ViitilTtisiclirettitr 2niinttlig 0atttirkto&Tabulae. Be 124wi4tar-wi..4 ....ad. 5.1 al.a.4, 1/2 wt.. (R205) .7. Ctrotg.-;Itr, 7..r. 7)7 1.17......d......... 77666397 Resistor -Wire wood, ow ohms, a at. (R203) 73764 inin.".i.i", '7 "70"11.es.'isror.--.. ennitOgeirCiligliari....10 ww*o'n"nl, '''°°o'h"'i ,'IwOc'w"atT('R'1)18) 73831 0.1 ..... ...zstmirevcass..zah..84..,t713-,. 76989 ohms, 7 watts (R117) :mistoorrirWire;:und,09660 " CirOtitii;(7Ciegigirt"... nii 1"7."8...iii. ii,i "7" 77:57" Cal.;'`i':7;2-1.311.iii '''.r. 80 'rna''''''. '27 M74.. .3033 83 ohm.. *10%. Y. watt 70E7 4397 7.o'h;:si. :99%%, 1/21/2 7v7tatttt (R1112199)) 71094 cy4tLipitir. ,-,...,, ttttr,...^..d. 0......, 503047 47 ona.... 310%. 1/2 watt (R109) 137' 0.1tgtv:J.T.V... 'in". ' ii"...n.4.2. 0.7 "7' "9043004827 4820 7okh:::, 0*2010%%, 1/21/2 87vratttt 7R1001)) 78498 Choke -Filter choke (L113) 735421 Coil -Antenna m440111.07711 (a ..q'4) (Peet of M.) 502118 180 ohm, 35%. 1/2 watt (R136) 503130 390 ohms. *10%. 1/2 watt (R182) 30 259 REPLACEMENT PARTS (Continued) N ST2C.. DESCRIPTION STOOX No, DESCRIPTION 503147 470 ohm.. .10%. 1/2 watt (8114) mum 980 ..66.. ,096, 1 8670 Man 904210 1000 ohm., *10%, 1/2 watt (8102, R118, R120, 8124. 8127) 909312 EEO ohms. *1096. 1/2 watt (R104. R212) 533222 23.60 aheaa. 310%. 2 ...att. (R131) a04233 3300 ohms, *20%. 1/2 watt (8211) 802238 3300 oltww. .5%. 1/2 watt (8120.8184) 803238 3900 ohms. *10%. 1/2 watt (1194) 503478 3600 ohms. *10%, 'h wan 91130) 523168 6600 ahra4. .10%. a wwwt. (0303) 503281 MOO ohms. *10%. 1/2 watt (R178, 8179) 913181 aaoo oh... *70%. 1 6.0a MISS) 502310 10,000 ohm., *9%, 1/2 watt (R107. R108. 8123) 501310 IS. ohm* *20%. 1/2 watt (R152) 502312 12.000 ohms. *5%, 1/2 matt (R111) 902312 mow 0166., *17%, 1/2 w/.70 011450 323319 ISOM eh... 310%. 2 watt. (R135) 903318 la,oco ohms, *10%. 1/2 watt (8133) 309318 18.031) ohms, *10%. Ve watt (R120, RMS. R166. 8196) 523318 18.000 ohms. *10%, ft 2.002 (R103) 070322 22.000 ohm., *106, 1/2 watt (R167. 8217) 513321 14,06 .1.6., 810%, 1 watt (8153) 503347 23,030 ahaw, 310%. 1/2 watt (MHO 513327 27,000 61..... .10%. 1 watt (712111) 513333 33,000 ohms. *10%. 1 watt (R114) 503339 ao,000 ohms. *10%. 1/2 watt (R108. 8141) 513939 39.000 ohms. 310%. I most (R132) 503347 509347 511347 503336 512356 somas slam 013361 47,000 ohms, *10%. 1/2 watt (R160) 47,000 3 20%. 9 waw (8144) 47,000 amts. 3596, 1 watt 81105) 58,000 ohms, *10%. 1/2 watt (RIO, R.. MOM ohms. *9%. I watt (R178) 68,07 ohms, 810%, J/./ watt (8111) 50050 ohms. *10%. 1 watt ono') 62.000 01..... 310%. 1 watt (8191) 805410 513410 630100 100.000 ohm.. 320%. 1/2 watt (R219) 100,000 el..., 310%, 1 Watt OMB) 130,000 ohm.. .5%. 1/2.watt (R143) 003415 160.000 ohms. *10%. 1/2 watt (Rya, 8183. 66104) 804.6 180,000 ohms, *20%. 1/2 watt (RI39) 912919 190.000 ohme a,a,. 1 watt (mos) 902416 180,000 ohms. *5%. 1/2 watt (R191) 3024.27 270.000 ohms. *6%. Ig watt (8I77) 503427 270.000 ohms. *10%. Ig watt (8I57) 91.. 90377 330.000 ohms, *1096, 1/2 matt (71711. RI.) .0,080 ohrns. x5%,1 watt (Rum) 50.99 380,003 ohm.. 31.0%. 1/2 watt (NI.) 503447 470.000 ohms. *10%. 1/2 watt (R150, R103) 304447 470.003 al.ms. 320%. 1/2 watt (8112. R147) 903.8 seem ohm*, *10%. 1/2 watt (R148. 8171) 603468 680.003 ohm..310%. 1/2 watt (8164. 8161) 5120.040 ohm.. .10%. 1/2 watt (8169, RIMS 503510 1 rtipollnl, *1%. 1/2 watt 0515% smell 1.1 megolten. +0%, 1/2 watt (R7.) 669141.1 rnpohnt. *10%. 1/2 watt (R160) 903815 5.a matron...10%. 1/2 watt (Rya) 11703 0.6 rapahm, 35%. V., watt (NI.) La numgellin, *8%, 1 watt (8I97) sown i.i rnagohnt, *10%. 1/2 watt (8128. 810) 800E0 10 meaols.a. .30%. 1/2 watt (R110) 71498 Samw-88. a .As. wing screw to mount dellmtion Yoke 76487 Shaft -Connecting shaft (nylon) /or P1/2171° ..d MM.. nem controls 73984 Shield -Tube shield for 7101, 1/102 V103, 7108 7.72 skt.00_,,,,, c0,1 tcr km. 76718 Scoket-Channel indicator lamp nocket and lea. 7934 Socket-ICinescope mocket 31231 'i.VInT,Tr17,;rzt7,a7.4 IbNIA.V..*:.:Igrd7ilriii.g8, "40"..".-irOtr.;111;1"(11.(11nidatlitirtie. Ware V;11,77 71905 Soak. -Tuba socket. 8 pin. moulded -for V117 for 8118 73117 SoVckIe0t -2T.ubVe 1so0ck3e.t1. pin. wafer mi OR V107, VI8. VniaIIItum for V101, 50367 Socket -Tube man.. 9 in, moulded saddImmounted for V1/24 71827 Socket -Tube socket. 8 pin, stoat7 saddle mounted for V116 70636 Stud -Adjusting etud complete with guard for focus magnet iii i 1.' iiiiiii "....i 8ntiri:Inandiige=2:v.ii4T161713M...ii.ii 78977 787as 48440 76907 76984 77112 7"iii 769711 76" ""n 79449 79241 7'" 78999 Trona °enter -Antenna matching transform*. cornate 200) Traatiettaat-311.wata05 wanatowww. (TM) tro plat. with mai...614 we.. (T110) Traneformer-Output transformer (7102) Teaa410.....-Powar trmnderener, 115 voIMBOoycl (712. Traneformer-Ratio detector transformer (7)01. C109) '::,tarz-17.7:74,01-.'darzlts7 E037°' wtii Transformer -Vertical output transformer (7108) ititncill=7:-onie...CF10.4.ig11871.1i177...."71.0...i." -" Tii:icti=1.0%.;gra.cUM:ieiM.I'et 'eer7:izgi.11-01,7.44Tar Tway-Fid trap complete 78th adjustable core and mud (1203, C209) Trap-i-f Oap (Lao°. Lam, caoo. cm/ Tie, -4.5 me trap (1.103, Cl.) '7,470-Filr(0:1:r08124.77.T11.,t71.111Ntrri7CUAr. SPEAKER ASSEMBLIES 971460-3.. RL106.8. RMA.274 (For Models 217108. 117217. 117230) coil (3.2 ohms) 9.69-11. RL-111-Al. RMA-174 (For Models 217218, 217237, 217126) 76388 Saw:ue-1V p.31. wpaa1.4.- 00.0.4 w1t. .0.4..6 rain5034a3 coil (3.2 ohm.) 971938-1. RMA-174 (For Model. 217107, 21790701/2 7776 SImalm6i1:,P.M. Speaker complete with crone and Notet-11 amping an Taker in,inetryte nts doss voice39063 ". 'in'.et" .".." :et crnirhir 31 260 21T207, 21T207G, 21T208, 21T211, 21T218, 21T227, 21T228, 21T229 REPLACEMENT PARTS (Continued) 67e79 DESCRIPTION K 67000C DESCRIPTION MISCELLANEOUS 7727' '''' (''''''' MliP.717.2.1.17.21.g3T.1iITZ9i8"2.'iqx 0"7"la.eia-r2(att.L.I./7r04t..77"7".."*"iiiiiii..innnni ""i' Rtict-ifi84717I81T1131.i."iin7*.i.".747747.7"ii".) 76189 or terminal board 7"" " iii"iii 7.. iii.godllr.71V2T9., rtn2;113.1.113; 77°' sTa=.1,var.. IrgrAg=01'-'°' "' Fee' 7*. 76607 Bracket -Masking panel support bromket 1,.4)d) , ,. .. ,.. cadettere stk t.r, k cc crc ""' '7:tt.Pta2t7arl';34.'crx1r..%)'"-° --- 76699 71882 "9 Bumper -Rubber bumper for kinescope (a....a.4) Catch -Bullet catch and soike for cabinet deer for Models 117217, 21.28, 21.29 "111:efilia.772.4iiii 0777(iniiiiiii 7.. 77070 800. baniiiii "77"ii alt .7.. '3444 CiefOal 2r181';345 0n igai'7i.rei;t11:tii.t.==le't; izz:17141.17criviyLrliTi2Breiiriiiintiinigt 01a!7,,?2: *3t'..01,411ct: ant :rat:Z=1: 75474 Com: tor-Single contact male connector for antenna 39159 71907 76698 78831 77"ii 77015 71984 77012 493 72113 77664 76 622 74308 Conneator-4 connmtor for antenna cable tcoownltand mp1aualcet g for masking mmol suppor Cord-PowerCuatioa;Ralert.,,,,rehion on -Rubber cushion for dust sealing the kinescope iii.iitf71Z.P.r.ielk 'iun:riiviTeni::*".. blond.m......7. 13...1-Cantral function 44,..1 km mahogany or Walnut irmtruments Dr4i;RCA Victor" decal for Models 117227. 2171213, Emblern-RCA Victor. emblem ub Foot -Rubber foot (4 raced) for Modal 217208 ettler2tit)esket for kinescope movntIng .1767 (Modal Clam -Safety glom Ciloca'Allmnirmlar .7k" 40.931)7877. Slaver2flaprtdoor hinge (1 xi) far Models 217217, 7&508 7"" "iaiiig-oiiifiraielIe.=i1/274.:eio.all-'a=a.tr) "n" i'ne:172:1's=:::z:::;:.;:7sTv '.e,:'71,:ataVT.1:5 knob- i'.:1:ifioci.nt7rinstrit.e=t7gilf:Leir)""."7..i ""a ''':,:t;?!:;'7::`:. (7:::::r".'cm-"' ..."'"'"'"' wn+ tam6.,...A mleator knob -tan -for nomle Metro - hopaoy or oak instruMents (outer) 70801 Kennol,e. -oFiondaeteutniinegmc0o0n0treoilik(nooubtm-m)aroon -for ma hog. 7"" i'int'Zierutisier"..""i""-0.8-7.."..81.".7"ii 7"" 'eitini'?rn'S. irFtefill'iirt'217..)ie l:7:'.17"7.'17 a4seo Knob -Picture moment. haww..wantala contra or volume c77ontroland1p7ow.'reirw..i.t.c.h. l6an.o..b.-maroon-formahogang 74001 Kn:=ob11.0P(7ii.c0i*7i,fct2onrt.r"o"l.ihio"rimnonnitiaih-onlidnc-oin.t.r"o.l.eir.ro"lnirie """ Krliitieinn=tnileTeitteilsTrrrntilsii(roilW;.".-7.. 76507 le 780 control antphonto swi,mh knobmaroon- ,og. Km._7788:nt178,,t 70.:::::::7:::::_,.._,.., '11769 1.704 ia4traraaulaatL/ amp -Channel marker escutcheon lamp-Meeda 661 Mr..%1T.:12:.1%?...:1aeeT:atitl=tr 7 'at,?"zr a.a,s.".ta oranz,7.1ag.a7"-'n.i 77567 ISIVI4i07,71valmene mas1/2.11 Porta 1.1 kino..... 1..d.7 77878 Mask-Polyetyrene mmking panel (94.1/21 217.70) 7.77 1.1:11f1,7k1.!,753.1.1 ..1 1.r 11.1......1. b....M.°. 7,0. ,,,wtaw,9 5,... wwt .. i .. 4..1.14ra te cabinet 73639 liu2t04frilAalortngjeL,,TAntmg acre.. for Models Zaulxi::: (4 ...k0.ai 1oor 4.1 217227 7770017 See 7..-Co.p,J:et pc,..,.. ctoorc tt.c.cccca rcred tc cuctooc ackccock r.ckc hood assembly ...mkt, ( ccc0 kt.kkogo) 0"" 87.0atiiti: eitiljti:Vr.LiZi(.i"si"..'n.."" ...- ygok jgc=kiigg r7 1( roc., head eorew foe door pun for 7.69 SerM;1340,014'. Mirnit head screw for a.... pall 1... 84iii*"*" i.iia 77688 Somm-212 r hex head Typo fticm6Mning kinescope m,.u1n.1...:07,,,=w4eltli 7865 01;:7tNgil0) 7.... 7.. ""iiiinnii 76630 SptkrinegeFt,rmed Mr*, Mr *pa maMng Pan, 77806 Bp:171-;1ecng spring for deflection yoke hood sup .... 77g.... .7..... 7.. n.... 77...' 74000 ... 02.340 pct.:eta-Retaining spring for Imohs neon, 785.34.1081.3 78837 , ,......'.....' -,,,,, 8597 ]8694. 78685, 74036 pring-Suspenslon spring 7..........7..1 I... 7.... Stop-naInnot door step 0..74.217227, 117228. 118224 ne7"t1=,T4 i*. ni.ii'iini Fernatr ;177P20730)8"87 in... ". -maroon-[1. 117207.)' 7'4" Wi:r"init.liPJ:::ti.Mittint71;t:nigieiseirenaltintitieiMii:Lnim:nitlini.1 7'.57 Wi:7h7annel marker escutcheon for mahogoos, o.' waaat 766. Wa.n.r-r., oono-tan-btvnton Iamb and oiiona "'" marker escutcheon for maP1e Metrumen. Wli:Otr:orttfriZeltincitscrete.. mini"' "8.7 iii. The smtern of employing an asterisk before the ma k number of now Rents has been discontInued. APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS. 32 261 RCAVICTOR TELEVISION, RADIO, ,110dcl 21-7.-2qy .Lihoganl Model 21-T-242 "Westland" Mahogany, Blonde Mahogany PHONOGRAPH COMBINATION MODELS 214-242 214-244 Chassis No. KCS72D-1 or KCS72D-2 930409 and RC1117B or RC1111B and RS141C -Mfr. No. 274- SERVICE DATA -1952 No. T9 PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. GENERAL DESCRIPTION Models 21-T-242 and 21-T-244 are 21 inch television, radio, phonograph combinations. Model 21-T-242 features an AM radio and Model 2I -T-244 features an AM, FM radio. Both models employ a three speed record changer and a 12" PM dynamic speaker. ELECTRICAL AND MECHANICAL SPECIFICATIONS PICTURE SIZE 227 square inches on a 21AP4 Kinescope RCA TUBE COMPLEMENT TELEVISION R -F FREQUENCY RANGE All 12 television channels, 54 mc. to 88 mc., 174 mc. to 216 mc. Picture I -F Carrier Frequency 25.50 mc. Sound I -F Carrier Frequency 21.00 mc. and 4.5 mc. VIDEO RESPONSE To 3.2 mc. SWEEP DEFLECTION Magnetic FOCUS Magnetic POWER SUPPLY RATING 21-T-242 21-T-244 115 volts, 60 cycles 190 watts max. 190 watts max. CHASSIS DESIGNATIONS In Model 21-T-242 . . . Television Chassis KCS72D-1, Radio Chassis RC1117B and Record Changer 930409-5 or. -10. In Model 21-T-244... Television Chassis KCS72D-2, Radio Chassis RC1111B, Audio Amplifier RS141C and Record Changer 930409-5 (mah.). See Service Data 930409 for Record Changer information. AUDIO POWER OUTPUT RATING. KCS72D, 4 watts max. RC1117B 2 4 watts max., RS141C 10 watts max. LOUDSPEAKER (92569-12) 12" PM Dynamic, 3.2 ohms Tube Used Television Chassis Function ( 1) RCA 6CB6 R -F Amplifier ( 2) RCA 616 R -F Oscillator and Mixer ( 3) RCA 6CB6 1st Picture I -F Amplifier ( 4) RCA 6CB6 2nd Picture I -F Amplifier ( 5) RCA 6CB6 3rd Picture I -F Amplifier ( 6) RCA 12AU7 Picture 2nd Detector and Vert. Sync. Sep. ( 7) RCA 6AG7 Video Amplifier ( 8) RCA 6AU6 1st Sound I -F Amplifier ( 9) RCA 6AU6 2nd Sound I -F Amplifier (10) RCA 6AL5 Ratio Detector (11) RCA 6AV6 1st Audio Amplifier (12) RCA 6K6GT Audio Output (13) RCA 6AU6 AGC Amplifier (14) RCA 6SN7GT Horizontal Sync. Sep. and Sync. Output (15) RCA 615 Vertical Sweep Oscillator (16) RCA 6K6GT Vertical Sweep Output (17) RCA 6SN7GT Horizontal Sweep Oscillator and Control (18) RCA 6BQ6GT Horizontal Sweep Output (19) RCA 6W4GT Damper (20) RCA 1B3-GT/8016 High Voltage Rectifier (21) RCA 21AP4 Kinescope (22) RCA 5U4G Rectifier (23) RCA 5Y3GT Rectifier WEIGHT Model 21-T-242 21-T-244 Net Weight 163 lbs. 186 lbs Shipping Weight 207 lbs. 232 lbs. RECEIVER ANTENNA INPUT IMPEDANCE Choice: 300 ohms balanced or 72 ohms unbalanced. (1) RCA 6CB6 (2) RCA 616 (3) RCA 6BA6 (4) RCA 6AU6 (5) RCA 6AL5 (6) RCA 6AV6 Radio Chassis RC1111B R -F Amplifier Oscillator and Mixer I -F Amplifier FM Driver Ratio Detector AM 2nd Det. and 1st Audio Amp. 262 21T242, 21T244 ELECTRICAL AND MECHANICAL SPECIFICATIONS (cont'd) RCA TUBE COMPLEMENT Tube Used Radio Chassis 1117B Function (1) RCA 12BE6 (2) RCA 12BA6 (3) RCA 6AQ6 (4) RCA 6AQ6 (5) RCA 35C5 Converter I -F Amplifier 2nd Det. and Audio Amp. Phase Inverter Audio Output (2 tubes) (1) RCA 6C4 (2) RCA 6V6GT (3) RCA 5Y3GT Audio Chassis RS141C Phase Inverter Audio Output (2 tubes) Rectifier HORIZONTAL SWEEP FREQUENCY 15,750 cps VERTICAL SWEEP FREQUENCY 60 cps FRAME FREQUENCY (Picture Repetition Rate) 30 cps SCANNING Interlaced, 525 line OPERATING CONTROLS (Front) Channel Selector Fine Tuning Picture 1 Brightness Picture Horizontal Hold 1 Picture Vertical Hold Sound Volume and On -Off Switch TV Tone Switch Dual Control Knobs Dual Control Knobs Dual Control Knobs . Dual Control Knobs NON -OPERATING CONTROLS (not including R -F and I -F adjustments) Picture Centering top chassis adjustment Width rear chassis adjustment Height rear chassis adjustment Vertical Linearity rear chassis adjustment Horizontal Drive rear chassis adjustment Horizontal Oscillator Frequency rear chassis adjustment Horizontal Oscillator Waveform bottom chassis adjustment Horizontal Locking Range rear chassis adjustment Focus top chassis adjustment Ion Trap Magnet top chassis adjustment Deflection Coil top chassis wing nut adjustment AGC Control rear chassis adjustment HIGH VOLTAGE WARNING OPERATION OF THIS RECEIVER OUTSIDE THE CABINET OR WITH THE COVERS REMOVED, INVOLVES A SHOCK HAZARD FROM THE RECEIVER POWER SUPPLIES. WORK ON THE RECEIVER SHOULD NOT BE ATTEMPTED BY ANYONE WHO IS NOT THOROUGHLY FAMILIAR WITH THE PRECAUTIONS NECESSARY WHEN WORKING ON HIGH VOLTAGE EQUIPMENT. DO NOT OPERATE THE RECEIVER WITH THE HIGH VOLTAGE COMPARTMENT SHIELD REMOVED. BE SURE THE GROUND STRAP, BETWEEN THE YOKE ASSEMBLY AND THE CHASSIS, IS SECURELY FASTENED BEFORE TURNING THE RECEIVER ON. KINESCOPE HANDLING PRECAUTIONS DO NOT REMOVE THE RECEIVER CHASSIS, INSTALL, REMOVE OR HANDLE THE KINESCOPE IN ANY MANNER UNLESS SHATTERPROOF GOGGLES ARE WORN. PEOPLE NOT SO EQUIPPED SHOULD BE KEPT AWAY WHILE HANDLING KINESCOPES. KEEP THE KINESCOPE AWAY FROM THE BODY WHILE HANDLING. The kinescope bulb encloses a high vacuum and, due to its large surface area, is subjected to considerable air pressure. For this reason, the kinescope must be handled with more care than ordinary receiving tubes. The large end of the kinescope bulb-particularly that part at the rim of the viewing surface-must not be struck, scratched or subjected to more than moderate pressure at any time. During service if the tube sticks or fails to slip smoothly into its socket, or deflecting yoke, investigate and remove the cause of the trouble. Do not force the tube. Refer to the Receiver Installation section for detailed instructions on kinescope installation. All RCA replacement kinescopes are shipped in special cartons and should be left in the cartons until ready for installation in the receiver. 2 OPERATING INSTRUCTIONS 263 21T242, 21T244 The following adjustments are necessary when turning the receiver on for the first time: 1. Turn the radio FUNCTION switch to TV. 2. Turn the receiver "ON" and advance the SOUND VOLUME control to approximately mid -position. 3. Set the STATION SELECTOR to the desired channel. 4. Adjust the FINE TUNING control for best sound fidelity and the VOLUME control for suitable volume. 5. Turn the BRIGHTNESS control fully counter -clockwise, then clockwise until a patter.n appears on the screen. 6. Adjust the VERTICAL hold control until the pattern stops vertical movement. 7. Adjust the HORIZONTAL hold control until a picture is obtained and centered. 8. Adjust the PICTURE and BRIGHTNESS controls for suitable picture contrast and brightness. 9. In switching from one channel to another, it may be necessary to repeat steps 4 and 8. 10. When the set is turned on again after an idle period it should not be necessary to repeat the adjustments if the positions of the controls have not been changed. If any adjustment is necessary, step No. 4 is generally sufficient. 11. If the positions of the controls have been changed, it may be necessary to repeat steps 1 through 8. RADIO OPERATION Model 21T242 1. Turn the RADIO TRANSFER switch to RADIO-PHONO position. 2. Turn the RADIO-PHONO tone switch to a radio position. 3. Tune in the desired station with the TUNING control. 4. Adjust tone as desired. Model 21T244 1. Turn the television TRANSFER switch to the RADIO position. 2. Turn the radio FUNCTION switch to AM or FM position. 3. Tune in the desired station with the TUNING control. 4. Adjust BASS and TREBLE controls for desired tone. Normal tone is with the BASS control fully counter -clockwise and the TREBLE control fully clockwise. PHONOGRAPH OPERATION 1. Turn the radio FUNCTION switch to the PHONO position. 2. Set speed control on changer to the desired speed. 3. Set stylus on tone arm to proper position for record to be used. (For 45 RPM records place 45 RPM centerpost over center spindle.) 4., Place a record on the changer and turn the changer power switch to "ON" position. VERTICAL HOLD HORIZONTAL HOLD TV TONE SWITCH ON -OFF SOUND VOLUME RADIO - PH. OFF -ON 8 TONE RADIO VOLUME RADIO- T V. TRANSFER SWITCH @R*--TAUDNIN0G CHANNEL SELECTOR CHANNEL NO. FINE TUNING ON -OFF SOUND VOLUME VERTICAL HOLD I HORIZONTAL HOLD TV TONE SW ITCH TRANSFER SWITCH RADIO OFF -ON VOLUME c)._ rr BASS II O. -TREBLE O. -TUNING ?RADIO-PHONO FUNCTION SWITCH CHANNEL SELECTOR CHANNEL NO. FINE TUNING PICTURE B IGHTNESS L-- r'- .,= 4-----L _t 3, z -L. -_-[ RECORD CHANGER i CONTROL SWITCH ': Il N MS -1455 Figure 1 -21T242 Operating Controls PICTURE if BRIGHTNESS II 11 1.'L`L_ __I =.= ,RECORD CHANGER [CONTROL SWITCH 0 0 5- 1e55 Figure 2-21 T244 Operating Controls REFER TO PAGES 236 TO 249 FOR TELEVISION ALIGNMENT PROCEDURE AND WAVE FORM PHOTOGRAPHS INSTALLATION INSTRUCTIONS ION TRAP MAGNET ADJUSTMENT. -Set the ion trap magnet approximately in the position shown in Figure 3. Starting from this position immediately adjust the magnet by moving it forward or backward at the same time rotating it slightly around the neck of the kinescope for the brightest raster on the screen. Reduce the brightness control setting until the raster is slightly above average brilliance. Turn the focus control (shown in Figure 3) until the line structure of the raster is clearly visible. Readjust the ion trap magnet for maximum raster brilliance. The final touches of this adjustment should be made with the brightness control at the maximum clockwise position with which good line focus can be maintained. CENTERING ADJUSTMENT LOCK SCREW Focus CONTROL ION TRAP MAGNET OCUS MAGNET MOUNTING SCREW KINESCOPE SOCKET ',CENTERING ADJUSTMENT j LEVER DEFLECTION YOKE NINE CUSHION KINE DEFLECTION YOKE ADJUSTMENT Figure 3-Yoke and Focus Magnet Adjustments 3 264 21T242, 21T244 INSTALLATION INSTRUCTIONS DEFLECTION YOKE ADJUSTMENT. -If the lines of the raster are not horizontal or squared with the picture mask, rotate the deflection yoke until this condition is obtained. Tighten the yoke adjustment wing screw. PICTURE ADJUSTMENTS. -It will now be necessary to obtain a test pattern picture in order to make further adjustments. Connect the antenna transmission line to the receiver. If the Horizontal Oscillator and AGC System are operating properly, it should be possible to sync the picture at this point. However, if the AGC control is misadjusted, and the receiver is overloading, it may be impossible to sync the picture. If the receiver is overloading, turn R149 on the rear apron (see Figure 4) counter -clockwise until the set operates normally and the picture can be synced. CHECK OF HORIZONTAL OSCILLATOR ALIGNMENT.-Turn the horizontal hold control to the extreme counter -clockwise position. The picture should remain in horizontal sync. Momentarily remove the signal by switching off channel then back. Normally the picture will be out of sync. Turn the control clockwise slowly. The number of diagonal black bars will be gradually reduced and when only 2 or 3 bars sloping downward to the left are obtained, the picture will pull into sync upon slight additional clockwise rotation of the control. Pull -in should occur before the control has been turned 120 degrees from the extreme counter -clockwise position. The picture should remain in sync for approximately 90 degrees of additional clockwise rotation of the control. At the R -F UNIT 11173 \HEIGHT CONTROL RISI VERTICAL LINEARITY CONTROL JIOI PHONO INPUT 11149 AGC CONTiROL l TIIO HORIZONTAL OSCILLATOR FREQ. ADJ. LIOB HORIZONTAL LINEARITY CONTROL L 106 WIDTH CIGIS CONTROL HORIZONTAL DRIVE 0 J102 C16IA HORIZ VJIADCEKO ° LORCAKNIGN,G)) Figure 4-Rear Chassis Adjustments extreme clockwise position, the picture should remain in sync and should not show a black bar in the picture. If the receiver passes the above checks and the picture is normal and stable, the horizontal oscillator is properly aligned. Skip "Alignment of Horizontal Oscillator" and proceed with "Focus Magnet Adjustment." ALIGNMENT OF HORIZONTAL OSCILLATOR -If in the above check the receiver failed to hold sync with the hold control at the extreme counter -clockwise position or failed to hold sync over 90 degrees of clockwise rotation of the control from the pull -in point, it will be necessary to make the following adjustments. Horizontal Frequency Adjustment. - Turn the horizontal hold control to the extreme clockwise position. Tune in a television station and adjust the T110 horizontal frequency adjustment at the rear of the chassis until the picture is just out of sync and the horizontal blanking appears as a vertical or diagonal black bar in the raster. Then turn the T110 core until the bar moves out of the picture leaving it in sync. Horizontal Locking Range Adjustment. -Set the horizontal hold control to the full counter -clockwise position. Momentarily remove the signal by switching off channel then back. The picture may remain in sync. If so turn the T110 rear core slightly and momentarily switch off channel. Repeat until the picture falls out of sync with the diagonal lines sloping down to the left. Slowly turn the horizontal hold control clockwise and note the least number of diagonal bars obtained just before the picture pulls into sync. If more than 3 bars are present just before the picture pulls into sync, adjust the horizontal locking range trimmer C161A slightly clockwise. If less than 2 bars are present, adjust C161A slightly counter -clockwise. Turn the horizontal hold control counter -clockwise, momentarily remove the signal and recheck the number of bars present at the pull -in point. Repeat this procedure until 2 or 3 bars are present. Repeat the adjustments under "Horizontal Frequency Adjustment" and "Horizontal Locking Range Adjustment" until the conditions specified under each are fulfilled. When the horizontal hold operates as outlined under "Check of Horizontal Oscillator Alignment" the oscillator is properly adjusted. If it is impossible to sync the picture at this point and the AGC system is in proper adjustment it will be necessary to adjust the Horizontal Oscillator by the method outlined in the alignment procedure on page 11. For field purposes paragraph "B" under Horizontal Oscillator Waveform Adjustment may be omitted. FOCUS MAGNET ADJUSTMENT. -The focus magnet should be adjusted so that there is approximately three -eighths inch of space between the rear cardboard shell of the yoke and the flat of the front face of the focus magnet. This spacing gives best average focus over the face of the tube. The axis of the hole through the magnet should be parallel with the axis of the kinescope neck with the kinescope neck through the center of the opening. CENTERING ADJUSTMENT. -No electrical centering controls are provided. Centering is accomplished by means of a separate plate on the focus magnet. The centering plates include a locking screw which must be loosened before centering. Up and down adjustment of the plate moves the picture side to side and sidewise adjustment moves the picture up and down. If a corner of the raster is shadowed, check the position of the ion trap magnet. Reposition the magnet within the range of maximum raster brightness to eliminate the shadow and recenter the picture by adjustment of the focus magnet plate. In no case should the magnet be adjusted to cause any loss of brightness since such operation may cause immediate or eventual damage to the tube. In some cases it may be necessary to shift the position of the focus magnet in order to eliminate a corner shadow. WIDTH, DRIVE AND HORIZONTAL LINEARITY ADJUSTMENTS.-Adjustment of the horizontal drive control affects the high voltage applied to the kinescope. In order to obtain the highest possible voltage hence the brightest and best focused picture, adjust horizontal drive trimmer C161B counter -clockwise until the picture begins to "wrinkle" in the middle then clockwise until the "wrinkle" disappears. Turn the horizontal linearity control L108 'clockwise until the picture begins to "wrinkle" on the right and then counterclockwise until the "wrinkle" disappears and best linearity is obtained. Adjust the width control L106 to obtain correct picture width. A slight readjustment of these three controls may be necessary to obtain the best linearity. Adjustments of the horizontal drive control affect horizontal oscillator hold and locking range. If the drive control was adjusted, recheck the oscillator alignment. HEIGHT AND VERTICAL LINEARITY ADJUSTMENTS.- Adjust the height control (R173 on chassis rear apron) until the picture fills the mask vertically. Adjust vertical linearity (R181 on rear apron), until the test pattern is symmetrical from top to bottom. Adjustment of either control will require a readjustment of the other. Adjust centering to align the picture with the mask. FOCUS.-Adjust the focus magnet for maximum definition in the test pattern vertical "wedge" and best focus in the white areas of the pattern. Recheck the position of the ion trap magnet to make sure that maximum brightness is obtained. Check to see that the yoke thumbscrew and the focus magnet mounting screws are tight. 4 INSTALLATION INSTRUCTIONS 265 21T242, 21T244 CHECK OF R -F OSCILLATOR ADJUSTMENTS.- Tune in all available stations to see if the receiver r -f oscillator is adjusted to the proper frequency on all channels. If adjustments are required, these should be made by the method outlined in the alignment procedure on page 9. The adjustments for channels 2 through 12 are available from the front of the cabinet by removing the station selector escutcheon as shown in Figure 5. Adjustment for channel 13 is on top of the c),assis. STATION SELECTOR FINE TUNING TO REMOVE ESCUTCHEON, SLIDE SPRING CLIP TO LEFT -OSCILLATOR ADJUSTMENT FOR CHANNEL NUMBER Figure 5-R -F Oscillator Adjustments AGC THRESHOLD CONTROL.-The AGC threshold control R149 is adjusted at the factory and normally should not require readjustment in the field. To check the adjustment of the AGC Threshold Control, tune in a strong signal and sync the picture. Momentarily remove the signal by switching off channel and then back. If the picture reappears immediately, the receiver is not overloading due to improper setting of 8149. If the picture requires an appreciable portion of a second to reappear, or bends excessively, R149 should be readjusted. Turn R149 fully counter -clockwise. The raster may be bent slightly. This should be disregarded. Turn R149 clockwise until there is a very, very slight bend or change of bend in the picture. Then turn R149 counter -clockwise just sufficiently to remove this bend or change of bend. If the signal is weak. the above method may not work as it may be impossible to get the picture to bend. In this case, turn R149 clockwise until the snow in the picture becomes more pronounced, then counter -clockwise until the best signal to noise ratio is obtained. The AGC control adjustment should be made on a strong signal if possible. If the control is set too far clockwise on a weak signal, then the receiver may overload when a strong signal is received. FM TRAP ADJUSTMENT.-In some instances interference may be encountered from a strong FM station signal. A trap is provided to eliminate this type of interference. To adjust the trap tune in the station on which the interference is observed and adjust the L203 core on top of the antenna. matching transformer for minimum interference in the picture. CAUTION.-In some receivers, the FM trap L203 will tune down into channel 6 or even into channel S. Needless to say, such an adjustment will cause greatly reduced sensitivity on these channels. If channels 5 or 6 are to be received, check L203 to make sure that it does not affect sensitivity on these two channels. Replace the cabinet back and connect the receiver antenna leads to the cabinet back. Make sure that the screws holding it are up tight, otherwise it may rattle or buzz when the receiver is operated at high volume. KINESCOPE SCREEN CLEANING.-The kinescope safety glass is held in place by four spring clips which may be removed from the back of the front panel. This permits removing the safety glass for cleaning without the necessity of removing the chassis and kinescope. CHASSIS REMOVAL. -To remove the chassis from the cabinet for repair or installation of a new kinescope, remove the control knobs, the cabinet back, unplug the speaker cable, the kinescope socket, the antenna cable, the yoke and high voltage cable. Take out the chassis bolts under the cabinet. Withdraw the chassis from the back of the cabinet. RADIO OPERATION Model 21T242 Turn the RADIO -TV TRANSFER switch to radio. Turn the radio function switch to RADIO and check radio for proper operation. Model 2I T244 Turn the TELEVISION TRANSFER switch to the RADIO position. Turn the radio function switch to the AM and FM positions and check the radio for proper operation. CS _CIA 53 / JF 4.--.,. J1F RIM LI LOOP ___A-S--SEMBLY J3;--NN RADIO PaIOl S CHASSIS RC 1117 B ia J200 F P300A M R -F UNIT 1" ANTENNA 4-- -ff.1 1--- - - -U i'mr-48 if, , ANT. TB. 115%160,, SUPPLY SPED I* ...Lii., 5103 INTERLOCK FOR POWER CORD aii, TV CHASSIS KCS 72A a..,----..........._ x7 / SPEAKER BVAIECWK 0.45631 Figure 6-Model 21T242 Cable Diagram FM ANTE NNA,,a_ ,--Er,--- == 1:., , - 3 TB ill 1.7041F LOOP TB. .../ ,... LI ., CIE :. ----'1F:: V 1C-ijs?o2 RADIO CHASSIS RC Mier TV CHASSIS P104 KCS 7 2 D r ) J201F 5201 TRANSFER ^"1u,u-, SwITCH 5103 INTERLOCK FOR POWER CORD AMPLIFIE.REJurlj ff R5141C ., I :t..."1 -L SUNt,5-'( ffr"-'' L ' 'It i 11 Tv ANTENNA -, II.K P103M .1203F 3 -SPEED CHANGER .. / P104 M J 202 F .,... J204 F 1151/.50, P105 SUPPLY P.M SPEAKER Figure 7-Model 21T244 Cable Diagram 0.IISI 266 21T242, 21T244 TELEVISION CHASSIS TOP VIEW TO ANTENNA TERMINALS ANTENNA MATCHING TRANSFORMER C-Thr 6CB6 R -F AMR CHANNEL SELECTOR SWITCH FINE TUNING CONTROL SPEAKER CABLE Et T1O2 RATIO PET. TRANS. V103 GALS RATIO DET. V102 GAUG two SND I -F AMP T101 SOUND I -F TRANS Viol 6AUG 1,9401-F AMP. V111 GAU6 AGC AMP VHS G5N7GT NOR SYNC SEP. VERT SYNC. OUTPUT T107 418 PIX I -F V109 I2A U7 DIX SET. TRANS 0 VERT. SYNC SEP V108 6CB6 3SPPIXFF AMP. TIO6 3RD P1X I -F TRANS. V107 6CB6 2-PPIX I -F AMP TIO5 VA. PIX I -F TRANS. V110 GAG7 VIDEO AMP v104 6C86 !UPI% I -F AMP. TIO4 147 PIX 1-F TRAN V104 GAVE, AUDIO AMP v105 6K6GT AUDIO OUTPUT / V116 `\ I 6806 GT 1 tHORIZONTALl OUTPUT \ / VII5 6SN7GT I HOR.05C. %CONTROL,' 1 - I V117 11 11133GT/I3016 INV. RECT. I V118 6W4 GT I ----- DAMPER I I I II - lc - I - 101E1110 V114 6KGGT VERTICAL SWEEP OUTPUT TIOS VERT. SWP. OUTPUT TRANS. T109 POWER TRANSFORMER V120 5U 4G RECT. V121 5Y3GT RECT. V113 6J5 VERT SWP OSC. 5101 TONE SWITCH 033 5102 - R109 ON OFF SWITCH &VOL. CONTROL 5 201 ----=-1TRANSFER SW. 2 -e - I ON MODEL 1217244 ONLY n -iu II 0--tr u R1S4 BRIGHTNESS CONTROL 4 R137 PICTURE CONTROL RI708 51705 R170A VERTICAL HOLD CONTROL 046807 R17 0 8 HORIZONTAL HOLD CONTROL KINESCOPE SOCKET Figure 8-Television Chassis Top View 6 POWER CORD CHANNEL SELECTOR SWITCH FINE TUNING CONTROL TELEVISION CHASSIS BOTTOM VIEW 267 21T242, 21T244 R- F UNIT ANTENNA MATCHING TRANSFORMER TO ANTENNA TERMINALS SIOi TONE SWITCH 5102 - R109 ON -OFF SWITCH VOL CONTROL I5 zr -S I I II II iL-1 5201 t. TRANSFER SW ON MODEL 217244 ONLY R184 BRIGHTNESS CONTROL R137 PICTURE CONTROL 12170A VERTICAL HOLD CONTROL RI70A 51708 R1708 HORIZONTAL HOLD CONTROL SPEAKER CABLE V io4 6AV6 AUDIO MP VI OS 6K6 GT AUDIO OUTPUT TIOS SW PIX I -F TRANS 107 6C86 250 PIX I -F AMP 7106 382 PIX I -F TRANS. 108 6[136 Ig PI X I -F AMP 1107 470 P1X I -F TRANS. 109 12AU7 SIX SET VERT. SY SEP. VIO 6C B6 1E7 PIX I -F MP 7101 SOUND kF TRANS VIO 6AU6 IIT SND I -F MP 102 6AU6 2S2 SND. I -F AMP T102 RATIO DET. TRANS. T104 ISTPIX I -F TRANS. V110 6A07 VIDEO AMP. V112 657176T NOR SYNC SEP L VERT SYNC OUTPUT VIII 6AU6 AGC AMR V114 6K6GT VERT. SWP. OUT. VI I5 65747 GT NOR OSC CONTRO V116 68.26 GT HORIZONTAL OUTPUT TI10 HOR. SWEEP OSC. TRANS. VII3 6.15 VERT. SWP. OSC. V121 5V3GT RECT. V120 5U46 RECT. 048606 POWER CORD KINESCOPE SOCKET Figure 9-Television Chassis Bottom View 7 LI LOOP CIA 1.5A 12- 7 43<2-- Vi T1 ii E 12 B E 6 1ST. I -F TRANS. CONVERTER , 3 I CS toov. 3-30 86 = 107 I.I 41 SI I -10y. L 2 12n_ 4 V2 T2 12 BA6 2ND. I -F TRAN S. I -F I 3 is 8.v. I 2 I CY pc, ,0,1 4.1 4 1 L 15-1 L 5, 5(:;111 R V3 6A0.6 DET-AVC -AF C14 .0039 744v R13 C13 220K I120 C15 1.7 V. .022 INDEX TAB R2 .t 'C4 R6 0 0 T 39K, ® ft Cy- 56 270 R 12 io _- C 12 - MEG. 0033 RED OSC DOT © OSC.COIL COIL .=.1 8_, r.,C3-2320 017_26cL.,513A26. © thi RS 3.3 MEG .0C472---P2N2RA0INK-- R7 120K 0-1 C 3 .047 /7177 V4 SI 6A 0.6 VS 35C5 OUTPUT 7 120V. C19 .0039 2-5 ZR16 470K R17 12 K 8R219 6.4v -4- 300/1. TOTAL cco. C. I 2-5 RIB 470K 6 7 120V 35C5' OUTPUT 410' 0 0C02309 I(-1 P -M SPEAleR P3 TV- RADIO TRANSFER sw. S3 FRoNT J2 -_F ELK. 52 MUTING SW 5WL0 MI-N%FW*1I GNO.ON MOTOR BOARD PI -M PIN VIEW REAR VIEW 2 Chi R3 _IC7 .0018 I.047 1.5 MEG. R4 27K PICKUP 3 SPEED =-1r== CHANGER tipil..ytir g_ MOTOR .4 [0 P24.1 P2 -F R8 390K C2I .0018 FRONT =C11 .022 SI REAR 4 Rlo 68K C10 .00471 RII 2 MEG VOLUME CONTROL PHASE INV. 88V R20 1800 C I7A C178 to 30 MF mF.1 R2I 1200 4O c 17C I 80 MF. V3 V4 VI V2 V5 VS 64156 GAGS 1213E6 1264E 35C5 35C5 34 34 43 4 3 34 34 RESISTANCES IN OHMS. K=1000 CAPACITANCES LESS THAN 1, IN MF. AND ABOVE I MMF: UNLESS OTHERWISE NOTED. To Pio4 TV CHASSIS RED SRI SELENIUM RECT. 0 R22 DIAL GG °LAMPS R23 95.0n. 38% . 13.5n a 104.C. SS 1 ICNHDAICSASTEISS INDICATES COMMON WIRING INSULATED GROUND. FROM CHASSIS. FUNCTION SW. Si VIEWED FROM FRONT, AND SHOWN IN POSITION (MAX. COUNTER C LOCKW1SE ). NO.1 POS. 1 - OFF. 423--- RADIO > u - - MIN. HIGHS NORMAL MAX. HIGHS 567---PHO/) NO --MNINO.RHMIGALHS -MAX. HIGHS TV -RADIO TRANSFER SW. S3 VIEWED FROM FRONT,AND SHOWN IN POSITION NO.1 (MAX.CouNTER- CLOPC0K5W. I1SE-)TV. 2- RADIO. D-48858-0 TV 54 I.'"IC 1e (ON REAR ,J031F OF 53) (To P105 ON 1I5II vII. Go, TV CHASSIS) SUPPLY Figure 10-Radio Schematic Diagram Chassis RCI I I7B Critical Lead Dress 1. Dress C15 (.022 mfd. at grid of phase inverter) over tube socket away from filament leads. 2. Keep all filament leads close to chassis. 3. Keep leads of R26 (270 ohms at I -F amplifier cath- ode) short as possible. 4. Connect outside foil of all capacitors in schematic diagram. as indicated 5. Dress output plate bypasses, C19 and C20, chassis as possible. as near RADIO DATA 21T242 Dial Pointer Adjustment.-Rotate tuning condenser fully counter -clockwise (plates fully meshed). Adjust indicator pointer so that it is 3" ,;," from the left hand edge of the dial back plate. TUNING KNOB SHAFT Figure 11-Dial Cord and Drive TUNING CONTROL .5IPIL LAMP 53 TRANSFER SWITCH VOLUME CONTROL RADIO-PHONO AND TONE SW 4'51 PILOT RADIO DATA 269 21T244 NOTE L2 - FM. RE COIL AND OSC. COIL ARE LOCATED UNDERSIDE OF CHASSIS. CIF -T Kw MC. LT AM-RF 455 KC (TOP AND BOTTOM) 455 KC.A. (TOP BOTTOM) EA IN DC, TNN4411171.1,...... KM/ MC TOP. Re SoNANC E BOTTOM -CENTERING NMINL.O, ON INN.... °PITON 4 v01.0.4 O55 TONE TOUSLE TONE TOWN. BAND SmolCN PHONO-/. N. ix Figure 13-RCIII1A Chassis Top View A.G. POWER POWER CORD TO RADIO CHASSIS PHONO POWER J3 -F TV POWER SOCKET POWER CORD V4 PHA 1.4v 6.06 VS OUTPUT 35C5 Figure I2-Chassis Top View JI-F PHONO INPUT SOCKET Alignment Procedure Output Meter.-Connect meter across speaker voice coil. Turn volume control to maximum. Test Oscillator.-Connect low side of test oscillator to common wiring in series with a .1 mf. capacitor. If the test oscillator is a -c operated it may be necessary to use an isolation transformer for the receiver during alignment and the low side of the test oscillator connected directly to common wiring at the electrolytic capacitor. Keep the oscil lator output low to prevent a -v -c action. Steps Connect the high side of test -otosc-illator Tune testto-o-sc. Turn radtioo-dial Adjust the fol- lowing for max. output I-F grid, in Pri. & Sec. 1 series with 2nd I -F .1 mfd. Quiet point transformer 455 kc 1,600 kc Converter grid end of dial Pri. & Sec. 2 in series with 1st I -F .1 mfd. transformer NOTE.-ANTENNA LOOP AND RECORD CHANGER MUST BE IN CABINET FOR THE FOLLOWING Extreme 3 Short wire 1,620 kc R. H. end C1B-T (osc.) placed near (gang open) loop for radiated 4 signal 1,400 kc 1,400 kc C5 (ant.) 5 Repeat steps 3 & 4 if necessary JEWEL LAMP LEADS SPEAKER LEADS Figure 14-RS141C Chassis Top View Figure 15Dial Cord CRITICAL LEAD DRESS 1. The 1st FM i-f plate lead should be dressed away from the r -f amp plate. 2. Dress the 1st AM i-f plate lead to the S2 wafer away from the AM r -f coil. 3. Dress the a -c power switch wires away from all audio components. 4. Dress C26 down toward the base between the terminal board and the side apron. 5. The C18 bypass ground should be as close to the r -f shelf ground strap as possible. 6. Dress C25 away from the arm contact of the volume control. 7. All leads from the r -f shelf leaving through the shields must be kept as short as possible. 8. Dress the a -c leads in the RS141 chassis away from the audio input leads and components. 9 270 21T244 RADIO ALIGNMENT PROCEDURE evBnoedifcooerfecdoaiialli,lg.anWnidnhgteunsrenmt,tahckeoimnregpcaleeictveoelmyr vpmoleeltusehmatelhigcenogmnatenrongltatfonodlmlosawext.tthTheeutrdanibatlloenpbeoeiclnootwenrtrintoolsstehfqoeuremmnecacexh.imaCnuoimcnanlhemcigtahtxhs.eacnoadulitmpburaatxtimimoenutemprolaioncwrtoass.tsetxhteresmpeealkeefrt "AM" I -F ALIGNMENT Test -Oscillator. -connect low side of the test-osc. to the chassis, and keep the output as low as possible to avoid a -v -c action. Steps 1 2 Connect the High Side of the Test Osc. to- Pin No. 1 of (43) in series with .01 mfd. Stator of Cl-D in series with .01 mfd. Tune tToe-st Osc. 455 kc. Modulated 455 kc. Modulated Function Switch AM AM Turn Radio Dial to- Low Freq. end of Dial Low Freq. end of Dial Adjust the following tTop and bot. cores of T4 For max. voltage across voice coil. tTop and bot. cores of T2 For max. voltage across voice coil. For proper adjustment of the i-f cores start with the cores all the way out. The first peak obtained will be the correct one. FM ALIGNMENT PROCEDURE Connect probe of "VoltOhmyst" to negative side of C39 and low side to chassis. Top shield must be on and the bottom shield off. Steps 3 4 Connect the High Side of the Test Osc. to- Pin No. 1 of V4 in series with .01 mfd. Pin No. 1 of V4 in series with .01 mfd. Tune tToes-t Osc. Function Switch FM Radio Dial --- Tuned to - Adjust Top of Ratio d-ct Trans. T5 Modulate-d--for 10.7 mc. 30% AM FM for maximum DC on "VoltOhmyst." Bpttom of Ratio d-cf Trans. T5 minimum audio output on meter. 5 Repeat steps 3 and 4 as necessary making final adjustment with input set to give approx. -4.0 v. on "VoltOhmyst." 6 Pin No. 1 of V3 in series 10.7 mc. FM with .01 mfd. 88 mc. tTop and bottom cores of T3 for maximum d -c across C39. 7 Stator of Cl-C in series with .01 mfd. 10.7 mc. FM 88 mc. flop and bottom cores of T1 for maximum d-:-.. across C39. 8 Connect sweep generator 90 mc. FM cable to antenna termi- 22.5 kc. FM mod. 9 nals through 120 ohms in each side of line. 106 mc. 22.5 kc. FM mod. FM 88 mc. Tune to signal tOSC, L8 for max. audio output. ANT, Cl-FT and R -F Cl-CT for max. voltage across C39. 10 90 mc. FM 22.5 kc. FM mod. 11 Repeat steps 8, 9 and 10 as required. Tune to signal tANT, Ll and R -F L2 for max. voltage across C39. 12 Connect a scope to junction R33 and C35, check response and linearity. Peak separation should be at least 180 kc. fFor proper adjustment of the i-f cores start with the cores all the way out. The first peak obtained is the correct one. Adjustable by increasing or decreasing spacing between turns. Steps 13 14 15 16 17. "AM" R -F ALIGNMENT Connect the High Side of the Test Osc. to- Tune tToe-st Osc. Function Switch Turn Radio Dial to- Adjust the following External radiating loop and couple loosely to receiver loop. 1,620 kc. 1,400 kc. 600 kc. 600 kc. AM Min. capacity *Osc. Cl-BT for maximum output. AM Tune to signal *Cl-DT and CI -ET for max. output. AM Tune to signal tOsc. L5 for max. output while rocking gang. AM Tune to signal ***R -F L7 for max. output. Repeat steps 13, 14, 15 and 16 until no additional gain in sensitivity is obtained. Clip a 10,000 ohm resistor across Cl-D when making this adjustment. ***Be sure the resistor employed in step 15 is removed for this adjustment. *All R -F shields must be in place. RADIO VOLTAGE CHART Voltages shown are as read and with no signal input. with "VoltOhmyst" between indicated terminal and chassis, with receiver operating on 117 volts, Tube Type and Function Tube Element Pin No. AM VI 6CB6 R -F Amp Plate 5 Screen 6 Cathode 2 Grid 1 215 74 0.4 -0.8 V2 616 Osc. and Mixer Plate Grid Plate Grid 2 55 5 -1.2 1 6 -24.03 V3 6BA6 I -F Amp Plate 5 210 Screen 6 126 Cathode 7 0.9 Grid 1 -0.8 V4 6AU6 Plate 5 216 Screen 6 150 Driver Cathode 7 1.5 Grid 1 0 FM 180 62 0.4 0.4 -15.38 -14.26 210 115 -00..27 216 150 1.5 0 Phono ------------- Tube Type and Function Tube Element Pin No. AM V5 6AL5 Ratio Det. -- -- -- V6 6AV6 Audio Amp. Plate Grid 7 88 1 -0.7 V102 6C4 Phase Inverter Plate 5 Cathode 7 Grid 6 --8117.165 V103 6V6GT V104 6V6GT Plate 3 300 Audio Screen 4 224 Power Output Cathode 8 Grid 5 -170 V101 5Y3GT Rectifier Fil. 8 305 FM Phono -- -- -08.78 -010.48 --118186 120 - 13 -19 300 298 224 292 0 - 17 -210 305 307 10 EAxTM. 6M C- ANT ANT _L Iv-TV 6M ANT COIL : CI -F 4 -ST m.----- :._ 2_25 r,?..2- 17 ___ LI - 6CB6 R -F AMPL. 2 83 39 LOOP CI -0 i13-496 ) SI-D FRONT T 2-17 RI 2.2 MEG 12 10 3 C3 9 220 8 76 to 9 6VJ26 CIS MIXER &05C 68 2 C16 -/-1 6.8T .14 COIL CI -A 7.5-22.5 C C R13 C14 7 18K 5 6817 - RII 120 K hoe R6 680 COUPLED F A-61 OSC. COIL C RI2 390 ). CII 14700 TI- 10.7 MC. I. I I - 33 IL@__ --J RS 8200 C9 14/00 SI-C FRONT 12/11 2 oases A- M R -F COIL pf:14 L7 C 6-D 8.5-272' 5 -4 2-17 S1-8 FRONT 121. I 10 T2- 455 KC. 13 I 1 133 I :-F.6(67-. I :tt 13 C18 CI9 4700 .047 515 120 K 76 5,-C REAR 121\1 11 2 470 R7 2.2 MEG 9 B 7M6 _14700 I5_T_C41 12 10 2 5 51-B REAR 3 7116 C 20 4700 523 220 K 150 K RB 2.2 MEG SHIELD v3 6BA6 I -F AMPL. 7 R21 68 I I V4 6AU6 DRIVER 5 850 T3 120 10.7 MC. l46' :"t7t 1 I 33 C33 T.005 I C32 4700 R3I 22 K TS RATIO DET. TRANS. 10.7 MC - VS 6AL5 RATIO DET. C 5 C 2 z.-sii 7. 33 536 I 1200 Cal T .Con 71 11i A I LB - JVV R34100 3333:050 < R33 5.15 K 4C72030 T R22 221S T4- 455 KC IC1134 64700 R32 680 250 C24 - 4700 I R25 680 R26 56K SI-A REAR SI-A W2 FRONT 2- 10 4 7 S 6 C31 1150 929 E C25 .0033 3 I 6AVV6 6 C30 T v:4 -c.2F00 o4ET 47: C26 2 DET.-A.V.C. -AAMP'CL 7 R19 t 2 .022 43 5 1.5 MEG.1 VOL CONTR 5 5;570 K 4-.1it RNG , ki27E0° RE RIB . 27K CI C22 T.018 t .015 I 2 RIG 2 mEG. L -F ToNE CONTROL _1C473050 C29 .01 028 C28 R39' 270K 150 S 1 MEG. P102 12_1:7173 J2 AUDIO OUTPUT cit7F R38 .3:973 :7 FUNCTION SWITCH Si VIEWED FROM FRONT AND SHOWN IN POSITION 1. (MAX. COUNTER - CLOCKWISE) P05. 1 - PHONO. 33%6.45,78 R.p M. 2- A -M RADIO. 3- F -M RADIO, RESISTANCES IN OHMS. K.= 1000 CAPACITANCES LESS THAN 1 IN MF. AND ABOVE 1 IN MMF UNLESS OTHERWISE NF,TE 0 MUTING ' SW MOTOR BOARD PICKUP 3 -SPEED CHANGER Pt IN PI- F L LPL'S V4 v5 V2 sit V3 v6 -..1/)"r3 3,c. LI° 3.4...3..4-1ILs4 G - CIO 47 - C2 C 27 T4700 47001 R 27 22 MEG. .J5 171.4136.0 P3 INPUT 6)=P RIO ,.5 MEG WI ce I PK .801811 JI-M PIN VIEW P101 -F VIEW GRN BLKI P103 -6I To J 203-F ON Tv. C 40 4700 7101 V 101 5Y3-GT RECT. V 103 6V6-GT OUTPUT 31 -=58 6VC1042 5 17104 PHASE INV. 5470 K R101 2200 C 13001A-- ME. U IS C1016 = 30 ME. X X 4 8103 82K C 102 .022 R108 100 x To AUDIO ...EATERS X 47930 -O C104 .001 C103 .001 272 21T242, 21T244 TELEVISION VOLTAGE CHART tTrseehhrcomeeritifvnocealirllr,ocatwuhniiedtninpgcighcmattushesraeiessrusegrycerneomciuveenedndrtasaannnrdetdeptnhwreenisatAehtnGetthrCtmewcironoeacnsleetsrit.ovsVleorpofrolcotpaopegneredralsitytisinoahgdnojswou. nsnItne1da1th.r7eeTvrfhoeierlastsdste, cwc6oo0innthcddyiactcioltoeynnspd,,eiaatiWo-1cn5V. 0wT90h7a0esAmsoysbiemctnarboiionovrelod"<lVtbmtoyeelstratOenpmshamoltetveysirssnnttg"hsabtihgneen.twaalenwetenanstnhfaeeldienaidnditcsoaattnehdde Tube Tube No. Type Function Operating Condition E.,Plate Pin No. Volts VI 616 Mixer 15000 Mu. V. Signal 2 No Signal 2 R -F 15000 Mu. V. VI 616 Oscillator Signal 1 No Signal 1 R -F 15000 Mu. V. V2 6CB6 Amplifier Signal 5 No Signal 5 1st Sound 15000 Mu. V. V101 6AU6 I -F Amp. Signal 5 2d Sound V102 6AU6 I -F Amp. No Signal 5 15000 Mu. V. Signal 5 Ratio V103 6AL5 Detector No Signal 5 15000 Mu. V. Signal 7 No Signal 7 1st Audio 15000 Mu. V. V104 6AV6 Amplifier Signal 7 No Signal 7 Audio V105 6K6GT Output 15000 Mu. V. Signal 3 No Signal 3 1st Pix. I -F 15000 Mu. V. V106 6CB6 Amplifier Signal 5 No Signal 5 2nd Pix. I -F 15000 Mu. V. V107 6CB6 Amplifier Signal 5 No Signal 5 3rd Pix. I -F 15000 Mu. V. V108 6CB6 Amplifier Signal 5 No Signal 5 Picture V109A 12AU7 2d Det. 15000 Mu. V. Signal 1 No Signal 1 Vert. Sync 15000 Mu. V. V109B 12AU7 Separator Signal 6 No Signal 6 153 135 100 85 260 220 130 116 131 110 0 0.7 87 76 260 250 246 108 242 108 133 115 -8.4 -1.8 71 *50 to 100 E. Screen Pin No. Volts ----- 6 150 6 100 6 142 6 129 6 148 6 120 -- -- -- -- 4 263 4 251 6 258 6 108 6 255 6 108 6 172 6 162 -- -- -- -- E. Cathode Pin No. Volts 7 0 7 0 7 0 7 0 2 1 2 1.0 7 0.8 7 0.6 7 0 7 0 1 12 1 *5.1 2 0 2 0 8 19 8 18.5 2 <0.1 2 0.7 2 <0.1 2 0.5 2 2.1 2 1.9 3 0 3 0 8 0 8 0 E. Grid Pin No. Volts *_3 5 to -5 *_3 5 to -5 *_3 6 to -5 *_3 6 to -5 1 -5.8 1 -0.1 Notes on Measurements *Depending on channel *Depending on channel *Depending on channel *Depending on channel 1 0 1 0 1 -5.1 1 *-0.3 *Unreliable measuring point. Voltage depends on noise. -- 7.5 kc deviation at 1000 cycles - - *Unreliable measuring point. Voltage depends on noise. 1 -0.7 At min. volume 1 -0.6 At min. volume 5 -0.7 At min. volume 5 -0.7 At min. volume 1 -8.6 1 *-0.2 *Unreliable measuring point. Make measurement at T104 -B 1 -8.6 1 -0.2 1 0 1 0 2 -1.3 2 -0.6 7 -40 7 *-15 *Unreliable, depends on noise 12 275 - 276 21T242 TO SPEAKER BLK ORN. WHY BLU. TEL BRN BLK V104 CHASSIS WIRING DIAGRAM KCS72D-1 TIOG V108 V109 BAN " V102 CHANNEL IND. LAMP WHY BLK BRIGHTNESS wNT BLN CAN RITE. VERT HOLD 2:0 RED wNT TO 01733 9C0 NT BLK HT BLF ew T BUJ ANT OLD -RED GRIN Cle2 V115., TEL. GRN TEL BLV HOLE HOLE HOLE RED Figure 18-Chassis Wiring Diagram, KCS72D-1 15 R -E SECT ION SEE DRWG. J 103F HOLE GAN 2 OUT RED -2 IN NI"W5:PC (REAR view) TO PLATE CAP OF VHS C175 To OPLrATvEinCAP V118 alU 16 TELEVISION VOLTAGE CHART 273 21T242, 21T244 Tube No. Tube Type Function Operating Condition E. Plate No. Volts Video 15000 Mu. V. V110 6AG7 Amplifier Signal 8 130 No Signal 8 110 V111 AGC 15000 Mu. V. 6AU6 Amplifier Signal 5 -40 No Signal 5 +2.3 Hor. Sync 15000 Mu. V. V112A 6SN7GT Separator Signal 2 263 No Signal 2 258 Sync V112B 6SN7GT Output 15000 Mu. V. Signal 5 58 No Signal 5 48 V113 615 Vertical 15000 Mu. V. Oscillator Signal 3 70 No Signal 3 68 Vertical 15000 Mu. V. V114 6K6GT Output Signal 3 265 No Signal 3 253 Horizontal 15000 Mu. V. V115 6SN7GT Osc. Control Signal 2 165 No Signal 2 160 Horizontal 15000 Mu. V. V115 6SN7GT Oscillator Signal 5 185 No Signal 5 170 Horizontal 15000 Mu. V. V116 6BQ6GT Output Signal Cap No Signal Cap V117 1B3GT H. V. /8016 Rectifier 15000 Mu. V. Signal Cap No Signal Cap 15000 Mu. V. V118 6W4GT Damper Signal 5 270 No Signal 5 260 15000 Mu. V. V119 21AP4 Kinescope Signal Cap 14,000 No Signal Cap 13,600 V120 V121 5U4G 5Y3GT Rectifiers - 15000 Mu. V. Signal 4 & 6 No Signal 4 & 6 E. Screen Pin No. Volts E. Cathode Pin No. Volts 6 149 5 0.2 6 130 5 0.5 6 250 7 153 6 258 7 135 --3 190 -- 3 138 -- 6 0 --6 0 --8 0 -- 8 0 4 270 8 30 4 260 8 28 - - 3 +1.5 - - 3 -10 -- 6 0 -- 6 0 4 180 8 21.2 4 170 8 21.0 - - 2 & 7 14,000 - - 2 & 7 13,600 -- 3 -- 3 10 400 11 170 10 385 11 150 - - 2 & 8 285 2 & 8 275 E. Grid Pin No. Volts 4 -1.3 4 -0.6 Notes on Measurements AGC control set for normal operation AGC control set for normal operation 1 151 1 105 1 130 1 110 4 -2.1 4 +0.6 *Depends on noise 5 *Depends on setting of Vert. -15 hold control 5 -14 Voltages shown are synced pix adjustment 5 -5 5 -5 1 -21 1 -24 4 -80 4 -88 5 -13 5 -13 *High Voltage Pulse Present *High Voltage Pulse Present *High Voltage Pulse Present *High Voltage Pulse Present *High Voltage Pulse Present *High Voltage Pulse Present 2 120 At average Brightness 2 115 At average Brightness 13 TO L203 C209 A7771.4 14ATCMHD UNIT To TV CHASSIS TO 4104 f f t 6.34 to Ct t I 4 5G L. A r'' C Hi% I 31-D 7 IE RCAF MI / 114 L T (1) CAA R -F UNIT WIRING DIAGRAM 274 21T242, 21T244 SwITCE COttwECrORS AS SHOWN AaR VIEWED FROM DIRECTION OP AARON. ORH BON RE D 6.7 SI-C fRONT IE tt. <30 L29 S. Iii r I " ' 0 51-e ...mc REAR I Oa ,e RI (toL5ru0oss) Ib C25 LAB I Figure 17-R -F Unit Wiring Diagram 0-46513-0 CRITICAL LEAD DRESS: 1. Keep all wiring in the pix i-f, sound i-f and video circuits as short as possible. 2. Keep the leads on C118, C120, C122, C124, C126, R114, R121 and R123 as short and direct as possible. 3. Do not run any leads under C115 trimmer capacitor. 4: Dress C118 vertically parallel to terminals A and B of T104. Dress C135 parallel to terminals A and B of T104 close to the chassis. 5. Keep C127 away from chassis with no more than 1/4 inch leads at each end. 6. Dress the lead from T105(C) to the terminal board, close to the chassis. 7. Keep all filament leads dressed close to the chassis. 8. Ground filaments of V106, V107 and V108 independently of tube shields (pin 8). Use ground lances provided near pins of each socket. 9. Dress lead from pin 5 of V110 to 1102-2 close to the chassis. 10. Keep leads to L103 as short as possible. 11. Dress C130, C132, L102, L104, L105, L114, R131, R133, 8135 and R139 away from the chassis. 12. Do not tape kinescope cathode lead in with other kinescope leads. 13. Do not change the bus wire connections to pin 2 of V101 and V102. Sleeving is used to insure length and to prevent shorting. 14. Keep leads on C136 short and direct. Dress the lead from C136 to pin 5 of V111 as shown in wiring diagram. 15. Do not dress C170 in such a position that adjustment of T110 is inaccessible. 16. Keep the leads on 8201 as short and direct as possible. 17. Dress the lead from pin 3 of V113 to C153 as shown in the wiring diagram. 18. Mount C183 directly on the terminal board provided keeping it as far away from T109 as possible. 19. Dress all leads in the high voltage compartment away from each other and away from the high voltage transformer. 14 CHASSIS WIRING DIAGRAM, KCS72D-2 Figure 19-Chassis Wiring Diagram, KCS72D-2 17 18 277-278 21 T244 ww,srancrl§ fa; ,M.W"fr cns 'UT LL'3' L33 316-67AA t27 L26 L26 L25 R -F UNIT_ KRK8D ?A.! = 0 - ag JAL. TELEVISION CIRCUIT SCHEMATIC DIAGRAM 'nfral 6Ai5 or,ITrese 86 SCB6 ?A! 666 -ST 279-280 21T242, 2IT244 Tr.r.i.rrT,Z= 647 iist. 1 PRODUCTION CHANGES IN KC872D-1, RC£172D-2 The schematic1 shown in the late. condition. The notes below tell how early receivers differed from the schematic shown above. In some receivers, 8172, at pin 3 of V113, was 1.2 megohms. In some receivers, 8182, connected between terminal 1 of 8181 vertical linearity control and ground, was 470 ohms. REFER TO PAGES 236 TO 249 FOR TELEVISION ALIGNMENT PROCEDURE AND WAVE FORM PHOTOGRAPHS 19 :gg otVd, ,.;7a217.4. tt Nt t t 2 Sr All resistance values in ohms. 11 =1006. 411 capacitance values less than ii, MC ondabove lin MMF unless otherwisenoted. Direction of arrows at controls indicates clockwise rotation. et...79AB - AllzvoilLtaogesiKmei atsnurVedowltitah g"VnolslOhmyst'' hold FigmZ:LetonCicliiVth 281 21T242, 21T244 REPLACEMENT PARTS ewn DESCRIPTION STaCK DESCRIPTION pima 79201 Board iF UNIT,,MSEMBLISS iral Ircrii 3 7nMr,t Ind ...,,L,.... . 03e, -87350o, hm coax cable (7%.) oomP1ote with coil WP (C25) . P"' Mua-e"" 79173 79181 SMd- 6- a. Tr I o, I 7.7 73130 WW Inorsult. Zi,:oliel./31"nta:". and j ing stud foe trimmer C7 or (neoprene) for trimmer C7 CHASSIS ASSEMSLIES mE. (0031 316,18.8 gy,a:xci.t1o7r-4It,.T.4.4q.lzo,o..a.,),o,,..s.a,,T18,1r,.77,1..7(C82-47)...e.......0.. 76956 78499 Y8`477tEL=]1904 711171:1117,1134 Bracket -Channel indicator 4). )))...k.) 8/racket-Mounting bracket comp 1 with insulator foe E11 5188 4.3485 76138 Nilte 73891 75168 73748 73473 ;VA 73932 75185 PP.' y310 73960 73132 73453 73163 7.18 somaa 8.338 503113 803222 503233 511.1.247 503310 309322 303910 3164 71476 78177 76176 8==S;=: e.eltf`.°(28) Capacitor-Aa,..t.m., 7-00 enrol. (C22) 33098 75217 mfr Copacitor-Cermic. 15 romf. (C3) 33380 Capacitor -Ceramic, 93 men!. (53) 74476 Capacito40 "P:iit:Tge.::ir7'i:' VP`n7r1PflirgirC;O)") C:;:citoe-Ceramic: 330 mini: (Cloi ' 1.r -Ceramic. moo rnrnf. (631. 814, cm. cm) r -Ceramic. 1600 erten/. (018. C28) (111 76948 76873 Capacitor -Ceramic. WOO men, (.1) 47617 RIffor4t-L12.:)' ----"'"'-'' ""-" ;Ng Coil -Choke coll. .36 rotth1L4) 33640 Coil-Conveter plate loading coil (L41) 73094 eP'IIP=71i:Peri ((l'It(r87:11=esPrd=e:tiihgt TX Coii-Trmmor coil (3 turn.) wah adjusMble inductance 73473 :11o7(1.4e7676VPP 'Pa 'PP** P.4".PPP" 'PP P-. Contoct-Test point contact Dotent-Deeent inechanDm and fib. shaft Ferm-Coll form fer L43, 443 Link -Link aseembly foe fine tuning Pl8aetes--Frontrno.8t. oraa ehoft bearing "PP° 77693801 7743121. 7'''' 27 hms, .1. wio 7413) 150 ohm., att (74)) (R6)88 MO ohm., I oft 0 38E0 ohms, (09. R11) +Kw 9700 h 10.000 olmta I watt (RD % won (RD 7"PP 22500 ohms. 0- 1 % wart (117) 100500 ohm. ..110%. % watt (RI. DI. 113) 73043 Rad-Actuating plunger ...a (fibre) for one tuning 1tnk Solall-40 a l/e. adjusting screw for 1.8. 1.7. L8, Mt 4o %. adjusting...iv for LI D2. 13,L4D43 Pee" 87303 .'" ScrowY1-40 a 7/186 adjusting enemy Mr LS 73535 CCarappac.titooer--CMaicnaa.mitye. m10.r.n,mdf.u(aCl12710)-160 romf. (C1613. Cripacitor-Cor 2 rtunf. (0162) mmf. (0.203) Copocitor- rnmf. (C164) :;f:::::::::c ,i(fon.M./'.%202) Cap°crier-Mad. 120 mme. (clam apaczter-blzca. am room. (clan Capa.tor -Ceramic. 220 mmf. (0136) Capbciter-C. 270 'tiro,. (..) 231==M::: mmh (,T:: 21M Capacitor -Mica. 330 mmf. (C143) Capacime-Mlort, 390 rnmf. (CI. :1;:==m.lr;00-1ZnoTor .°:. (0:80, Cagacitor -Ceramic 4700 rnmf (C1113 CI20 C122 C133 81124, C18. C13) ' c7ra.PEIVPP8114PC4.17.17!.cf2AT' c"7" Capacitor -Ceramic. duol 10.000 rnmf. (CIOIA. C10113) Capaciror -.ramie. 10,00 Capa.me-Electreytc. 9 omit. fd.. 9(C0109%. C1(8.7.)) Capacitor-Adjutabl mica, 5-70 mini. (C113) 18IF 70:Ftibi'illFE1/1.a167)"?1.1'Plti - °2Ottli.PV:=1Cretik.ESB`811481. crs.18ra ' cPra,11%-ii7V.Jm,,,7814T °-°- -" ''''"'"'''' . elPONtii;i6lif'61e3r--.°" -"---a. -081 -12- .oveaa.3....-.,-:,,_e,,i...(-a,=,.,s..d,i-a,...-.-.-.-o-n--P1P.aP.P-"sPra.a.'. c'Sg=7,1=%,:rottla °`''''' '''' '..."....d. Caottorm-Asau181.4aper. eil impregnated. 5022 rad.. ;NT: 4111 79038 00191 30340 74573 :=7 -J:1 -1°:.:L7=7:171.':: '42 73117cTIOPZIliortten°1°Pt::::ctionsshie)d-ttnap-on iTP 3171.21,-;Ilitnezkiit. 7 centric.. miniature, ceramic. spoc_-r031y33 intion mg (formed tuningne tutting coin Spring -Hair pin spring for fin.u link SpNag-listaining Apring for adjusting (arm.. "139 Pa1l1,::7:4k.oesisrio=liPiosw1. :7. iT. 1R.37r,iLli3313.,101,88..117.1.0.,aL1c1., 73," c-attr-(ZTIV-r."°- °"'"'"°""a 07.17 -42- 7"" cumit7TAV- 0-°- *" i-----E .'''' n.".' 73735 .701:7.7,-,6-11.7°,8191)a1er. oil impregnate% .0033 rad., 73310 Cad14,8=111regid(rper, oil impregnated. 5047 mid.. ""'73P38 Currz,-;TeiTer. °-"'s °"'`""*"'''' ''''' -2" c783t7:;-(Ilt.t13P,Uari"P.PP""P'. ." P"a73'. cliPtliterCeirti;(CITea'a ""P ""PL°P"`"P"' 7"3P csott,17.-(SIT---°- In ir-----1. ."2 ''''.. 73797 Cazgtog.,,Zr4Iler. paper. oil impregnated. Ana mfd., Els1it.o.d,-,L,l(1ce4,,gLlaI), ,I,),48.r_1.@.1.7,....8(0.14.80.,LRII3D,))7(8,210%. PPPPP P.[P6-1t1t.lPl.:PCl9i=.31."eLcI.*LPIr.eL=3.P1P.4n. Lrn3,`1V7r6r.e1:P4,AP1P.83.Pre.CLaIOli, 770" PtliiiPlirar31;71:11%1Pr"(7631111:32:C:1172.3Prst: 75170 DrTPLerdiseg:nentIntnill lir-iii-L.'H. Ijiver' 73171 :1=?ilo.7.91.4.1 emranting striP-L.0. upp.-b1, M:2, SI'V=":=7,1:01P-ni':LnIvf;ii.,77,1h7r ;:;;. 3/84. tor CI ut:7;dtrZ,5t:171:2"E '27, `40 "PI `8"`.. 73798 CO rens (CI.) paper. oil impregnated. .022 odd.. 7P""Pir0=11.;b7-8at.i?,t7lafrr. ""P P" 'PP'"'''' '''' PP'PP 73811 Capacitor -Tubular. PO0o, Oil impregnated, .027 mid., 1060 val. (C176) 733" cmz:VZ;Tegr "" '1 im°`""'". ''a `P'" 7'3a clatt-nV8.4-'', *" '-°"--a '''''' m''" 75071 ComVotaTiabolar, mould paper..097 nif8. 100 volts """70gt1-(.6261'" "7" P" 'n.PP"PLPta '`." .P.P.. 83784 °-As=-:11117'81Z-°°' III ---'"--' 0.4 -92" 21 282 21T242, 21T244 REPLACEMENT PARTS Continued) BTaCK DESCRIPTION STOCK No. DESCRIPTION ""' clmtli,1-(Zrl'egwgg,-814.-gm-d. °.1 -m.. 7'"''' Cc.1..1. 3-,7..1..tr:.ItP-(.ZPr..Ao7i'l8i1m3P3r'e..g..n-o')tei-d--,-0'a.3. 7'-'ro"M"'.-. Oopotr. 7.39 ZOO volts (C179) Caatc,(LikI31.. PO,Or. Oil i0.PrO0.101.0. 0.03 mfd.. 73787 -Tubular. paper, oil impregnated. 0.97 mfd., 76938 311041 Cce).,.1(T1-s_etieA..,L:::M. m]..h(Ltt1iz1z3)..it (84)..e.,0 a,. oI TM) ca. (L1010 76640 Coil-PeakMg coil (1.5 mull (L107) 29212 c.il-P9qan9 992 (22 mull/ 0.101) 2.111:1:1::: :11 rsior"..-Z1'1,111, C-::'Z;:r:M.7,trt-' -°''') .37?11 N.8Z. :11 ROPPOrrrP!.4)Tirg. R216) °I. e° ;71;trmrn ..` toe .. n.. 60387 Caamor -8 2..t2.< female connector foe yak. lead 75542 Contiring, ...mot mom conn.tor -port of dell.tion Er°,1 ELT soma 3,,0,3,4,1,0, eg.M. 512416 50.384410, 303433 31.33 303436 903447 503496 300468 48 5::Zii,1 L'Isi; 0nla ,,g9313 ::12:1::: IA': .'1,.7.11,(Ig' RI"' R'" :::gg3 :LT:: I igt ...7,7:*(1'1:g) 82.0oo oho... ±110. 1 ....1 (0131/ 1,,0,,0598,0 ohms. 2)j%n.,Vjs ywo.lttt(0,)j8y3,, 13213) 1:0°:= : 130,660 ohms. V780...30.°217:. 330.000 ohms, 030.000 ohm% 39,000 ohms. 470.000 ohms. 56,000 ohms. 680.000 ohms. 820 . okunit. : ntellohm. T att (0139, 19174, 12137) 8(0185) an (Alen ott (R177) 98 (R137) Mt 01111, 12168) I (R190) 10 1 (11188) 10 (0112, RI47, 0150. 0200) 10 11 )8148. 0171) watt (0154. 0181) 10% 18 watt (74189 R133) wan (01.) ' 1:; 7, 11 :ego. 1.8 rnego,, w -V7:11.),) ritg41 watt(11197) 77008 39787 C2=ctor-Anade connector comp1ete with tormintdond contort t Phono input connector (J101) ,., ...n.°ior-n`mintilii on 903810 1453 l.o°P°r_'e°r",P,l.i.t: VAT)* 0"" 76487 Shaft-Co nnecting shaft (nylon) for picture and brio... 73.74 .cflar°-.......n.e. n8' ......(ili. iiir 98(iiT 73584 SIZTLPTPutthield for V101. V102. V103. me 75482 Connector -Video onn.tor (J102) 76373 Control-AOC control 1149) 773 r.n:TIV:ilt'itill`i:ateoVr109lamp socket and leads 76444 Control -Brightness control (R184) Nal 2oliI.il.ttzr:n',.r::,t..: ...m .....: (0170A. 76443 Control -Picture control (R137) 73129 11:21:17.111"...irr `17.al. wafer for VI03. VIII, V113. Nilel esPPPeortPVI-T.i"Ir'P`77"i.Pr'Pm'r. Pe'rP!P' "P`PP*"111!.,--'Igo -mounted 2,:217,,,..1.117, 7,, --af s'w"od WrtZTli,:"') RISS :::Sx.7.7 .. -*X Cum te hood ''''' 's,327127;F.iiLrtrIbrOm..-4717'..- '' ""''. ler V114 72627 Socket -Tube socket. 8 pin. steatite saddle -mounted for 7 1739 'ra" 7.4 784 8030 Lea vo ts P" `PPP."' ." trotnirtIg"ti!:tct: km yoke hood less rubber cushions ad complete with ye let V113 76971 "4" Socket -Tub bock... pin, wafer miniaturaf.e"ePVeI0n3d. PPro'ritroP1'. "P". PPP'. PPPP'`'''' "ddl 76636 Stud -Adjusting stud complete with guard far lamas 77303 S.tch-one control and hone swatch lee volume 8168 76141 ' ,.aol1-ftM1:, -*-'"--'''' P"" ]8398;° ANS agnet magnet on magnet (P.M. type) 76463 T.minal-Screw type grounding terniind /3 wan (RaOs77)0J'7 2T0r0am)t'.71'07t3r-c-sztl&-.°.240-1001ATEkr. 1: 12 : 11. 8. (81witlZradjumoble cores (T110) 761333 Resistor- wound. 850 ohm.] trans (0116) 76997 Transformer -0u.. transform. (TIOD I ed 76984 onsformen-ower transformer. 113 velem. 80 cycle 30...,03Z, 1 77112 ) en -Ratio detector tronform. (T102, C103) 502047 303047 503082 502118 11111 513158 303210 303229. 47 82 ahm 180 ohro 7*" 1000 ohrne. 2200 ohms, 4 ! ,li"" 35), 4i) ot RI02. R118, R120.19134, 01271 tt (0104, (212) 76981 78978 73973 78380 75482 o ra 0203) ..iiItTs'irTlit?tItTi 211'fil'n°,32. ' ::::6Pg:4g:.77,f1-77-- --s-"" "'" waTml fli 5 i'Iht'iaiii I Fa? !'n'a' *1u (TO 903233 3300 ohms. 0%. watt (02111 523233 3300 ohms. 302239 3900 ohms. 96 cantle 01131) (RI.. 8184) ;2,31.1 R.:::',..1:k.674.12.0rVisFsP". c"" 503233 MOO ohms. won (0194) 770' 1.!"gP12111110`7711.7.171"C1381`PP.133' k27(8. 303258 5600 ohms. watt (11138) 523266 6800 ohm.. g°322 SES: 4° '7' 11(1 (0103) . RADIO CHASSIS ASSEMBLIES 0C -1117B 302310 10500 144.5a,19108, 0123) (7or 88o2o1 21821. 42) 303312 :0133111 523318 503322 513322 503327 513333 503333 803397 512347 513347 I) 13000 ohms. 310%,.: 2,;:t7,;11170. ms.. R186, 111913) m.000 ohms. 10%. 2 watts (0133) 22.030 ohm.. 10%. % watt (R167. R217) aa.000 naeoo, o% ant (0199) 27.000 ahrns, 1% watt (0215) watt 33500 ohms. 2 10%. I watt ( 0214) 33000 oho...4 10%. % watt (0106. 11142) 47.000 ohm*. T 10%. 18 watt (RIM. R)60) 47,000 ohms. TM. 1 watt (R138) 47.000 ohms. -I- 10%, 1 watt 091321 iSel 78613 Telg 73851 3111: 7.53. ;rssl !cr.% capacitor complete with Capacitor -AdEastoble. trimmer. 2.5-30 rnrof. (C3) 8C::::=1:;=g::::':nloPly. tnic0m7Pr.8t.1M4%1110) of ea rni9.. Criegt.cW- c----- CP8VCS(D. .e' C173, C1716, Cl7C) e, pape. ..18 mid., I600 ro1 __ (C7. 11-°"'. 0"'-'-'''.'P.' P. -73- 40° -It m'a- 04° (1211) .°,8°..8`.-- g --it j, - '.. P*°... -or T.. P°9 :IP 0S1 cz: ,::::....:0,in.41..:ioont:7811. cm 22 283 REPLACEMENT PARTS (Continued) 21T242, 21T244 PTI°f`. DESCRIPTION STOCK DESCRIPTION 7007) Nrs C2,*,(1I:L=V1)1.°2'-,'4."r'"1'am.''in.'s'''r.-a""0"'"-"7 Ma- "°''''' 78536 Coil -Oscillator coil -complete with adjustable core 2,: 3.1S12 ggE - - V:::::r.x.:,==!4: roe for Power input (90 F11: 2:.:,,-1:::12:1:71,.:,-mIr.=ttt!:;..... r1 2==,., ''. 1 °... ..... (,,,,...) ,T: (1.2; 52.3i cvn...01.-8 .(i.i.8. imi(i 8°n.22.8J Dr 11°Y.r D'i.i.' 398%"7 98422 76674 73333 70392 C(Y5"7 otor-3 contact female cannectjr for phono cable Control -Volume conkrol (R11) Card -Delve cord lap roe. 33r overall) Cord -Pow rd on Plug PPuns 9 c*oko"7,7.1°'"P 74839 Fastenee-Push fastener to foston,DF shelf (4 retid).., ..33. ..iri"!,VRit.8.8.i. ..mi..' '. m°°...9 RF 11763 72602 38841 Larri7I'Dial larnp-maza. ePnullolery--oDneoiv. oora an]. 92, 72283 1112.! mig. 77378 mg Gromm u cape o g(1) Pt:":t17.)varioble tuning .cL Pc,T,,,to. Tct,r,I,l,i,t,t. Lar..s.1e.c,trmooYtt.io(4, .1jen P .. - _tation sel i aaa .: on. c ram noon... "3". .''. ... 303110 si./8,,1,2, '80 .. 4 70)0 1903 oh goorza gio,orl..h 14 4) Rln 13 033, 0321 n tom tu 77379 Ruiet 901,06410%." 0ax (RB 903127 aoo "" 30 1800 ohm " " 4.1.E.1..7:. 361.000 ohms.903913 5034. 220.000 ohm .33131011(7343)' 939K :3111? 0 66 s. 9 wat. (R22) o`l1R19) ? It 13. R14) -t1 R18) 303319 503318 503327 3.10324123 503427 303017 19.003 a 18,000 . we 1 27,000 o watt 2:ro 2 112;70 P. 4t ) 0) 220.000 oh at 270,800 o 470.000 oh wo -1109654 w1. 10) Rs, 0 2et 503810 ;24E s AI; malt 10 wol I 15) . .. - ='=t:rPV............. monaoa. roam.- 7303 7.40 73584 pea S'h a evii eh h Stihhtiiokltde-Tlu.m.bh1eo .s1haie:ldr.f.oTr V.L.2..,",. Vil. V3 88]3 3097 Bill fo=1 TeansL TR= - ho less volume control (SI) rn et? ...PD. wt. .dt er-12:11 i-f transformer coracle. with 2a- 145,0 (T2) r (Tot CHASSILTIMBLIES (For Model 21T244) ill 'c''r''i'l'.''.s°C-'ia°.cril' Er---- 3311 .::1r:12.idi7, VI CI -3, . . C41) 0 IN:2 Cmuraic, 93 PPalms,17 for Vit ]3111 ot, mai0.n wens. or ;MI ir.V4-13:717:use::::17: nl for function switch ertensi. sstf,t1_po,,,.t,,,......,,,,, Hai ' P. PL"PtVit.liir adjustable '''"P" TP,Pcitfrli:Tere (4 'PP"`°`"*P-PP''P'... PuP nsformer-Ist. i-f transformor-em -o.n.o.. w)r, adjustable core (TI2 nano 33726 with adjustable core (T4) neNEe`mm- adarstable core IT3) o ley 8 7745618 73811 39690 31:11 773747. 7 72 M9877939 73933 rano 3111 7315 7noe 3B11 AMPLIFIER ASSENIBLI M Capo 06.10 Cap Ca .°.. cm. .Ca rn . 290 f.r(o03. 6(8. C))M. / f C8 c4c 251/ 9. cu 74298 77929 (For Model 2IT2441 Cable -Shielded audio cable normal.% with pin plug C (`Pc".'12.34lytic comprising 1 enction of 30 Capacitor lactrolyt c. 2 Capac:tor tablar. Pon g°1:,(%%, ' 79643 Ca am loaCediA!CitieT" "*"."' gP(PPP'" 6P .004 930 Xis (sca . c 26. C o CP Tabula.: poPer. Clip-Moun no clip con -Antenna an I ..."'°I. .33' c") 8%gna x2l)3..25i Ma 7". c:::=-=-,9.. . cPc87`11.101) r2778 73697 SR'P.ii=set.n-nWmo p. l',-",: I .c..oVo.Wn......f2.,2 ,;.2...*. 12r4 1nPot rat od qr.,/ P on.rna a watts (0101) 2:11:Stmt..., A;L(..t1,;,?°,,...,,..:,...... core gra hog :tz., with adjustablepetatt COoailL*4.cLoS)il-FAI (L3) Coil-R.F coil -AM -complete (LDRL7) c*" -"V-.7.111., '71`riVZ:in 'n ° ....1......... ,. °:,... 0,ibt, .) 817231 .3368 303382 309447 73 ]%% 0300 ohms t wen 68.000 oh 82.300 o o, 470.000 :P 03) .0.--T b VT.onknesta,-rmubeee-sOPoeuctwp,.mutotr-aannns!°emeee.ln.2d) b.8md.(T4on 23 284 21T242, 21T244 REPLACEMENT PARTS (Continued) S Nocx DESCRIPTION NE SPEAKER ASSEMBLIES 92589-1EN RLI1131 RM-27.1 . ' coitl ((1122ohme) con* GM voice 042:(t;Cwrt.17717,= .17,...="' 'PlPrtr(Ve7.sPeP'PP 2,..1 r29 PP° er fu es on MI L 77.1 Sock-TIvittla,ZoMat . asrot comPle% with "841 W-;::T.11r.7.-=7.:0:mr:V71,;"'"" "-- P7:1F4 1:717-.J.7-..7..-"'72 for `'"*"1"" '"" -- ......., 22922 Bracket -111ongerbeacIret for defloction yoke hood 76697 Bracket-Mosking 00001.0rn bracket (30821 S":47;ud ...,.... '''''' m---..- -- ]7088 he . b.ac6d far en e6. Flea PTOCK Na. DESCRIPTION "''."" Ps"4 74983 K''in-.(o= "'PP' " ''' ".mVt..-.t-lo°n. .... 1,-:%1::rt-' - '- els 217.242 ana "intr7Zint . ab-Pic=cnnIrt.ht! - mr let' it; 'o.:IPX 747.1 aPnontorha otl o orT bens 77384 adtd4311ona Mnction mach -beige -Muter) for 'Una, PPPP3 for keled:1 21T242 77330 K4142otlio Mnctionwitch knob -maroon -for Model "'" Cra°71=1-'" ---' "'-'-'---(---) `PP "8" 773. x'al;FrAZL'- ---' k"'. Knob-Rocho 1.1.6 contrei, Moe z4 ''' °*".` 'w" c-o.n"t"nro"o8b-"P7 °'vm`)m.v" :701-;Trtrta:tztztr:.tztvzn.t.:::: bracket 7,379 Bomper_19ohber bumper Mr door for Model 21,244 77.57 CL.1ia1Dd-rfg°1A8r1...........r. c'.id..',.'°n°^"T.I.i..w.".i'..`......°.M..°...' '3" .°X.artla8:"8 ..'''. ...° ."'"" 3'. S'.3 71.2 70142 X3222 Catch -Bullet catch and etrike for cabinet doors Clantp-Diol clomp foe Model 21T942 CloM-rille cloth for blonde insteurnenD Or:ll cloth for '47" c°f`orr M=ojdgel ZrIT^S.`°' ...^...' ` Am-r...m. 780. m° .1.° P7f.P. V sr f 1801) bouts fee or Model 21T244 beard "'" cPtrelt7321PAPI'P.' P. ,,zrz : o-,,. ; 33." ...=:11.'.' ni' ..n......r .°` `........ 77461 Cord -Pow. cord troole 8 female) for tele- 38»B 76691 76827 77343 Mode.l-2R11a1b4b. cmhe for me. a Pend uDDen bracket Cushion -Rubber cushion Mr dust seeding th kin... Cushion -Rubber cuellion for .1111 111. ...I earl. unction for blond. in- 7M"D" ''Prt;i1Pdt=rn'ZIrst:IZLIP2tgl%." ."'""" Degaadio control and function 922,21 for moa, 7".3 rn`t,Trt.ntt. itrreirgeuPPPPP`'.."°` m.'" 77343 9333 77334 D.o2c1Ta2l4t-47TJlee.tsrieoPnacloenntProalrpt`aPni:e1l4fu°.n:ictti4io.n719.2.121.it4foi7r MM(e1a%d Dial-Oloo dial scale for Model 211192 Dia1-Oleic dial scale for Model 211194 74203 .1395 MU 37396 320 71784 790 Escutcheon 1T12 4 -Dial escukcheon 422 .9I:2d. dI..a. d29t2e9r, M21oTd24a2l Glass-SalD Glass OrennenetRubbor grommet for elreak. mounNog laced) handle for Hinge -Butt hin go for L.H. doer for Modal 21TM2 Hinge -jilt. hinge for H. door for Model 211244 Hinge -Cabinet door kin. (1.0 for main deo. PS"S ....on-u...iior Modol 211.24 77388 1,7ronsfer switch knob-beigeuteri for 290221 77387 Ii74,- eTlr2a1n,s4f3er switch knob- moroon -Muter/ M- -Food up - 77013 Nut-Spoed nut to fasten -RCA Victor- emblem 78801 ad-Kinescop .06 SUPPO pod (4 reg..) 77ii Po1==111M1: rollunt`ttg 0°' (......)-.,40- 77048 Prin,11.oeclut.rtme mounting can (mtal)-plum_ jr.:2:.%jna.., nno PlmeyDiell hack plate le. .21 2.9 noi2.2. for 29.am y.80 - 78888 Iciniltt,I,Irt,titrinnt ='41" °.:.1;f8a4'=28riz'2t".I"r."Z."....-i.,..;:... ° grO6P rrt---0=nnTetTrfo. r7= yt = !uti 7.32 011=21Laining eon, Mr slide mechanism stop pin 23.790. 33sw"lien1g5-.-...1.,,Vm3, e.1rMr7q3fforr knob moo ooa 75984 7=.111a 17"38P8 P7321. 72595 74734 SpLimSpring clip for Imo 37308 and T7330 for Model 72308 Stop -Door 10010 7.00 Sivaon p-Orounding strap 1.003. 1/2. ., .00 0010,... tr1P) non 77390 vWiromrth-ecr2-Cne.lil2ul2a2w,9a.s2hhe9r r-2.I.dkllniioi b0e.1O1n1o.rtr0a. mDJ. r...ter ....... MSS Woher Felt waeher beige betrieen knob and channel 78800 maunt .e APPLY TO YOUR R. DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 29 RCAVICTOR UHF Selector Model VIA, UIB UHF SELECTOR MODELS U1A, U1B Chassis Nos. KRK 19, KRK 19A - Mfr. No. 274 - SERVICE DATA - 1952 No. T6 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. GENERAL DESCRIPTION UHF Selectors Models U1A and UIB permit the reception of any one UHF television station within receiving range when employed with a VHF television receiver. The unit employs one tube and a crystal rectifier. Filament and plate power is obtained from the receiver to which it is attached. The two models are identical except for power cables. The UHF Selector units may be mounted on the back of the receiver cabinet or other convenient location, as long as the selector switch is accessible. ELECTRICAL SPECIFICATIONS TELEVISION R -F FREQUENCY RANGE All 70 UHF television channels I -F Output Frequency 470 mc. to 890 mc. Channel 5 or 6 POWER SUPPLY RATING Filament Plate 6.3 volts, .225 amps. Approx. 10 ma at 70 to 370 volts (see text) ANTENNA INPUT IMPEDANCE 72 ohms unbalanced. TUBE COMPLEMENT Tube Used RCA 6AF4 CK 710 Function R -F Oscillator Crystal Mixer INSTALLATION INSTRUCTIONS UHF Selector U1A is provided with a 52 inch power cable with a 7 pin miniature adapter socket for use with television receivers which employ a 6AQ5 audio output stage. UHF Selector U1B is provided with a similar power cable except that it employs an octal adapter socket for use with television receivers which use a 6K6GT or 6V6 audio output tube. Table No. 2 on pages 3 and 4 lists all RCA Victor television receivers to date and the UHF Selector to be employed. Consult the table and select the proper selector for the receiver. Mount the UHF Selector on the back cover of the cabinet with the adjustment screw holes facing up. Be sure to locate the selector so that the selector switch may be reached conveniently from the top or side of the cabinet and so that the cables may be easily attached. Mount the selector VHF terminal board on the back of the cabinet. To install the UHF Selector power cable, remove the television receiver audio output the receiver audio tube tube and plug socket. the In adapter socket into all television -radio combinations, except models 21T242 and 21T244 plug the adapter into the radio's audio output tube audio output tube into the adapter socket. sGorcokuentd. Itnhseerbtlatchke lead with the spade terminal under the most convenient screw on the chassis. Dress the power cable out the back of the cabinet in the most convenient and orderly manner. With the cnd of the power cable hanging out the back of the cabinet fasten the receiver back cover cable is not pinched under at cable to the selector. in place making sure that the any point. Connect the power Connect terminals. the UHF antenna to the UHF Selector UHF antenna Connect the VHF antenna to the Selector's terminals. VHF antenna Connect the UHF Selector output leads ceiver antenna terminals. to the television re- The UHF Selector is wired with a jumper across R6 as shown in the schematic diagram for receivers which provide 270 volts at the adapter socket. If the receiver provides 370 volts at the adapter socket, the jumper across R6 should be removed. See Table 2 for recommendations for RCA Victor receivers. USE ON OTHER MAKES OF RECEIVERS The U1A and U1B UHF Selectors will provide satisfactory UHF reception on other makes of receivers provided that the proper voltages for operation of the selector can be obtained from the receiver. The U1A and U1B UHF Selectors were designed for use on receivers in which the tube filaments are fed in parallel from a 6.3 volt transformer winding. Since the black lead of the selector power cable is connected to the selector chassis, the Ul series selectors should not be employed with any receiver in which a direct connection exists between the a -c power line and the receiver d -c power supply. The plate voltage available from the receiver may not be optimum for operation of the selector as wired. It is very important that between 60 and 90 volts should be present at the junction of R2 and R6 in order to obtain optimum crystal current. The voltage at the junction of R2 and R6 should be measured with a "VoltOhmyst" and with the UHF Selector shield in place. To obtain proper voltage at R2 and R6, shunt R4. R5 and Ft6 as necessary with resistors of adequate wattage to obtain the desired voltage. The television receiver operating voltages should not be materially altered by the installation of the UHF Selector. In some makes of receivers it may be necessary to rewire the adapter socket and cable to suit the particular type of audio output tube. In some instances where filament wiring difficulties are encountered, it may be necessary to remove the adapter socket and wire the power cable into the television re- ceiver. 286 U1A, U113 INSTALLATION INSTRUCTIONS ADJUSTMENT INSTRUCTIONS The 6AF4 oscillator coil is provided with shorting Jumper "B" which is connected in place in a new UHF Selector unit. With this strap in place, the selector will tune from channel 45 through 83. If the channel to be received is below channel 45, Jumper "B" must be clipped out and removed. The selector will then tune from channel 14 through 44. Turn the receiver on and to channel 5 or 6, whichever is vacant in the operating area. Switch the UHF Selector switch to the UHF operating position. Set the television receiver fine tuning control to the middle of its range and the volume control clockwise until background noise is heard. Adjust the UHF Selector Primary, Secondary and Oscillator adjustments to the approximate locations as indicated in Table 1. Adjust the selector oscillator trimmer C13 until sound from the desired UHF station is heard. This adjustment must be made very slowly for it is easy to pass by the proper adjustment point without hearing the sound, particularly if the signal is weak. Once the sound is obtained, adjust the primary trimmer Cl for the best sound and picture. Next, adjust the secondary trimmer C3 for best sound and picture. Readjust the UHF Selector oscillator trimmer so that the best sound and picture occur when the television receiver fine tuning control is in the middle of its range. Repeak Cl and C3 for best sound and picture. Note: In adjusting the UHF Selector oscillator, it may be possible to obtain sound in two positions of the oscillator trimmer. However, for proper reception of both sound and picture, the oscillator should be lower in frequency than the station picture carrier. Therefore, if sound is heard in two positions of the trimmer, the most clockwise position is the correct one. The input circuits to the UHF Selector tune very sharplyparticularly the primary. If the UHF signal is very weak, the primary and secondary trimmers Cl and C3 must be in approximately the correct adjustment in order to be able to hear the sound upon adjusting the oscillator trimmer C13. If it is not possible to hear the sound by the method described above. preset the primary and secondary trimmers one -quarter turn in the same direction from their previous position and search for the sound by adjustment of oscillator trimmer C13. Repeat this procedure until the sound is obtained. If the above method should not work, try connecting one side of the transmission line to the crystal at L2 and the other side to the chassis. Under some conditions interfering beats may be obtained between the UHF Selector oscillator and harmonics of the television receiver oscillator which show up as lines in the picture. In some cases these may be eliminated by adjusting the receiver fine tuning for elimination of the beat, then retuning the selector oscillator core for best sound and picture. As an alternate method switch the television receiver to any vacant channel between 2 and 6 and retune the UHF Selector oscillator trimmer C13 to obtain sound and picture. Under some conditions, adjacent channel interference may be experienced if the VHF station is strong and the UHF signal is weak. In such cases, it may be desirable to provide a shielded cable between the UHF Selector unit and the television receiver r -f unit. As a test for drift, turn the receiver off for five minutes then turn it on again. Within approximately one minute it should be possible to receive the UHF station by adjustment of the receiver fine tuning control and without the necessity of readjusting the UHF Selector oscillator. When it is desired to receive a VHF station on the television receiver, switch the UHF selector switch to the VHF position and operate the receiver normally. TABLE 1-ADJUSTMENTS VERSUS CHANNEL NUMBER CHANNEL PRIMARY & SECONDARY OSCILLATOR 14 15-16 17-19 20-23 24-27 28-32 33-37 38.41 42.44 45-46 47-50 51-54 55-60 61-67 68-75 76-82 83 6.5 turns CW 5.5 turns CW 5.0 turns CW 4.5 turns CW 3.5 turns CW 2.5 turns CW 2.0 turns CW 1.5 turns CW 1.0 turn CW .5 turn CW .5 turn CCW 1.0 turn CCW 1.5 turns CCW 2.0 turns CCW 2.5 turns CCW 3.0 turns CCW 3.5 turns CCW 1 turn CW 1 turn CCW 2 turns CCW 3 turns CCW 4 turns CCW 5 turns CCW 6 turns CCW 7 turns CCW 8 turns CCW 1 turn CW 1 turn CCW 2 turns CCW 3 turns CCW 4 turns CCW 5 turns CCW 6 turns CCW 7 turns CCW The above tabulation is based on the assumption that the Selector is aligned to 670 mc, the condition in which the unit leaves the factory. CW means clockwise. CCW means counter clockwise. C2 CI 0.5-5 JI U.H.F. ANT. 1 I ce 1 1--)47 C3 0.5- 5 CR CK-710 MIXER VI 6AF4 05C. RI 10K L__ CIz L6 C I I /1000 TI L3 1-F TRANS. OPER. 1000 111C0I0O0 R6 R4 33K JUMPER CONNECTED L9 FOR CHANNELS IN UPPER HALF OF U.H.F SPECTRUIN C13 1 0.5 -3 1 _J V.H.F. OPE R. w2 WI TO V.H.F. ANT. TO V.H.F. REC . RED J2 -M PIN VIEW TO V. H . F. CHASSIS POWER CABLE C.46459 -0 287 REPLACEMENT PARTS U1A, U1B TO 72 OHM CO -AX INPUT UHF SAWN -TO MATCH 300 OHM BALANCED LINE TO SE LECTOR 72 ONM CO -AA INPUT BALUN-In some cases it may be possible to employ the VHF antenna for UHF reception by connecting a balun to the selector VHF antenna terminal board and to Jl. Check to insure that the permanently connected balun does not impair VHF reception. TABLE The table below lists all RCA Victor television receivers NO. 2 to date and data regarding the selector to be employed. The voltages in the receiver and hence the voltage at the selector may vary depending on the signal strength, the a -c line voltage and the particular chassis involved. In some cases, therefore, it may be necessary to employ slightly different values of resistors across R4 than that specified in the table below. In any event, the voltage at the junction of R2 and R6 should be between 60 and 90 volts as measured with a "VoltOhmyst" with the selector shield in place, with the receiver operating and the desired UHF channel being received. STOCK No. DESCRIPTION 77275 Adapter -7 pin miniature tube adapter for U1A 77276 Adapter-Standard octal tube adapter ter UM 74104 Board-"VHF Antenna" terminal board, less cable 77273 Capacitor-Tubular trimmer, 0.5-3 mmf., complete with adjustable core (C13) 77272 Capacitor-Tubular trimmer, 0 5-5.0 mmf., complete with adjustable core (Cl, C3) 77277 Capacitor-Ceramic, 3 mini. (C4) . 76557 Capacitor-Ceramic, 22 mmf. (C5) 77278 Capacitor-Ceramic, disc, 47 mmf. (C8. C9) 77084 Capacitor-Ceramic, feed-thru, 1000 mmf. (C10. C11, C12) 77280 Coil-Cathode choke coil (L8, R3) 77279 Coil-Heater choke coil (L3, L6, L7) 77281 Coil-Oscillator coil (L9) 77088 Connector-Single contact, for antenna connection (Jl) 5040 Connector -4 contact female, for adapter cable (J2) 5039 Connector -4 contact male connector for power cable 77271 Printed Circuit-Input printed circuit comprising two inductances and one capacitance (Ll. L2, C2) 77282 Rectifier-Germanium crystal rectifier (CR1) Resistor-Fixed, composition: 503210 1000 ohms, -±10%, 1/2 watt (R2) 523282 8200 ohms, ±-10%, 2 watts (R6) 503310 10,000 ohms, -±-10%, 1/2 watt (R1) 523333 33.000 ohms. ±10%, 2 watts (R4, R5) 75192 Shield-Tube shield for VI 77274 Socket-Tube socket, 7 pin, miniature, steatite sad- dle -mounted for VI 76961 Spring-Retaining spring for tube shield 46760 Switch-"UHF-VHF" switch (SI, S2) 77283 Transformer-I-F transformer (T1) RECEIVER MODELS 621TS 630TS, 630TCS 641TV 648PTK 648PV 721TS, 721TCS 730TV1, 730TV2 741PCS 8PCS41 8TS30 8TV41 87241, 87243, 8T244 8T270, 8TC270, 8TC271 8TR29, 8TK29 8TK320 8TV321, 8TV323 9PC41 9T240, 9T240K, 9TC240 9TC245, 9TS247, 9TC249 9T246 97256 9T270, 9TC272, 9TC275 9TW309 9TW333 AUDIO OUTPUT TUBE VOLTS 6K6GT 200 6K6GT 265 6F6G 270 6F6G 270 6F6G 270 6K6GT 200 6K6GT 245 6F6G 250 6F6G 250 6K6GT 245 6F6G 270 6K6GT 80 6K6GT 152 6K6GT 80 6V6GT 152 6V6GT 295 6F6G 250 6K6GT 80 6K6GT 80 6K6GT 80 6K6GT 80 6K6GT 152 6V6GT 80 6V6GT 217 USE SELECTOR U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B U1B 'JUMPER ACROSS R6 Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In Leave In JUMPER OR RESISTOR ACROSS R4 AND R5 22K, 1 watt None None None None 22K, 1 watt None None None None None Jumper across R4 6.8K, 0.5 watt Jumper across R4 6.8K, 0.5 watt None None Jumper across R4 Jumper across R4 Jumper across R4 Jumper across R4 6.8K, 0.5 watt Jumper across R4 33K, 1 watt 288 U1A, U1B TABLE NO. 2 -Continued RECEIVER MODELS 9TW390 T100 T120, T121 TC124, TC125, TC127 TA128 TA129 T164, TC165, TC166, TC167, TC168 TA169 S1000 2151, 2T61 2T81 4T101 4T141 6172 6T53, 6T54, 6T64, 6T65 6T71, 6T74, 6T75, 6T76 6T84 6T86, 6T87 7T103, 71103B, 7T104, 7T104B 7T11B, 7T112, 71112B, 7T122 71122B, 7T123, 7T123B, 7T124 71125B 7T132 7T143 9T57, 9T77, 9T79 9T89 9T105, 9T126, 9T128 9T147 161152 17T150, 17T151, 17T163 17T153, 171154, 17T155, 17T160 17T162, 17T172, 17T172K, 17T173 17T173K, 171174, 17T174K 17T200, 17T201, 17T202 17T211, 17T220 17T250DE, 17T261DE 211159, 21T1S9DE, 21T165 21T174DE, 21T176, 21T177 21T178, 21T178DE, 21T179, 21T179DE 21T197DE 21T208, 211217, 21T218 21T227, 21T228, 21T229 21T242 See note below 21T244 See note below AUDIO OUTPUT TUBE VOLTS 6V6GT 210 6K6GT 80 6K6GT 80 6K6GT 90 6V6GT 80 6V6GT 80 6K6GT 120 6V6GT 85 6V6GT 210 6AQ5 268 6V6GT 210 6AQ5 270 6V6GT 210 6K6GT 120 6K6GT 360 6K6GT 360 6V6GT 20 6V6GT 290 6K6GT 360 6K6GT 360 6K6GT 360 6K6GT 360 6AQ5 360 6V6GT 290 6K6GT 360 6V6GT 290 6K6GT 360 6V6GT 290 6K6GT 360 6AQ5 250 6AQ5 250 6AQ5 250 6AQ5 250 6K6GT 250 6K6GT 250 6AQ5 250 6AQ5 356 6AQ5 356 6AQ5 356 6V6GT 290 6K6GT 250 6K6GT 250 6K6GT 250 6K6GT 250 USE SELECTOR U1B U1B U1B U1B U1B U1B U1B U1B U1B U1A U1B UlA U1B U1B U1B UIB U1B U1B U1B UIB U1B U1B U1A U1B U1B U1B U1B U1B U1B U1A U1A U1A U1A U1B U1B U1A U1A U1A U1A UIB U1B U1B U1B U1B JUMPER ACROSS R6 Leave In JUMPER OR RESISTOR ACROSS R4 AND R5 27K, 1 watt Leave In Jumper across R4 Leave In Jumper across R4 Leave In Jumper across R4 Leave In Jumper across R4 Leave In Jumper across R4 Leave In 5K, 1 watt Leave In Jumper across R4 Leave In 27K, 1 watt Leave In None . Leave In 27K, 1 watt Leave In None Leave In 27K, 1 watt Leave In 5K, 1 watt Clip Out None Clip Out None Leave In 27K, 1 watt Leave In None Clip Out None Clip Out None Clip Out None Clip Out None Leave In None Leave In None Clip Out None Leave In None Clip Out None Leave In None Clip Out None Leave In None Leave In None Leave In None Leave In None Leave In None Leave In None Leave In None Clip Out None Clip Out None Clip Out None Leave In None Leave In None Leave In None Leave In None Leave In None NOTE: Model 21T242 sary to plug system. and the 21T244 power craebceleivaedrsahpatevre separate into the audio systems for radio television audio output and television operation. tube socket rather than It is therefore into the radio necesaudio RCAVICTOR UHF SELECTORS UHF Selectors Models U2, U2A MODELS U2, U2A Chassis Nos. KCS 79 or KCS 79A - Mfr. No. 274 - SERVICE DATA - 1952 No. T7 - PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. GENERAL DESCRIPTION UHF Selectors Models U2 and U2A permit the reception of any two UHF television stations within receiving range when employed with a VHF television receiver. These units employ two tubes, a crystal rectifier and a selenium power rectifier. The units are housed in small metal cabinets and are operated by a single control knob. ELECTRICAL SP ECIFICATIONS TELEVISION R -F FREQUENCY RANGE All 70 UHF television channels I -F Output Frequency 470 mc. to 890 mc. Channel 5 or 6 POWER SUPPLY RATING WEIGHT AND DIMENSIONS Net Weight Shipping Weight Width Inches 5 61/2 8% Height Inches 49/16 Depth Inches 73/8 ANTENNA INPUT IMPEDANCE UHF -300 ohms balanced (or 72 ohms unbalanced on U2). VHF -300 ohms balanced. TUBE COMPLEMENT Tube Used CK 710 6BQ7 (U2), 6BQ7A (U2A) 6CB6. Function Crystal Mixer R -F Oscillator I -F Amplifier INSTALLATION INSTRUCTIONS Remove the UHF Selector from the shipping carton. Make sure that all tubes are in place and firmly seated in their sockets. Place the selector on top of or near the VHF television receiver in a position which will permit convenient operation. The UHF Selectors have been designed to operate from either of two or three types of antenna installations. They will operate from the VHF antenna, or from a separate UHF antenna with 300 ohm transmission line (or with the U2, from a separate UHF antenna with 72 ohm co -ax transmission line). In all cases, the VHF antenna transmission line must be disconnected from the VHF receiver and reconnected to the selector VHF antenna terminals. A short length of 300 ohm line must then be connected between the VHF receiver antenna terminals and the selector terminals marked "Receiver". If the UHF signals from the VHF antenna are strong and free from reflections, the above connections are all that are required. Model U2 If a separate UHF antenna with 300 ohm transmission line is employed, connect the line to the terminal board marked "UHF". Then disconnect the 300 ohm line to the UHF terminal board TB1 on the inside of the selector. Make sure that the balun is connected to the terminal board marked "UHF" and is also connected to the selector input jack 11. If a separate UHF antenna with 72 ohm co -ax transmission line is employed, remove the balun from 11, attach a male co -ax fitting to the UHF antenna transmission line and plug it into the selector co -ax input 11. Dress or tape the co -ax line so that it cannot be pulled out if the customer moves the selector. See figures 1 2 and 3 for proper connections of the different transmission lines. Model U2A If a separate UHF antenna with 300 ohm transmission line is employed, connect the line to the terminal board marked "UHF ANT". Disconnect the 300 ohm jumper to the "UHF ANT" terminal board, at the UHF ANT terminal board TB4. If desired a separate UHF antenna with 72 ohm co -ax transmission line may be employed. Remove the jumper from TB4 and connect the co -ax transmission line, through a "balun" to the "UHF ANT" terminal board. See figures 4, 5 and 6 for proper connections of the different transmission lines. Plug the television receiver power cord into the a -c receptacle on the back of the selector, and plug the selector power cord into the nearest 110 volt a -c outlet. With this connection, if the VHF receiver "on -off" switch is left in the on position, both the receiver and the selector will be controlled by the selector switch. With the selector switch in the VHF position, the receiver is turned on, the selector is on byt in standby condition and the VHF antenna is connected through to the receiver. With the selector switch in the UHF 1 position, the selector is operating, the VHF antenna is disconnected from the receiver, the selector output is connected to the receiver and the antenna employed for UHF operation is connected to the selector input. A similar condition exists when the selector switch is in the UHF 2 position. To receive a UHF station, switch the selector switch to UHF 1 or UHF 2 and the television receiver to channel 5 or 6, whichever is vacant in the receiving area. Tune the VHF receiver fine tuning control to obtain the best sound and picture. 290 U2, U2A Otti6 ig ;10 010 INSTALLATION INSTRUCTIONS Model 112 0(0 010 NIA Figure 1 -Connections for Employing VHF Antenna for UHF Reception Pt. J 310 °Jo HOE 7r, -C= Figure 4 -Connections for Employing VHF Antenna for UHF Reception Figure 2 -Connection for Employing Separate UHF Antenna with 300 Ohm Lead -In Model U2A Figure 5 -Connection for Employing Separate UHF Antenna with 300 Ohm Lead -In Figure 3 -Connection for Employing Separate UHF Antenna with 72 Ohm Co -as Lead -In nun is fOo RI C= rind[ Figure 6 -Connection for Employing Separate UHF Antenna with 72 Obm Co -ax Lead -In ADJUSTMENT INSTRUCTIONS To adjust the UHF selectors to the particular UHF stations to be received, connect the antenna, selector and VHF receiver as indicated in the installation instructions on page 1. Tune the VHF receiver to channel 5 or 6 whichever is vacant in the receiving area. Set the UHF selector switch to UHF 1. Preset the oscillator tank capacitor C15 and the harmonic tank capacitor C19 as indicated in the table. Temporarily connect the UHF antenna directly to the crystal CR1 as follows. Disconnect the balun matching stub from the input jack J1 (or the 300 ohm jumper on Model U2A from the UHF ANT terminal board). Connect a bus wire to the center conductor of the balun connector PI (on U2A to right hand terminal of UHF ANT terminal board TB4). Insert the other end of the bus wire 11/2 inches straight into the 1/4 inch hole directly below 11 (or TB4) on the selector chassis rear apron. Make contact with the center of the black eyelet terminal. Adjust C15 slightly until sound is heard, then retouch C15 and C19 for best sound and picture with minimum interference. The use of an insulated slotted tuning stick is recommended for these adjustments. Remove the bus wire and reconnect the balun to 11 or jumper to TB4. Starting C2 and C4 at minimum capacity (maximum counterclockwise) turn both trimmers to obtain the best sound and picture. To adjust the U2 UHF selector for a second channel, switch the selector switch to UHF 2. Preset the oscillator capacitor C14 and the harmonic tank capacitor C18 as indicated in the appropriate table. Connect the antenna to the crystal as before. Tune C14 slightly until sound is heard then adjust C14 and C18 until best sound and picture with minimum interference is obtained. Then reconnect the antenna to J1 or TB4 and tune Cl and C3 for best sound and picture. ADJUSTMENTS VERSUS CHANNEL NUMBER Model U2 The turns listed in the table below are from the minimum capacity position of the trimmer -(maximum counterclockwise position). UHF Channel 14-16 17-19 20-22 23-25 OSC Tank C14 or C15 13.0 turns CW 11.5 turns CW 10.25 turns CW 9.0 turns CW Harmonic Tank C18 or C19 12.5 turns CW 11.5 turns CW 10.25 turns CW 9.5 turns CW UHF Channel 26-28 29-31 32-34 35-37 38.40 41-43 44-46 47-49 50-52 53-55 56-58 59-61 62-64 65-67 68-70 7 1-73 74-76 77-79 80-83 OSC Tank C14 or C15 8.25 turns CW 7.25 turns CW 6.25 turns CW 5.5 turns CW 4.75 turns CW 4.25 turns CW 3.5 turns CW 13.0 turns CW 12.25 turns CW 11.25 turns CW 10.5 turns CW 9.5 turns CW 9.0 turns CW 8.25 turns CW 7.75 turns CW 7.0 turns CW 6.5 turns CW 6.0 turns CW 5.5 turns CW Harmonic Tank C18 or C19 8.5 turns CW 7.75 turns CW 7.0 turns CW 6.5 turns CW 6.25 turns CW 5.75 turns CW 5.25 turns CW 5.0 turns CW 4.75 turns CW 4.25 turns CW 4.0 turns CW 3.5 turns CW 3.25 turns CW 3.0 turns CW 2.75 turns CW 2.5 turns CW 2.25 turns CW 2.0 turns CW 1.75 turns CW ADJUSTMENTS VERSUS CHANNEL NUMBER Model U2A The turns listed in the table below are from the minimum capacity position of the trimmer -(maximum counterclockwise position). UHF Channel OSC Tank C14 or C15 Harmonic Tank C18 or C19 .14-16 17-19 20-22 23-25 26-28 29-3 1 32-34 35-37 38-40 4 1-43 44-46 47-49 50-52 53-55 56-58 59-61 62-64 65-67 68-70 71-73 74-76 77-79 80-83 16.25 turns CW 14.75 turns CW 13.25 turns CW 11.75 turns CW 10.5 turns CW 9.25 turns CW 8.0 turns CW 7.0 turns CW 6.0 turns CW 5.0 turns CW 3.75 turns CW 16.25 turns CW 15.5 turns CW 14.5 turns CW 13.5 turns CW 12.5 turns CW 11.5 turns CW 10.75 turns CW 9.75 turns CW 9.0 turns CW 8.25 turns CW 7.5 turns CW 5.5' turns CW 11.0 turns CW 9.75 turns CW 8.75 turns CW 8.0 turns CW 7.25 turns CW 6.5 turns CW 5.75 turns CW 5.25 turns CW 4.75 turns CW 4.5 turns CW 4.0 turns CW 3.75 turns CW 3.5 turns CW 3.25 turns CW 3.0 turns CW 2.75 turns CW 2.5 turns CW 2.25 turns CW 2.0 turns CW 1.75 turns CW 1.5 turns CW 1.25 turns CW 1.0 turns CW 2 ALIGNMENT DATA 291 U2, U2A Notes on Adjustments-For proper reception, the oscillator harmonic employed for conversion must be lower in frequency than the UHF station. If two slightly different positions of the oscillator core produce sound from the desired station, the most clockwise position is the correct one. In tuning one oscillator it may occasionally happen that the oscillator tank of the circuit not in use may be tuned to the same frequency. If this occurs, the second oscillator tank may act as a trap absorbing energy from the first oscillator and causing poor operation. In such a case, detune the second oscillator tank until the first oscillator circuit is adjusted. Once adjusted for the proper channels no difficulty should be experienced from this source as it is extremely unlikely that both oscillators would be operating on the same frequency. When properly aligned, the crystal current should be 0.75 for best noise figure. This current can be measured by disconnecting the test link on top of the chassis and inserting a 0-5 milliampere meter between the link and ground. Under some conditions interfering beats may be obtained between the UHF Selector oscillator and harmonics of the television receiver oscillator which show up as lines in the picture. In some cases these may be eliminated by adjusting the receiver fine tuning for elimination of the beat, then returning the selector oscillator core for best sound and picture. The oscillators in the selectors operate in the 200 mc. to 300 mc. range. The oscillator signal applied to the crystal mixer is taken from a harmonic tank in the oscillator circuits. The usual practice as listed in the table is to employ the oscillator second harmonic for reception of channels 14 through 46, and the third harmonic for reception of channels 47 through 83. In rare cases where interference is obtained due to a beat between the UHF selector oscillator and a harmonic of the VHF receiver oscillator, it may be possible to eliminate it by tuning the oscillator to a different frequency and employing a different harmonic. Under some conditions, adjacent channel interference may be experienced if the VHF station is strong and the UHF signal is weak. In such cases, it may be desirable to provide a shielded cable between the UHF Selector unit and the television receiver r -f unit. As a test for drift, turn the selector off for five minutes then turn it on again. Within approximately one minute it should be possible to receive the UHF station by adjustment of the receiver fine tuning control and without the necessity of readjusting the UHF Selector oscillator. When it is desired to receive a VHF station on the television receiver, switch the selector switch to the VHF position and operate the receiver normally. I -F ALIGNMENT Construct a 300 ohm balanced detector as shown in figure 8 and connect it to the VHF selector terminal board marked "Receiver" (TB2). Connect a high gain oscilloscope to the balanced detector and set the gain to maximum. Connect an attenuator pad of the type shown in figure 9 to the output cable of the VHF sweep generator. Connect the output of the attenuator pad through a 470 mmf. ceramic capacitor to the cathode, pin 2 of VI. Set the sweep generator to sweep from 70 mc. to 95 mc. As an alternate method when using RCA type WR59 sweep generators, switch the generator to channel 5 to see the low frequency side of the response curve and to channel 6 to see the high frequency side of the response curve. Insert markers from a VHF marker generator by loosely coupling the generator output cable to the cathode, pin 2 of VI. Adjust the primary and secondary cores of T2 until the response shown in figure 8 is obtained. Check of R -F Circuits-Adjust the selector for the reception of 2 UHF stations as described in the adjustment instructions. Connect a 0-5 milliampere meter to the crystal by opening the test connection on top of the chassis and connecting the meter in series with the test connection and ground. The crystal current should be 0.75 ma. on each channel. The oscillator injection trimmers were set at the factory to produce this value of current. However if it should become necessary to readjust the oscillator injection, this may be done by adjusting capacitors C26 and/or C27. These capacitors consist of a large metal headed tack mounted in a feed through bushing in the wall of the oscillator compartment. Adjustment is affected by sliding the head towards or away from the harmonic tank capacitors C18 or C19. To prevent the adjustment from changing, the body of the tack is then soldered in place. The measurement of crystal current should be made with the selector adjusted for reception of a station but with no signal input and with the oscillator compartment bottom shield in place. Do not adjust the injection to compensate for a defective crystal or oscillator tube. 6BQ7A (U2A) C15 C16 JUHF O5CtD UHF 2 MAR. Vf,i, 1 T2 OSC C19 TANK .1- sr .0 26 ;UHF 2 INJECTION 11 O IF T RAN; C) C14 1 UHF 1 UHF 2 1 H7A. RTMAONNKIC OSC . . C 27 21 UHF IV1" INJECTION C4 TP I UHF 1 SEC. C2 UHF 1 PR 1 52 Il CI UHF 2 PRi . 1 1545641 Figure 7-Chassis top view LEADS TO CIRCUIT UNDER TEST 33 OHMS 22 MMF. 560 OHMS CO -AX LEAD TO HIGH GAIN SCOPE MOUNT ON BAKELITE BOARD Figure 8-300 Ohm Balanced Detector 22 22 18 61)8 ATTENUATOR PAD FOR 72 OHM CO -AX 631116 ADS ATTENUATOR PAD FOR 52 OHM CO -AX Figure 9-Attenuator Pad M1 5 MC 82.5 85% MC 05% .1 5v. 181115524 Figure 10-Adjustment Locations Figure 11-I -F Response 3 292 U2, U2A CIRCUIT SCHEMATIC DIAGRAMS CI 1- B .1. oq g L3 1- V I 6CB6 I -F AMPL. TZ I -F TRANS. C23 10 II5V 5 I qIs I 1C'24 C 120 7 + 1.1 V. G Itt5 -F1C25 33 WI ANT. MATCHING CABLE JI C2 1-8 L2:, U.H.F PI ANT. CS 3 P C4. 4 SIB FR. C(1C' 710 MIXER LE 3 nl R12 21 41 TP1 55 TEST BB UI CONN. C8 C9 .1C 22 470 1470 1470 SI A FRONT 1000 REMOSIE TBI =" TB2 W3 V.H.F. RECEIVER T53 W4 V N. F ANTENNA 5 I A -B -C FUNCTION SWITCH VIEWED FROM FRONT AND SHOWN IN P05.4 ( MAXIMUM CLOCKWISE) POSITION I - OFF 23--UV..HH..FFI 4-U.N. F ALL RESISTANCE VALUES IN OHMS. K=1000 ALL CAPACITANCE VALUES LESS THAN 1 IN MF., AND ABOVE 1 IN MMF. UNLESS OTHERWISE NOTED. 12 4 R2 27 RI 27 C 10 L30J_: I- L7 C12 L9 27 C11 (10110_ 6B2a7 OSCILLATORS L8 C13 27 L 10 0 C14 1-10-10V. 2 C15 1-10 7 - 1 V. A CIE 3 RE 2 9 3900 c RB 3900 C26 CI #L11 1-8 L13 R7 100 (.C22000 C27 112t""t = _J RECEIVER CR2 SELENIUM 129 RIO RECT. TI aft1000 1000 +I37V ELK - - C2IA C216 -C2IC i30 MFTO MET 30 ME I g I aa GRi1S20 1 SRN IL'IALAC111. 1 : 61.K-BRN S2 (OH S%) ? 53 INTERLOCK 0 -46510-2 115 V. SOW SUPPLY R13 100K )1 C28 3 7E14 U H. F. ANT. TB2 e V. H. F RECEIVER & TB3 W4 V H. F ANTENNA S I A-13- C FUNCTION SWITCH VIEWED FROM FRONT AND SHOWN IN PO5.4 ( MAXIMUM CLOCKWISE) POSITION I - OFF 2- V.H.F. 3- U.K. F I 4 - U. H.F 2. RESISTANCE VALUES IN OHMS. K.,1000 CAPACITANCE VALUES LESS THAN 1. IN MF., AND ABOVE 1 . IN MMF, EXCEPT AS INDICATED. Figure 12-U2 Schematic Diagram, KCS79 W5 C6 120 If CO I CK7I0 MIXER VI 6CB6 I -F TRANS. 523 Ic I -F AMPL. 10 I s, s I I T 33 ilt -TIC25 - f1 33 11212 "s 100 K 1022 1470 CIO 2L3 CII 119C' -- - L7 )C2172 *4F-11 v2 LB GOSBCILA7TOARS C13 27 CIS 2 Cc2,68 -S3 C27 CI9 1-B LIS L 14 I- S 39R600 -II-C216 2 C17 I 39R0e 0 C20 J200 J Figure 13-U2A Schematic Diagram, KCS79A JI F TO V.H.F RECEIVER RIO 1000 CR2 SELENIUM RECT. TI RED 1 AA C2IA -C218 C21C I T30 MFI50 MET 3014F I I ORN.RED I SRN. LPAI LmOTp 0 EAR ED BI.K;i3RN_ S2 (ON ? S3 4, INTERLOCK 0 413687 - 0 115 VOW SUPPLY REPLACEMENT PARTS 293 U2, U2A STOCK No. DESCRIPTION 75039 77290 77210 77277 77340 53511 72570 70596 76347 77293 77084 77086 77298 77296 77297 77153 77279 77294 77088 52131 74594 76460 77286 CHASSIS ASSEMBLIES KCS79, KCS79A Board -"Antenna" terminal board Capacitor -Tubular trimmer, 1-8 mmf., complete with adjustable core (C1, C2, C3, C4, C18, C19) Capacitor -Ceramic, 2 mmf. (C16, C17) Capacitor -Ceramic, 3 mmf. (C5, C28) Capacitor -Tubular trimmer, 1.0-10.0 mmf., complete with adjustable core (C14, C15, L16, L17) Capacitor -Ceramic, 10 mmf. (C23) Capacitor -Ceramic, 27 mmf. (C12, C13) Capacitor -Ceramic, 33 mmf. (C24, C25) Capacitor -Ceramic, 120 mmf. (C6) Capacitor -Ceramic, 470 mmf. (C8. C9, C22) Capacitor -Ceramic, feed-thru, 1000 mmf. (C7, C10, C11, C20) Capacitor -Electrolytic comprising 1 section of 50 mfd., 200 volts and 2 sections of 30 mfd., 200 volts (C21A, C21B, C21C) Coil -Choke coil (L13, R7) Coil -Fundamental oscillator coil (L9, 210) Coil -Harmonic tank coil (L11, 212) Coil -r -f choke coil (L5, L7, L8, L14, L15) Coil -r -f choke coil (L6) Coil -r -f coil (primary and secondary) (LI, L2, L3, L4) Connector -Single contact connector for UHF an- terina (J1) for model U2 Connector -2 contact female connector for television power (J2) Connector -2 contact male connector for power input Contact -Test point contact Cover -Oscillator section shielding Cover for Model U2A STOCK No. DESCRIPTION 11765 77282 77292 513027 503068 513210 523::10 503239 503410 503456 77284 77285 76967 76534 35574 77087 76530 77289 78578 77288 77287 77300 77212 77033 74889 77299 77013 74734 :Lamp -Pilot lamp -Mazda #51 Rectifier -Germanium rectifier (CR1) Rectifier -Selenium rectifier (CR2) Resistor -Fixed, composition:27 ohms. ±10%, 1 watt (R1, R2) 68 ohms, ± 10%, 1/2 watt (R5) 1000 ohms, ± 10%, 1 watt (R9) 1000 ohms, ± 10%,2 watts (R10) 3900 ohms, ± 10%, 1/2 watt (R6, R8) 100,000 ohms, ± 10%, 1/2 watt (R11, R12, R13, R14) 560,000 ohms, ± 10%. 1/2 watt (R3. R4) Shield -Oscillator shield for Model U2A Shield -r -f shield Shield -Tube shield for VI Shield -Tube shield for V2 Socket -Lamp socket Socket -Tube socket, 7 pin, miniature for V1 Socket -Tube socket, 9 pin, miniature for V2 Switch -Selector switch (S1, S2) Transformer -Antenna input transformer (T3) Transformer-i-f transformer (T2) Transformer -Power transformer, 117 volt, 60 cycle (T1) MISCELLANEOUS Back -Cabinet back complete with power cord Connector -Single contact male connector for antenna matching assembly Emblem -"RCA Victor" emblem Foot -Felt foot Knob -Selector knob Nut -Speed nut to fasten emblem Spring -Spring clip for knob APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS 5 294 295 RCAVICTOR CHF Selector Model L170 UHF SELECTOR MODEL U70 Chassis No. KCS70 - Mfr. No. 274 - SERVICE DATA - 1952 No. T8 - GENERAL DESCRIPTION UHF Selector Model U70 permits the reception of any UHF television station within receiving range when employed with a VHF television receiver. The unit employs three tubes plus rectifier and a crystal mixer. PREPARED BY RCA SERVICE CO., INC. FOR RADIO CORPORATION OF AMERICA RCA VICTOR DIVISION CAMDEN, N. J., U. S. A. ELECTRICAL SPECIFICATIONS TELEVISION R -F FREQUENCY RANGE All 70 UHF television channels I -F Output Frequency 470 mc. to 890 mc. Channel 5 or 6 POWER SUPPLY RATING 115 volts, 60 cycles, 40 watts WEIGHT AND DIMENSIONS Net Weight Shipping Weight Width Inches 10 lbs. 12 lbs. 11 Va Height Inches 81/4 Depth Inches 921/32 ANTENNA INPUT IMPEDANCE UHF - Choice: 300 ohms balanced or 72 ohms unbalanced. VHF - 300 ohms balanced. TUBE COMPLEMENT Tube Used 6AF4 6CB6 6CB6 5Y3GT A 1N82 crystal is used as a mixer. Function R -F Oscillator 1st I -F Amplifier 2nd I -F Amplifier Rectifier INSTALLATION INSTRUCTIONS The UHF Selector has been designed to operate from either of three types of antenna installations. In all cases, the VHF antenna transmission line must be disconnected from the VHF receiver and reconnected to the selector VHF antenna terminals. A short length of 300 ohm line must then be connected between the VHF receiver antenna terminals and the selector terminals marked "Receiver." If the UHF signals from the VHF antenna are strong and free from reflections, the above connections are all that are required. See Figure 1. If a separate UHF antenna with 300 ohm transmission line is employed, connect the line to the selector terminal board marked UHF. Then, disconnect the 300 ohm line which runs over the fiber back and into the selector. Tape the ends of these leads so that they will not short other terminals on the back and cause trouble. See Figure 2. If a separate UHF antenna with 72 ohm co -ax transmission line is employed, remove the balun, attach a male co -ax fitting to the antenna transmission line and plug it into the selector co -ax input at the lower left hand corner on the selector rear apron. Dress or tape the co -ax line so that it cannot be pulled out if the customer moves the selector. See Figure 3. Plug the television receiver power cord into the a -c receptacle on the back of the selector and plug the selector power cord into the nearest 110 volt a -c outlet. With this connection, if the VHF receiver "on -off" switch is left in the "on" position, both the receiver and the selector will be controlled by the selector function switch. With the selector function switch in the VHF position, the receiver is turned "on," the selector is "on" but in stand-by condition and the VHF antenna is connected through to the receiver. With the selector function switch in the UHF position, the selector is operating, the VHF antenna is disconnected from the receiver, the selector output is connected to the receiver and the antenna employed for UHF operation is connected to the selector input. To receive a UHF station, switch the selector function switch to UHF and the television receiver to channel 5 or 6, whichever is vacant in the receiving area. Tune in the UHF station by adjusting the selector tuning knob. The selector dial is calibrated in channel numbers as an aid in locating the channel. Tune the selector for best sound and picture. In some instances interference may result if the receiver fine tuning control is not properly adjusted. If this should occur, adjust fine tuning until the interference is eliminated and retune the selector for the best sound and picture. IfiritatIN 3000. LINE TO VHF vx ANTENNA UHF 72A CO -AX INPUT BALUN 1-1; 300A LINE TO VHF TELEV RECEIVER UHF O J2 CED.J3 PLUG VHF RECEIVER IN J3 Figure I-Selector Connections When VHF Antenna Is Employed For UHF Reception. 300A LINE TO VHF ANTENNA UHF 720. CO -AX INPUT BALUN .001111r..%. W 1 30CUILI 1\CLF TELEV. ECEIVE 0VHF 300A UNE TO UHF ANTENNA J2 CD3J3 PLUG VHF RECEIVER IN J3 Figure 2-Selector Connections For Use of Separate Ulf Antenna With 300 Ohm Lead -In. Figure 3-Selector Connections For Use of Separate UHF Antenna With 72 Ohm Co -As. 296 U70 ALIGNMENT PROCEDURE TEST EQUIPMENT The following test equipment is required for alignment of the U70 UHF Selector: A UHF sweep generator with a range of 470 mc. to 890 mc. A VHF sweep generator with a range of 70 mc. to 90 mc. A UHF marker generator for locating 480; 630 and 840 mc. A VHF marker generator capable of supplying 72.5 mc., 76.5 mc., 82.5 mc., 88.5 mc. and 92.5 mc. signals. An oscilloscope with a high gain vertical amplifier. A milliammeter with a 0-5 ma. range. A resistive pad for terminating the sweep generator cable. A 300 ohm balanced detector. A small protractor. I -F ALIGNMENT Second 1-F Stage - Construct a 300 ohm balanced detector as shown in Figure 4 and connect it to terminal board TB3. Connect a high gain oscilloscope to the balanced detector and set the gain to maximum. Connect a jumper across terminals A and B of Tl. Connect a 72 ohm attenuator pad of the type shown in Figure 5 to the output cable of the sweep and connect the output of the pad to the grid, pin 1 of V2 and to ground. Set the sweep generator to sweep from 72 mc. to 90 mc. As an alternate, an RCA WR59 sweep generator may be employed and switched to channel 5 to see the low frequency side of the response curve and to channel 6 to see the high frequency side of the response curve. Insert markers from the VHF marker generator by loosely coupling the generator output cable to the grid of V2. Adjust the T2 pri. and sec. cores and the bandwidth trimmer C22 to obtain response as shown in Figure 9A. The bandwidth capacitors C22 (and C21 in T1) consist of a short piece of wire soldered to terminal A and the free end inserted into a ceramic tube capacitor. Adjustment is made by pushing the wire in further or pulling it out. First I -F Stage - Remove the jumper from terminals A and B of T1 and reconnect it across terminals A and B of T2. Connect the balanced detector across T2 terminals C and D. Connect the output cable of the sweep generator with the 72 ohm pad through a 1,500 mmf. capacitor to pin 2 of VI. Connect the VHF marker generator loosely to pin 2 of VI. Adjust the T1 pri. and sec. cores and the bandwidth trimmer C21 to obtain the response shown in Figure 9B. Overall I -F Response - Leave the sweep generator connected to the cathode of VI. Remove the jumper across terminals A and B of T2. Connect the balanced detector across terminal board TB3. The overall i-f response should appear as shown in Figure 9C. The oscilloscope gain should be kept at maximum and the input kept low to prevent overloading the selector. If excessive tilt of the curve is present, retouch the T1 and T2 pri. and sec. cores until the curve is reasonably flat. R -F ALIGNMENT If the selector needs only touch-up adjustments, no presetting of the tuning cores is required. However, if the selector is completely out of alignment, the tuning cores should be preset as follows. With the dial drive mechanism 11/4 turns from the low frequency stop (channel 14 end of the dial), set the C18 oscillator tuning core as shown in the Figure 6A. The cores of the r -f tuning capacitors CI and C2 should be set as shown in Figure 6B. The tapered end of the L9 core should be set about 3/4 of an inch from the closest end of the L9 coil as shown in Figure 6C. Turn the dial drive mechanism until it comes up against the stop at the low frequency (channel 14) end of the dial. Turn the dial pointer on its shaft until the pointer coincides with the end marker on the dial back plate. Turn the dial drive mechanism until the pointer is 17 degrees to the left of center of the dial when the selector is sitting in an upright position. This position should be located with a protractor to insure accuracy. Make a small mark on the dial back plate so that the dial can be returned to this position quickly and accurately throughout the remainder of the alignment procedure. This is the 630 mc. calibration point. Connect the 300 ohm balanced detector across terminals A and B of T1 and shunt a 1,000 ohm resistor across terminals C and D of T1. Connect the UHF sweep generator through a 6 db pad to the 72 ohm co -ax input to the selector at J1. It is necessary to use the pad so that impedances will be matched. Otherwise standing waves on the sweep cable may become objectionable. Connect the UHF marker gen. loosely to the selector input. Connect a VHF marker generator loosely to the cathode of VI. Insert an 82.5 mc. marker into the selector. 630 Mc. Adjustments - Turn the dial drive mechanism until the dial pointer points to the 630 mc. calibration mark scribed on the dial back plate at 17 degrees left of center. Insert a 630 mc. marker from the UHF marker generator. Set the UHF sweep generator to sweep from 615 mc. to 645 mc. and observe the output on the oscilloscope. If the sweep generator is not sweeping the correct frequency range, it may be necessary to readjust the sweep in order to center the 630 mc. marker on the response curve. The shields must be in place over the top and bottom of the r -f section when making any adjustments. Adjust the C18 oscillator core until the markers for 630 mc. and 82.5 mc. coincide on the sweep pattern. Adjust the cores of the r -f tuning capacitors CI and C2 to obtain a maximum amplitude, symmetrical response curve centered about the 82.5 mc. marker. Set the bandwidth adjustment L2 until the response bandwidth is 20 mc. at 70% response. Tune L5 for max. response at the center of the bandpass. Repeat the adjustments of CI, C2, L2 and L5 if necessary. Plug the 0-5 milliammeter into the crystal current jack J2. The current should be between 0.8 ma. and 5 ma. If this current is not obtained, either the crystal is defective or the oscillator is not functioning properly. The bottom cover should be in place when measuring crystal current. Turn off the sweep and marker generators. If the crystal current decreases by more than 10%, it indicates that excessive input signals are being employed. Proper alignment cannot be obtained under such conditions. 490 Mc. Adjustments - Set the UHF marker gen. tc 490 mc. Set the UHF sweep gen. to sweep 475 mc. to 505 mc. Turn off the 82.5 mc. marker generator. Turn the UHF selector toward the low frequency end of the band. Tune the selector and the sweep generator until the 490 mc. marker is centered in the bandpass. Turn the 82.5 mc. marker back on. Adjust C18 until the markers coincide. Then, overshoot the adjustment by an amount slightly less than the amount of adjustment required to get the markers to coincide. Then close or spread the turns on the L9 coil until the markers again coincide. Repeat the adjustments in the section above labeled "630 Mc. Adjustments." CI, C2, L2 and L5 probably will not require retouching. Then repeat the adjustments in the section above labeled "490 Mc. Adjustments." Continue the repetition of the 630 mc. and 490 mc. adjustments until no further adjustments are required. Make the final adjustment at 630 mc. before proceeding with the next section. 840 Mc. Adjustment - Set the UHF marker gen. to 840 mc. Turn off the 82.5 mc. marker generator. Adjust the UHF sweep gen. to sweep 825 mc. to 855 mc. Turn the UHF selector dial drive and the sweep generator until the 840 mc. marker is centered in the bandpass of the response curve on the oscilloscope. Turn the 82.5 mc. marker back on. Adjust the L9 core until the two markers coincide. Check of Tracking - Turn off the UHF marker generator. Tune the sweep generator across the band in small steps. Tune in the sweep generator with the selector. The response on the oscilloscope should not fall below 70% response between the 76.5 mc. and 88.5 mc. markers obtained from the VHF marker generator. The crystal current should be between 0.8 and 5 ma. at all points between 470 mc. and 890 mc. when measured with the bottom shield in place and with no signal input. Overall Response Check - Leave the sweep and signal generators connected as for r -f alignment. Remove the 1,000 ohm resistor from terminals C and D of Ti. Connect the 300 ohm balanced detector across the output terminal board TB3 and observe the overall response which should be similar to that shown in Figure 9. If excessive tilt appears, it may cause the picture to be overpeaked or smeared depending on the direction of the tilt. The maximum tilt or sag of the curve should not exceed 30%. 2 297 ALIGNMENT DATA U70 Air Check - As a final test, the selector should be tested on the air by receiving a known weak signal. If the picture obtained seems excessively snowy for a particular selector unit, it may be necessary to replace the mixer crystal CR1. If the crystal is changed, the r -f alignment should be retouched. A good crystal may perform no better than a defective one unless the r -f section is aligned for the good crystal. TO HIGH2 GAIN SCOPE Figure 4-300 Ohm Balanced Detector 22 22 --.V18kA-6-IWB f- A GOB PAD FOR 72 OHM CO -AX GOB PAD FOR 52 OHM CO -AX Figure 5 - Sweep Cable Attenuator 16 CIS OSC. B CI AND C2 hol11110 Figure 6-Preset for R -F Adjustments LOCATE POINTER AT INDEX MARK DIAL BACK PLATE WITH TUNING SHAFT IN MAX.cLOCKWiSE COUNTER - t) I' POS. SPRING 1%4 TURNS EACH END ON POINTER PULLEY ASSEMBLE DIAL CORDS AS SHOWN WITH TUNING SHAFT &TURNS FROM MAX. COUNTER -CLOCKWISE POSIT - ION. 34 TURNS ON PULLEY SHAFT I% TURNS EACH END TURNS ON TUNING SHAFT WITH SHAFT TURNS FROM STOP .14 Figure 8-Dial Cord and Drive 76.SME A 88SMC. 76.SMC. 88.5 MC. 88.5 7'S MC. /12.6 MC. B 2E2 I -F TRANS MI I -F TRANS OVERALL I -F Figure 9 - Sweep Response Curves LS IS! I -F AMR TI 152 I -F TRANS T3 POWER TRANS. 2E2 I-FAAIP. I -F TRANS. Figure 7- Bottom Chassis Adjustments Figure 10-Top Chassis Adjustments WI ANT MATCHING CABLE v, 6C B6 I sr. I -F AMPL TI Ie. 1-F TRANS. V2 6C B6 2ND. I -F AMPL. T51 W3 T2 2E2 I -F TRANS. SIA FRONT T82 VHF ANT. L UHF ANT * TANDEM '84:TRIO& ARE) a I 33 -1ITC.,3 1 K =1000 I ALL RESISTANCE VALUES IN OHMS. I ALL CAPACITANCE VALUES LESS THAN I I IN ME. AND ABOVE I IN NIMF. UNLESS I OTHERWISE NOTED. L4 20 /HUH 141v. C20 15 t ..12 XTAL .2! URRENT CG 11000 14 7 I R3 2200 0l f I RA 47 1 NSW B! ctz .W An 27 C it C9 I47° SIB REAR IN SOME SELECTORS 11472 CRYSTAL IS EMPLOYED. Figure 11- Circuit Schematic Diagram VS 6A F4 OSC. L I RIO ..1,411 V. .., T C14 A". 1000 ". RI2 RI3 R9 1500 330 22K *AA. IA c 19A C195 CMG T50 ME 130 ME T30 ME v4 5Y3-GT RECT. ITay SI FUNCTION Sw. VIEWED r FROM FRONT AND SHOWN IN T3 POSITION NO.3 ; MAXIMUM CLOCKWISE) P05.1 -POWER OFF. 11 OLK RE 2- VHF. 3 -UHF. ll TB31661 J3 F TO VHF VHF RECE RECEIVER INPUT DIAL LIGHT ELK 52 JON St) 13-45603 - I BLK 5Rx1 1195. GO, SUPPLY 3 298 U70 REPLACEMENT PARTS STNOCogK DESCRIPTION STCO K DESCRIPTION 77097 76184 77069 76522 77072 77210 77108 77085 45465 77209 70935 70599 75198 77084 77252 77086 77102 77109 77083 77224 72618 77212 75474 77088 52131 72953 72953 70392 77074 77075 77076 77093 77103 74838 77079 75482 11765 77106 77073 77095 77077 77105 77094 77489 30340 CHASSIS ASSEMBLIES KCS70 Back-Back cover complete with three (3) terminal boards Board-Terminal board for back cover Bracket-Mounting bracket for r -f tuning assembly (includes L2 and part of LI, L3, Cl, C2) le.ss glass tubing Bracket-Vertical bracket for tube shield for 6AF4 Bushing-Drive shaft bushing (in rear of coil spring) Capacitor-Ceramic, 2 mmf. (C16) Capacitor-Ceramic, 9 mmf. (C11) Capacitor-Ceramic, feed-thru, 10 mmf. (C3) Capacitor-Ceramic, 15 mmf. (C20) Capacitor-Ceramic, 18 mmf. (C15) Capacitor-Ceramic, 27 mmf. (C12, C13) Capacitor-Ceramic, 56 mmf. (C5) Capacitor-Ceramic, 470 mmf. (C4, C7, C8, C9, C10) Capacitor-Ceramic, feed-thru, 1,000 mmf. (C14, C17) Capacitor-Ceramic, 1,000 mmf. (C6) Capacitor-Electrolytic comprising 1 section of 50 mid., 200 volts and 2 sections of 30 mfd., 200 volts (C19A, C19B, C19C) Clamp-Polystyrene clamp for oscillator tuning ca - pacitor and coil (2 required) Coil-Choke coil (L6, L7; L8, L10) Coil-Cathode peaking coil (L5) Coil-Oscillator tuning coil (L9) Coil-Peaking coil (20 muh) (L4) Connector-Single contact male connector for an - tenna matching assembly (P1) Connector-Single contact male connector for W3, W4, W5 Connector-Single contact connector for 72 ohm an- tenna connection (J1) Connector=2 contact female connector (J3) Cord-Drive cord (approx. 23" overall) Cord-Drive cord (approx. 38" overall) Cord-Power cord and plug Core-Adjusting core assembly for r -f tuning as- sembly capacitors Cl and C2 Core-Adjusting core assembly for oscillator tuning capacitor C18 Core-Adjusting core assembly for oscillator tuning coil L9 Cover-Bottom cover for oscillator tuning shield Crystal-See Rectifier Cushion-Rubber cushion for mounting oscillator tuning coil (2 required) or oscillator tuning capacitor (2 required) Grommet-Power cord strain relief (1 set) Holder-Holder for crystal rectifier Jack-Test jack (J2) Lamp-Dial lamp-Mazda 51 Plate-Dial back plate and bushing less dial and pulley Plate-Plate complete with five (5) bushings for drive shaft and adjusting cores Pointer-Station selector pointer Post-Retainer post for plate and bushing assembly Pulley-Drive cord pulley (11/2" dia.) and shaft Pulley-Drive cord pulley (23/4" dia.) and shaft assembly Rectifier-Crystal rectifier 1N82 (CR I) Retainer-Retainer ring for drive shaft 503033 503047 503068 503115 523133 503212 523215 503222 503233 503282 503310 513322 77078 77092 77091 77090 76967 31251 31364 77087 77207 77071 77096 12007 75068 77208 77099 77089 76463 77080 77081 77082 77100 77070 2917 33726 77098 Resistor-Fixed, composition: 33 ohms, -I-10%, 1/2 watt (R1) 47 ohms, +10%, 1/2 watt (R4) 68 ohms, +10%, 1/2 watt (R5) 150 ohms, ±10%, V2 watt (R2) 330 ohms, +10%, 2 watt (R13) 1,200 ohms, -4-10%, 1/2 watt (R8) 1,500 ohms, ±10%, 2 watt (R10, R12) 2,200 ohms, ±10%, 1/2 watt (R3) 3,300 ohms, -4- 10%, 1/2 watt (R7) 8,200 ohms, ± 10%, 1/2 watt (R11) 10,000 ohms, +10 %, 1/2 watt (R6) 22,000 ohms, ± 10 %, 1 watt (R9) Shaft-Drive shaft Shield-Shield assembly for oscillator tuning as - sembly Shield-Shield assembly for r -f tuning assembly Shield-Tube shield for 6AF4 Shield-Tube shield for 6CB6 Socket-Tube socket, octal, wafer Socket-Dial lamp socket Socket Tube socket, 7 pin, miniature, moulded phenolic, saddle -mounted Socket-Tube socket, 7 pin, miniature, steatite, saddle -mounted Spring-Drive shaft spring Spring-Drive cord spring Spring-Retaining spring for adjusting cores Spring-Retaining spring for tube shield for 6AF4 Support-Oscillator tuning coil support (glass tube) support only for oscillator tun ing coil and capacitor Switch-Function and power switch (Si. S2) Terminal-Screw type grounding terminal Transformer-Power transformer, 117 volts, 60 cycles (T3) Transformer-First i-f transformer complete with ad justable cores (T1, C21) Transformer-Second i-f transformer complete with adjustable cores (T2, C22) Tubing-Capacitor tubing (glass) for oscillator tun ing capacitor (Part of C18) Tubing -,..:apacitor tubing (glass) for r -f tuning as sembly capacitors Cl and C2 Washer-"C" washer for drive shaft and drive cord pulleys Washer-"C" washer for plate and bushing re tainer post Washer-Spring washer for drive shaft 77111 77110 77033 77492 77251 77844 77140 77843 77013 74734 MISCELLANEOUS Clamp-Dial clamp (2 required) Dial-Glass dial scale Emblem-"RCA Victor" emblem Foot-Rubber foot (4 required) Knob-Function and power switch knob-maroon- for mahogany and walnut instruments Knob-Function and power switch knob-beige- for blonde mahogany instruments Knob-Tuning control knob-maroon-for mahogany and walnut instruments Knob-Tuning control knob-beige-for blonde ma hogany instruments Nut-Speednut to fasten emblem to cabinet Spring-Spring clip for knobs The system of employing an asterisk before the stock number of new items has been discontinued. APPLY TO YOUR RCA DISTRIBUTOR FOR PRICES OF REPLACEMENT PARTS. 4 aPdfCompressor 6.6.1697 CVISION Technologies