ARRIS NVG510 Wireless Voice Gateway, ADSL2+ User Manual Administrator s Handbook V9 0 6 NVG510 att

ARRIS Group, Inc. Wireless Voice Gateway, ADSL2+ Administrator s Handbook V9 0 6 NVG510 att

User Manual

b Motorola ®  NVG510 Voice Gateway Motorola ®  Embedded Software Version 9.0.6 Administrator’s Handbook
 Administrator’s Handbook Copyright ©2011 Motorola Mobility, Inc. All rights reserved. MOTOROLA, and the Stylized M logo are trademarks or registered trademarks of Motorola Trademark Holdings, LLC. All other product or service names are the property of their respective owners. No part of this publication may be reproduced in any form or by any means or used to make any derivative work (such as translation, transformation, or adaptation) without written permission from Motorola Mobility, Inc. Motorola reserves the right to revise this publication and to make changes in content from time to time without obligation on the part of Motorola to provide notification of such revision or change. Motorola pro-vides this guide without warranty of any kind, implied or expressed, including, but not limited to, the implied warranties of merchantability and fitness for a particular pur-pose. Motorola may make improvements or changes in the product(s) described in this manual at any time.©2010 Motorola Mobility, Inc. All rights reserved. MOTOROLA, and the Stylized M logo are trademarks or registered trademarks of Motorola Trademark Holdings, LLC. All other product or service names are the property of their respective owners. No part of this publication may be reproduced in any form or by any means or used to make any derivative work (such as translation, transformation, or adaptation) without written permission from Motorola Mobility, Inc. Motorola reserves the right to revise this publication and to make changes in content from time to time without obligation on the part of Motorola to provide notification of such revision or change. Motorola pro-vides this guide without warranty of any kind, implied or expressed, including, but not limited to, the implied warranties of merchantability and fitness for a particular pur-pose. Motorola may make improvements or changes in the product(s) described in this manual at any time.EXCEPT AS INDICATED IN THE APPLICABLE SYSTEM PURCHASE AGREEMENT, THE SYSTEM, DOCUMENTATION AND SERVICES ARE PROVIDED “AS IS”, AS AVAIL-ABLE, WITHOUT WARRANTY OF ANY KIND. MOTOROLA MOBILITY, INC. DOES NOT WARRANT THAT THE SYSTEM WILL MEET CUSTOMER'S REQUIREMENTS, OR THAT THEIR OPERATION WILL BE UNINTERRUPTED OR ERROR-FREE, OR THAT ANY ERRORS CAN OR WILL BE FIXED. MOTOROLA MOBILITY, INC. HEREBY DISCLAIMS ALL OTHER WARRANTIES, EXPRESS OR IMPLIED, ORAL OR WRITTEN, WITH RESPECT TO THE SYSTEM AND SERVICES INCLUDING, WITHOUT LIMITATION, ALL IMPLIED WARRANTIES OF TITLE, NON-INFRINGEMENT, INTEGRATION, MERCHANTABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE AND ALL WARRANTIES ARISING FROM ANY COURSE OF DEALING OR PERFORMANCE OR USAGE OF TRADE.EXCEPT AS INDICATED IN THE APPLICABLE SYSTEM PURCHASE AGREEMENT, MOTOROLA MOBILITY, INC. SHALL NOT BE LIABLE CONCERNING THE SYSTEM OR SUBJECT MATTER OF THIS DOCUMENTATION, REGARDLESS OF THE FORM OF ANY CLAIM OR ACTION (WHETHER IN CONTRACT, NEGLIGENCE, STRICT LIABILITY OR OTHERWISE), FOR ANY (A) MATTER BEYOND ITS REASONABLE CONTROL, (B) LOSS OR INACCURACY OF DATA, LOSS OR INTERRUPTION OF USE, OR COST OF PROCUR-ING SUBSTITUTE TECHNOLOGY, GOODS OR SERVICES, (C) INDIRECT, PUNITIVE, INCIDENTAL, RELIANCE, SPECIAL, EXEMPLARY OR CONSEQUENTIAL DAMAGES INCLUDING, BUT NOT LIMITED TO, LOSS OF BUSINESS, REVENUES, PROFITS OR GOODWILL, OR (D) DIRECT DAMAGES, IN THE AGGREGATE, IN EXCESS OF THE FEES PAID TO IT HEREUNDER FOR THE SYSTEM OR SERVICE GIVING RISE TO SUCH DAMAGES DURING THE 12-MONTH PERIOD PRIOR TO THE DATE THE CAUSE OF ACTION AROSE, EVEN IF COMPANY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. THESE LIMITATIONS ARE INDEPENDENT FROM ALL OTHER PROVISIONS OF THIS AGREEMENT AND SHALL APPLY NOTWITHSTANDING THE FAILURE OF ANY REMEDY PROVIDED HEREIN.All Motorola Mobility, Inc. products are furnished under a license agreement included with the product. If you are unable to locate a copy of the license agreement, please contact Motorola Mobility, Inc. NOTE: THIS IS DRAFT DOCUMENTATION INTENDED FOR TESTING AND EVALUATIVE REVIEW. IT MAY CON-TAIN ERRORS. IT SHOULD NOT BE CONSIDERED SUITABLE FOR USE IN A PRODUCTION ENVIRONMENT. Motorola Mobility, Inc.600 North U.S. Highway 45Libertyville, Illinois 60048 USATelephone: +1 847 523 5000Part Number58XXXX-001-00d8 rev aV9.0.6-sku 64
 Table of Contents Table of Contents CHAPTER 1  Introduction  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  7 About Motorola ®  Documentation . . . . . . . . . . . . . . . . . . . . . . . .  7 Documentation Conventions  . . . . . . . . . . . . . . . . . . . . . . . . . . .  8 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8Internal Web Interface . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8Command Line Interface . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Organization  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  9 A Word About Example Screens  . . . . . . . . . . . . . . . . . . . . . . . .  9 CHAPTER 2  Device Configuration   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .11 Important Safety Instructions . . . . . . . . . . . . . . . . . . . . . . . . . .  12 POWER SUPPLY INSTALLATION. . . . . . . . . . . . . . . . . . . . . . . . . . . . 12TELECOMMUNICATION INSTALLATION . . . . . . . . . . . . . . . . . . . . . . 12PRODUCT VENTILATION . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Wichtige Sicherheitshinweise  . . . . . . . . . . . . . . . . . . . . . . . . .  13 NETZTEIL INSTALLIEREN  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13INSTALLATION DER TELEKOMMUNIKATION . . . . . . . . . . . . . . . . . . 13 Motorola ®  Gateway Status Indicator Lights . . . . . . . . . . . . . . .  14 Set up the Motorola Gateway  . . . . . . . . . . . . . . . . . . . . . . . . .  16 Accessing the Web Management Interface . . . . . . . . . . . . . . .  19 Device Status page  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  21 Device Access Code  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 Tab Bar  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  23 Help . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  23 Links Bar  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  24 Device List . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24System Information   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25Access Code  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26Restart Device  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 Broadband . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  28 Configure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 Home Network . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  31 Configure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34Wireless   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 Wireless Security . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37 WPS   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39MAC Filtering  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40Subnets & DHCP   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 Voice  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  43 Line Details  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44Call Statistics   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45 Firewall  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  48 Packet Filter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49
 Administrator’s Handbook Working with Packet Filters. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .51 NAT/Gaming   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 Custom Services . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .55 IP Passthrough  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58Firewall Advanced  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 Diagnostics  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  61 Logs   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64Manual Update . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66Resets . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67 CHAPTER 3  Basic Troubleshooting   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .69 Status Indicator Lights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  70 LED Function Summary Matrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72 Factory Reset Switch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  75 CHAPTER 4  Command Line Interface   . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .77 Overview  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  79 Starting and Ending a CLI Session  . . . . . . . . . . . . . . . . . . . . .  81 Logging In . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .81Ending a CLI Session . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .81 Using the CLI Help Facility  . . . . . . . . . . . . . . . . . . . . . . . . . . .  81 About SHELL Commands . . . . . . . . . . . . . . . . . . . . . . . . . . . .  82 SHELL Prompt  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82SHELL Command Shortcuts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82 SHELL Commands  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  83 Common Commands  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .83WAN Commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .90 About CONFIG Commands . . . . . . . . . . . . . . . . . . . . . . . . . . .  92 CONFIG Mode Prompt . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92Navigating the CONFIG Hierarchy . . . . . . . . . . . . . . . . . . . . . . . . . . . .92Entering Commands in CONFIG Mode. . . . . . . . . . . . . . . . . . . . . . . . .92Guidelines: CONFIG Commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . .93Displaying Current Gateway Settings . . . . . . . . . . . . . . . . . . . . . . . . . .93Step Mode: A CLI Configuration Technique. . . . . . . . . . . . . . . . . . . . . .93Validating Your Configuration  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .94 CONFIG Commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  95 Connection commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .95Filterset commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .96Queue commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .100IP Gateway commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101IPv6 Commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101IP DNS commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106IP IGMP commands  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .107NTP commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .109Application Layer Gateway (ALG) commands  . . . . . . . . . . . . . . . . . .110Dynamic DNS Commands  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .110Link commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 111Management commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .113Remote access commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .115
 Table of Contents Physical interfaces commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 117PPPoE relay commands  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120NAT Pinhole commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 121Security Stateful Packet Inspection (SPI) commands . . . . . . . . . . . . 121VoIP commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 122System commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 130 Debug Commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  132 Disclaimer & Warning Text . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 132Commands. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 132 CHAPTER 5  Technical Specifications and Safety Information   . . .  135 Description . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  135 Power requirements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135Environment . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135Software and protocols. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135 Agency approvals  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  136 Manufacturer’s Declaration of Conformance . . . . . . . . . . . . .  137 Important Safety Instructions . . . . . . . . . . . . . . . . . . . . . . . . .  139 47 CFR Part 68 Information . . . . . . . . . . . . . . . . . . . . . . . . . .  140 FCC Requirements. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 140FCC Statements. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 140 Electrical Safety Advisory  . . . . . . . . . . . . . . . . . . . . . . . . . . .  141 Caring for the Environment by Recycling  . . . . . . . . . . . . . . .  142 Beskyttelse af miljøet med genbrug . . . . . . . . . . . . . . . . . . . . . . . . . . 142Umweltschutz durch Recycling  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 142Cuidar el medio ambiente mediante el reciclaje  . . . . . . . . . . . . . . . . 142Recyclage pour le respect de l'environnement  . . . . . . . . . . . . . . . . . 142Milieubewust recycleren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 143Dba∏oÊç o Êrodowisko - recykling . . . . . . . . . . . . . . . . . . . . . . . . . . 143Cuidando do meio ambiente através da reciclagem  . . . . . . . . . . . . . 143Var rädd om miljön genom återvinning. . . . . . . . . . . . . . . . . . . . . . . . 143 Appendix A  Motorola ®  Gateway Captive Portal Implementation  145 Overview  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  145 Captive Portal RPC  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  146 X_00D09E_GetCaptivePortalParams RPC:  . . . . . . . . . . . . . . . . . . . 146X_00D09E_SetCaptivePortalParams RPC:. . . . . . . . . . . . . . . . . . . . 147 Index  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .  149
 Administrator’s Handbook
 7 CHAPTER 1 Introduction About Motorola ®  Documentation ☛   NOTE: This guide describes the wide variety of features and functionality of the Motorola ®  Gateway, when used in Router mode. The Motorola ®  Gateway may also be delivered in Bridge mode. In Bridge mode, the Gateway acts as a pass-through device and allows the workstations on your LAN to have public addresses directly on the Internet. Motorola, Inc. provides a suite of technical information for its family of intelligent enterprise and consumer Gate-ways. It consists of:  ◆ Administrator’s Handbook ◆ Dedicated User Manuals ◆ Specific White PapersThe documents are available in electronic form as Portable Document Format (PDF) files. They are viewed (and printed) from Adobe Acrobat Reader, Exchange, or any other application that supports PDF files.They are downloadable from the Motorola’s website:   http://www.motorola.com/support
 Administrator’s Handbook 8 Documentation Conventions General This manual uses the following conventions to present information: Internal Web InterfaceCommand Line Interface Syntax conventions for the Motorola Gateway command line interface are as follows: Convention (Typeface) Description bold italic monospaced Menu commands bold sans serif  Web GUI page links and button names terminal Computer display text bold terminal User-entered text Italic   Italic type indicates the complete titles of manuals. Convention (Graphics) Description Denotes an “excerpt” from a Web page or the visual truncation of a Web pageDenotes an area of emphasis on a Web page Convention Description straight ([ ]) brackets in cmd line Optional command arguments curly ({ }) brackets, with values separated with vertical bars (|).Alternative values for an argument are pre-sented in curly ({ }) brackets, with values separated with vertical bars (|). bold terminal type face User-entered text italic terminal type face Variables for which you supply your own valuesblue rectangle or linesolid rounded rectangle with an arrow
 9 Organization This guide consists of five chapters, an appendix, and an index. It is organized as follows: ◆ Chapter 1, Introduction  — Describes the Motorola ®  document suite, the purpose of, the audience for, and structure of this guide. It gives a table of conventions. ◆Chapter 2, “Device Configuration” — Describes how to get up and running with your Motorola® Gateway.◆Chapter 3, “Basic Troubleshooting” — Gives some simple suggestions for troubleshooting problems with your Gateway’s initial configuration.◆Chapter 4, “Command Line Interface” — Describes all the current text-based commands for both the SHELL and CONFIG modes. A summary table and individual command examples for each mode is provided.◆Chapter 5, “Technical Specifications and Safety Information”◆“Appendix A Motorola® Gateway Captive Portal Implementation” — Describes the Motorola® Gateway Captive Portal Implementation◆IndexA Word About Example ScreensThis manual contains many example screen illustrations. Since Motorola® Gateways offer a wide variety of fea-tures and functionality, the example screens shown may not appear exactly the same for your particular Gateway or setup as they appear in this manual. The example screens are for illustrative and explanatory purposes, and should not be construed to represent your own unique environment.
Administrator’s Handbook10
11CHAPTER 2 Device ConfigurationMost users will find that the basic Quick Start configuration is all that they ever need to use. The Quick Start sec-tion may be all that you ever need to configure and use your Motorola® Gateway. For more advanced users, a rich feature set is available. The following instructions cover installation in Router Mode.This chapter covers:◆“Important Safety Instructions” on page 12◆“Motorola® Gateway Status Indicator Lights” on page 14◆“Set up the Motorola Gateway” on page 16◆“Accessing the Web Management Interface” on page 19◆“Device Status page” on page 21◆“Tab Bar” on page 23◆“Broadband” on page 28◆“Home Network” on page 31◆“Wireless” on page 35◆“Voice” on page 43◆“Firewall” on page 48◆“Diagnostics” on page 61
Administrator’s Handbook12Important Safety InstructionsPOWER SUPPLY INSTALLATIONConnect the power supply cord to the power jack on the Motorola® Gateway. Plug the power supply into an appro-priate electrical outlet. There is no power (on / off) switch to power off the device.☛  WARNING:The power supply must be connected to a mains outlet with a protective earth connection. Do not defeat the protective earth connection.CAUTION: Depending on the power supply provided with the product, either the direct plug-in power supply blades, power supply cord plug or the appliance coupler serves as the mains power disconnect. It is important that the direct plug-in power supply, socket-outlet or appliance coupler be located so it is readily accessible.(Sweden) Apparaten skall anslutas till jordat uttag när den ansluts till ett nätverk(Norway) Apparatet må kun tilkoples jordet stikkontakt.TELECOMMUNICATION INSTALLATIONWhen using your telephone equipment, basic safety precautions should always be followed to reduce the risk of fire, electric shock and injury to persons, including the following:◆Do not use this product near water, for example, near a bathtub, wash bowl, kitchen sink or laundry tub, in a wet basement or near a swimming pool.◆Avoid using a telephone (other than a cordless type) during an electrical storm. There may be a remote risk of electrical shock from lightning.◆Do not use the telephone to report a gas leak in the vicinity of the leak.◆CAUTION: The external phone should be UL Listed and the connections should be made in accordance with Article 800 of the NEC.PRODUCT VENTILATIONThe Motorola® Gateway is intended for use in a consumer's home. Ambient temperatures around this product should not exceed 104°F (40°C).  It should not be used in locations exposed to outside heat radiation or trapping of its own heat. The product should have at least one inch of clearance on all sides except the bottom when prop-erly installed and should not be placed inside tightly enclosed spaces unless proper ventilation is provided.SAVE THESE  INSTRUCTIONS
13Wichtige SicherheitshinweiseNETZTEIL INSTALLIERENVerbinden Sie das Kabel vom Netzteil mit dem Power-Anschluss an dem Motorola® Gateway. Stecken Sie dann das Netzteil in eine Netzsteckdose.☛  Warnung:Das Netzteil muss an eine Steckdose, die mit einem Schutzleiter verbunden ist, angeschlos-sen werden.  Die Schutzleiterverbindung darf in keinem Fall unterbrochen werden.Achtung:Abhängig von dem mit dem Produkt gelieferten Netzteil, entweder die direkten Steckernetzgeräte, Stecker vom Netzkabel oder der Gerätekoppler dienen als Hauptspannungsunterbrechung. Es ist wichtig, dass das Steckernetzgerät, Steckdose oder Gerätekoppler frei zugänglich sind.(Sweden) Apparaten skall anslutas till jordat uttag när den ansluts till ett nätverk(Norway) Apparatet må kun tilkoples jordet stikkontakt.INSTALLATION DER TELEKOMMUNIKATIONWenn Ihre Telefonausrüstung verwendet wird, sollten grundlegende Sicherheitsanweisungen immer befolgt wer-den, um die Gefahr eines Feuers, eines elektrischen Schlages und die Verletzung von Personen, zu verringern. Beachten Sie diese weiteren Hinweise:◆Benutzen Sie dieses Produkt nicht in Wassernähe wie z.B. nahe einer Badewanne, Waschschüssel, Küchenspüle, in einem nassen Keller oder an einem Swimmingpool. ◆Vermeiden Sie das Telefonieren (gilt nicht für schnurlose Telefone) während eines Gewitters. Es besteht die Gefahr eines elektrischen Schlages durch einen Blitz. ◆Nicht das Telefon benutzen um eine Gasleckstelle zu Melden, wenn Sie sich in der Nähe der Leckstelle befin-den.Bewahren Sie diese Anweisungen auf
Administrator’s Handbook14Motorola® Gateway Status Indicator LightsColored LEDs on your Motorola® Gateway indicate the status of various port activity.Motorola® Gateway NVG510 status indicator lightsLED ActionPowerSolid Green = The device is powered.Flashing Green = A Power-On Self-Test (POST) is in progressFlashing Red = A POST failure (not bootable) or device malfunction occurred.* When the device encounters a POST failure, all indicator lights on the front of the device continuously flash.Off = The unit has no AC power.EthernetSolid Green = Powered device connected to the associated port (includes devices with wake-on-LAN capability where a slight voltage is supplied to the Ethernet connection).Flickering Green = Activity seen from devices associated with the port. The flickering of the light is synchronized to actual data traffic.Off = The device is not powered, no cable or no powered devices connected to the associ-ated ports.WirelessSolid Green = WIFI is powered.Flickering Green = Activity seen from devices connected via WIFI. The flickering of the light is synchronized to actual data traffic.Off = The device is not powered or no powered devices connected to the associated ports.Wi-Fi SetupFlickering Green = Indicates when WPS is broadcasting.Off = not in use, not broadcasting.BroadbandSolid Green = Good broadband connection (i.e., good DSL Sync).Flashing Green = Attempting broadband connection (i.e., DSL attempting sync).Flashing Green & Red = If the broadband connection fails to be established for more than three consecutive minutes the LED switches to Flashing Green when attempting or waiting to establish a broadband connection alternating with a five second steady Red. This pattern continues until the broadband connection is successfully established.Flashing Red = No DSL signal on the line. This is only used when there is no signal, not dur-ing times of temporary ‘no tone’ during the training sequence.Off = The device is not powered.PowerEthernetSide ViewWirelessBroadbandServicePhone 1Phone 2Wi-Fi Setup
15Motorola® Gateway NVG510 Rear ViewServiceSolid Green = IP connected (The device has a WAN IP address from DHCP or 802.1x authentication and the broadband connection is up).                                                                                                Flashing Green = Attempting PPP connection.  Attempting IEEE 802.1X authentication or attempting to obtain DHCP information.Red = Device attempted to become IP connected and failed (no DHCP response, no PPPoE response, 802.1x authentication failed, no IP address from IPCP, etc.). The Red state times out after two minutes and the Service indicator light returns to the Off state. Off = The device is not powered or the broadband connection is not present.Phone 1, 2Solid Green = The associated VoIP line has been registered with a SIP proxy server.Flashing Green = Indicates a telephone is off-hook on the associated VoIP line.Off = VoIP not in use, line not registered or Gateway power off.LED ActionFactory Reset SwitchDC Power PortWPS PushbuttonEthernet PortsPhone Port(use splitter for2 phones)DSL Port
Administrator’s Handbook16Set up the Motorola GatewayRefer to your Quickstart Guide for instructions on how to connect your Motorola® gateway to your power source, PC or local area network, and your Internet access point, whether it is a dedicated DSL outlet or a DSL or cable modem. Different Motorola® Gateway models are supplied for any of these connections. Be sure to enable Dynamic Addressing on your PC. Perform the following:Microsoft Windows: Step 1. Navigate to the TCP/IP Properties Control Panel. a. Some Windows versions follow a path like this:Start menu -> Settings -> Control Panel -> Network (or Network and Dial-up Connections -> Local Area Connection -> Proper-ties) -> TCP/IP [your_network_card] or Internet Protocol [TCP/IP] -> Propertiesb. Some Windows versions follow a path like this:Start menu -> Control Panel -> Network and Internet Connections -> Network Connections -> Local Area Connection -> Properties -> Internet Protocol [TCP/IP] -> Properties Then go to Step 2.Step 2. Select Obtain an IP address automatically.Step 3. Select Obtain DNS server address automatically, if available.Step 4. Remove any previously configured Gateways, if available.Step 5. OK the settings. Restart if prompted.
17c. Windows Vista and Windows 7 obtain an IP address automatically by default. You may not need to configure it at all.To check, open the Networking Control Panel and select Internet Protocol Version 4 (TCP/IPv4). Click the Properties button.The Internet Protocol Version 4 (TCP/IPv4) Properties window should appear as shown.If not, select the radio buttons shown above, and click the OK button.
Administrator’s Handbook18Macintosh MacOS 8 or higher or Mac OS X: Step 1. Access the TCP/IP or Network control panel. a. MacOS follows a path like this:Apple Menu -> Control Panels -> TCP/IP Control Panel b. Mac OS X follows a path like this:Apple Menu -> System Preferences -> NetworkThen go to Step 2.Step 2. Select Built-in Ethernet Step 3. Select Configure Using DHCPStep 4. Close and Save, if prompted.Proceed to “Accessing the Web Management Interface” on page 19.
19Accessing the Web Management Interface1. Run your Web browser application, such as Firefox or Microsoft Internet Explorer, from the computer connected to the Motorola® Gateway.2. Enter http://192.168.1.254 in the Location text box.The Device Status Page appears.3. Check to make sure the Broadband and Service LEDs are lit GREEN to verify that the connection to the Internet is active.Congratulations! Your installation is complete.You can now surf to your favorite Web sites by typing an URL in your browser’s location box or by selecting one of your favorite Internet bookmarks.
Administrator’s Handbook20IP Diagnostics pageIn the event that your connection to the Internet fails, the IP Diagnostics page displays.Follow the on-screen troubleshooting suggestions.For additional troubleshooting information, see “Basic Troubleshooting” on page 69.
21Device Status pageAfter you have performed the basic Easy Login configuration, any time you log in to your Motorola® Gateway you will access the Motorola® Gateway Home Page. You access the Home Page by typing http://192.168.1.254 in your Web browser’s location box.Device Access CodeYou may be required to provide your Device Access Code in order to access the web management configuration pages. The Device Access Code is unique to your device. It is printed on a label on the side of the Gateway.Enter your Device Access Code and click the Continue button.The Device Status Page appears.
Administrator’s Handbook22The Device Status displays the following information in the center section: Some fields may or may not display, depending on your particular setup.The Diagnostics button will connect you to the Troubleshoot page. See “Diagnostics” on page 61.The right-hand frame displays some links to commonly performed tasks for easy access.◆Go to AT&T online support for troubleshooting and repair »This link will connect you to the IP Diagnostics page with help for troubleshooting and the AT&T Help Desk information. See “IP Diagnostics page” on page 20.◆Modify your Wireless security or settings »This link will connect you to the Wireless page. See “Wireless” on page 35.◆Restart your gateway »This link will connect you to the Restart Device page. See “Restart Device” on page 27.◆Find a computer on your home network »This link will connect you to the Device List page. See “Device List” on page 24.◆Adjust firewall settings for gaming and applications »This link will connect you to the NAT/Gaming page. See “NAT/Gaming” on page 53.Field DescriptionBroadbandBroadband Connection ‘Waiting for DSL’ is displayed while the Gateway is training. This should change to ‘Up’ within two minutes.‘Up’ is displayed when the ADSL line is synched and the PPPoE ses-sion is established.‘Down’ indicates inability to establish a connection; possible line fail-ure.Line State Line State connection (Internet) is either Up or DownWi-FiStatus Your wireless signal may be ‘On’ or ‘Off’.Network ID (SSID) This is the name or ID that is displayed to a client scan. The default SSID for the Gateway is attxxx where xxx is the last 3 digits of the serial number located on the side of the Gateway.Authentication Type The type of wireless encryption security in use. May be Disabled, WPA or WEP, Default Key or Manual.Network Key Wireless network encryption key in use.VoiceLine 1 Indication of VoIP or other phone connection.Line 2 Indication of VoIP or other phone connection.
23Tab BarThe tab bar is located at the top of every page, allowing you to move freely about the site.The tabs reveal a succession of pages that allow you to manage or configure several features of your Gateway. Each tab is described in its own section.HelpHelp is provided in your Gateway. Help is available in the right hand frame on every page in the Web interface.Here is an example:The page shown here is displayed when you are on the System Information page.
Administrator’s Handbook24Links BarThe links bar at the top of each page allows you to configure different aspects of the features displayed on the page. For example, on the Home Summary page, the button bar is shown below:Click the links below to be taken to each section.◆“Device Status page” on page 21◆“Device List” on page 24◆“System Information” on page 25◆“Access Code” on page 26◆“Restart Device” on page 27Link: Device ListWhen you click the Device List link, the Device List page appears.The page displays the following information:Click the Refresh button to update the Home Network summary.Home Network DevicesHome Network Devices Displays the IP Address, Network Name, and MAC Address of devices connected to this Gateway on your local area network.Device IPv4 Address Client device’s IP address or device network name.MAC Address Client device’s unique hardware address.Status May be off or on.Connection Type of connection, for example, Ethernet.Allocation Type of IP address assignment, for example, Static or DHCP.
25Link: System InformationWhen you click the System Information link, the System Information page appears.The page displays the following information:System InformationManufacturer This is the manufacturer’s identifier name.Model Number This is the manufacturer’s model number.Serial Number This is the unique serial number of your Gateway.Software Version This is the version number of the current embedded software in your Gateway.MAC Address Unique hardware address of this Gateway unit.First Use Date Date and Time when the Gateway is first used. This field changes to the cur-rent date and time after a reset to factory defaults.Time Since Last Reboot Elapsed time since last reboot of the Gateway in days:hr:min:sec.Datapump Version Underlying operating system software datapump versionLegal Disclaimer Clicking the Licenses link displays a listing of software copyright attributions.
Administrator’s Handbook26Link: Access CodeAccess to your Gateway is controlled through an account named Admin. The default Admin password for your Gateway is the unique Access Code printed on the label on the side of your Gateway. As the Admin, you can change this password to a different one of your own choosing up to 32 characters long. The new password must also include two characters from any these categories: alpha, number, and special char-acters.Example: “fru1tfl13s_likeabanana”Enter your Old Access Code, your New Access Code, and click the Use New Access Code button. The new Access Code takes effect immediately.You can always return to the original default password by clicking the Use Default Access Code button.
27Link: Restart DeviceWhen the Gateway is restarted, it will disconnect all users, initialize all its interfaces, and load the Operating Sys-tem Software.When you make configuration changes, you may be required restart for the changes to take effect.
Administrator’s Handbook28BroadbandWhen you click the Broadband tab, the Broadband Status page appears.The Broadband Status page displays information about the Gateway’s WAN connection to the Internet. Broadband StatusLine State May be Up (connected) or Down (disconnected).Broadband Connection May be Up (connected) or Down (disconnected).Downstream Sync Rate This is the rate at which your connection can download (receive) data on your DSL line, in kilobits per second.Upstream Sync Rate This is the rate at which your connection can upload (send) data on your DSL line, in kilobits per second.Modulation Method of regulating the DSL signal. DMT (Discrete MultiTone) allows connec-tions to work better when certain radio transmitters are present. Data Path Type of path used by the device's processor. Broadband IPv4 Address The public IP address of your device, whether dynamically or statically assigned.
29Gateway IPv4 Address Your ISP's gateway router IP address.MAC Address Your Gateway’s unique hardware address identifier.Primary DNS The IP Address of the Primary Domain Name Server.Secondary DNS The IP Address of the backup Domain Name Server, if available.Primary DNS Name The name of the Primary Domain Name Server.Secondary DNS Name The name of the backup Domain Name Server, if available.MTU Maximum Transmittable Unit before packets are broken into multiple packets.IPv6Status May be Enabled or Disabled.Global Unicast IPv6 AddressThe public IPv6 address of your device, whether dynamically or statically assigned.Border Relay IPv4 AddressThe public IPv4 address of your device.IPv4 StatisticsTransmit Packets IPv4 packets transmitted.Transmit Errors Errors on IPv4 packets transmitted.Transmit Discards IPv4 packets dropped.Downstream and Upstream StatisticsSN Margin (db) Signal to noise margin, in decibels. Reflects the amount of unwanted “noise” on the DSL line. Line Attenuation Amount of reduction in signal strength on the DSL line, in decibels. Output Power (dBm) Measure of power output in decibels (dB) referenced to one milliwatt (mW).Errored Seconds The number of uncorrected seconds after being down for seven consecutive seconds.Loss of Signal The absence of any signal for any reason, such as a disconnected cable or loss of power.Loss of Frame A signal is detected but cannot sync with signal caused by mismatched proto-cols, wrong ISP connection configuration, or faulty cable.FEC Errors (Forwarded Error Correction errors) Count of received errored packets that were fixed successfully with out a retry.CRC Errors Number of times data packets have had to be resent due to errors in transmis-sion or reception.
Administrator’s Handbook30Link: ConfigureWhen you click the Configure link, the Broadband Configure screen appears.The WAN connection is automatically configured. However, you can adjust the MTU (Maximum Transmittable Unit) value, if your service provider suggests it. The default 1500 is the maximum value, but some services require other values. 1492 is common.If you make any change here, click the Save button.
31Home NetworkWhen you click the Home Network tab, the Home Network Status page appears.The Home Network Status page displays information about the Gateway’s local area network.
Administrator’s Handbook32Home Network StatusDevice IPv4 Address The Gateway’s own IP address on the network.DHCP Netmask The Gateway’s own netmask on the network.DHCPv4 Start Address The starting IP address of the DHCP range served by the Gateway.DHCPv4 End Address The ending IP address of the DHCP range served by the Gateway.DHCP Leases Available The number of IP addresses of the DHCP range available to be served by the Gateway.DHCP Leases Allocated The number of IP addresses of the DHCP range currently being served by the Gateway.DHCP Primary Pool Source pool of the IP addresses served by the Gateway, Public or Private.IPv6Status May be Enabled or Disabled.Global Unicast IPv6 AddressThe public IPv6 address of your device, whether dynamically or statically assigned.Link-local Unicast IPv6 AddressThe private IPv6 address of your device, whether dynamically or statically assigned.Router Advertisement PrefixThe IPv6 prefix to include in router advertisements.Prefix Delegation range The IPv6 prefix range from which prefixes can be delegated to clients by spec-ifying an IPv6 prefixIPv4 StatisticsTransmit Packets IPv4 packets transmitted.Transmit Errors Errors on IPv4 packets transmitted.Transmit Discards IPv4 packets dropped.Wireless StatusWireless Radio Status Indicates whether the Wi-Fi radio is operational or off.Network Name (SSID) This is the name or ID that is displayed to a client scan. The default SSID for the Gateway is attxxx where xxx is the last 3 digits of the serial number located on the side of the Gateway.Hide SSID May be either On or Off. If On, your SSID will not appear in a client scan.Mode May be 802.11b only, 802.11g only, 802.11n, or 802.11 b+g+n.Bandwidth The capacity of the wireless LAN to carry traffic. May be wide or narrow.Current Radio Channel The radio channel that your Wi-Fi network is broadcasting on.Radio Channel Selection May be set to automatic or manually selected.Wireless Security The type of wireless encryption security in use. May be Disabled, WPA-PSK or WEP, Default Key or Manual.Configured Data Rate This is the rate that you have configured the wireless driver to use.Supported Data Rates These are the rates the wireless driver is actually currently advertising and using. This is a combination of the Configured Rates, plus any run-time limita-tions that the environment is incurring (for instance, the presence of legacy cli-ents in the area can limit the offering of higher rates).Current Signal Strength (dBm)This is an average measure of how strong the signals received from clients are.
33The links at the top of the Home Network page access a series of pages to allow you to configure and monitor features of your device. The following sections give brief descriptions of these pages.◆“Configure” on page 34◆“Wireless” on page 35◆“WPS” on page 39◆“MAC Filtering” on page 40◆“Subnets & DHCP” on page 41ERP-PBCC Status This tells whether or not the Gateway is honoring legacy 802.11b compatibility mode.DSSS-OFDM Status This is the wireless modulation in use.  DSS if in b-only mode, OFDM other-wise.MAC Address Filtering May be either On or Off. If On, you can accept or block client devices from your WLAN based on their MAC address.Power Level May be adjusted up to 100%, lower if multiple wireless access points are in use, and might interfere with each other.Key Management Infor-mationShows the information of the security encryption key in use.LAN Wireless StatisticsBytes Transmitted Number of bytes transmitted on the Wi-Fi network.Bytes Received Number of bytes received on the Wi-Fi network.Packets Transmitted Number of packets transmitted on the Wi-Fi network.Packets Received Number of packets received on the Wi-Fi network.Error Packets Transmitted This is the number of errors on packets transmitted on the Wi-Fi network.Error Packets Received This is the number of errors on packets received on the Wi-Fi network.Discard Packets Transmit-tedThis is the number of packets transmitted on the Wi-Fi network that were dropped.Discard Packets Received This is the number of packets received on the Wi-Fi network that were dropped.LAN Ethernet StatisticsState up or downTransmit Speed This is the maximum speed of which the port is capable.Transmit Packets This is the number of packets sent out from the port.Transmit Bytes This is the number of bytes sent out from the port.Transmit Dropped This is the number of packets sent out from the port that were dropped.Transmit Errors This is the number of errors on packets sent out from the port.Receive Packets This is the number of packets received on the port.Receive Bytes This is the number of bytes received on the port.Receive Unicast This is the number of unicast packets received on the port.Receive Multicast This is the number of multicast packets received on the port.Receive Dropped This is the number of packets received on the port that were dropped.Receive Errors This is the number of errors on packets received on the port.
Administrator’s Handbook34Link: ConfigureWhen you click the Configure link, the Configure page for the Ethernet LAN appears.For each Ethernet Port, 1 through 4, you can select:◆Ethernet – auto (the default self-sensing rate), 10M full- or half-duplex, 100M full- or half-duplex, or 1G full- or half-duplex.◆MDI-X – auto (the default self-sensing crossover setting), off, or on.You can also enable or disable IPv6 if your LAN devices support or require it. Select On or Off from the pull-down menu. Click the Save button.
35Link: WirelessWhen you click the Wireless link the Wireless page appears. The Wireless page displays the status of your Wireless LAN elements.The Wireless page’s center section contains a summary of the Wireless Access Point’s configuration settings and operational status.◆The Wireless Operation function is automatically enabled by default. If you uncheck the checkbox, the Wire-less Options are disabled, and the Wireless Access Point will not provide or broadcast its wireless LAN ser-vices.Summary Information   Field    Status and/or DescriptionGeneral InformationWireless Operation May be either On or Off.Network Name (SSID) This is the name or ID that is displayed to a client scan. The default SSID for the Gateway is attxxx where xxx is the last 3 digits of the serial number located on the side of the gateway.Hide SSID May be either Enabled or Disabled. If Enabled, your SSID will not appear in a client scan.Security The type of wireless encryption security in use. May be OFF-No Privacy, WPA-PSK or WEP, Default Key or Manual.WPA Version If WPA is selected, may be Both, WPA-1, or WPA-2,.WEP Key Length May be 10 characters for 40/64-bit, or 26 characters for 128-bit WP encryption.Key Here you can enter a manual encryption key.Mode May be 802.11b only, 802.11g only, 802.11n, or 802.11 b+g+n.Bandwidth The capacity of the wireless LAN to carry traffic. May be wide or narrow.Channel The radio channel that your Wi-Fi network is broadcasting on.Power Level May be adjusted up to 100%, lower if multiple wireless access points are in use, and might interfere with each other.Wireless Protected Setup (WPS)May be either On or Off.
Administrator’s Handbook36◆Network Name (SSID) – preset to a number unique to your unit. You can either leave it as is, or change it by entering a freeform name of up to 32 characters, for example “Hercule’s Wireless LAN”. On client PCs’ soft-ware, this might also be called the Network Name. The Wireless ID is used to identify this particular wireless LAN. Depending on their operating system or client wireless card, users must either:• select from a list of available wireless LANs that appear in a scanned list on their client• or enter this name on their clients in order to join this wireless LAN.◆Hide SSID –  If enabled, this mode hides the wireless network from the scanning features of wireless client computers. Unless both the wireless clients and the Gateway share the same Network Name (SSID) in hidden mode, the Gateway’s wireless LAN will not appear as an available network when scanned for by wireless-enabled computers. Members of the hidden WLAN must log onto the Gateway’s wireless network with the identical SSID as that configured in the Gateway.Closed System mode is an ideal way to increase wireless security and to prevent casual detection by unwanted neighbors, office users, or malicious users such as hackers. If you do not enable Hide SSID, it is more convenient, but potentially less secure, for clients to access your WLAN by scanning available access points. You must decide based on your own network requirements.◆Security, WPA Version, WEP Key Length, Key – see “Wireless Security” on page 37.◆Mode – The pull-down menu allows you to select and lock the Gateway into the wireless transmission mode you want: B/G/N, B-only, B/G, G-only, or N-only.For compatibility with clients using 802.11b (up to 11 Mbps transmission), 802.11g (up to 20+ Mbps), 802.11a (up to 54 Mbit/s using the 5 GHz band), or 802.11n (from 54 Mbit/s to 600 Mbit/s with the use of four spatial streams at a channel width of 40 MHz), select B/G/N. To limit your wireless LAN to one mode or the other, select G-only, N-only, or B-only, or some combination that applies to your setup.☛  NOTE:If you choose to limit the operating mode to 802.11b or 802.11g only, clients using the mode you excluded will not be able to connect.◆Bandwidth – May only be selected if mode is some combination of 802.11n (from 54 Mbit/s to 600 Mbit/s with the use of four spatial streams at a channel width of 40 MHz). Measure of the width of a range of frequen-cies, in megahertz. ◆Channel (1 through 11, for North America) on which the network will broadcast. This is a frequency range within the 2.4Ghz band. Channel selection depends on government regulated radio frequencies that vary from region to region. Channel selection can have a significant impact on performance, depending on other wireless activity close to this Wireless Access Point. You need not select a channel at any of the computers on your wireless network. They will automatically scan available channels seeking a Gateway broadcasting on the SSID for which they are configured.The Automatic setting allows the Wireless Access Point to determine the best channel to broadcast automati-cally.◆Wireless Power Level – Sets the wireless transmit power, scaling down the Wireless Access Point’s wireless transmit coverage by lowering its radio power output. Default is 100% power. Transmit power settings are use-ful in large venues with multiple wireless routers where you want to reuse channels. Since there are only three non-overlapping channels in the 802.11 spectrum, it helps to size the Wireless Access Point’s cell to match the location. This allows you to install a router to cover a small “hole” without conflicting with other routers nearby.◆Wireless Protected Setup (WPS) is a not a new security protocol. It is simply an easier way to use existing protocols to provide greater security for your wireless network connections.By default, Privacy is set to Wireless Protected Access (WPA-PSK). WPS allows you to automatically generate a new strong WPA key for your Gateway and any client devices on your wireless network.☛  Note:Not all client wireless devices support WPS. Refer to their documentation.
37Wireless SecurityBy default, Wireless Security is set to WPA-PSK with a pre-defined WPA-Default Key (Wireless Protected Access Pre-Shared Key).Other options are available from the Security pull-down menu:◆WEP - Manual: WEP Security is a Privacy option that is based on encryption between the Router and any PCs (“clients”) you have with wireless cards. If you are not using WPA-PSK Privacy, you can use WEP encryption instead. For this encryption to work, both your Wireless Access Point and each client must share the same Wireless ID (SSID), and both must be using the same encryption keys. See “WEP-Manual” on page 37.◆WPA-PSK: allows you to enter your own key, the most secure option for your wireless network. The key can be between 8 and 63 characters, but for best security it should be at least 20 characters.If you select WPA-PSK as your privacy setting, the WPA Version pull-down menu allows you to select the WPA version(s) that will be required for client connections. Choices are: Both, for maximum interoperability,WPA-1, for backward compatibility,WPA-2, for maximum security.All clients must support the version(s) selected in order to successfully connect.Be sure that your Wi-Fi client adapter supports this option. Not all Wi-Fi clients support WPA-PSK.◆OFF - No Privacy: This mode disables privacy on your network, allowing any wireless users to connect to your wireless LAN. Use this option if you are using alternative security measures such as VPN tunnels, or if your network is for public use.Click the Save button.WEP-ManualYou can provide a level of data security by enabling WEP (Wired Equivalent Privacy) for encryption of net-work data. You can enable 40- or 128-bit WEP Encr yption (depending on the capability of your client wireless card) for IP traffic on your LAN.WEP - Manual allows you to enter your own encryption keys manually. This is a difficult process, but only needs to be done once. Avoid the temptation to enter all the same characters.
Administrator’s Handbook38Key Length: The pull-down menu selects the length of each encryption key. The longer the key, the stronger the encryption and the more difficult it is to break the encryption.Key: You enter a key using hexadecimal digits. For 40/64-bit encryption, you need ten digits; 26 digits for 128-bit WEP. Hexadecimal characters are 0 – 9, and a – f. Examples:◆ 40 bits: 02468ACE02◆ 128 bits: 0123456789ABCDEF0123456789Any WEP-enabled client must have an identical key of the same length as the Router, in order to suc-cessfully receive and decrypt the traffic. Similarly, the client also has a ‘default’ key that it uses to encrypt its transmissions. In order for the Router to receive the client’s data, it must likewise have the identical key of the same length.Click the click Save button.
39Link: WPSWireless Protected Setup (WPS) is a not a new security protocol. It is simply an easier way to use existing pro-tocols to provide greater security for your wireless network connections.By default, Privacy is set to Wireless Protected Access (WPA-PSK). WPS allows you to automatically generate a new strong WPA key for your Gateway and any client devices on your wireless network.☛  Note:Not all client wireless devices support WPS. Refer to their documentation.Adding wireless clients to your network is easier using Wireless Protected Setup (WPS). Before you begin, be sure WPS is enabled on your device. WPS clients will be "auto-configured" by pushbutton or PIN-entry. Older, non-WPS clients can still be added to the network by configuring them the standard way with WPA-PSK or WEP. The client machine(s) to be added should be powered on and their wireless cards operational. Follow any instruc-tions that came with your wireless client devices.Click the here link to proceed.
Administrator’s Handbook40Link: MAC FilteringWhen you click the MAC Filtering link the MAC Filtering page appears.MAC Filtering allows you to specify which client PCs are allowed to join the wireless LAN by unique hardware (MAC) address.◆To enable this feature, select Blacklist or Whitelist from the MAC Filtering Type menu. Blacklist means that only MAC addresses you specify will be denied access; Whitelist means that only MAC addresses you specify will be allowed access.◆You add wireless clients that you want to Whitelist or Blacklist for your wireless LAN by selecting them from the List of MACs or by entering the MAC addresses in the Manual Entry field provided.◆Click the Add button.Your entries will be added to a list of clients that will be either authorized (Whitelisted) or disallowed (Blacklisted) depending on your selection.◆Click the Save button.You can Add or Remove any of your entries later by returning to this page.
41Link: Subnets & DHCPWhen you click the Subnets & DHCP link, the Subnets & DHCP page appears.The Server configuration determines the functionality of your DHCP Settings. This functionality enables the Gate-way to assign your LAN computer(s) a “private” IP address and other parameters that allow network communica-tion. This feature simplifies network administration because the Gateway maintains a list of IP address assignments. Additional computers can be added to your LAN without the hassle of configuring an IP address. This is the default mode for your Gateway.Private LAN Subnet◆Device IP Address: The IP address of your Gateway as seen from the LAN ◆Subnet Mask: Subnet mask of your LAN ◆DHCP Start Address: First IP address in the range being served to your LAN by the Gateway's DHCP server ◆DHCP End Address: Last IP address in the range being served to your LAN by the Gateway's DHCP server Public Subnet◆Public Subnet Enable: If you select On from the pull-down menu, you can enable a second subnet to distrib-ute public addresses to DHCP clients.◆Routed Network: If Public Subnet Enable is checked, this selection permits you to specify Gateway Selec-tion by the Gateway Router IP Address or its Router Name.◆Delegated Gateway: The IP address for a router set up behind this Gateway, if one is used.◆Public IPv4 Address: The IP address of your Gateway as seen from the WAN◆Subnet Mask: Public subnet mask◆DHCPv4 Start Address: First IP address in the range being served from a DHCP public pool.◆DHCPv4 End Address: Last IP address in the range being served from a DHCP public pool.
Administrator’s Handbook42DHCP Options◆DHCP Lease Time: Specifies the default length for DHCP leases issued by the Router. Enter lease time in dd:hh:mm:ss (days/hours/minutes/seconds) format.◆Primary DHCP Pool: Choose the source of the DHCP pool IP address assignment by selecting either the Pri-vate (local to your LAN) or Public (assigned remotely) radio button.If you make any changes here, click the Save button, and if prompted, restart the Gateway.
43VoiceIf you click the Voice ink, the Voice page appears.Voice-over-IP (VoIP) refers to the ability to make voice telephone calls over the Internet. This differs from tradi-tional phone calls that use the Public Switched Telephone Network (PSTN). VoIP calls use an Internet protocol, Session Initiation Protocol (SIP), to transmit sound over a network or the Internet in the form of data packets.◆The Voice page displays information about your VoIP phone lines, if configured. Your Gateway supports two phones, Line 1 and Line 2.◆If either one or both are registered with a SIP server by your service provider or not registered, the Voice page will display their Registration Status.The links at the top of the Voice page access a series of pages to allow you to configure and monitor features of your device. The following sections give brief descriptions of these pages.◆“Line Details” on page 44◆“Call Statistics” on page 45
Administrator’s Handbook44Link: Line DetailsWhen you click the Line Details link, the Line Details page appears.◆If your service provider has enabled your VoIP phone lines, you can register them by clicking the Register Line 1 or Register Line 2 button(s).◆To test if the lines are enabled, click the Ring Line 1 or Ring Line 2 button(s). If enabled and registered, the respective phone will ring until you click the Stop Ring Line 1 or Stop Ring Line 2 buttons.◆To update the display, click the Refresh button.
45Link: Call StatisticsWhen you click Call Statistics, the Call Statistics page appears.For Line 1 and Line 2:, the two available phone lines, the Call Statistics page displays the following information:Call Statistics - Line 1 and Line 2Last Call/Cumulative – Incomin/OutgoingRTP Packet Loss Real-time Transport Protocol packets droppedTotal RTCP Packets Total Real-time Transport Control Protocol packetsAverage Inter Arrival Jitter This is calculated continuously as each data packet is received and averaged.Max Inter Arrival Jitter This is the maximum value recorded as each data packet is received.Sum of Inter Arrival Jitter This is calculated continuously as each data packet is received and totalled.Sum of Inter Arrival Jitter SquaredThis is calculated continuously as each data packet is received and the total is squared.
Administrator’s Handbook46Sum of Franc Loss Fraction Lost: The fraction of RTP data packets lost since the previous SR or RR packet was sent. This fraction is defined to be the number of packets lost divided by the number of packets expected. This will be calculated on every RTCP SR packet. Sum of the fraction lost is calculated with all the RTCP pack-ets. Sum of Franc Loss SquaredFraction lost is squared with every RTCP SR or RR packet. Sum of all this will give the Sum of Franc Loss Squared.Max One Way Delay One Way Delay will be calculated on every RTCP SR or RR packet. This value is ( systime - lsr - dslr) / 2 lsr means last SR timestampdslr means delay since last SR.Sum of One Way Delay The sum of all the one way delays calculated on every RTCP packet is dis-played as Sum of One Way Delay.Sum of One Way Delay SquaredOne Way Delay is squared with every RTCP SR or RR packet. Sum of all this will give the Sum of One Way Delay Squared.Avg Round Trip Time Average time from this local source to destination address and back again for all logged callsMax Round Trip Time Maximum amount of time from this local source to destination address and back again for all logged callsSum of Round Trip Time Sum of time from this local source to destination address and back again for all logged callsSum of Round Trip Time SquaredSum squared of time from this local source to destination address and back again for all logged calls
47For Line 1 and Line 2:, the two available phone lines, the Call Summary section displays the following informa-tion:Call Summary - Line 1 and Line 2Current Call/Last Completed CallCall Timestamp Date and Time of the current callType May be Incoming or OutgoingDuration Length of time of call connectionCodec in Use Audio codec used for decoding the call packet traffic.Far-End Host Information SIP server IP information: IP address and port numberFar-End Caller Information Caller ID information, if availableCumulative Since Last ResetLast Reset Timestamp Date and Time of the last callNumber of Calls Total number of calls for each VoIP lineDuration Time since the last callNumber of Incoming Calls Failed Number of Incoming calls that fail to connectNumber of Outgoing Calls Failed Number of Outgoing calls that fail to connect
Administrator’s Handbook48FirewallWhen you click the Firewall tab, the Firewall Status page appears. The Firewall page displays the status of your system firewall elements.All computer operating systems are vulnerable to attack from outside sources, typically at the operating system or Internet Protocol (IP) layers. Stateful Inspection firewalls intercept and analyze incoming data packets to deter-mine whether they should be admitted to your private LAN, based on multiple criteria, or blocked. Stateful inspec-tion improves security by tracking data packets over a period of time, examining incoming and outgoing packets. Outgoing packets that request specific types of incoming packets are tracked; only those incoming packets consti-tuting a proper response are allowed through the firewall.Stateful inspection is a security feature that prevents unsolicited inbound access when NAT is disabled. You can configure UDP and TCP “no-activity” periods that will also apply to NAT time-outs if stateful inspection is enabled on the interface. Stateful Inspection parameters are active on a WAN interface only if enabled on your system. Stateful inspection can be enabled on a WAN interface whether NAT is enabled or not.The center section displays the following:The links at the top of the Firewall page access a series of pages to allow you to configure security features of your device. The following sections give brief descriptions of these pages.◆“Packet Filter” on page 49◆“NAT/Gaming” on page 53◆“IP Passthrough” on page 58◆“Firewall Advanced” on page 60Packet Filter May be On or OffIP Passthrough May be On or OffNAT Default Server May be On or OffFirewall Advanced May be On or Off
49Link: Packet FilterWhen you click the Packet Filter link the Packet Filter screen appears.Security should be a high priority for anyone administering a network connected to the Internet. Using packet fil-ters to control network communications can greatly improve your network’s security. The Packet Filter engine allows creation of a maximum of eight Filtersets. Each Filterset can have up to eight rules configured.☛  WARNING:Before attempting to configure filters and filtersets, please read and understand this entire section thoroughly. The Motorola Gateway incorporating NAT has advanced security features built in. Improperly adding filters and filtersets increases the possibility of loss of communication with the Gateway and the Internet. Never attempt to configure filters unless you are local to the Gateway.Although using filtersets can enhance network security, there are disadvantages:• Filters are complex. Combining them in filtersets introduces subtle interactions, increasing the like-lihood of implementation errors.• Enabling a large number of filters can have a negative impact on performance. Processing of pack-ets will take longer if they have to go through many checkpoints in addition to NAT.• Too much reliance on packet filters can cause too little reliance on other security methods. Filter-sets are not a substitute for password protection, effective safeguarding of passwords, and general awareness of how your network may be vulnerable.Motorola’s packet filters are designed to provide security for the Internet connections made to and from your net-work. You can customize the Gateway’s filtersets for a variety of packet filtering applications. Typically, you use fil-ters to selectively admit or refuse TCP/IP connections from certain remote networks and specific hosts. You will also use filters to screen particular types of connections. This is commonly called firewalling your network.Before creating filtersets, you should read the next few sections to learn more about how these powerful security tools work.
Administrator’s Handbook50Parts of a filterA filter consists of criteria based on packet attributes. A typical filter can match a packet on any one of the follow-ing attributes:◆The source IP address (where the packet was sent from)◆The destination IP address (where the packet is going)◆The type of higher-layer Internet protocol the packet is carrying, such as TCP or UDPOther filter attributesThere are three other attributes to each filter:◆The filter’s order (i.e., priority) in the filterset◆Whether the filter is currently active◆Whether the filter is set to forward packets or to block (discard) packetsDesign guidelinesCareful thought must go into designing a new filterset. You should consider the following guidelines: ◆Be sure the filterset’s overall purpose is clear from the beginning. A vague purpose can lead to a faulty set, and that can actually make your network less secure.◆Be sure each individual filter’s purpose is clear.◆Determine how filter priority will affect the set’s actions. Test the set (on paper) by determining how the filters would respond to a number of different hypothetical packets.◆Consider the combined effect of the filters. If every filter in a set fails to match on a particular packet, the packet is:• Forwarded if all the filters are configured to discard (not forward)• Discarded if all the filters are configured to forward• Discarded if the set contains a combination of forward and discard filtersAn approach to using filtersThe ultimate goal of network security is to prevent unauthorized access to the network without compromising authorized access. Using filtersets is part of reaching that goal. Each filterset you design will be based on one of the following approaches:◆That which is not expressly prohibited is permitted.◆That which is not expressly permitted is prohibited.It is strongly recommended that you take the latter, and safer, approach to all of your filterset designs.
51Working with Packet FiltersTo work with filters, begin by accessing the Packet Filter pages.Packet Filter◆Enable Filter – Select On from the pull-down menu to enable this filter rule.Filter Rule Entry◆Action – Select either the drop or pass radio buttons:• drop: If you select drop, the specified packets will be blocked. • pass: If you select pass, the specified packets will be forwarded.◆Enter the Source IP Address this filter will match on.◆Enter the Destination IP Address this filter will match on.◆Select Protocol from the pull-down menu: ICMP, TCP, UDP, or None to specify any another IP transport proto-col.◆Enter the Source Port this filter will match on.◆Enter the Destination Port this filter will match on.◆If you selected ICMP, enter the ICMP Type here.When you are finished configuring the filter, click the Add button, then the Save button to save the filter.Filter Rules ListYour entries are displayed as a table.
Administrator’s Handbook52☛  NOTE:Default Forwarding FilterIf you create one or more filters that have a matching action of forward, then action on a packet matching none of the filters is to block any traffic.Therefore, if the behavior you want is to force the routing of a certain type of packet and pass all oth-ers through the normal routing mechanism, you must configure one filter to match the first type of packet and apply Force Routing. A subsequent filter is required to match and forward all other pack-ets.Management IP trafficIf the Force Routing filter is applied to source IP addresses, it may inadvertently block communica-tion with the router itself. You can avoid this by preceding the Force Routing filter with a filter that matches the destination IP address of the Gateway itself.Example:To create a Packet Filter that will block telnet from one LAN client, block access to the Gateway’s web interface from one LAN client and then allow all other traffic to pass from the LAN to the Gateway, you enable LAN Packet Filter and create filters and then apply them as an inbound filter.Input Rules:Pass Source IP Address Destination IP Address ProtocolNo 192.168.1.65 0.0.0.0 TCPNo 192.168.1.64 192.168.1.254 TCPYes 0.0.0.0 0.0.0.0 Any
53Link: NAT/GamingWhen you click the NAT/Gaming button, the NAT/Gaming page appears.NAT/Gaming allows you to host internet applications when NAT is enabled. You can host different games and software on different PCs.From the Service pull-down menu, you can select any of a large number of predefined games and software. (See “List of Supported Games and Software” on page 56.)In addition to choosing from these predefined services you can also select a user defined custom service. (See “Custom Services” on page 55.)For each supported game or service, you can view the protocols and port ranges used by the game or service by clicking the Service Details button. For example:Select a hosting device from the Needed by Device pull-down menu.1. Once you choose a software service or game, click Add.2. Select a PC to host the software from the Select Host Device pull-down menu and click Save.
Administrator’s Handbook54Each time you enable a software service or game your entry will be added to the list of Service names dis-played on the NAT Configuration page.To remove a game or software from the hosted list, choose the game or software you want to remove and click the Remove button.
55Custom ServicesTo configure a Custom Service, click the Add/Edit Services button. The Custom Services page appears.Enter the following information: ◆Service Name: A unique identifier for the Custom Service. ◆Global Port Range: Range of ports on which incoming traffic will be received. ◆Base Host Port: The port number at the start of the port range your Gateway should use when forwarding traf-fic of the specified type(s) to the internal IP address. ◆Protocol: Protocol type of Internet traffic, TCP or UDP.Once you define a Custom Service it becomes available in the Application Hosting Entry Service menu as one of the services to select.Click the Add button.Each time you enable a custom service your entry will be added to the list of Service names displayed on the Custom Services page.Changes are saved immediately.
Administrator’s Handbook56List of Supported Games and SoftwareAIM Talk Act of War - Direct Action Age of Empires IIAge of Empires, v.1.0 Age of Empires: The Rise of Rome, v.1.0Age of MythologyAge of Wonders America's Army ApacheAsheron's Call Azureus Baldur's Gate I and IIBattlefield 1942 Battlefield Communicator Battlefield VietnamBitTornado BitTorrent Black and WhiteBlazing Angels Online Brothers in Arms - Earned in BloodBrothers in Arms OnlineBuddy Phone CART Precision Racing, v 1.0 Calista IP PhoneCall of Duty Citrix Metaframe/ICA Client Close Combat III: The Russian Front, v 1.0Close Combat for Windows 1.0 Close Combat: A Bridge Too Far, v 2.0Combat Flight Sim 2: WWII Pacific Thr, v 1.0Combat Flight Sim: WWII Europe Series, v 1.0Counter Strike DNS ServerDark Reign Delta Force (Client and Server) Delta Force 2Delta Force Black Hawk Down Diablo II Server DialpadDirecTV STB 1 DirecTV STB 2 DirecTV STB 3Doom 3 Dues Ex Dune 2000Empire Earth Empire Earth 2 F-16, Mig 29F-22, Lightning 3 FTP Far CryFighter Ace II GNUtella Grand Theft Auto 2 MultiplayerH.323 compliant (Netmeeting, CUSeeME)HTTP HTTPSHalf Life Half Life 2 Steam Half Life 2 Steam ServerHalf Life Steam Half Life Steam Server HaloHellbender for Windows, v 1.0 Heretic II Hexen IIHotline Server ICQ 2001b ICQ OldIMAP Client IMAP Client v.3 IPSec IKEInternet Phone Jedi Knight II: Jedi Outcast KaliKazaA Lime Wire Links LS 2000Lord of the Rings Online MSN Game Zone MSN Game Zone DXMSN Messenger Mech Warrior 3 MechWarrior 4: VengeanceMedal of Honor Allied Assault Microsoft Flight Simulator 2000 Microsoft Flight Simulator 98
57Microsoft Golf 1998 Edition, v 1.0Microsoft Golf 1999 Edition Microsoft Golf 2001 EditionMidtown Madness, v 1.0 Monster Truck Madness 2, v 2.0 Monster Truck Madness, v 1.0Motocross Madness 2, v 2.0 Motocross Madness, v 1.0 NNTPNeed for Speed 3, Hot Pursuit Need for Speed, Porsche Net2PhoneOperation FlashPoint Outlaws POP-3PPTP PlayStation Network Quake 2Quake 3 Quake 4 Rainbow SixRealAudio Return to Castle Wolfenstein Roger WilcoRogue Spear SMTP SNMPSSH server ShoutCast Server SlingBoxSoldier of Fortune StarCraft StarLancer, v 1.0Starfleet Command TFTP TeamSpeakTelnet Tiberian Sun: Command and Con-querTimbuktuTotal Annihilation Ultima Online Unreal Tournament ServerUrban Assault, v 1.0 VNC, Virtual Network Computing Warlords BattlecryWarrock Westwood Online, Command and ConquerWin2000 Terminal ServerWolfenstein Enemy Territory World of Warcraft X-LiteXBox 360 Media Center XBox Live 360 Yahoo Messenger ChatYahoo Messenger Phone ZNES eDonkeyeMule eMule Plus iTunesmIRC Auth-IdentD mIRC Chat mIRC DCC - IRC DCCpcAnywhere (incoming)
Administrator’s Handbook58Link: IP PassthroughWhen you click the IP Passthrough button, the IP Passthrough page appears.IP PassthroughThe IP Passthrough feature allows a single PC on the LAN to have the Router’s public address assigned to it. It also provides PAT (NAPT) via the same public IP address for all other hosts on the private LAN subnet. Using IP Passthrough:◆The public WAN IP is used to provide IP address translation for private LAN computers.◆The public WAN IP is assigned and reused on a LAN computer.◆DHCP address serving can automatically serve the WAN IP address to a LAN computer.When DHCP is used for addressing the designated passthrough PC, the acquired or configured WAN address is passed to DHCP, which will dynamically configure a single-servable-address subnet, and reserve the address for the configured PC’s MAC address. This dynamic subnet configuration is based on the local and remote WAN address and subnet mask. If the WAN interface does not have a suitable subnet mask that is usable, for example when using PPP or PPPoE, the DHCP subnet configuration will default to a class C sub-net mask.◆The Passthrough DHCP Lease – By default, the passthrough host's DHCP leases will be shortened to two minutes. This allows for timely updates of the host's IP address, which will be a private IP address before the WAN connection is established. After the WAN connection is established and has an address, the passthrough host can renew its DHCP address binding to acquire the WAN IP address. You may alter this setting.◆Click Save. Changes take effect immediately.A restrictionSince both the Router and the passthrough host will use the same IP address, new sessions that conflict with existing sessions will be rejected by the Router. For example, suppose you are a teleworker using an IPSec tunnel from the Router and from the passthrough host. Both tunnels go to the same remote endpoint, such as the VPN access concentrator at your employer’s office. In this case, the first one to start the IPSec traffic will be allowed; the second one – since, from the WAN, it's indistinguishable – will fail.
59NAT Default ServerThis feature allows you to:◆Direct your Gateway to forward all externally initiated IP traffic (TCP and UDP protocols only) to a default host on the LAN, specified by your entry in the Internal Address field.◆ Enable it for certain situations: – Where you cannot anticipate what port number or packet protocol an in-bound application might use. For example, some network games select arbitrary port numbers when a connection is opened.– When you want all unsolicited traffic to go to a specific LAN host.This feature allows you to direct unsolicited or non-specific traffic to a designated LAN station. With NAT “On” in the Gateway, these packets normally would be discarded.For instance, this could be application traffic where you don’t know (in advance) the port or protocol that will be used. Some game applications fit this profile.◆Click Save. Changes take effect immediately.
Administrator’s Handbook60Link: Firewall AdvancedWhen you click the Firewall Advanced button the Firewall Advanced screen appears.All computer operating systems are vulnerable to attack from outside sources, typically at the operating system or Internet Protocol (IP) layers. Stateful Inspection firewalls intercept and analyze incoming data packets to deter-mine whether they should be admitted to your private LAN, based on multiple criteria, or blocked. Stateful inspec-tion improves security by tracking data packets over a period of time, examining incoming and outgoing packets. Outgoing packets that request specific types of incoming packets are tracked; only those incoming packets consti-tuting a proper response are allowed through the firewall.Stateful inspection is a security feature that prevents unsolicited inbound access when NAT is disabled. You can configure UDP and TCP “no-activity” periods that will also apply to NAT time-outs if stateful inspection is enabled on the interface. Stateful Inspection parameters are active on a WAN interface only if enabled on your Gateway. Stateful inspection can be enabled on a WAN interface whether NAT is enabled or not.DoS Protection – Denial-0f-Service attacks are common on the Internet, and can render an individual PC or a whole network practically unusable by consuming all its resources. Your Gateway includes default settings to block the most common types of DoS attacks. For special requirements or circumstances, a variety of additional blocking characteristics is offered. See the following table. If you make any changes here, click the Save button.Menu item FunctionDrop packets with invalid source or destination IP addressWhether packets with invalid source or destination IP address(es) are to be droppedProtect against port scan Whether to detect and drop port scans.Drop packets with unknown ether typesWhether packets with unknown ether types are to be droppedDrop packets with invalid TCP flags Whether packets with invalid TCP flag settings (NULL, FIN, Xmas, etc.) should be droppedDetect and drop packet floods Whether packet flooding should be detected and offending packets be droppedFlood limit (packets per second) Specifies the number limit of packets per second before dropping the remainder.Flood burst limit (maximum num-ber of packets in a burst)Specifies the number limit of packets in a single burst before dropping the remainder.
61DiagnosticsWhen you click the Diagnostics tab, the Troubleshoot page appears.This automated multi-layer test examines the functionality of the Router from the physical connections to the data traffic being sent by users through the Router.You can run all the tests in order by clicking the Run Full Diagnostics button.The modem will automatically test a number of components to determine any problems. You can see detailed results of the tests by clicking the Details buttons for each item.
Administrator’s Handbook62Here is an example of the Ethernet Details screen.Test Internet Access These tests send a PING from the modem to either the LAN or WAN to verify connectivity. A PING could be either an IP address (163.176.4.32) or Domain Name (www.motorola.com). You enter a web address URL or an IP address in the respective field and Select your Preferred protocol radio button, IPv4 or IPv6.Click the Ping, Trace, or Lookup button. Results will be displayed in the Progress Window as they are generated.◆Ping - tests the “reachability” of a particular network destination by sending an ICMP echo request and waiting for a reply.◆Traceroute - displays the path to a destination by showing the number of hops and the router addresses of these hops.◆NSLookup - converts a domain name to its IP address and vice versa.To use the Ping capability, type a destination address (domain name or IP address) in the text box and click the Ping, Trace, or Lookup button. The results are displayed in the Progress Window.This sequence of tests takes approximately one minute to generate results. Please wait for the test to run to com-pletion.Each test generates one of the following result codes:Result Meaning* PASS: The test was successful.* FAIL: The test was unsuccessful.* SKIPPED: The test was skipped because a test on which it depended failed.* PENDING: The test timed out without producing a result. Try running the test again.* WARNING: The test was unsuccessful. The Service Provider equipment your Modem connects to may not support this test.
63Below are some specific tests:Action If PING fails, possible causes are:From the Check Connection page:Ping the internet default gateway IP address DSL is down, DSL or ATM settings are incorrect; Gateway’s IP address or subnet mask are wrong; gateway router is down.Ping an internet site by IP address Site is down.Ping an internet site by name Servers are down; site is down.From a LAN PC:Ping the Modem’s LAN IP address IP address and subnet mask of PC are not on the same scheme as the Modem; cabling or other con-nectivity issue.Ping an internet site by IP address PC's subnet mask may be incorrect, site is down.Ping an internet site by name DNS is not properly configured on the PC, site is down.
Administrator’s Handbook64Link: LogsWhen you click Logs, the Logs page appears.The current status of the Router is displayed for all logs.◆You can clear all log entries by clicking the Clear Log button.◆You can save logs to a text (.TXT) file by clicking the Save to File button. This will download the file to your browser’s default download location on your hard drive. The file can be opened with your favorite text editor.☛  Note: Some browsers, such as Internet Explorer for Windows XP, require that you specify the Motorola® Gateway’s URL as a “Trusted site” in “Internet Options: Security”. This is necessary to allow the “download” of the log text file to the PC.
65The following is an example log portion saved as a .TXT file:P0000-00-00T00:00:08 L6 sdb[306]: log buffer size set to 8192P0000-00-00T00:00:08 L7 sdb[306]: libmotopia: Closing /dev/motopiaP0000-00-00T00:00:08 L7 sdb[306]: Loading platform module bcm_enetP0000-00-00T00:00:08 L6 sdb[306]: SSL CA-root-cert directory is ready.P0000-00-00T00:00:08 L6 sdb[306]: Hardware is 'NVG510'P0000-00-00T00:00:09 L6 sdb[306]: S/N 157978490448, SKU 64P0000-00-00T00:00:12 L5 sdb[306]: Wireless subsystem foundP0000-00-00T00:00:15 L5 sdb[306]: VOIP subsystem foundP0000-00-00T00:00:15 L7 sdb[306]: nm_add_supp1x entrypointP0000-00-00T00:00:15 L7 sdb[306]: netfilter: redirect object not found. skip prerouting rulesP0000-00-00T00:00:17 L3 sdb[306]: scheduler: no ntp objectP0000-00-00T00:00:17 L6 sdb[306]: ip6.route[1]: Setting state from 'unset' to 'down'P0000-00-00T00:00:18 L5 sdb[306]: skip authorization-delay timer. not defaultedP0000-00-00T00:00:18 L3 sdb[306]: ELAN: Error creating 'enet' 'power-save' object: Item not foundP0000-00-00T00:00:18 L7 sdb[306]: Wi-Fi: Taking down phy.wl80211 interface wl0P0000-00-00T00:00:18 L6 sdb[306]: Wi-Fi: Adding wireless port ssid-1 (wl0)P0000-00-00T00:00:18 L6 sdb[306]: Wi-Fi: Adding wireless port ssid-2 (wl0.1)P0000-00-00T00:00:18 L6 sdb[306]: Wi-Fi: Adding wireless port ssid-3 (wl0.2)P0000-00-00T00:00:18 L6 sdb[306]: Wi-Fi: Adding wireless port ssid-4 (wl0.3)P0000-00-00T00:00:18 L5 sdb[306]: DSL: EOC version 157978490448:NVG510:905012P0000-00-00T00:00:18 L7 sdb[306]: enabling vc[1]P0000-00-00T00:00:19 L5 sdb[306]: voipexe start returned ret=0 P0000-00-00T00:00:19 L5 sdb[306]: skip authorization-delay timer. not defaultedP0000-00-00T00:00:19 L4 sdb[306]: Configured for IPDSLAM modeP0000-00-00T00:00:19 L3 sdb[306]: start[8024] end[8036]P0000-00-00T00:00:19 L6 sdb[306]: validate <basic> queue(1)P0000-00-00T00:00:19 L6 sdb[306]: validate <basic> queue(2)P0000-00-00T00:00:19 L6 sdb[306]: validate <basic> queue(3)P0000-00-00T00:00:19 L6 sdb[306]: validate <basic> queue(4)P0000-00-00T00:00:19 L6 sdb[306]: validate <basic> queue(5)P0000-00-00T00:00:19 L6 sdb[306]: validate <basic> queue(6)P0000-00-00T00:00:19 L6 sdb[306]: validate <priority> queue(7)P0000-00-00T00:00:19 L6 sdb[306]: ip6_set_proc: setting </proc/sys/net/ipv6/conf/all/disable_ipv6> to '1'P0000-00-00T00:00:19 L6 sdb[306]: ip6_set_proc: setting </proc/sys/net/ipv6/conf/default/disable_ipv6> to '1'P0000-00-00T00:00:19 L6 sdb[306]: ip6_set_proc: setting </proc/sys/net/ipv6/conf/all/forwarding> to '0'P0000-00-00T00:00:23 L7 sdb[306]: Wi-Fi: First apply - apply everythingP0000-00-00T00:00:23 L7 sdb[306]: Wi-Fi: NAS daemon not found, not killingP0000-00-00T00:00:23 L7 sdb[306]: Wi-Fi: Taking down phy.wl80211 interface wl0P0000-00-00T00:00:23 L7 sdb[306]: Wi-Fi: Bringing up phy.wl80211 interface wl0P0000-00-00T00:00:23 L6 sdb[306]: Wi-Fi: Starting autochannel scan...P0000-00-00T00:00:24 L7 sdb[306]: Wi-Fi: SIOCDEVPRIVATE ioctl cmd=215 failed: Bad ArgumentP0000-00-00T00:00:26 L6 sdb[306]: Wi-Fi: Autochannel found channel 11019P0000-00-00T00:00:26 L7 sdb[306]: Wi-Fi: Taking down phy.wl80211 interface wl0P0000-00-00T00:00:26 L7 sdb[306]: Wi-Fi: Bringing up phy.wl80211 interface wl0P0000-00-00T00:00:26 L7 sdb[306]: Wi-Fi: Setting kernel ip link wl0 to upP0000-00-00T00:00:26 L7 sdb[306]: Wi-Fi: Setting kernel ip link wl0.1 to downP0000-00-00T00:00:26 L7 sdb[306]: Wi-Fi: Setting kernel ip link wl0.2 to downP0000-00-00T00:00:26 L7 sdb[306]: Wi-Fi: Setting kernel ip link wl0.3 to downP0000-00-00T00:00:26 L6 sdb[306]: Wi-Fi: EAPD daemon started (pid: 1030)P0000-00-00T00:00:26 L6 sdb[306]: Wi-Fi: NAS daemon started, bringing up phy.wl80211.ssid[1]P0000-00-00T00:00:26 L7 sdb[306]: Port ssid-1 sending UP eventP0000-00-00T00:00:26 L6 sdb[306]: DSL: Vectoring function is not supported.P0000-00-00T00:00:26 L6 sdb[306]: DSL: Warning: PTM only.P0000-00-00T00:00:27 L6 sdb[306]: DSL: set the NLNM Threshold value...
Administrator’s Handbook66Link: Manual UpdateWhen you click Manual Update, the Manual Update page appears.Operating System Software is what makes your Gateway run and occasionally it needs to be updated. Your Cur-rent version is displayed at the top of the page.To update your software from a file on your PC, you must first download the software from your Service Provider's Support Site to your PC's hard drive.◆Browse your computer for the operating system file you downloaded.◆Click the Update button.◆The installation may take a few minutes; wait for it to complete. You will be prompted to restart the Gateway.◆Restart your Gateway. A counter will countdown 3 times before returning you to home. Your new operating system will then be running.
67Link: ResetsIn some cases, you may need to clear all the configuration settings and start over again to program the Motorola® Gateway. You can perform a factory reset to do this.It might also be useful to reset your connection to the Internet without deleting all of your configuration settings.◆Click the Reset Device button to reset the Gateway back to its original factory default settings. You will be prompted to make sure you want to do this.◆Click the Reset Connection button to disconnect and reconnect all of your connections, including your VoIP phones.☛  NOTE:Exercise caution before performing a Factory Reset. This will erase any configuration changes that you may have made and allow you to reprogram your Gateway.
Administrator’s Handbook68
69CHAPTER 3 Basic TroubleshootingThis section gives some simple suggestions for troubleshooting problems with your Gateway’s initial configura-tion.Before troubleshooting, make sure you have◆read the User Manual;◆plugged in all the necessary cables; and◆set your PC’s TCP/IP controls to obtain an IP address automatically.
Administrator’s Handbook70Status Indicator LightsThe first step in troubleshooting is to check the status indicator lights (LEDs) in the order outlined below.Motorola® Gateway NVG510 status indicator lightsLED ActionPowerSolid Green = The device is powered.Flashing Green = A Power-On Self-Test (POST) is in progressFlashing Red = A POST failure (not bootable) or device malfunction occurred.* When the device encounters a POST failure, all indicator lights on the front of the device continuously flash.Off = The unit has no AC power.EthernetSolid Green = Powered device connected to the associated port (includes devices with wake-on-LAN capability where a slight voltage is supplied to the Ethernet connection).Flickering Green = Activity seen from devices associated with the port. The flickering of the light is synchronized to actual data traffic.Off = The device is not powered, no cable or no powered devices connected to the associ-ated ports.WirelessSolid Green = WIFI is powered.Flickering Green = Activity seen from devices connected via WIFI. The flickering of the light is synchronized to actual data traffic.Off = The device is not powered or no powered devices connected to the associated ports.Wi-Fi SetupFlickering Green = Indicates when WPS is broadcasting.Off = not in use, not broadcasting.BroadbandSolid Green = Good broadband connection (i.e., good DSL Sync).Flashing Green = Attempting broadband connection (i.e., DSL attempting sync).Flashing Green & Red = If the broadband connection fails to be established for more than three consecutive minutes the LED switches to Flashing Green when attempting or waiting to establish a broadband connection alternating with a five second steady Red. This pattern continues until the broadband connection is successfully established.Flashing Red = No DSL signal on the line. This is only used when there is no signal, not dur-ing times of temporary ‘no tone’ during the training sequence.Off = The device is not powered.PowerEthernetSide ViewWirelessBroadbandServicePhone 1Phone 2Wi-Fi Setup
71Motorola® Gateway NVG510 Rear ViewServiceSolid Green = IP connected (The device has a WAN IP address from DHCP or 802.1x authentication and the broadband connection is up).                                                                                                Flashing Green = Attempting PPP connection.  Attempting IEEE 802.1X authentication or attempting to obtain DHCP information.Red = Device attempted to become IP connected and failed (no DHCP response, no PPPoE response, 802.1x authentication failed, no IP address from IPCP, etc.). The Red state times out after two minutes and the Service indicator light returns to the Off state. Off = The device is not powered or the broadband connection is not present.Phone 1, 2Solid Green = The associated VoIP line has been registered with a SIP proxy server.Flashing Green = Indicates a telephone is off-hook on the associated VoIP line.Off = VoIP not in use, line not registered or Gateway power off.LED ActionFactory Reset SwitchDC Power PortWPS PushbuttonEthernet PortsPhone Port(use splitter for2 phones)DSL Port
Administrator’s Handbook72LED Function Summary MatrixPowerSolid Green = The device is powered.Flashing Green = A Power-On Self-Test (POST) is in progressFlashing Red = A POST fail-ure (not boota-ble) or device malfunction occurred.* When the device encoun-ters a POST failure, all indi-cator lights on the front of the device continu-ously flash.Off = The unit has no AC power.EthernetSolid Green = Powered device con-nected to the associated port (includes devices with wake-on-LAN capability where a slight voltage is sup-plied to the Ethernet con-nection).Flashing Green = Activ-ity seen from devices associ-ated with the port. The flick-ering of the light is synchro-nized to actual data traffic.Off = The device is not powered, no cable or no powered devices con-nected to the associated ports.WirelessSolid Green = WIFI is pow-ered.Flashing Green = Activ-ity seen from devices con-nected via WIFI. The flick-ering of the light is synchro-nized to actual data traffic.Off = The device is not powered or no powered devices con-nected to the associated ports.Phone 1, 2Solid Green = The associated VoIP line has been regis-tered with a SIP proxy server.Flashing Green = Indi-cates a tele-phone is off-hook on the associated VoIP line.Off = VoIP not in use, line not registered or Gateway power off.WPSFlashing Green = Indi-cates when WPS is broad-casting.Off = not in use, not broad-casting.
73BroadbandSolid Green = Good broad-band connec-tion (i.e., good DSL Sync).Flashing Green = Attempting broadband con-nection (i.e., DSL attempt-ing sync).Flashing Green & Red = If the broad-band connec-tion fails to be established for more than three consecutive minutes the LED switches to Flashing Green when attempting or waiting to establish a broadband con-nection alter-nating with a five second steady Red. This pattern continues until the broadband connection is successfully established.Flashing Red = No DSL sig-nal on the line. This is only used when there is no sig-nal, not during times of tempo-rary ‘no tone’ during the train-ing sequence.Off = The device is not powered.ServiceSolid Green = IP connected (The device has a WAN IP address from DHCP or 802.1x authen-tication and the broadband con-nection is up).Flashing Green = Attempting PPP connection.  Attempting IEEE 802.1X authentication or attempting to obtain DHCP information.Red = Device attempted to become IP con-nected and failed (no DHCP response, no PPPoE response, 802.1x authen-tication failed, no IP address from IPCP, etc.). The Red state times out after two min-utes and the Service indica-tor light returns to the Off state.Off = The device is not powered or the broadband con-nection is not present.
Administrator’s Handbook74If a status indicator light does not look correct, look for these possible problems: If LED is not Lit Possible problemsPower◆Make sure the power adapter is plugged into the DSL Modem properly.◆Try a known good wall outlet.◆If a power strip is used, make sure it is switched on.Broadband◆Make sure that any telephone has a microfilter installed.◆Make sure that you are using the correct cable. The DSL cable is the thinner stan-dard telephone cable and labeled “Data Cable.”◆Make sure the DSL cable is plugged into the correct wall jack.◆Make sure the DSL cable is plugged into the DSL port on the DSL Modem.◆Make sure the DSL line has been activated at the central office DSLAM.◆Make sure the DSL Modem is not plugged into a micro filter.Ethernet◆Make sure the you are using the yellow Ethernet cable, not the DSL cable. The Ethernet cable is thicker than the standard telephone cable.◆Make sure the Ethernet cable is securely plugged into the Ethernet jack on the PC.◆Make sure the Ethernet cable is securely plugged into the Ethernet port on the DSL Modem.◆Make sure you have Ethernet drivers installed on the PC.◆Make sure the PC’s TCP/IP Properties for the Ethernet Network Control Panel is set to obtain an IP address via DHCP.◆Make sure the PC has obtained an address in the 192.168.1.x range. (You may have changed the subnet addressing.)◆Make sure the PC is configured to access the Internet over a LAN.◆Disable any installed network devices (Ethernet, HomePNA, wireless) that are not being used to connect to the DSL Modem.
75Factory Reset SwitchLose your Access Code? This section shows how to reset the Motorola® Gateway so that you can access the configuration screens once again.☛  NOTE: Keep in mind that all of your settings will need to be reconfigured.If you don't have an Access Code, the only way to access the Motorola® Gateway is the following: 1. Referring to the diagram below, find the round Reset Switch opening. 2. Carefully insert the point of a pen or an unwound paperclip into the opening.◆If you press the factory reset button for less than ten (10) seconds, the device will be rebooted.The indicator lights on the device will respond immediately and start blinking red within one (1) second of the reset button being pressed. This will occur independent of the fact that the button is still being pressed or has been released. The indicator lights will flash for a minimum of five seconds, even if the reset button is released prior to five seconds after it has been depressed. If the reset button is held for more than 5 seconds, then it will continue to flash until released or until 10 seconds (see below).◆If you press the factory reset button for a longer period of time, the device will be reset to the factory default shipped settings.If the button is held for ten seconds, the Power indicator continues to flash, for an additional 5 seconds and then the indicator lights will return to their normal operating mode, independent of whether or not the reset but-ton is still depressed.Factory Reset Switch: Push to clear all settings
Administrator’s Handbook76
77CHAPTER 4 Command Line InterfaceThe Motorola Gateway operating software includes a command line interface (CLI) that lets you access your Motorola Gateway over a telnet connection. You can use the command line interface to enter and update the unit’s configuration settings, monitor its performance, and restart it.This chapter covers the following topics:◆“Overview” on page 79◆“Starting and Ending a CLI Session” on page 81◆“Using the CLI Help Facility” on page 81◆“About SHELL Commands” on page 82◆“SHELL Commands” on page 83◆“About CONFIG Commands” on page 92◆“CONFIG Commands” on page 95◆“Debug Commands” on page 132CONFIG Commands“Connection commands” on page 95“Filterset commands” on page 96“Queue commands” on page 100“IP Gateway commands” on page 101“IPv6 Commands” on page 101“IP DNS commands” on page 106“IP IGMP commands” on page 107“NTP commands” on page 109“Application Layer Gateway (ALG) commands” on page 110“Dynamic DNS Commands” on page 110“Link commands” on page 111“Management commands” on page 113“Remote access commands” on page 115“Physical interfaces commands” on page 117“PPPoE relay commands” on page 120“NAT Pinhole commands” on page 121“Security Stateful Packet Inspection (SPI) commands” on page 121
Administrator’s Handbook78“VoIP commands” on page 122“System commands” on page 130CONFIG Commands
79OverviewThe CLI has two major command modes: SHELL and CONFIG. Summary tables that list the commands are pro-vided below. Details of the entire command set follow in this section.SHELL CommandsCommand Status and/or Descriptionarp to send ARP requestatmping to send ATM OAM loopbackclear to erase all stored configuration informationclear_certificate to remove an SSL certificate that has been installedclear_log to erase all stored log info in flash memoryconfigure to configure unit's optionsdiagnose to run self-testdownload to download config fileexit to quit this shellhelp to get more: “help all” or “help help”install to download and program an image into flashlog to add a message to the diagnostic logloglevel to report or change diagnostic log levelnetstat to show IP informationnslookup to send DNS query for hostping to send ICMP Echo requestquit to quit this shellreset to reset subsystemsrestart to restart unitshow to show system informationstart to start subsystemstatus to show basic status of unittelnet to telnet to a remote hosttraceroute to send traceroute probesupload to upload config fileview to show configuration informationwho to show who is using the shell
Administrator’s Handbook80CONFIG CommandsCommand Verbs Status and/or Descriptiondelete Delete configuration list datahelp Help command optionsave Save configuration data script Print configuration dataset Set configuration datavalidate Validate configuration settingsview View configuration dataKeywordsconn Connection optionsip TCP/IP protocol optionsdns Domain Name System optionsigmp IGMP configuration optionsntp Network Time Protocol optionsgateway Gateway optionslink WAN link optionsmgmt System management optionsphy Physical interface optionsdsl DSL configuration optionsenet Ethernet optionspinhole Pinhole optionssystem Gateway’s system optionslog System activity logging optionsCommand Utilitiestop  Go to top level of configuration modequit Exit from configuration mode; return to shell modeexit Exit from configuration mode; return to shell mode
81Starting and Ending a CLI SessionOpen a telnet connection from a workstation on your network.You initiate a telnet connection by issuing the following command from an IP host that supports telnet, for exam-ple, a personal computer running a telnet application such as NCSA Telnet.telnet <ip_address>You must know the IP address of the Motorola Gateway before you can make a telnet connection to it. By default, your Motorola Gateway uses 192.168.1.254 as the IP address for its LAN interface. You can use a Web browser to configure the Motorola Gateway IP address.Logging InThe command line interface log-in process emulates the log-in process for a UNIX host. To logon, enter the user-name and your password.Entering the administrator password lets you display and update all Motorola Gateway settings. When you have logged in successfully, the command line interface lists the username and the security level asso-ciated with the password you entered in the diagnostic log.Ending a CLI SessionYou end a command line interface session by typing quit from the SHELL node of the command line interface hierarchy.Using the CLI Help FacilityThe help command lets you display on-line help for SHELL and CONFIG commands. To display a list of the com-mands available to you from your current location within the command line interface hierarchy, enter help or type a question mark (?).To obtain help for a specific CLI command, type help <command>. You can truncate the help command to h or a question mark when you request help for a CLI command.
Administrator’s Handbook82About SHELL CommandsYou begin in SHELL mode when you start a CLI session. SHELL mode lets you perform the following tasks with your Motorola Gateway: ◆Monitor its performance ◆Display and reset Gateway statistics◆Issue administrative commands to restart Motorola Gateway functions SHELL PromptWhen you are in SHELL mode, the CLI prompt is the name of the Motorola Gateway followed by a right angle bracket (>). For example, if you open a CLI connection to the Motorola Gateway named “Motorola-3000/9437188,” you would see Motorola-3000/9437188> as your CLI prompt.SHELL Command ShortcutsYou can truncate most commands in the CLI to their shortest unique string. For example, you can use the trun-cated command q in place of the full quit command to exit the CLI. However, you would need to enter rese for the reset command, since the first characters of reset are common to the restart command.The only commands you cannot truncate are restart and clear. To prevent accidental interruption of communi-cations, you must enter the restart and clear commands in their entirety.You can use the Up and Down arrow keys to scroll backward and forward through recent commands you have entered. Alternatively, you can use the !! command to repeat the last command you entered.
83SHELL CommandsCommon Commandsarp nnn.nnn.nnn.nnnSends an Address Resolution Protocol (ARP) request to match the nnn.nnn.nnn.nnn IP address to an Ethernet hardware address.clear [ yes ]Clears the configuration settings in a Motorola Gateway. You are prompted to confirm the clear command by entering yes.clear_certificateRemoves an SSL certificate that has been installed.configurePuts the command line interface into Configure mode, which lets you configure your Motorola Gateway with Con-fig commands. Config commands are described starting on page 95. download [ server_address ] [ filename ] [ confirm ]This command installs a file of configuration parameters into the Motorola Gateway from a TFTP (Trivial File Transfer Protocol) server. The TFTP server must be accessible on your Ethernet network.You can include one or more of the following arguments with the download command. If you omit arguments, the console prompts you for this information.◆The server_address argument identifies the IP address of the TFTP server from which you want to copy the Motorola Gateway configuration file. ◆The filename argument identifies the path and name of the configuration file on the TFTP server. ◆If you include the optional confirm keyword, the download begins as soon as all information is entered.You can also download an SSL certificate file from a trusted Certification Authority (CA), on platforms that support SSL, as follows:download [-cert] [server_address ] [filename] [confirm]install [ server_address ] [ filename ] [ confirm ]Downloads a new version of the Motorola Gateway operating software from a TFTP (Trivial File Transfer Protocol) server, validates the software image, and programs the image into the Motorola Gateway memory. After you install new operating software, you must restart the Motorola Gateway.The server_address argument identifies the IP address of the TFTP server on which your Motorola Gateway operating software is stored. The filename argument identifies the path and name of the operating software file on the TFTP server.If you include the optional keyword confirm, you will not be prompted to confirm whether or not you want to per-form the operation.
Administrator’s Handbook84log message_stringAdds the message in the message_string argument to the Motorola Gateway diagnostic log.loglevel [ level ] Displays or modifies the types of log messages you want the Motorola Gateway to record. If you enter the loglevel command without the optional level argument, the command line interface displays the current log level setting. You can enter the loglevel command with the level argument to specify the types of diagnostic messages you want to record. All messages with a level number equal to or greater than the level you specify are recorded. For example, if you specify loglevel 3, the diagnostic log will retain high-level informational messages (level 3), warnings (level 4), and failure messages (level 5).Use the following values for the level argument:◆1 or low – Low-level informational messages or greater; includes trivial status messages.◆2 or medium – Medium-level informational messages or greater; includes status messages that can help monitor network traffic.◆3 or high – High-level informational messages or greater; includes status messages that may be significant but do not constitute errors.◆4 or warning – Warnings or greater; includes recoverable error conditions and useful operator informa-tion.◆5 or failure – Failures; includes messages describing error conditions that may not be recoverable. netstat -i Displays the IP interfaces for your Motorola Gateway.netstat -r Displays the IP routes stored in your Motorola Gateway.nslookup [ hostname | ip_address ]Performs a domain name system lookup for a specified host.◆The hostname argument is the name of the host for which you want DNS information; for example, nslookup klaatu.◆The ip_address argument is the IP address, in dotted decimal notation, of the device for which you want DNS information.ping [-s size] [-c count ] [ hostname | ip_address ]Causes the Motorola Gateway to issue a series of ICMP Echo requests for the device with the specified name or IP address. ◆The hostname argument is the name of the device you want to ping; for example, ping ftp.motorola.com.◆The ip_address argument is the IP address, in dotted decimal notation, of the device you want to locate. If a host using the specified name or IP address is active, it returns one or more ICMP Echo replies, confirming that it is accessible from your network.◆The -s size argument lets you specify the size of the ICMP packet.◆The -c count argument lets you specify the number of ICMP packets generated for the ping request. Values greater than 250 are truncated to 250.
85You can use the ping command to determine whether a hostname or IP address is already in use on your net-work. You cannot use the ping command to ping the Motorola Gateway’s own IP address.quit Exits the Motorola Gateway command line interface.reset arp Clears the Address Resolution Protocol (ARP) cache on your unit.reset crash Clears crash-dump information, which identifies the contents of the Motorola Gateway registers at the point of sys-tem malfunction.reset dhcp serverClears the DHCP lease table in the Motorola Gateway.reset enet [ all ]Resets Ethernet statistics to zero. Resets individual LAN switch port statistics as well as wireless and WAN Ether-net statistics (where applicable).reset firewall-logRewinds the firewall log to the first entry.reset ipmapClears the IPMap table (NAT).reset logRewinds the diagnostic log display to the top of the existing Motorola Gateway diagnostic log. The reset log command does not clear the diagnostic log. The next show log command will display information from the beginning of the log file.reset wanThis function resets WAN interface statistics.reset wepkeysThis function allows you to force your wireless WEP key settings back to the default values, if there are default val-ues. For example, on some models, the WEP keys are based on the serial number. This allows you to get back those default settings if you have changed them without the need to reset the entire configuration of the unit.restart [ seconds ]Restarts your Motorola Gateway. If you include the optional seconds argument, your Motorola Gateway will restart when the specified number of seconds have elapsed. You must enter the complete restart command to initiate a restart.
Administrator’s Handbook86show all-infoDisplays all settings currently configured in the Motorola Gateway.show bridge interfacesDisplays bridge interfaces maintained by the Motorola Gateway.show bridge tableDisplays the bridging table maintained by the Motorola Gateway.show configDumps the Motorola Gateway’s configuration script just as the script command does in config mode.show crashDisplays the most recent crash information, if any, for your Motorola Gateway.show daylight-savingsDisplays the auto-daylight savings time settings information.show dhcp agentDisplays DHCP relay-agent leases.show dhcp server leasesDisplays the DHCP leases stored in RAM by your Motorola Gateway.show diffservDisplays the Differentiated Services and QoS values configured in the Motorola Gateway.show dslf device-associationDisplays LAN devices that conform with the TR111 Gateway requirement. It displays - IP Address, Manufacture OUI and Serial number.show enet [ all ]Displays Ethernet interface statistics maintained by the Motorola Gateway. Supports display of individual LAN switch port statistics as well as WAN Ethernet statistics (where applicable).Example:Ethernet driver full statistics - 10/100 EthernetPort Status:  Link upType: 100BASET  Duplex: FullGeneral: Transmit OK           : 434 Receive OK            : 267
87 Tx Errors             : 0 Rx Errors             : 0Receiver: Incompl Packet Errors : 0 No RBD's For Packet   : 0 Carrier Sense Lost    : 0 Deferred Replen       : 0Transmitter: TX Retries            : 0 Single Collisions     : 0 No Buf For Packet     : 0Upper Layers: Rx No Handler         : 0 Rx No Message         : 0 Rx Octets             : 30773 Rx Unicast Pkts       : 267 Rx Multicast Pkts     : 0 Tx Discards           : 0 Tx Octets             : 31692 10/100 Ethernet phy.enet.portPort Status:  Link upDuplex:  Full-duplex active Speed:  100BASE-T Transmit OK           : 434 Transmit unicastpkts  : NA Receive  OK           : 267 Receive unicastpkts   : 267show group-mgmtDisplays the IGMP Snooping Table. See “IP IGMP commands” on page 107 for detailed explanation.show ip arpDisplays the Ethernet address resolution table stored in your Motorola Gateway.show ip igmpDisplays the contents of the IGMP Group Address table and the IGMP Report table maintained by your Motorola Gateway.show ip interfacesDisplays the IP interfaces for your Motorola Gateway.show ip firewallDisplays firewall statistics.
Administrator’s Handbook88show ip lan-discoveryDisplays the LAN Host Discovery Table of hosts on the wired or wireless LAN, and whether or not they are cur-rently online.show ip routesDisplays the IP routes stored in your Motorola Gateway.show ipmapDisplays IPMap table (NAT).6rd-check 6rd_ip_v6_conn_nameSends out 6rd loopback packets to the 6rd BG. Verifies 6rd connectivity to the 6rd BGshow ipv6 interfacesDisplay IPv6 interfaces.show ipv6 routesDisplay IPv6 route table.show ipv6 neighborsDisplay IPv6 neighbor table.show ipv6 dhcp server leasesDisplay DHCPv6 server lease table.show ipv6 statisticsDisplay IPv6 statistics information.show logDisplays blocks of information from the Motorola Gateway diagnostic log. To see the entire log, you can repeat the show log command or you can enter show log all.show memory [ all ]Displays memory usage information for your Motorola Gateway. If you include the optional all argument, your Motorola Gateway will display a more detailed set of memory statistics.show pppoeDisplays status information for each PPPoE socket, such as the socket state, service names, and host ID values.show rootcert [ all | supplicant | openssl ]Dumps the Subject line for the list of all the trusted root certificates for the supplicant, which is currently a superset of the OpenSSL trusted root certificates.
89This syntax is for the 802.1x-supplicant-supported builds only. The openssl trust list is used in all TLS/SSL situa-tions except the 802.1X supplicant.The default, if you don't append a qualifier, is all. all will show both 802.1x supplicant and openssl trust list root certs; supplicant will show the supplicant trust list root certs; openssl will show openssl trust list root certsshow rtspDisplays RTSP ALG session activity data.show statusDisplays the current status of a Motorola Gateway, the device's hardware and software revision levels, a summary of errors encountered, and the length of time the Motorola Gateway has been running since it was last restarted. Identical to the status command.show summaryDisplays a summary of WAN, LAN, and Gateway information.show vlanDisplays detail of VLAN status and statistics.show wireless [ all ]Shows wireless status and statistics.show wireless clients [ MAC_address ]Displays details on connected clients, or more details on a particular client if the MAC address is added as an argument.telnet [ hostname | ip_address ] [ port ]Lets you open a telnet connection to the specified host through your Motorola Gateway.◆The hostname argument is the name of the device to which you want to connect; for example, telnet ftp.Motorola.com.◆The ip_address argument is the IP address, in dotted decimal notation, of the device to which you want to connect.◆The port argument is the number of t he port over which you want to open a telnet session.traceroute ( ip_address | hostname )Traces the routing path to an IP destination.upload [ server_address ] [ filename ] [ confirm ]Copies the current configuration settings of the Gateway to a TFTP (Trivial File Transfer Protocol) server. The TFTP server must be accessible on your Ethernet network. The server_address argument identifies the IP address of the TFTP server on which you want to store the Motorola Gateway settings. The filename argu-ment identifies the path and name of the configuration file on the TFTP server. If you include the optional con-firm keyword, you will not be prompted to confirm whether or not you want to perform the operation.
Administrator’s Handbook90view configDumps the Motorola Gateway’s configuration just as the view command does in config mode.who Displays the names of the current shell and PPP users. WAN Commandsatmping vccn [ segment | end-to-end ]Lets you check the ATM connection reachability and network connectivity. This command sends five Operations, Administration, and Maintenance (OAM) loopback calls to the specified vpi/vci destination. There is a five second total timeout interval.Use the segment argument to ping a neighbor switch.Use the end-to-end argument to ping a remote end node.reset dhcp client release [ vcc-id ]Releases the DHCP lease the Motorola Gateway is currently using to acquire the IP settings for the specified DSL port. The vcc-id identifier is an “index” letter in the range B-I, and does not directly map to the VCC in use. Enter the reset dhcp client release command without the variable to see the letter assigned to each virtual circuit.reset dhcp client renew [ vcc-id ]Renews the DHCP lease the Motorola Gateway is currently using to acquire the IP settings for the specified DSL port. The vcc-id identifier is an “index” letter in the range B-I, and does not directly map to the VCC in use. Enter the reset dhcp client release without the variable to see the letter assigned to each virtual circuit.reset dslResets any open DSL connection.reset ppp vccnResets the point-to-point connection over the specified virtual circuit. This command only applies to virtual circuits that use PPP framing.show atm [all]Displays ATM statistics for the Motorola Gateway. The optional all argument displays a more detailed set of ATM statistics.show dsl [ all ]Displays DSL port statistics, such as upstream and downstream connection rates and noise levels.
91show ppp [{ stats | lcp | ipcp }]Displays information about open PPP links. You can display a subset of the PPP statistics by including an optional stats, lcp, or ipcp argument for the show ppp command.start ppp vccnOpens a PPP link on the specified virtual circuit.
Administrator’s Handbook92About CONFIG CommandsYou reach the configuration mode of the command line interface by typing configure (or any truncation of con-figure, such as con or config) at the CLI SHELL prompt.CONFIG Mode PromptWhen you are in CONFIG mode, the CLI prompt consists of the name of the Motorola Gateway followed by your current node in the hierarchy and two right angle brackets (>>). For example, when you enter CONFIG mode (by typing config at the SHELL prompt), the Motorola-3000/9437188 (top)>> prompt reminds you that you are at the top of the CONFIG hierarchy. If you move to the ip node in the CONFIG hierarchy (by typing ip at the CONFIG prompt), the prompt changes to Motorola-3000/9437188 (ip)>> to identify your current location.Some CLI commands are not available until certain conditions are met. For example, you must enable IP for an interface before you can enter IP settings for that interface.Navigating the CONFIG Hierarchy◆Moving from CONFIG to SHELL — You can navigate from anywhere in the CONFIG hierarchy back to the SHELL level by entering quit at the CONFIG prompt and pressing Return. Motorola-3000/9437188 (top)>> quitMotorola-3000/9437188 >◆Moving from top to a subnode — You can navigate from the top node to a subnode by entering the node name (or the significant letters of the node name) at the CONFIG prompt and pressing RETURN. For example, you move to the IP subnode by entering ip and pressing RETURN.Motorola-3000/9437188 (top)>> ipMotorola-3000/9437188 (ip)>>As a shortcut, you can enter the significant letters of the node name in place of the full node name at the CONFIG prompt. The significant characters of a node name are the letters that uniquely identify the node. For example, since no other CONFIG node starts with b, you could enter one letter (“b”) to move to the bridge node.◆Jumping down several nodes at once — You can jump down several levels in the CONFIG hierarchy by entering the complete path to a node. ◆Moving up one node — You can move up through the CONFIG hierarchy one node at a time by entering the up command. ◆Jumping to the top node — You can jump to the top level from anywhere in the CONFIG hierarchy by enter-ing the top command. ◆Moving from one subnode to another — You can move from one subnode to another by entering a partial path that identifies how far back to climb.◆Moving from any subnode to any other subnode — You can move from any subnode to any other subnode by entering a partial path that starts with a top-level CONFIG command.◆Scrolling backward and forward through recent commands — You can use the Up and Down arrow keys to scroll backward and forward through recent commands you have entered. When the command you want appears, press Enter to execute it.Entering Commands in CONFIG ModeCONFIG commands consist of keywords and arguments. Keywords in a CONFIG command specify the action you want to take or the entity on which you want to act. Arguments in a CONFIG command specify the values appropriate to your site. For example, the CONFIG command
93set ip ethernet A ip_address consists of two keywords (ip, and ethernet A) and one argument (ip_address). When you use the com-mand to configure your Gateway, you would replace the argument with a value appropriate to your site.For example:set ip ethernet A 192.31.222.57Guidelines: CONFIG CommandsThe following table provides guidelines for entering and formatting CONFIG commands.If a command is ambiguous or miskeyed, the CLI prompts you to enter additional information. For example, you must specify which virtual circuit you are configuring when you are setting up a Motorola Gateway.Displaying Current Gateway SettingsYou can use the view command to display the current CONFIG settings for your Motorola Gateway. If you enter the view command at the top level of the CONFIG hierarchy, the CLI displays the settings for all enabled func-tions. If you enter the view command at an intermediate node, you see settings for that node and its subnodes.Step Mode: A CLI Configuration TechniqueThe Motorola Gateway command line interface includes a step mode to automate the process of entering configu-ration settings. When you use the CONFIG step mode, the command line interface prompts you for all required and optional information. You can then enter the configuration values appropriate for your site without having to enter complete CLI commands.When you are in step mode, the command line interface prompts you to enter required and optional settings. If a setting has a default value or a current setting, the command line interface displays the default value for the com-mand in parentheses. If a command has a limited number of acceptable values, those values are presented in brackets, with each value separated by a vertical line. For example, the following CLI step command indicates that the default value is off and that valid entries are limited to on and off.Command component Rules for entering CONFIG commandsCommand verbs CONFIG commands must start with a command verb (set, view, delete).You can truncate CONFIG verbs to three characters (set, vie, del).CONFIG verbs are case-insensitive. You can enter “SET,” “Set,” or “set.”Keywords Keywords are case-insensitive. You can enter “Ethernet,” “ETHERNET,” or “ethernet” as a keyword without changing its meaning.Keywords can be abbreviated to the length that they are differentiated from other key-words. Argument Text Text strings can be as many as 64 characters long, unless otherwise specified. In some cases they may be as long as 255 bytes.Special characters are represented using backslash notation.Text strings may be enclosed in double (“) or single (‘) quote marks. If the text string includes an embedded space, it must be enclosed in quotes.Special characters are represented using backslash notation.Numbers Enter numbers as integers, or in hexadecimal, where so noted.IP addresses Enter IP addresses in dotted decimal notation (0 to 255).
Administrator’s Handbook94option (off) [on | off]: onYou can accept the default value for a field by pressing the Return key. To use a different value, enter it and press Return.You can enter the CONFIG step mode by entering set from the top node of the CONFIG hierarchy. You can enter step mode for a particular service by entering set service_name. In stepping set mode (press Control-X <Return/Enter> to exit. For example:Motorola-3000/9437188 (top)>> set system...system   name (“Motorola-3000/9437188”): Mycroft   Diagnostic Level (High): mediumStepping mode ended.Validating Your ConfigurationYou can use the validate CONFIG command to make sure that your configuration settings have been entered correctly. If you use the validate command, the Motorola Gateway verifies that all required settings for all services are present and that settings are consistent.Motorola-3000/9437188 (top)>> validateError: Subnet mask is incorrectGlobal Validation did not pass inspection!You can use the validate command to verify your configuration settings at any time. Your Motorola Gateway automatically validates your configuration any time you save a modified configuration.
95CONFIG CommandsThis section describes the keywords and arguments for the various CONFIG commands.Connection commandsconns are used to create connections, for example, a WAN or LAN conn. There may be more than one of each depending on your model. names correspond to the system object IDs (OIDs) but you can name them yourself.set conn name name link-oid valueSets the connection named name to point to an associated link specified by the link-oid value.set conn name name type [ static | dhcpc ]Specifies whether the type of the connection named name is static or dhcpc.set conn name name side [ lan | wan ]Specifies whether this conn is LAN- or WAN-side. A conn can be either lan or wan.set conn name name dhcp-server-enable [ on | off ]Turns the DHCP server for this connection on or off. The DHCP server can be enabled per connection. The default is on.set conn name name mcast-forwarding [ off | on ]Turns IP IGMP multicast forwarding for this connection off or on. The default is off.set conn name name static ipaddr ipaddrSpecifies a static IP address when the connection type has been set to static. The default is 192.168.1.254set conn name name static netmask netmaskSpecifies a static netmask when the connection type has been set to static. The default is 255.255.255.0.set conn name name dhcp-server start-addr ipaddrIf dhcp-server-enable is set to on, specifies the first address in the DHCP address range. The Motorola Gateway can reserve a sequence of up to 253 IP addresses within a subnet, beginning with the specified address for dynamic assignment. The default is 192.168.1.64set conn name name dhcp-server end-addr ipaddrIf dhcp-server-enable is set to on, specifies the last address in the DHCP address range. The default is 192.168.1.253set conn name name dhcp-server lease-time secondsIf dhcp-server-enable is set to on, specifies the default length for DHCP leases issued by the Motorola Gateway. Lease time is in seconds. Default is 3600.
Administrator’s Handbook96set conn name name nat-enable [ on | off ]Specifies whether you want the Motorola Gateway to use network address translation (NAT) when communicating with remote Gateways. NAT lets you conceal details of your network from remote Gateways. It also permits all LAN devices to share a single IP address. By default, address NAT is turned on.set conn name name dhcp-client discover-time secondsThe DHCP client parameters appear when the connection type has been set to dhcpc. discover-time is in sec-onds; the default is 30.set conn name name dhcp-client dns-enable [ on | off ]This allows you to enable or disable the default behavior of acting as a DNS proxy. The default is on.set conn name name dhcp-client dns-override [ off | on ]This allows you to enable or disable overriding default DNS behavior. The default is off.set conn name name dhcp-client vendor-class stringThe vendor-class default information varies by model and components. This is information that identifies the unit.set conn name name fs-egress filterset_nameAttaches a user filterset to a conn which is applied to transmitted packets. See “Filterset commands” on page 96.set conn  name name fs-ingress filterset_nameAttaches a user filterset to a conn which is applied to received packets. See “Filterset commands” on page 96.Filterset commandsFiltersets provide packet filtering and QoS configuration. Packets are identified by characteristics that allow QoS and forwarding decisions to be made. These characteristics can be at the MAC layer, IP layer, TCP | UDP | ICMP layer(s), or (in applicable circumstances) 802.1q/p (VLAN-tagging) layer.A maximum of 8 filtersets are supported. Each filterset can have up to 8 rules configured.  A maximum 8 egress queues are supported. Each queue can have up to 8 entries.A filterset rule identifies packet attributes to match with its match parameters. It acts on these packets using its default action parameters.set filterset name filterset_name rule number order numberDetermines order of execution of filterset rules (1 before 2, etc).set filterset name filterset_name rule number match-eth-proto  number Matches ethernet protocol field to the supplied value.set filterset name filterset_name rule number match-eth-length  numberMatches ethernet length field to the supplied value.
97set filterset name filterset_name rule number match-eth-p-bits numberMatches VLAN priority bits.set filterset name filterset_name rule number match-eth-vid numberMatches VLAN id number.set filterset name filterset_name rule number                     match-eth-src-mac-addr mac_addressMatches supplied source MAC address field.set filterset name filterset_name rule number                     match-eth-dst-mac-addr mac_addressMatches supplied destination MAC address field.set filterset name  filterset_name rule number                     match-src-ip-addr  ip_address_rangeMatches supplied value with packet's source ip address field.set filterset name filterset_name rule number match-dst-ip-addr ip_address_rangeMatches supplied value with packet's destination ip address field.set filterset  name filterset_name rule number match-protocol protocol_stringMatches supplied value with packet's protocol field.set filterset name  filterset_name rule number                     match-tos [ number | descriptive_value ]Matches tos field from numeric value 0-255; or one of the following descriptive values:Minimize-Delay (0x10)Maximize-Throughput (0x08)Maximize-Reliability (0x04)Minimize-Cost (0x02)Normal-Service (0x00)set filterset name filterset_name rule number                     match-dscp [ number | diffserv_class_string ]Matches diffserv class with supplied numerical value, which can be in decimal(ex: 32) or in Hex(ex: 0x20);Or match the supplied diffserv class. This value may be any of the BE, EF, AFxx or CSx classes. A full list is:{ "CS0", 0x00 }{ "CS1", 0x08 }{ "CS2", 0x10 }{ "CS3", 0x18 }{ "CS4", 0x20 }{ "CS5", 0x28 }{ "CS6", 0x30 }
Administrator’s Handbook98{ "CS7", 0x38 }{ "BE", 0x00 }{ "AF11", 0x0a }{ "AF12", 0x0c }{ "AF13", 0x0e }{ "AF21", 0x12 }{ "AF22", 0x14 }{ "AF23", 0x16 }{ "AF31", 0x1a }{ "AF32", 0x1c }{ "AF33", 0x1e }{ "AF41", 0x22 }{ "AF42", 0x24 }{ "AF43", 0x26 }{ "EF", 0x2e }set filterset name filterset_name rule number match-src-port number [ number ]Matches TCP|UDP source port field or port range.set filterset name filterset_name rule number match-dst-port  number [ number ]Matches TCP|UDP destination port field or port range.set filterset name filterset_name rule number match-tcp-flags tcp_flag_stringMatches TCP flags in a packet. The flag string is comma-delimited.set filterset name filterset_name rule number match-pkt-length number [ number ]Matches packet length against value or range.set filterset name filterset_name rule number                     action forward [ pass | drop | reject ]Executes the named filterset’s default action: pass, drop, or reject.set filterset name filterset_name rule number                     action set-qos-marker qos_marker_stringTags the packet according to the queue marker name. See “Queue commands” on page 100.set filterset name filterset_name rule number action set-tos numberSets the packet tos field to the supplied value.set filterset name filterset_name rule number                     action set-dscp [ number | diffserv_class_string ]Sets the dscp field to the supplied value.set filterset name filterset_name rule number action set-eth-p-bits numberSets vlan priority bits to the supplied value.
99set filterset filterset_name rule number action do-filterset nameExecutes the supplied filterset.Default actionsIf a packet passes through all of a filter's rules without a match, then the filterset's default-actions come into play. These behave the same way that rule actions behave.set filterset name filterset_name default-action set-qos-marker qos_marker_stringTags the packet according to the queue marker name.set filterset name filterset_name default-action set-tos numberSets the packet tos field to the supplied value.set filterset name filterset_name default-action set-dscp [ number |      diffserv_class_string ]Sets the dscp field to the supplied value.set filterset name filterset_name default-action set-eth-p-bits numberSets vlan priority bits to the supplied value.set filterset name filterset_name default-action do-filterset nameExecutes the supplied filterset.set filterset name filterset_name default-action forward  [ pass | drop | reject ]Executes the named filterset’s default action: pass, drop, or reject.
Administrator’s Handbook100Queue commandsQueue configuration typically requires a classification component to set a QoS marker to a packet and a queueing component to schedule the marked packets to the link. This is accomplished using filtersets (“Filterset com-mands” on page 96).the following types of queue “building blocks” are supported:◆basic queue◆ingress queue ◆priority queue◆wfq (weighted fair queue)Basic queues have three different packet dropping options ◆byte|packet fifo (bpfifo)◆random early discard (red)◆stochastic fairness queuing (sfq)set queue name queue_name type [ basic | ingress | priority | wfq ]Sets the type of queue.set queue name queue_name options [ off | red | sfq ]Sets the queue packet dropping options.set queue name queue_name size [ 1... 64 ]Sets the maximum packet size in the queue. set queue name queue_name bytes [ 2048... 131072 ]Sets the maximum byte size in the queue.set queue name queue_name perturb [ 0... 100 ]Sets the interval in seconds for queue algorithm perturbation when queue option is sfq.set queue name queue_name police-rate [ 0... 100000000 ]Sets the rate in milliseconds that is used for policing traffic when the queue type is ingress.set queue name queue_name police-burst [ 0... 100000000 ]Sets the burst rate in milliseconds that is used for policing traffic when the queue type is ingress.set queue name queue_name bw-sharing [ on | off ]Enables or disables bandwidth sharing, when the queue type is either priority or wfq.set queue name queue_name bps-mode [ bps | relative ]Sets the mode of the weighted fair queue. bps indicates that weights are defined as “bits-per-second”. relative indicates that weights are defined as a proportion of the sum of the weights of all inputs to the wfq.
101set queue name queue_name entry number input queue_nameSets the input to a priority or weighted fair queue.set queue name queue_name entry number marker queue_markerSets the marker with which packets must be marked to be directed to this queue entry's input queue when the type is priority or wfq.set queue name queue_name entry number priority [ 0... 255 ]Sets the priority level of this queue. A lower value indicates a higher priority. All entries of equal priority will be sub-ject to a round robin algorithm.◆for (strict) priority queue, the higher priority gets link resource first.◆for wfq queue, each entry gets reserved bandwidth according to its weight. If different priority is given, any excess bandwidth is offered to higher priority entry first; otherwise any excess bandwidth is distributed to the weights ratio.set queue name queue_name entry number weight [ 0... 100 ]Sets the weight level of this weighted fair queue. Weight units are dependent on bps-mode setting. ◆If bps-mode is set to bps, then setting the weight to 0 will allocate the remaining available bandwidth to the queue entry. ◆If no priority specified, excess bandwidth will be distributed proportionately to the weight ratio. set queue name queue_name default-entry queue_nameIndicates the input queue which is used if there is no match between the packet queue marker and the configured markers in any of the queue's inputs when the queue type is priority or wfq.IP Gateway commandsset ip gateway enable [ on | off ]Specifies the conn of the gateway. Normally, this would be the WAN connection. Specifies whether the Motor-ola Gateway should send packets to a default Gateway if it does not know how to reach the destination host.set ip gateway conn-oid valueSets the default Gateway to point to an associated link specified by the conn-oid value.set ip gateway address ip_addressSpecifies the IP address of a host on a local or remote network in standard dotted-quad format.IPv6 Commandsset ip6 enable [ on | off ]Enables/disables IPv6 globally.
Administrator’s Handbook102ip6 connset ip6 conn name name enable [ on | off ]Enables/disables the IPv6 connection named name.set ip6 conn name name type [ static | autoconf | rd | dp | aiccu ]Type of connection. See below for connection types.set ip6 conn name name mtu octetsSpecified MTU of connection.set ip6 conn name name side [ lan | wan ]Specified whether the connection is LAN side or WAN side.set ip6 conn name name mcast-fwding [ off | on ] Turns IPv6 multicast forwarding for this connection off or on. The default is off. (not yet implemented)set ip6 conn name name old-prefix-purge-timer The time in seconds for which old, invalid prefixes are advertised with a lifetime of zero. The intent is to “flush out” global prefixes on attached IPv6 hosts which suddenly become invalid.Static Connectionsip6 conn (type = static): Statically configured IPv6 connection.set ip6 conn name name static link-oid link_nameSets the connection named name to point to an associated link specified by the link-oid link_name.set ip6 conn name name static ipaddr ipv6_addressSpecifies a static IPv6 address.set ip6 conn name name static prefix-length valueSpecifies the prefix length of the connection's static IPv6 address. Default is 64.6rd Connectionsip6 conn (type = rd, side = wan). This WAN connection type is a 6rd tunnel over an IPv4 conn in accordance with RFC 5569.set ip6 conn name name 6rd-tunnel type [ cpe | gateway ]The 6rd connection can operate in “cpe” or “gateway” mode as configured by the type parameter. “cpe” mode is used when operating as a CPE; “gateway” mode is used when operating as a “6rd relay” as per RFC 5569.
103set ip6 conn name name 6rd-tunnel ipv4-conn-oid ipv4_nameSets the 6rd connection named name to tunnel over an associated IPv4 connection named ipv4_name.set ip6 conn name name 6rd-tunnel use-dhcp-values [ off | on ]If this parameter is on, 6rd-provisioned parameters are obtained via the underlying DHCPv4 client associated with IPv4 connection named ipv4-name. See “draft-ietf-softwire-ipv6-6rd-10” for DHCP format description.ip6 conn (type = rd, 6rd-tunnel use-dhcp-values = off). set ip6 conn name name 6rd-tunnel prefix IPv6_address6rd domain prefix.set ip6 conn name name 6rd-tunnel prefix-length value [ 1 - 63 ]6rd domain prefix length.set ip6 conn name name 6rd-tunnel ipv4-common-bits  value [ 0 - 31 ]The number of bits common to all IPv4 addresses within the 6rd domain. The top-most bits of the IPv4 address will be “subtracted” from the 6rd address. If the whole 32-bit IPv4 address is contained in the 6rd IPv6 address, this value is set to zero. Default is 0, meaning all 42 bits of the IPv4 address are embedded in the 6rd prefix.set ip6 conn name name 6rd-tunnel relay-ipv4-addr IPv4_addressThe IPv4 anycast address of the 6rd border gateway.set ip6 conn name name 6rd-tunnel ipv4-tx-tos-mode [ off | use-ipv6 ]off means the TOS field in the IPv4 header is set to zero for transmitted 6rd packets. use-ipv6 means the the TOS field in the IPv4 header is set to the DS field of the 6rd-encapsulated IPv6 packet.set ip6 conn name name 6rd-tunnel ipv4-tx-to-br [ off | on ]off means each packet set to a destination IPv6 address within the originating 6rd domain is sent directly to the 6rd endpoint. on means that all packets are transmitted to the 6rd border gateway.AICCU (SixXS tunnel broker) Connectionsip6 conn (type = aiccu, side = wan). This connection type enables an IPv6 connection to the IPv6 internet over an IPv4/NAT/UDP tunnel to a tunnel endpoint administered by tunnel broker SIXXS (www.sixxs.net).You set up an account with SIXXS, and subsequently get assigned a tunnel and a subnet (usually a /48 subnet).set ip6 conn name name aiccu username usernameSIXXS username.set ip6 conn name name aiccu password passwordSIXXS password.
Administrator’s Handbook104Delegated Prefix Connectionsip6 conn (type = dp, side = lan). A conn of type “delegated prefix” obtains its global prefix information from one or more prefix another IPv6 conn (typically a WAN conn) , if available. In order for a “dp” connection to become fully operational, its underlying link must be up AND the IPv6 connection which delegates the prefix must have created one or more prefixes from which to draw the “dp” connection's global prefix.set ip6 conn name name dp link-oid link_nameset ip6 conn name name dp conn-oid ipv6_conn_nameSets the dp connection named name to obtain its prefix from IPv6 connection named ipv6_conn_name.set ip6 conn name name dp subnet-length value [ 0 - 16 ]The length of the subnet portion of the delegated prefix. Default is 0.set ip6 conn name name dp subnet-id value [ 0 - 65535 ]If a subnet length is specified, the value that would occupy the of the subnet portion of the conn's IPv6 prefix. Default is 0.set ip6 conn name name dp stay-up [ off | on ]If the delegated prefix parameter stay-up is set to on, the global prefix assigned from the conn delegating the pre-fix remains active in the event that the conn delegating the prefix goes down, and the prefix becomes invalid. This enables local LAN-side hosts to continue to use the global prefix uninterrupted. If parameter stay-up is set to off, the connection's delegated prefix becomes invalid when the connection named ipv6-conn-name delegating the prefix goes down.Router Advertisement and DHCPv6 Serverip6 conn (side = lan). Router Advertisements and the DHCPv6 server are available on LAN-side conns as the means to provide clients with stateful or stateless IPv6 prefixes and addresses, as well as addition client parame-ters such as MTU size and IPv6-addressable DNS servers.set ip6 conn name name radv enable [ off | on ]on means radv is enabled for this conn.set ip6 conn name name radv min-rtr-adv-interval seconds [ 3 - 1350 ]The minimum time allowed between sending unsolicited multicast router advertisements from the link, in seconds.set ip6 conn name name radv max-rtr-adv-interval seconds [ 4 - 1800 ]The maximum time allowed between sending unsolicited multicast router advertisements from the interface, in seconds. set ip6 conn name name dhcp-server  enable [ off | on ]on means the DHCPv6 server is enabled for this conn.
105set ip6 conn name name dhcp-server  addr-count value [ 0 - 256 ]The number of IPv6 addresses available to serve to DHCPv6 stateful clients. If the addr-count parameter is set to zero, the DHCPv6 server operates in “stateless” mode.set ip6 conn name name dhcp-server  start-addr-offset value [ 0 - 65536 ]If the addr-count parameter is greater than zero, the start address is an offset from the base address of the prefix which is assigned to the LAN conn.set ip6 conn name name dhcp-server  lease-time seconds [ 180 - 8553600 ]DHCPv6 lease time.set ip6 conn name name dhcp-server  dns-server optional IPv6 addressIPv6 address of advertised DNS server (optiona).Static Routesip6 static-route. set ip6 static-route name conn-oid ipv6_conn_nameRoute is directed to IPv6 connection named ipv6_conn_name.set ip6 static-route name nexthop IPv6_addressNext-hop IPv6 address for forwarding. Can be a global or link-local address.set ip6 static-route name prefix IPv6_prefixIPv6 prefix.set ip6 static-route name prefix-length value [ 1 - 64 ]IPv6 prefix-length.set ip6 static-route name metric value [ 0 - 255 ]metric assigned to route.
Administrator’s Handbook106IP DNS commandsset ip dns domain-name domain_nameSpecifies the default domain name for your network. When an application needs to resolve a host name, it appends the default domain name to the host name and asks the DNS server if it has an address for the “fully qualified host name.” set ip dns primary-address ip_addressSpecifies the IP address of the primary DNS name server. set ip dns secondary-address ip_addressSpecifies the IP address of the secondary DNS name server. Enter 0.0.0.0 if your network does not have a sec-ondary DNS name server.set ip dns proxy-enable [ on | off ]This allows you to disable the default behavior of acting as a DNS proxy. The default is on.
107IP IGMP commandsMulticasting is a method for transmitting large amounts of information to many, but not all, computers over an internet. One common use is to distribute real time voice, video, and data services to the set of computers which have joined a distributed conference. Other uses include updating the address books of mobile computer users in the field, or sending out company newsletters to a distribution list.Since a router should not be used as a passive forwarding device, Motorola Gateways use a protocol for forward-ing multicasting: Internet Group Management Protocol (IGMP).Motorola Gateways support IGMP Version 1, Version 2, or Version 3.IGMP “Snooping” is a feature of Ethernet layer 2 switches that “listens in” on the IGMP conversation between computers and multicast routers. Through this process, it builds a database of where the multicast routers reside by noting IGMP general queries used in the querier selection process and by listening to other router protocols.From the host point of view, the snooping function listens at a port level for an IGMP report. The switch then pro-cesses the IGMP report and starts forwarding the relevant multicast stream onto the host's port. When the switch receives an IGMP leave message, it processes the leave message, and if appropriate stops the multicast stream to that particular port. Basically, customer IGMP messages although processed by the switch are also sent to the multicast routers.In order for IGMP snooping to function with IGMP Version 3, it must always track the full source filter state of each host on each group, as was previously done with Version 2 only when Fast Leave support was enabled.IGMP Version 3 supports:IGMP Source Filtering: the ability for group memberships to incorporate source address filtering. This allows “Source-Specific Multicast” (SSM). By adding source filtering, a Gateway that proxies IGMP can more selectively join the specific multicast group for which there are interested LAN multicast receivers.These features require no user configuration on the Gateway.You can set the following options:◆IGMP Snooping – enables the Motorola Gateway to “listen in” to IGMP traffic. The Gateway discovers multi-cast group membership for the purpose of restricting multicast transmissions to only those ports which have requested them. This helps to reduce overall network traffic from streaming media and other bandwidth-inten-sive IP multicast applications.◆Robustness – a way of indicating how sensitive to lost packets the network is. IGMP can recover from robust-ness minus 1 lost IGMP packet. The default value is 2.◆Query Interval– the amount of time in seconds between IGMP General Query messages sent by the querier gateway. The default query interval is 125 seconds. ◆Query Response Interval – the maximum amount of time in tenths of a second that the IGMP Gateway waits to receive a response to a General Query message. The default query response interval is 10 seconds and must be less than the query interval.◆Unsolicited Report Interval – the amount of time in seconds between repetitions of a particular computer’s initial report of membership in a group. The default unsolicited report interval is 10 seconds.◆Querier Version – select a version of the IGMP Querier: version 1, version 2, or version 3. If you know you will be communicating with other hosts that are limited to v1 or v2, for backward compatibility, select accordingly; otherwise, allow the default v3.☛  NOTE:IGMP Querier version is relevant only if the Gateway is configured for IGMP forwarding. If any IGMP v1 routers are present on the subnet, the querier must use IGMP v1. The use of IGMP v1 must be administratively configured, since there is no reliable way of dynamically determining whether IGMP v1 routers are present on a network. IGMP forwarding is enabled per IP Profile and WAN Connec-
Administrator’s Handbook108tion Profile.◆Last Member Query Interval – the amount of time in tenths of a second that the IGMP gateway waits to receive a response to a Group-Specific Query message. The last member query interval is also the amount of time in seconds between successive Group-Specific Query messages. The default last member query interval is 1 second (10 deci-seconds).◆Last Member Query Count – the number of Group-Specific Query messages sent before the gateway assumes that there are no members of the host group being queried on this interface. The default last member query count is 2.◆Fast Leave – set to off by default, fast leave enables a non-standard expedited leave mechanism. The querier keeps track of which client is requesting which channel by IP address. When a leave message is received, the querier can check its internal table to see if there are any more clients on this group. If there are none, it imme-diately sends an IGMP leave message to the upstream querier.◆Log Enable – If set to on, all IGMP messages on both the LAN and the WAN will be logged.◆Wireless Multicast to Unicast conversion – Only available if IGMP Snooping is enabled. If set to on, the Gateway replaces the multicast MAC-address with the physical MAC-address of the wireless client. If there is more than one wireless client interested in the same multicast group, the Gateway will revert to multicasting the stream immediately. When one or more wireless clients leave a group, and the Gateway determines that only a single wireless client is interested in the stream, it will once again unicast the stream.set ip igmp querier-version [ 1 | 2 | 3 ]Sets the IGMP querier version: version 1, version 2, or version 3. If you know you will be communicating with other hosts that are limited to v1, for backward compatibility, select 1; otherwise, allow the default 3.set ip igmp robustness valueSets IGMP robustness range: from 2 – 255. The default is 2.set ip igmp query-interval valueSets the query-interval range: from 10 seconds – 600 seconds, The default is 125 seconds.set ip igmp query-response-interval valueSets the query-response interval range: from 5 deci-seconds (tenths of a second) – 255 deci-seconds. The default is 100 deci-seconds.set ip igmp unsolicited-report-interval valueSets the unsolicited report interval: the amount of time in seconds between repetitions of a particular computer’s initial report of membership in a group. The default is 10 seconds.set ip igmp last-member-interval valueSets the last member query interval: the amount of time in tenths of a second that the IGMP gateway waits to receive a response to a Group-Specific Query message. The last member query interval is also the amount of time in seconds between successive Group-Specific Query messages. The default is 1 second (10 deci-seconds).set ip igmp last-member-count valueSets the last member query count: the number of Group-Specific Query messages sent before the gateway assumes that there are no members of the host group being queried on this interface. The default is 2.
109set ip igmp snoop-entry-time secondsThe snoop-entry-time is the amount of time an entry will remain in the snooping table (in seconds) after being added. An entry is added when a “JOIN” is seen from a multicast client. Any new joins (triggered by upstream que-ries) will reset the timeout back to seconds. If no additional joins are seen, the entry will expire after seconds. Default is 130.set ip igmp snooping-unreg-mode [ block | flood ]The snooping-unreg-mode can be set to block or flood. This indicates what should happen to unregistered mul-ticast traffic – traffic that hasn't been subscribed to by any clients. If set to flood, the traffic will be sent to all LAN ports. If set to block, the traffic will not be sent to any LAN ports; it will be dropped. Default is block.NTP commandsset ip ntp enable [ on | off ]Enables or disables acquiring the time of day from an NTP (Network Time Protocol) server.set ip ntp server-address server_addressset ip ntp alt-server-address alt_server_addressSpecify the NTP server(s) to use for time updates. The NTP server-address and alt-server-address can be entered as DNS names as well as IP addresses.set ip ntp update-period minutesupdate-period specifies how often, in minutes, the Gateway should update the clock. Default is 60.
Administrator’s Handbook110Application Layer Gateway (ALG) commandsThese commands allow you to enable or disable the router’s support for a variety of Application Layer Gateways (ALGs). An application layer gateway (ALG) is a NAT component that helps certain application sessions to pass cleanly through NAT. Each ALG has a slightly different function based on the particular application’s protocol-spe-cific requirements.An internal client first establishes a connection with the ALG. The ALG determines if the connection should be allowed or not and then establishes a connection with the destination computer. All communications go through two connections – client to ALG and ALG to destination. The ALG monitors all traffic against its rules before decid-ing whether or not to forward it. The ALG is the only address seen by the public Internet so the internal network is concealed. In some situations, it may be desirable to disable some of the ALGs.set ip alg esp-enable [ on | off ]Turns the ESP (Encapsulated Security Payload) ALG for file transfers on or off. Default is on.set ip alg esp-setup-timeout valueSpecifies the timeout value for the ESP ALG setup. Default is 180.set ip alg esp-stream-timeout valueSpecifies the timeout value for the ESP ALG streaming. Default is 300.set ip alg ftp-enable [ on | off ]Turns the FTP (File Transfer Protocol) ALG for file transfers on or off. Default is on.set ip alg h323-enable [ on | off ]Turns the H323 ALG for audio, video, and data communications across IP-based networks on or off. Default is on.set ip alg pptp-enable [ on | off ]Turns the PPTP (Point-to-Point Transfer Protocol) ALG for authentication on or off. Default is on.set ip alg sip-enable [ on | off ]Turns the SIP (Session Initiation Protocol) ALG for voice communication initiation on or off. Default is on.set ip alg tftp-enable [ on | off ]Turns the TFTP (Trivial File Transfer Protocol) ALG for simple file transfers and firmware updates on or off. Default is on.Dynamic DNS Commandsset ip dynamic-dns enable [ off | on ]Enables or disables Dynamic DNS. Dynamic DNS support allows you to use the free services of www.dyndns.org. Dynamic DNS automatically directs any public Internet request for your computer's name to your current dynami-cally-assigned IP address. This allows you to get to the IP address assigned to your Gateway, even though your actual IP address may change as a result of a PPPoE connection to the Internet.
111set ip dynamic-dns service-type [ dyndns ]set ip dynamic-dns username myusernameset ip dynamic-dns password mypasswordset ip dynamic-dns hostname myhostnameset ip dynamic-dns retries [ 1 - 64 ]Enables or disables dynamic DNS services. The default is off. If you specify dyndns.org, you must supply your hostname, username for the service, and password. Number of retries defaults to 5.Default server settingsSet ip allocate-wan mode [ normal | defaultserver ]Sets the WAN mode to direct your Gateway to forward all externally initiated IP traffic (TCP and UDP protocols only) to a default host on the LAN, otherwise this feature is disabled. Default is normal.Link commandslinks represent physical connections. Currently, port-based VLAN support is provided at this level.set link name name type [ ethernet | ppp ]Specifies whether the type of the link named name is ethernet or ppp.set link name name igmp-snooping [ off | on ]Turns igmp-snooping off or on on the link named name.set link name name port-vlan ports [ lan | ptm | vc-1 | vc-2 ]Specifies a port-based VLAN on the selected ports on the link named name.set link name name port-vlan priority [ 0 - 7 ]Specifies the 802.1p priority bit. If you set this to a value greater than 0, all packets of this VLAN with unmarked priority bits (pbits) will be re-marked to this priority.set link name name ppp sub-link link_nameSpecifies a name link_name for this secondary link when one is required.set link name name ppp auth-type [ on | off ]Enables or disables PPP login authorization.set link name name ppp username unameSpecifies a username uname for authentication on the specified link when ppp auth-type is set to on.set link name name ppp password pwdSpecifies a password pwd for authentication on the specified link when ppp auth-type is set to on.
Administrator’s Handbook112set link name name ppp magic-number [ on | off ]Enables or disables LCP magic number negotiation.set link name name ppp protocol-compression [ off | on ]Specifies whether you want the Gateway to compress the PPP Protocol field when it transmits datagrams over the PPP link.set link name name ppp max-failures integerSpecifies the maximum number of Configure-NAK messages the PPP module can send without having sent a Configure-ACK message. The integer argument can be any number between 1 and 20.set link name name ppp max-configures integerSpecifies the maximum number of unacknowledged configuration requests that your Gateway will send. The inte-ger argument can be any number between 1 and 20.set link name name ppp max-terminates integerSpecifies the maximum number of unacknowledged termination requests that your Gateway will send before ter-minating the PPP link. The integer argument can be any number between 1 and 10.set link name name ppp restart-timer integerSpecifies the number of seconds the Gateway should wait before retransmitting a configuration or termination request. The integer argument can be any number between 1 and 30.set link name name ppp connection-type [ instant-on | always-on ]Specifies whether a PPP connection is maintained by the Motorola® Gateway when it is unused for extended peri-ods. If you specify always-on, the Gateway never shuts down the PPP link. If you specify instant-on, the Gate-way shuts down the PPP link after the number of seconds specified in the time-out setting (below) if no traffic is moving over the circuit.set link name name ppp echo-request [ on | off ]Specifies whether you want your Gateway to send LCP echo requests. You should turn off LCP echoing if you do not want the Gateway to drop a PPP link to a nonresponsive peer.set link name name ppp echo-failures integerSpecifies the maximum number of lost echoes the Gateway should tolerate before bringing down the PPP con-nection. The integer argument can be any number from between 1 and 20.set link name name ppp echo-interval integerSpecifies the number of seconds the Gateway should wait before sending another echo from an LCP echo request. The integer argument can be any number from between 5 and 300 (seconds).set link name name ppp mru integerSpecifies the Maximum Receive Unit (MRU) for the PPP interface. The integer argument can be any number between 128 and 1492 for PPPoE; 1500 otherwise.
113set link name name ppp peer-dns [ on | off ]Controls whether the Gateway accepts nameserver addresses from the peer. ◆The default is on, which means the Gateway expects to get nameserver addresses when the PPP link comes up. This especially applies when the primary WAN connection is PPP. ◆However, there are some unusual situations where the PPP connection is not the primary WAN, for example when the connection is used only for management. In that situation it may be desirable to not pick up more nameserver addresses. You can do that by setting the parameter to off. ☛  NOTE:This is an expert-mode setting that will rarely be used. The setting should be left on, unless you are an expert user who knows you do not want the Gateway to acquire any nameserver addresses from this PPP connection.set link name name pppoe service-name nameSpecifies an ISP name or a class or quality of service. The Service Name tells the access concentrator which net-work service the Motorola Gateway is trying to reach.set link name name pppoe ac-name nameSpecifies this particular Access Concentrator unit from all others.. Some access provider networks may have mul-tiple PPPoE servers, and having the Motorola Gateway indicate an AC Name specifies to which one the Motorola Gateway is trying to connect. Management commandsAll management related items are grouped in this section.set management account administrator username usernameSpecifies the username for the administrative user – the default is admin.set management account user username usernameSpecifies the username for the non-administrative user – the default is user.set management cwmp enable [ off | on ]Turns cwmp (TR-069 CPE WAN Management Protocol) on or off. TR-069 allows a remote Auto-Config Server (ACS) to provision and manage the Motorola Gateway. TR-069 protects sensitive data on the Gateway by not advertising its presence, and by password protection.set management cwmp acs-url acs_url:port_numberset management cwmp acs-username acs_usernameset management cwmp acs-password acs_passwordIf TR-069 WAN side management services are enabled, specifies the auto-config server URL and port number. A username and password must also be supplied, if TR-069 is enabled.The auto-config server is specified by URL and port number. The format for the ACS URL is as follows:
Administrator’s Handbook114http://some_url.com:port_numberorhttp://123.45.678.910:port_numberOn units that support SSL, the format for the ACS URL can also be:https://some_url.com:port_numberorhttps://123.45.678.910:port_numberset management shell idle-timeout [ 1...120 ]Specifies a timeout period of inactivity for telnet access to the Gateway, after which a user must re-login to the Gateway. Default is 15 minutes for telnet.set management shell telnet-port [ 1 - 65534 ]Specifies the port number for telnet (CLI) communication with the Motorola Gateway. Because port numbers in the range 0-1024 are used by other protocols, you should use numbers in the range 1025-65534 when assigning new port numbers to the Motorola Gateway telnet configuration interface. A setting of 0 (zero) will turn the server off.set management web http-port [ 1 - 65534 ]Specifies the port number for HTTP (web) communication with the Motorola Gateway. Because port numbers in the range 0-1024 are used by other protocols, you should use numbers in the range 1025-65534 when assigning new port numbers to the Motorola Gateway web configuration interface. A setting of 0 (zero) will turn the server off.set management web idle-timeout [ 1...120 ]Specifies a timeout period of inactivity for HTTP access to the Gateway, after which a user must re-login to the Gateway. Default is 5 minutes for HTTP.☛  NOTE:You cannot specify a port setting of 0 (zero) for both the web and telnet ports at the same time. This would prevent you from accessing the Gateway.
115Remote access commandsset management remote-access http-port [ 1 - 65534 ]Sets the web access port for remote access management of the Gateway. Default is port 51003.set management remote-access http-idle-timeout [ 1...120 ]Specifies a timeout period of inactivity for remote HTTP access to the Gateway, after which a user must re-login to the Gateway. Default is 20 minutes for HTTP.set management remote-access http-total-timeout [ 1...120 ]Specifies a total timeout period of inactivity for remote HTTP access to the Gateway, after which a user must re-login to the Gateway. Default is 20 minutes for HTTP.set management remote-access http-max-clients numberSpecifies the maximum number of client sessions for remote web access management. Defaults to 1 (one).set management remote-access https-port [ 1 - 65534 ]Sets the secure web access port for remote access management of the Gateway. Default is port 51443.set management remote-access https-idle-timeout [ 1...120 ]Specifies a timeout period of inactivity for secure remote HTTPS access to the Gateway, after which a user must re-login to the Gateway. Default is 20 minutes for HTTPS.set management remote-access https-total-timeout [ 1...120 ]Specifies a total timeout period of inactivity for secure remote HTTPS access to the Gateway, after which a user must re-login to the Gateway. Default is 20 minutes for HTTPS.set management remote-access https-max-clients numberSpecifies the maximum number of client sessions for secure remote web access management. Defaults to 1 (one).set management remote-access telnet-port [ 1 - 65534 ]Specifies the port number for remote access telnet (CLI) communication with the Motorola Gateway. Because port numbers in the range 0-1024 are used by other protocols, you should use numbers in the range 1025-65534 when assigning new port numbers to the Motorola Gateway telnet configuration interface. A setting of 0 (zero) will turn the server off. Defaults to port 23.set management remote-access telnet-idle-timeout [ 1...120 ]Specifies a timeout period of inactivity for remote telnet access to the Gateway, after which a user must re-login to the Gateway. Default is 5 minutes for telnet.set management remote-access telnet-total-timeout [ 1...120 ]Specifies a total timeout period of inactivity for remote telnet access to the Gateway, after which a user must re-login to the Gateway. Default is 20 minutes for telnet.
Administrator’s Handbook116set management remote-access telnet-max-clients numberSpecifies the maximum number of client sessions for remote telnet access management. Defaults to 4.set management remote-access ssh-port [ 1 - 65534 ]Specifies the port number for secure shell (SSH) communication with the Motorola Gateway. Defaults to port 22.set management remote-access ssh-idle-timeout [ 1...120 ]Specifies a timeout period of inactivity for remote secure shell (SSH) access to the Gateway, after which a user must re-login to the Gateway. Default is 5 minutes for SSH.set management remote-access ssh-total-timeout [ 1...120 ]Specifies a total timeout period of inactivity for remote secure shell (SSH) access to the Gateway, after which a user must re-login to the Gateway. Default is 20 minutes for SSH.set management remote-access ssh-max-clients numberSpecifies the maximum number of client sessions for remote secure shell (SSH) access management. Defaults to 4.set management lan-redirect enable [ off | on ]If set to on, if a WAN failure condition is detected, the LAN client's browser is redirected to a web page of failure and help text information. The redirect will only occur once, as the web UI maintains a state variable to determine whether the redirect has occurred; to continually redirect would block the user from reconfiguring the router.set management lan-access wan-cpe-mgmt-block [ off | web | all ]Blocks management of the device from the LAN via the web or all interface(s).TR-064DSL Forum LAN Side CPE Configuration (TR-064) is an extension of UPnP. It defines more services to locally manage the Motorola® Gateway. While UPnP allows open access to configure the Gateway's features, TR-064 requires a password to execute any command that changes the Gateway's configuration.set management lanmgmt enable [ off | on ]Turns TR-064 LAN side management services on or off. The default is off.
117Physical interfaces commandsDSL interfacesset physical dsl enable [ off | on ]Turns the physical DSL interface off or on. Default is on.set physical dsl loopback [ off | on ]Turns the DSL loopback mode off or on. Default is off.set physical dsl modulation auto [ off | on ]Turns automatic DSL modulation off or on. Default is on.set physical dsl transport [ atm | ptm | auto | off ]Sets the DSL transport mode: Asynchronous (atm), Packet (ptm), Automatic (auto), or none (off). Default is auto.set physical dsl atm vcc 1 enable [ off | on ]Turns atm on or off on vcc 1. Default is on.set physical dsl atm vcc 1 aal-type [ aal5 | aal0pkt | aal0cell ]Sets the ATM Adaptation Layer type (aal-type): AAL5, AAL0-packet, or AAL0-cell. Default is aal5.set physical dsl atm vcc 1 datapath [ phy0fast | phy0interleaved ]Sets the ATM datapath, Fast Path or Interleaved. Default is phy0fast.set physical dsl atm vcc 1 encap-type [ llcsnap-eth | llcsnap-rtip | llcencaps-ppp                     | vcmux-eth | vcmux-ipoa | vcmux-pppoa ]Specifies the data link encapsulation type. Default is llcsnap-eth.set physical dsl atm vcc 1 vpi [ 0 - 255 ]Sets the Virtual Path Identifier (vpi) for the circuit. Default is 0.set physical dsl atm vcc 1 vci [ 32 - 65535 ]Sets the Virtual Channel Identifier (vci) for the circuit. Default is 35.set physical dsl atm vcc 2 enable [ off | on ]Turns atm on or off on vcc 2. Default is on.set physical dsl atm vcc 2 aal-type [ aal5 | aal0pkt | aal0cell ]Sets the ATM Adaptation Layer type (aal-type): AAL5, AAL0-packet, or AAL0-cell. Default is aal5.
Administrator’s Handbook118set physical dsl atm vcc 2 datapath [ phy0fast | phy0interleaved ]Sets the ATM datapath, Fast Path or Interleaved. Default is phy0fast.set physical dsl atm vcc 2 encap-type [ llcsnap-eth | llcsnap-rtip | llcencaps-ppp | vcmux-eth | vcmux-ipoa | vcmux-pppoa ]Specifies the data link encapsulation type. Default is llcsnap-eth.set physical dsl atm vcc 2 vpi [ 0 - 255 ]Sets the Virtual Path Identifier (vpi) for the circuit. Default is 8.set physical dsl atm vcc 2 vci [ 32 - 65535 ]Sets the Virtual Channel Identifier (vci) for the circuit. Default is 35.set physical dsl atm vcc vcc_num tx-queue queue_nameAttaches the egress queue template to the atm vc when the queue type is egress.set physical dsl atm vcc vcc_num rx-queue queue_nameAttaches the ingress queue to the atm vc when the queue type is ingress.set physical dsl ptm datapath [ phy0fast | phy0interleaved ]Sets the ATM datapath, Fast Path or Interleaved. Default is phy0fast.set physical dsl ptm priority [ low | high ]Sets the Packet Transfer Mode (ptm) priority. Default is low.set physical dsl ptm tx-queue queue_nameAttaches the egress queue template to the ptm interface when the queue type is egress.set physical dsl ptm rx-queue queue_nameAttaches the ingress queue to the ptm interface when the queue type is ingress.set physical enet enet_num tx-queue queue_nameAttaches the egress queue template to the ethernet interface when the queue type is egress.set physical enet enet_num rx-queue queue_nameAttaches the ingress queue to the ethernet interface when the queue type is ingress.set physical dsl power-save enable [ off | on ]Turns power saving mode off or on. Default is off.
119Ethernet interfacesset physical enet 1 mac-addr-override mac_addrYou can override your Gateway’s Ethernet MAC address with any necessary setting. Some ISPs require your account to be identified by the MAC address, among other things. Enter your 12-character Ethernet MAC override address as instructed by your service provider, for example: 12 34 AB CD 19 64set physical enet 1 port media [ auto | 100-fd | 100-hd | 10-fd | 10-hd ]Sets the Ethernet port’s media flow control: Automatic, 100 Mbps Full-Duplex, 100 Mbps Half-Duplex, 10 Mbps Full-Duplex, or 10 Mbps Half-Duplex. Default is auto.set physical enet 1 port mdix [ auto | on | off ]Sets the Ethernet port’s crossover detection. Default is off.Wireless interfacesset physical wireless enable [ on | off ]Enables or disables the wireless capability for supported Wi-Fi Gateways. Default is on.set physical wireless standard [ bg | b-only | g-only | bgn | n-only | an | a-only ]Sets and locks the Gateway into the wireless transmission mode you want: bg, b-only, g-only, bgn, n-only, an, or a-only. For compatibility with clients using 802.11b (up to 11 Mbps transmission), 802.11g (up to 20+ Mbps), 802.11a (up to 54 Mbit/s using the 5 GHz band), or 802.11n (from 54 Mbit/s to 600 Mbit/s with the use of four spa-tial streams at a channel width of 40 MHz), select B/G/N. To limit your wireless LAN to one mode or the other, select G-only, N-only, A-only, or B-only, or some combination that applies to your setup. Default is bgn.set physical wireless auto-channel [ off | on ]Turns auto-channel detection on or off.set physical wireless default-channel [ 1... 11 ](1 through 11, for North America) on which the network will broadcast. This is a frequency range within the 2.4Ghz band. Channel selection depends on government regulated radio frequencies that vary from region to region. The widest range available is from 1 to 14. Europe, France, Spain and Japan differ. Channel selection can have a sig-nificant impact on performance, depending on other wireless activity close to this Router. Channel selection is not necessary at the client computers; the clients will scan the available channels seeking access points using the same SSID as the client. Defaults to 6.set physical wireless power [ 1 - 100 ]Sets some value lower than 100 percent transmit power if your Gateway is located close to other Wi-Fi Gateways and causes interference. Defaults to 100 (percent).set physical wireless ssid 1 enable [ on | off ]Enables or disables the first (default) Wi-Fi SSID.set physical wireless ssid 1 name nameSpecifies a name for the first Wi-Fi SSID. Defaults to a unique value per router.
Administrator’s Handbook120set physical wireless ssid 1 access-type [ none | allow | deny ]Specifies the type of address list for defining MAC address filtering. If set to allow, only hosts with the specified addresses will be permitted to join the WLAN of the specified SSID. If set to deny, any hosts except those with the specified addresses will be permitted to join the specified SSID. Default is none.set physical wireless ssid 1 access-list mac_addressSpecifies the MAC address of devices controlled by MAC address filtering.set physical wireless ssid 1 hidden [ off | on ]Enables or disables “closed system mode” for the specified SSID. If set to on, the specified SSID will not appear on client scans. Clients must log into the SSID with the exact SSID name and credentials specified for that SSID.set physical wireless ssid 1 isolate [ off | on ]If set to on, blocks wireless clients from communicating with other wireless clients on the LAN side of the Gate-way. Defaults to off.set physical wireless ssid 1 security [ none | wep | wpa ]Sets the wireless privacy type: none, wep, or wpa-psk. Default is none.set physical wireless ssid 2 enable [ off | on ]Enables or disables the second available SSID.set physical wireless ssid 3 enable [ off | on ]Enables or disables the third available SSID.set physical wireless ssid 4 enable [ off | on ]Enables or disables the fourth available SSID.set physical wireless wps [ on | off ]Enables or disables Wi-Fi Protected Setup (WPS) for simplified security configuration with Wi-Fi clients that sup-port it.set physical wireless wmm enable [ off | on ]Enables or disables Wi-Fi Multimedia settings for multimedia queueing characteristics.PPPoE relay commandsset pppoe-relay enable [ on | off ]Allows the Gateway to forward PPPoE packets. Default is on.set pppoe-relay max-sessions [ 0... 4 ]Specifies the maximum number of PPPoE relay sessions. Default is 4.
121NAT Pinhole commandsNAT pinholes let you pass specific types of network traffic through the NAT interfaces on the Motorola Gateway. NAT pinholes allow you to route selected types of network traffic, such as FTP requests or HTTP (Web) connec-tions, to a specific host behind the Motorola Gateway transparently.To set up NAT pinholes, you identify the type(s) of traffic you want to redirect by port number, and you specify the internal host to which each specified type of traffic should be directed.The following list identifies protocol type and port number for common TCP/IP protocols:◆FTP (TCP 21)◆telnet (TCP 23)◆SMTP (TCP 25),◆TFTP (UDP 69)set pinhole name name protocol [ tcp | udp ]Specifies the identifier for the entry in the Gateway's pinhole table. You can name pinhole table entries sequen-tially (1, 2, 3), by port number (21, 80, 23), by protocol, or by some other naming scheme. Specifies the type of protocol being redirected.set pinhole name name ext-port-range [ 0 - 49151 ]Specifies the first and last port number in the range being translated.set pinhole name name int-addr ipaddrSpecifies the IP address of the internal host to which traffic of the specified type should be transferred.set pinhole name name int-start-port [ 0 - 65535 ]Specifies the port number your Motorola Gateway should use when forwarding traffic of the specified type. Under most circumstances, you would use the same number for the external and internal port.Security Stateful Packet Inspection (SPI) commandsset security firewall-level [ low | high | off ]All computer operating systems are vulnerable to attack from outside sources, typically at the operating system or Internet Protocol (IP) layers. Stateful Inspection firewalls intercept and analyze incoming data packets to deter-mine whether they should be admitted to your private LAN, based on multiple criteria, or blocked. Stateful inspec-tion improves security by tracking data packets over a period of time, examining incoming and outgoing packets. Outgoing packets that request specific types of incoming packets are tracked; only those incoming packets consti-tuting a proper response are allowed through the firewall.The high setting is recommended, but for special circumstances, a low level of firewall protection is available. You can also turn all firewall protection off. Defaults to low.set security spi invalid-address-drop [ on | off ]Enables or disables whether Broadband packets with invalid source or destination addresses should be dropped. Default is on.set security spi unknown-ethertypes-drop [ on | off ]Enables or disables whether packets with unknown ether types are to be dropped. Default is on.
Administrator’s Handbook122set security spi portscan-protect [ on | off ]Enables or disables whether to detect and drop port scans. Default is on.set security spi invalid-tcp-flags-drop [ on | off ]Enables or disables whether packets with invalid TCP flag settings (NULL, FIN, Xmas, etc.) are to be dropped. Default is on.set security spi flood-limit enable [ on | off ]Enables or disables whether packet flooding should be detected and offending packets be dropped. Default is on.set security spi flood-limit limit pps_valueSets a maximum Packets Per Second (PPS) value for packet flood criterion.set security spi flood-limit burst-limit max_valueSets a maximum value in a packet-burst for packet flood criterion.VoIP commands(supported models only}Voice-over-IP (VoIP) refers to the ability to make voice telephone calls over the Internet. This differs from tradi-tional phone calls that use the Public Switched Telephone Network (PSTN). VoIP calls use an Internet protocol, Session Initiation Protocol (SIP), to transmit sound over a network or the Internet in the form of data packets. Cer-tain Motorola Gateway models have one or more voice ports for connecting telephone handsets. These models support VoIP. If your Gateway is a VoIP model, you can configure the VoIP features.set voip phone n sip-option [ off | on ]Turns SIP on or off for the phone specified by n, usually 1 or 2, depending on your Gateway’s number of physical voice ports. Default is off.set voip phone n sip-proxy-server [ server_name | ip_address  ]Specifies the SIP proxy server for the specified phone by fully qualified server name or IP address.set voip phone n sip-proxy-server-port [ 1 - 65535 ]Specifies the SIP proxy server port number for the specified phone. Default is 5060.set voip phone n sip-proxy-server-transport [ udp | tcp ]Specifies the SIP proxy server transport protocol for the specified phone. Default is UDP.set voip phone n sip-registrar-server [ server_name | ip_address  ]Specifies the SIP registration server for the specified phone by fully qualified server name or IP address.set voip phone n sip-registrar-server-port [ 1 - 65535 ]Specifies the SIP registration server port number for the specified phone. Default is 5060.
123set voip phone n sip-registrar-server-transport [ udp | tcp ]Specifies the SIP registration server transport protocol for the specified phone. Default is UDP.set voip phone n sip-expires-time [ 5 - 65535 ]Specifies the SIP registration server time-out duration from 0 – 65535 seconds for the specified phone. Default is 3600 (1 hour).set voip phone n sip-outproxy-server [ server_name | ip_address  ]Specifies the SIP outbound proxy server for the specified phone by fully qualified server name or IP address.set voip phone n sip-outproxy-server-port [ 1 - 65535 ]Specifies the SIP outbound proxy server port for the specified phone. Default is 5060.set voip phone n sip-user-display-name nameSpecifies the user name that is displayed on the web UI Home page, or other caller-id displays for the specified phone.set voip phone n sip-user-name usernameSpecifies the user name that authenticates the user to SIP for the specified phone.set voip phone n sip-user-password passwordSpecifies the password that authenticates the user to SIP for the specified phone.set voip phone n auth-id stringSpecifies the authorization ID that authenticates the user to SIP for the specified phone. Most SIP Servers expect this to be the username itself but some may use auth-id.set voip phone n sip-user-port [ 1 - 65535 ]Specifies the SIP user port for the specified phone, Default is 5060.set voip phone n codec G711U priority [ 1 | 2 | 3 | 4 | 5 | 6 | 7 | none ]Assigns a priority to the ulaw codec, the common analog voice encoding method used in North America.set voip phone n codec G711A priority [ 1 | 2 | 3 | 4 | 5 | 6 | 7 | none ]Assigns a priority to the alaw codec, the common analog voice encoding method used outside North America.set voip phone n codec G729 priority [ 1 | 2 | 3 | 4 | 5 | 6 | 7 | none ]Assigns a priority to the G729 annex A codec, the common analog voice compression implementation used in North America.set voip phone n codec G726_16 priority [ 1 | 2 | 3 | 4 | 5 | 6 | 7 | none ]Assigns a priority to the G726-16 codec, a common audio media type implementation at 16 kbit/s.
Administrator’s Handbook124set voip phone n codec G726_24 priority [ 1 | 2 | 3 | 4 | 5 | 6 | 7 | none ]Assigns a priority to the G726-24 codec, a common audio media type implementation at 24 kbit/s.set voip phone n codec G726_32 priority [ 1 | 2 | 3 | 4 | 5 | 6 | 7 | none ]Assigns a priority to the G726-32 codec, a common audio media type implementation at 32 kbit/s.set voip phone n codec G726_40 priority [ 1 | 2 | 3 | 4 | 5 | 6 | 7 | none ]Assigns a priority to the G726-40 codec, a common audio media type implementation at 40 kbit/s.Advanced settingsset voip phone n sip-advanced-setting sip-dtmf-mode [ inband | rfc2833 | info ]sip-dtmf-mode – sets the Dual Tone Multi-Frequency Mode:◆inband: sends the DTMF digits as a normal inband tone.◆rfc2833: (default) sends the DTMF digits as an event as part of the RTP packet header    information.◆info: sends the DTMF digits in the SIP INFO message.set voip phone n sip-advanced-setting sip-hk-flash-mode [ cpe | info ]Sets the behavior of the flash hook mode for the specified phone line. Default is info.set voip phone n sip-advanced-setting sip-session-refresher       [ local | remote | auto ]Sets the method for refreshing the SIP session. Default is auto.set voip phone n sip-advanced-setting sip-dynamic-payload [ 96 - 110 ]Specifies a default dynamic payload value for a named telephony event. Default is 101.set voip phone n sip-advanced-setting sip-digit-map stringSpecifies rules used to recognize a number dialed by the user and to ensure this number matches the dial plan defined by the ITSP.set voip phone n sip-advanced-setting sip-compact-header [ off | on ]Forces all headers in the message to use compact format when set to on. Sends the SIP messages with Compact Headers, reducing the size of the SIP messages.set voip phone n sip-advanced-setting sip-q-value [ 0 - 10 ]This is used to prioritize the SIP account based on the value.set voip phone n sip-advanced-setting sip-qos-tos-value [ 0 - 255 ]Specifies the SIP Diff-Serv Type of Service (ToS) values for Quality of Service (QoS) assignment. Default is 136.
125set voip phone n sip-advanced-setting sip-qos-p-bit-value [ 0 - 7 ]Sets a QoS P-bit value for the SIP session. Default is 6.set voip phone n sip-advanced-setting sip-qos-marker-value valueSets a QoS marker on the SIP session packets on the specified phone line.set voip phone n sip-advanced-setting rtp-qos-tos-value [ 0 - 255 ]Specifies the RTP Diff-Serv Type of Service (ToS) values for Quality of Service (QoS) assignment. Default is 184.set voip phone n sip-advanced-setting rtp-qos-p-bit-value [ 0 - 7 ]Sets a QoS P-bit value for the RTP session. Default is 6..set voip phone n sip-advanced-setting rtp-qos-marker-value valueSets a QoS marker on the RTP session packets on the specified phone line.set voip phone n sip-advanced-setting fax-redundancy-level [ 0 - 1 ]Specifies  the level of fax redundancy for t38  fax data rate management.set voip phone n sip-advanced-setting sip-init-de-register [ off | on ]Turns SIP de-registration on or off. Default is off.set voip phone n sip-advanced-setting sip-known-ip-list stringSpecifies a known IP address list of SIP servers for the SIP session.Advanced telephony settingsThe telephony features include advanced settings for fine tuning phone behavior. The following codecs and asso-ciated value defaults are supported: Codec G711U Codec G711A Codec G729 Codec G726_16packetization-time 20 20 20 20jitter-max-reorder-delay 50 50 50 50jitter-max-accept-late-seq-num200 200 200 200jitter-initial-delay 80 80 80 80jitter-exe-frame-del-mode off off off offjitter-max-transit-delay 250 250 250 250jitter-peak-transit-delay 475 475 475 475jitter-delay-buff-inc 10 10 10 10jitter-transit-delay-threshold 10000 10000 10000 10000
Administrator’s Handbook126Syntax is as follows:set voip advanced-telephony-setting codec codec packetization-time valueset voip advanced-telephony-setting codec codec jitter-max-reorder-delay valueset voip advanced-telephony-setting codec codec        jitter-max-accept-late-seq-num valueset voip advanced-telephony-setting codec codec jitter-initial-delay valueset voip advanced-telephony-setting codec codec jitter-exe-frame-del-mode       [ off | on ]set voip advanced-telephony-setting codec codec jitter-max-transit-delay valueset voip advanced-telephony-setting codec codec jitter-peak-transit-delay valueset voip advanced-telephony-setting codec codec jitter-delay-buff-inc valueset voip advanced-telephony-setting codec codec        jitter-transit-delay-threshold valueset voip advanced-telephony-setting fxs-port-setting-for-fxo        [ none | fxs1 | fxs2 | both | emgncy ]Sets a port to be used for the FXS (Foreign eXchange Subscriber interface) port to the FXO (Foreign eXchange Office interface -- the phone) port. Default is none,Codec G726_24 Codec G726_32 Codec G726_40packetization-time 20 20 20jitter-max-reorder-delay 50 50 50jitter-max-accept-late-seq-num200 200 200jitter-initial-delay 80 80 80jitter-exe-frame-del-mode off off offjitter-max-transit-delay 250 250 250jitter-peak-transit-delay 475 475 475jitter-delay-buff-inc 10 10 10jitter-transit-delay-threshold 10000 10000 10000
127set voip advanced-telephony-setting rtp-port-range-start valueset voip advanced-telephony-setting rtp-port-range-end valueSets the start and end port values for the RTP port range. Although no ports are specified for the RTP protocol, the RTP data is to be carried on an even UDP port number. The defaults in use for the Motorola Gateway are 8024 and 8036, respectively.set voip advanced-telephony-setting rtcp-option [ off | on ]Turns Real-Time Transport Control Protocol on or off. RTCP supports and controls RTP media streams, but does not itself deliver media streams. Default is off.set voip advanced-telephony-setting t38-option [ off | on ]Turns T.38 fax capability on or off. Default is off.set voip advanced-telephony-setting sip-session-timer-value secondsSets a timer in seconds for SIP sessions to periodically verify that an established session is still active. Default is 2280.set voip advanced-telephony-setting sip-t1-timer-value millisecondsSets a SIP T1 timer value, an estimate of the round trip time, in milliseconds from 100 – 5000. Default is 500.set voip advanced-telephony-setting sip-dynamic-line-selection [ off | on ]Turns dynamic (next available) line selection off or on. Default is off.set voip RegionSpecificSettings Region-Code region_codeSpecifies the set of standards in use for the geographical region. Example: "USA_DEFAULT".set voip RegionSpecificSettings fxs-hook-flash-min-time secondsSpecifies the minimum Foreign Exchange Station ( FXS) hookflash time in seconds. Default is 280.set voip RegionSpecificSettings fxs-hook-flash-max-time secondsSpecifies the maximum Foreign Exchange Station ( FXS) hookflash time in seconds. Default is 1100.set voip RegionSpecificSettings fxs-debounce-onoff-hook-delay secondsSpecifies the on/off-hook debounce time delay for removing the ripple signal, in seconds. Default is 100.set voip RegionSpecificSettings fxs-debounce-offon-hook-delay secondsSpecifies the off/on-hook debounce time delay for removing the ripple signal, in seconds. Default is 300.Call feature settingsset voip phone n call-feature call-forwarding-all-option [ off | on ]call-forwarding-all-option – turns unconditional call forwarding on or off.
Administrator’s Handbook128set voip phone n call-feature call-forwarding-on-busy-option [ off | on ]call-forwarding-on-busy-option – turns call forwarding when line is busy on or off.. Default is off.set voip phone n call-feature call-forwarding-on-no-answer-option [ off | on ]call-forwarding-on-no-answer-option – turns call forwarding when there is no answer on or off.set voip phone n call-feature call-waiting-option [ off | on ]call-waiting-option – enables or disables call waiting.set voip phone n call-feature call-conferencing-option [ off | on ]call-conferencing-option – enables or disables 3-way call conferencing.set voip phone n call-feature do-not-disturb-option [ off | on ]do-not-disturb-option – enables or disables option to prevent the phone from ringing.set voip phone n call-feature subscribe-mwi-option [ off | on ]subscribe-mwi-option – if set to on, the Message Waiting Indicator is enabled when new voice mail is received.set voip phone n call-feature anonymous-call-block-option [ off | on ]anonymous-call-block-option – if set to on, blocks calls from unidentified sources, such as those with caller-ID blocking.set voip phone n call-feature call-transfer-option [ off | on ]call-transfer-option – if set to on, permits call transfer to another phone.DSP settingsset voip phone n dsp-settings echo-option [ echo-off | echo-on | echo-on-nlp |                             echo-on-cng-nlp ]echo-option – specifies under what conditions the system invokes or disables echo cancellation. Default is echo-on-cng-nlp (Comfort Noise Generation with non-linear processor).set voip phone n dsp-settings echo-start-attenuation [ 0 - 65535 ]echo-start-attenuation – specifies the minimum attenuation level at which to invoke echo cancellation. Default is 8192.set voip phone n dsp-settings echo-max-attenuation [ 0 - 65535 ]echo-max-attenuation – specifies the maximum attenuation level at which to invoke echo cancellation. Default is 16384.set voip phone n dsp-settings echo-tail-length [ 0 - 65535 ]echo-tail-length – specifies the duration of an echo tail required to invoke cancellation. Default is 0.
129set voip phone n dsp-settings vad-option [ off | on ]When vad-option is set to on – enables Voice Activity Detection/Comfort Noise Generation. When speech is not present, the CNG algorithm generates a noise signal at the level sent from the transmit side.
Administrator’s Handbook130System commandsset system name nameSpecifies the name of your Motorola Gateway. Each Motorola Gateway is assigned a name as part of its factory initialization. The default name for a Motorola Gateway consists of the word “Motorola-7000/XXX” where “XXX” is the serial number of the device; for example, Motorola-7000/9437188. A system name can be 1 – 255 characters long. Once you have assigned a name to your Motorola Gateway, you can enter that name in the Address text field of your browser to open a connection to your Motorola Gateway.☛  NOTE:Some broadband cable-oriented Service Providers use the System Name as an important identifi-cation and support parameter. If your Gateway is part of this type of network, do NOT alter the Sys-tem Name unless specifically instructed by your Service Provider.set system time-zone [ UTC | HST10 | AKST9AKDT | YST8 | PST8PDT |      MST7MDT | MST7 | CST6CDT | CST6 | EST5EDT | AST4ADT | NST3:30NDT ]time-zone of 0 is Coordinated Universal Time (UTC); options are -12 through 12 (+/- 1 hour increments from UTC time). set system auto-daylight-savings [ on | off ]Time zones honoring Daylight Saving Time may be automatically designated.set system firewall-log enable [ on | off ]Turns firewall logging on or off. The firewall log tracks attempted violations of the firewall rules. Default is on.set system firewall-log file-size [ 4096... 65536 ]Specifies a size for the firewall logs. The most recent entries are posted to the beginning of the log. When the log becomes full, the oldest entries are dropped. The default is 16384.set system firewall-log file-count [ 2... 8 ]Specifies the number of possible log files. The default is 4.set system log buffer-size [ 4096... 65536 ]Specifies a size for the system log. The most recent entries are posted to the beginning of the log. When the log becomes full, the oldest entries are dropped. The default is 16384.set system log level [ low | medium | high | alerts | failures ]Specifies the types of log messages you want the Motorola Gateway to record. All messages with a level equal to or greater than the level you specify are recorded. For example, if you specify set system diagnostic-level medium, the diagnostic log will retain medium-level informational messages, alerts, and failure messages.Use the following guidelines:◆low - Low-level informational messages or greater; includes trivial status messages.◆medium - Medium-level informational messages or greater; includes status messages that can help monitor network traffic.
131◆high - High-level informational messages or greater; includes status messages that may be significant but do not constitute errors. The default.◆alerts - Warnings or greater; includes recoverable error conditions and useful operator information.◆failures - Failures; includes messages describing error conditions that may not be recoverable.
Administrator’s Handbook132Debug CommandsWhen you are in SHELL mode, the DEBUG prompt is the name of the Motorola Gateway/DEBUG followed by a right angle bracket (>). For example, if you open a CLI connection to the Motorola Gateway named “Motorola-3000/9437188,” then type “debug” you would see Motorola-3000/9437188/DEBUG> as your prompt.Debug level is available for field debugging purposes.There is no service and quality level guarantee from Motor-ola. This level is intended for SEs or Telcos lab people, not for normal operation at home for end users.Disclaimer & Warning TextThe following is displayed when entering Debug level from normal Config level.“Warning: Accessing these commands may impact the normal operation of this device. Exit now if you entered by mistake”CommandsconsoleMake this session the console.mirror <src-port> <dst-port>To mirror one port's traffic to another. Causes traffic transmitted or received on <src-port> to be mirrored on <dst-port>. Ports must support Ethernet (IPoA and PPPoA ATM ports are not supported).mirror offTurns off port mirroring.traceTo see the "trace" messages, first enable console. Toggles routing tracing for:arpdhcp server agent clientbridgednsdyndnsfwhttp server client shell stcp tlsigmp proxy snoopingipipespipmapipseckeypptpriptftpsip
133wirelessvoip sip dsp
Administrator’s Handbook134
135CHAPTER 5 Technical Specifications and Safety InformationDescriptionDimensions: (Unit without the stand) H: 194 mm, W: 32 mm, D: 148 mm, Weight: 403 grams(Unit with the stand) H: 210 mm, W: 77 mm, D: 166 mm, Weight: 449 gramsCommunications interfaces: The Motorola® Gateways have an RJ-11 jack for DSL line connections and a 4-port 10/100Base-T Ethernet switch for your LAN connections, and a 400 mW wireless radio for Wi-Fi connections.Power requirements■Min10.5W/110VAC■Max17.2W/110AC■Min 8.4W/12VDC@2A■Max 14.4W/12VDC@2A (2phone,5REN, RINGING)EnvironmentOperating temperature: 0° to +40° CStorage temperature: 0° to +70° CRelative storage humidity: 20 to 80% noncondensingSoftware and protocolsSoftware media: Software preloaded on internal flash memory; field upgrades done via download to internal flash memory via CLI or web upload.Routing: TCP/IP Internet Protocol Suite, RIPWAN support: PPPoA, PPPoE, DHCP, static IP addressSecurity: PAP, CHAP, UI password security, IPsecManagement/configuration methods:  HTTP (Web server), telnet command line inter faceDiagnostics: Ping, event logging, routing table displays, statistics counters, web-based management, traceroute, nslookup, and diagnostic commands.
Administrator’s Handbook136Agency approvalsNorth AmericaSafety Approvals:■United States – UL 60950, Third Edition■Canada – CSA: CAN/CSA-C22.2 No. 60950-00EMC:■United States – FCC Part 15 Class B■Canada – ICES-003Telecom:■United States – 47 CFR Part 68■Canada – CS-03
137Manufacturer’s Declaration of Conformance☛  Warnings:This is a Class B product. In a domestic environment this product may cause radio interference, in which case the user may be required to take adequate measures. Adequate measures include increasing the physical distance between this product and other electrical devices.Changes or modifications to this unit not expressly approved by the party responsible for compli-ance could void the user’s authority to operate the equipment.United States. This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to Part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses, and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio commu-nications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures:■Reorient or relocate the receiving antenna.■Increase the separation between the equipment and receiver.■Connect the equipment into an outlet on a circuit different from that to which the receiver is connected.■Consult the dealer or an experienced radio TV technician for help.This device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions:1. This device may not cause harmful interference, and2. this device must accept any interference received, including interference that may cause undesired operation.Service requirements. In the event of equipment malfunction, if under warranty we will exchange a product deemed defective. Under FCC rules, no customer is authorized to repair this equipment. This restriction applies regardless of whether the equipment is in or out of warranty. Technical Support for Hardware Products1-877-466-8646 http://www.motorola.com/support☛  ImportantThis product was tested for FCC compliance under conditions that included the use of shielded cables and connectors between system components. Changes or modifications to this product not authorized by the manufacturer could void your authority to operate the equipment.Canada. This Class B digital apparatus meets all requirements of the Canadian Inter ference -Causing Equipment Regulations.Cet appareil numérique de la classe B respecte toutes les exigences du Réglement sur le matériel brouilleur du Canada.Declaration for Canadian usersNOTICE: The Canadian Industry Canada label identifies certified equipment. This certification means that the equipment meets certain telecommunications network protective, operation, and safety requirements. The Department does not guarantee the equipment will operate to the user’s satisfaction.
Administrator’s Handbook138Before installing this equipment, users should ensure that it is permissible to be connected to the facilities of the local telecommunications company. The equipment must also be installed using an acceptable method of connection. In some cases, the company’s inside wiring associated with a single line individual service may be extended by means of a certified connector assembly (telephone extension cord). The customer should be aware that compliance with the above conditions may not prevent degradation of service in some situations.Repairs to the certified equipment should be made by an authorized Canadian maintenance facility designated by the supplier. Any repairs or alterations made by the user to this equipment, or equipment malfunctions, may give the telecommunications company cause to request the user to disconnect the equipment.Users should ensure for their own protection that the electrical ground connections of the power utility, telephone lines, and internal metallic water pipe system, if present, are connected together. This precaution may be particularly important in rural areas.CautionUsers should not attempt to make such connections themselves, but should contact the appropriate electric inspection authority, or electrician, as appropriate.The Ringer Equivalence Number (REN) assigned to each terminal device provides an indication of the maximum number of terminals allowed to be connected to a telephone interface. The termination on an interface may consist of any combination of devices subject only to the requirement that the sum of the Ringer Equivalence Numbers of all the devices does not exceed 5.
139Important Safety InstructionsCautionDO NOT USE BEFORE READING THE INSTRUCTIONS: Do not connect the Ethernet ports to a carrier or carriage service provider’s telecommunications network or facility unless: a) you have the written consent of the network or facility manager, or b) the connection is in accordance with a connection permit or connection rules.Connection of the Ethernet ports may cause a hazard or damage to the telecommunication network or facility, or persons, with consequential liability for substantial compensation.Caution■The direct plug-in power supply serves as the main power disconnect; locate the direct plug-in power supply near the product for easy access.■For use only with CSA Certified Class 2 power supply, rated 12VDC, 1.0A.Telecommunication installation cautions■Never install telephone wiring during a lightning storm.■Never install telephone jacks in wet locations unless the jack is specifically designed for wet locations.■Never touch uninsulated telephone wires or terminals unless the telephone line has been disconnected at the network interface.■Use caution when installing or modifying telephone lines.■Avoid using a telephone (other than a cordless type) during an electrical storm. There may be a remote risk of electric shock from lightning.■Do not use the telephone to report a gas leak in the vicinity of the leak.
Administrator’s Handbook14047 CFR Part 68 InformationFCC Requirements1. The Federal Communications Commission (FCC) has established Rules which permit this device to be directly connected to the telephone network. Standardized jacks are used for these connections. This equipment should not be used on party lines or coin phones.2. If this device is malfunctioning, it may also be causing harm to the telephone network; this device should be disconnected until the source of the problem can be determined and until repair has been made. If this is not done, the telephone company may temporarily disconnect service.3. The telephone company may make changes in its technical operations and procedures; if such changes affect the compatibility or use of this device, the telephone company is required to give adequate notice of the changes. You will be advised of your right to file a complaint with the FCC.4. If the telephone company requests information on what equipment is connected to their lines, inform them of:a. The telephone number to which this unit is connected.b. The ringer equivalence number. [0.XB]c. The USOC jack required. [RJ11C]d. The FCC Registration Number. [XXXUSA-XXXXX-XX-E]Items (b) and (d) are indicated on the label. The Ringer Equivalence Number (REN) is used to determine how many devices can be connected to your telephone line. In most areas, the sum of the REN's of all devices on any one line should not exceed five (5.0). If too many devices are attached, they may not ring properly.FCC Statementsa) This equipment complies with Part 68 of the FCC rules and the requirements adopted by the ACTA. On the bottom of this equipment is a label that contains, among other information, a product identifier in the format US:AAAEQ##TXXXX. If requested, this number must be provided to the telephone company.b) List all applicable certification jack Universal Service Order Codes (“USOC”) for the equipment: RJ11.c) A plug and jack used to connect this equipment to the premises wiring and telephone network must comply with the applicable FCC Part 68 rules and requirements adopted by the ACTA. A compliant telephone cord and modular plug is provided with this product. It is designed to be connected to a compatible modular jack that is also compliant. See installation instructions for details.d) The REN is used to determine the number of devices that may be connected to a telephone line. Excessive RENs on a telephone line may result in the devices not ringing in response to an incoming call. In most but not all areas, the sum of RENs should not exceed five (5.0). To be certain of the number of devices that may be connected to a line, as determined by the total RENs, contact the local telephone company. For products approved after July 23, 2002, the REN for this product is part of the product identifier that has the format US:AAAEQ##TXXXX. The digits represented by ## are the REN without a decimal point (e.g., 03 is a REN of 0.3). For earlier products, the REN is separately shown on the label.e) If this equipment, the Motorola® Gateway, causes harm to the telephone network, the telephone company will notify you in advance that temporary discontinuance of service may be required. But if advance notice isn’t practical, the telephone company will notify the customer as soon as possible. Also, you will be advised of your right to file a complaint with the FCC if you believe it is necessary.f) The telephone company may make changes in its facilities, equipment, operations or procedures that could affect the operation of the equipment. If this happens the telephone company will provide advance notice in order for you to make necessary modifications to maintain uninterrupted service.g) If trouble is experienced with this equipment, the Motorola® Gateway, for warranty information, please contact:Technical Support for Hardware Products1-877-466-8646 http://www.motorola.com/supportIf the equipment is causing harm to the telephone network, the telephone company may request that you disconnect the equipment until the problem is resolved.h) This equipment not intended to be repaired by the end user. In case of any problems, please refer to the trouble-shooting section of the Product User Manual before calling Motorola Technical Support.i) Connection to party line service is subject to state tariffs. Contact the state public utility commission, public service commission or corporation commission for information.
141j) If your home has specially wired alarm equipment connected to the telephone line, ensure the installation of this Motorola® Series Gateway does not disable your alarm equipment. If you have questions about what will disable alarm equipment, consult your telephone company or qualified installer.RF Exposure Statement:NOTE: Installation of the wireless models must maintain at least 20 cm between the wireless Gateway and any body part of the user to be in compliance with FCC RF exposure guidelines.Electrical Safety AdvisoryTelephone companies report that electrical surges, typically lightning transients, are very destructive to customer terminal equipment connected to AC power sources. This has been identified as a major nationwide problem. Therefore it is advised that this equipment be connected to AC power through the use of a surge arrestor or similar protection device.
Administrator’s Handbook142Caring for the Environment by RecyclingRecycling your Motorola EquipmentPlease do not dispose of this product with your residential or commercial waste. Some countries or regions, such as the European Union, have set up systems to collect and recycle electrical and electronic waste items. Contact your local authori-ties for information about practices established for your region.If collection systems are not available, call Motor-ola Customer Service for assistance.Please visit www.motorola.com/recycle <http://www.motorola.com/recycle> for instructions on recycling.Genbrug af dit Motorola-udstyrDette produkt må ikke bortskaffes sammen med husholdningsaffald eller erh-vervsaffald. Nogle lande eller områder, f.eks. EU, har oprettet systemer til ind-samling og genbrug af elektriske og elektroniske affaldsprodukter. Kontakt de lokale myndigheder for oplysninger om gældende fremgangsmåder i dit område. Hvis der ikke findes tilgængelige indsamlingssystemer, kan du kon-takte Motorola Kundeservice.Recycling bei Geräten von MotorolaBitte entsorgen Sie dieses Produkt nicht als gewöhnlichen Haus- oder Büromüll. In einigen Ländern und Gebieten, z. B. in der Europäischen Union, wurden Systeme für die Rücknahme und Wiederverwertung von Elek-troschrott eingeführt. Erkundigen Sie sich bitte bei Ihrer Stadtoder Kreisver-waltung nach der geltenden Entsorgungspraxis. Falls bei Ihnen noch kein Abfuhroder Rücknahmesystem besteht, wenden Sie sich bitte an den Kun-dendienst von Motorola.Reciclaje de su equipo MotorolaNo deseche este producto junto con sus residuos residenciales o comer-ciales. Algunos países o regiones, tales como la Unión Europea, han orga-nizado sistemas para recoger y reciclar desechos eléctricos y electrónicos. Comuníquese con las autoridades locales para obtener información acerca de las prácticas vigentes en su región. Si no existen sistemas de recolección disponibles, solicite asistencia llamando el Servicio al Cliente de Motorola.Recyclage de votre équipement MotorolaVeuillez ne pas jeter ce produit avec vos ordures ménagères ou vos rebuts d'entreprise. Certains pays ou certaines régions comme l'Union Européenne ont mis en place des systèmes de collecte et de recyclage des produits élec-triques et électroniques mis au rebut. Veuillez contacter vos autorités locales pour vous informer des pratiques instaurées dans votre region. Si aucun système de collecte n'est disponible, veuillez appeler le Service clientèle de Motorola qui vous apportera son assistance.When you see this symbol on a Motorola product, do not dispose of the product with residential or commercial waste.Beskyttelse af miljøet med genbrugNår du ser dette symbol på et Motorola-produkt, må produktet ikke bortskaffes sammen med husholdningsaffald eller erh-vervsaffald.Umweltschutz durch RecyclingWenn Sie dieses Zeichen auf einem Produkt von Motorola sehen, entsorgen Sie das Produkt bitte nicht als gewöhnli-chen Hausoder Büromüll.Cuidar el medio ambiente mediante el reciclajeCuando vea este símbolo en un producto Motorola, no lo deseche junto con residuos resi-denciales o comerciales.Recyclage pour le respect de l'environnementLorsque vous voyez ce symbole sur un produit Motorola, ne le jetez pas avec vos ordures ménagères ou vos rebuts d'entreprise.
143Uw Motorola-materiaal recycleren.Gooi dit product niet bij het huishoudelijk afval het of bedrijfsafval. In sommige landen of regio's zoals de Europese Unie, zijn er bepaalde systemen om elek-trische of elektronische afvalproducten in te zamelen en te recycleren. Neem contact op met de plaatselijke overheid voor informatie over de geldende regels in uw regio. Indien er geen systemen bestaan, neemt u contact op met de klantendienst van Motorola.Recykling posiadanego sprzętu MotorolaProduktu nie należy wyrzucać do komunalnych pojemników na śmieci. W niek-tórych krajach i regionach, np. w Unii Europejskiej, istnieją systemy zbierania i recyklingu sprzętu elektrycznego i elektronicznego. Informacje o utylizacji tego rodzaju odpadów należy uzyskać od władz lokalnych. Jeśli w danym regionie nie istnieją systemy zbierania odpadów elektrycznych i elektronicznych, infor-macje o utylizacji należy uzyskać od biura obsługi klienta firmy Motorola (Motorola Customer Service).Reciclagem do seu equipamento MotorolaNão descarte este produto junto com o lixo residencial ou comercial. Alguns países ou regiões, tais como a União Européia, criaram sistemas para cole-cionar e reciclar produtos eletroeletrônicos. Para obter informações sobre as práticas estabelecidas para sua região, entre em contato com as autoridades locais. Se não houver sistemas de coleta disponíveis, entre em contato com o Serviço ao Cliente da Motorola para obter assistência.Återvinning av din Motorola-utrustningKasta inte denna produkt tillsammans med det vanliga avfallet. Vissa länder eller regioner, som t.ex. EU, har satt upp ett system för insamling och återvin-ning av el- och elektronikavfall. Kontakta dina lokala myndigheter för informa-tion om vilka regler som gäller i din region. Om det inte finns något insamlingssystem ska du kontakta Motorolas kundtjänst för hjälp.Milieubewust recyclerenAls u dit symbool op een Motor-ola-product ziet, gooi het dan niet bij het huishoudelijk afval of het bedrijfsafval.Dbałość o środowisko - recyklingProduktów Motorola oznac-zonych tym symbolem nie należy wyrzucać do komunalnych pojem-ników na śmieci.Cuidando do meio ambiente através da reciclagemQuando você ver este símbolo em um produto Motorola, não descarte o produto junto com lixo residencial ou comercial.Var rädd om miljön genom återvinningNär du ser den här symbolen på en av Motorolas produkter ska du inte kasta produkten tillsam-mans med det vanliga avfallet.
Administrator’s Handbook144Please visit http://www.motorola.com/recycle for instructions on recycling.
145Appendix A Motorola® Gateway Captive Portal ImplementationThis section contains information about the Motorola Gateway Captive Portal Support.OverviewMotorola follows the 2Wire RPC specification for implementation of Captive Portal.The Captive Portal feature redirects all TCP traffic destined to port 80 and redirects it to a captive por-tal URL. White-IP address list can be configured. HTTP traffic destined to IP addresses in the white IP address list will not be redirected. Changes to Captive Portal parameters take place immediately with-out reboot.■   PortalURL can be a maximum of 512 characters long. ■   A maximum of 500 WhiteIPAddresses are supported WhiteIPAddresses list takes a comma-sepa-rated string, which can be Individual IP addresses or a range of IP addresses. For a range of IP Addresses, subnet mask is required.  ■   The following formats of IP address are accepted:■   Individual IP address - 144.130.120.62 or 144.130.120.62/32■   Range of 64 IP addresses - 144.130.120.64/26 ■   White IP Address list gets rewritten on any changes. ■   Clearing the Captive Portal URL disables Captive Portal. Turning OFF the enable parameter can also disable captive Portal functionality.■   Captive Portal is disabled by default and enabled via TR-069■   White List can be a combination of FQDN (Fully Qualified Domain Names) and white IP Address/cidr.■   FQDNs will be resolved to IP addresses on BOOT and whenever a new list is pushed.■   For NVG510, Captive Portal implementation only redirects port 80 traffic.Traffic to port 443 is allowed.■   DNS Traffic will not be blocked
Administrator’s Handbook146Captive Portal RPCRPC supported per 2Wire requirements that will set Captive Portal Parameters. <xs:schema xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:soapenv="http://schemas.xmlsoap.org/soap/envelope/"  xmlns:soapenc="http://schemas.xmlsoap.org/soap/encoding/"  xmlns:tns="urn:dslforum-org:cwmp-1-0"targetNamespace="urn:dslforum-org:cwmp-1-0"  elementFormDefault="unqualified"attributeFormDefault="unqualified">  <xs:import namespace="http://schemas.xmlsoap.org/soap/envelope/"     schemaLocation="soapenv.xsd"/>  <xs:import namespace="http://schemas.xmlsoap.org/soap/encoding/"     schemaLocation="soapenc.xsd"/><xs:complexType name="CaptivePortalParamStruct">    <xs:sequence>      <xs:element name="Enable" type="soapenc:boolean">        <xs:annotation>          <xs:documentation>If true, the Captive Portal is enabled.<xs:documentation>          <xs:documentation>If false, the Captive Portal isdisabled.</xs:documentation>        </xs:annotation>      </xs:element>      <xs:element name="RedirectURL">        <xs:annotation>          <xs:documentation>the URL to be redirected to.<xs:documentation>        </xs:annotation>        <xs:simpleType>          <xs:restriction base="xs:string">            <xs:maxLength value="512"/>          </xs:restriction>        </xs:simpleType>      </xs:element>      <xs:element name="WhiteList" type="tns:WhiteList">        <xs:annotation>          <xs:documentation>a list of sites and IP address to beescaped by the Captive Portal.</xs:documentation>        </xs:annotation>      </xs:element>    </xs:sequence>  </xs:complexType>X_00D09E_GetCaptivePortalParams RPC:<!-- X_00D09E_GetCaptivePortalParams -->  <xs:element name="X_00D09E_GetCaptivePortalParams">    <xs:annotation>      <xs:documentation>X_00D09E_GetCaptivePortalParams message isto get the Captive Portal parameters on a CPE.</xs:documentation>
147    </xs:annotation>    <xs:complexType/>  </xs:element><!-- X_00D09E_GetCaptivePortalParamsResponse -->  <xs:element name="X_00D09E_GetCaptivePortalParamsResponse">    <xs:annotation>      <xs:documentation>X_00D09E_GetCaptivePortalParamsResponseresponse message for X_00D09E_GetCaptivePortalParams request.<xs:documentation>    </xs:annotation>    <xs:complexType>      <xs:sequence>        <xs:element name="CaptivePortalParamStruct"type="tns:CaptivePortalParamStruct"/>      </xs:sequence>    </xs:complexType>  </xs:element>X_00D09E_SetCaptivePortalParams RPC:<!-- X_00D09E_SetCaptivePortalParams -->  <xs:element name="X_00D09E_SetCaptivePortalParams">    <xs:annotation>      <xs:documentation>X_00D09E_SetCaptivePortalParams message toset the Captive Portal parameters on a CPE.</xs:documentation>    </xs:annotation>    <xs:complexType>      <xs:sequence>        <xs:element name="CaptivePortalParamStruct"type="tns:CaptivePortalParamStruct"/>      </xs:sequence>    </xs:complexType>  </xs:element><!-- X_00D09E_SetCaptivePortalParamsResponse -->  <xs:element name="X_00D09E_SetCaptivePortalParamsResponse">    <xs:annotation>      <xs:documentation>X_00D09E_SetCaptivePortalParamsResponseresponse message is a response for X_00D09E_SetCaptivePortalParamsrequest.</xs:documentation>    </xs:annotation>    <xs:complexType/>  </xs:element>
Administrator’s Handbook148
149IndexSymbols!! command 82AAccess Code 26Address resolution table 87Administrator password 81Arguments, CLI 92ARPCommand 83, 90BBroadband Status 28CCall Statistics 45Captive Portal 145CLI 77!! command 82Arguments 92Command shortcuts 82Command truncation 92Configuration mode 92Keywords 92Navigating 92Prompt 82, 92Restart command 82SHELL mode 82View command 93CommandARP 83, 90Ping 84Telnet 89Command line interface (see CLI)CONFIGCommand List 80Configuration mode 92Connection commands 95Custom Service 55DDefault Server 59designing a new filter set 50Device Access Code 21Device List 24DHCP lease table 85Diagnostic log 85, 88Diagnostics 61Documentation conventions 8EEthernet statistics 85Ffilterparts 50parts of 50filter setsdisadvantages 49using 51filtersusing 50, 51firewall 87Firewall Advanced 60Firewall Status 48HHelp 23Home Network 31IICMP Echo 84IGMP 107IGMP Snooping 107IP DNS commands 106IP Gateway commands 101IP IGMP commands 107IP interfaces 87IP Passthrough 58IP routes 88IPMap table 88KKeywords, CLI 92LLAN Ethernet Statistics 33LAN Host Discovery Table 88LEDs 14Link commands 111links bar 24Log 88Logging in 81
Administrator’s Handbook150Logs 64MMAC Filtering 40Management commands 113Manual Update 66Memory 88NNAT Pinhole commands 121NAT/Gaming 53NSLookup 62NTP commands 109PPacket Filters 49PasswordAdministrator 81User 81Physical interfaces commands 117Ping 62Ping command 84PPP 91Prompt, CLI 82, 92RReset Connection 67Reset Device 67Restart 85Restart command 82Restart Modem 27SSafety Instructions 12Securityfilters 49Session Initiation Protocol 122SHELLCommand Shortcuts 82Commands 82Prompt 82SHELL level 92SHELL mode 82show config 86Show ppp 91SIP 122Step mode 93Subnets & DHCP 41Supported Games and Software 56System commands 130System Information 25Ttab bar 23Telnet 81Telnet command 89Test Web Access 62TFTP server 83Traceroute 62Trivial File Transfer Protocol 83Troubleshoot 61Truncation 92UUser name 81User password 81VView command 93view config 90Voice 43Voice-over-IP 122VoIP 122WWiFi-Key 37Wireless 35Wireless Security 37
151Motorola® Mobility DSL GatewaysMotorola Mobility, Inc.600 North U.S. Highway 45Libertyville, Illinois 60048 USATelephone: +1 847 523 5000April 19, 2011
Administrator’s Handbook152

Navigation menu