Billion Electric BIL-7404VGOX (3G)/VoIP/802.11g ADSL2+(VPN) Firewall Router User Manual 2
Billion Electric Co., Ltd. (3G)/VoIP/802.11g ADSL2+(VPN) Firewall Router Users Manual 2
Contents
- 1. Users Manual 1
- 2. Users Manual 2
Users Manual 2
URL Filter 85/ 8QLIRUP5HVRXUFH/RFDWRUÂąHJDQDGGUHVVLQWKHIRUPRIKWWSZZZDEFGHFRPRUKWWS ZZZH[DPSOHFRP ÂżOWHUUXOHVDOORZ\RXWRSUHYHQWXVHUVRQ\RXUQHWZRUNIURPDFFHVVLQJSDUWLFXODU ZHEVLWHVE\WKHLU85/7KHUHDUHQRSUHGHÂżQHG85/ÂżOWHUUXOHV\RXFDQDGGÂżOWHUUXOHVWRPHHW \RXUUHTXLUHPHQWV Enable/Disable: To enable or disable URL Filter feature. Block Mode: $OLVWRIWKHPRGHVWKDW\RXFDQFKRRVHWRFKHFNWKH85/ÂżOWHUUXOHV The default is set to Always On. Disabled: 1RDFWLRQZLOOEHSHUIRUPHGE\WKH%ORFN0RGH Always On:$FWLRQLVHQDEOHG85/ÂżOWHUUXOHVZLOOEHPRQLWRULQJDQGFKHFNLQJDWDOOKRXUVRI the day. TimeSlot1 ~ TimeSlot16: ,W LV VHOIGHÂżQHG WLPH SHULRG#: Use your phone key pad to insert a phone number to the Speed Dial phone book. Or you can update your Speed Dial phone number manually. Refer to the Phone Port section in the:HE*8,IRUGHWDLOV *67 Anonymous Call: Hide the own phone number for each call and it will not be displayed on the remote site. It is only applied to the next call when you enter this control character. The detailed operation procedure is ÂłOff Hook -> *67 -> On Hook -> Off Hook -> Dial´. This feature is disabled by default. Phone Number + #: This is the fast dial which you can dial out a phone number immediately 121 without waiting. Note: Refer to Special Dial Code section in this Manual for more details. Codec Preference Codec is known as Coder-Decoder used for data signal conversion. Set the priority of voice compression; Priority 1 owns the top priority. G.729: It is used to encoder and decoder voice information into a single packet which reduces the bandwidth consumption. *Č/$:,WLVDEDVLFQRQFRPSUHVVHGHQFRGHUDQGGHFRGHUWHFKQLTXHČ/$:XVHVSXOVH FRGHPRGXODWLRQ 3&0 HQFRGHUDQGGHFRGHUWRFRQYHUWELWOLQHDUVDPSOH G.711A-LAW:,WLVDEDVLFQRQFRPSUHVVHGHQFRGHUDQGGHFRGHUWHFKQLTXHA/$:XVHVSXOVH FRGHPRGXODWLRQ 3&0 HQFRGHUDQGGHFRGHUWRFRQYHUWELWOLQHDUVDPSOH G.726-32: It is used to encoder and decoder voice information into a single packet which reduces the bandwidth consumption.&XUUHQWO\RQO\VXSSRUWVELWUDWHZLWK.ESV DTMF Method: The Inband, RFC 2833 and SIP INFO (RFC 2976) are supported. Volume Control 9ROXPHFRQWUROKHOSV\RXWRDGMXVWWKHYRLFHTXDOLW\RIWHOHSKRQHWRWKHEHVWFRPIRUWDEOHOLVWHQLQJ level. 3UHVV³³WKHPLQXVVLJQWRUHGXFHHLWKHUPLFURSKRQHRUERWKVSHDNHUÂśVOHYHORI\RXUWHOHSKRQH 3UHVV³³WKHSOXVVLJQWRLQFUHDVHHLWKHUPLFURSKRQHRUERWKVSHDNHUÂśVOHYHORI\RXUWHOHSKRQH 122 PSTN Dial Plan (Router with LINE port only) 7KLVVHFWLRQHQDEOHV\RXWRFRQÂżJXUHÂł9R,3ZLWK3671VZLWFKLQJ´RQ\RXUV\VWHP VoIP > VoIP Dial Plan. Dial Plan Rules &OLFNWKH$GGEXWWRQWRFUHDWHDQGGHÂżQHD9R,3GLDOSODQUXOH V 3UHÂż[3URFHVVLQJ Prepend xxx unconditionally: xxx number is appended unconditionally to the front of the dialing number when making a call. 3UHÂż[FDQDOVREHLQFOXGHGZLWKDQ\QXPEHUDQGRUcharacter such as +, *, #. Note: For special service with +, *, #, you may need to check with your VoIP or Local Telephone Service Provider for information. ,I3UHÂż[LV[[[GHOHWHLW3UHÂż[[[[LVUHPRYHG from the dialing numbers before making a call. ,I3UHÂż[LV[[[UHSODFHZLWK3UHÂż[[[[LVDSSHQGHGWRWKHIURQWRIWKHGLDOLQJQXPEHUVZKHQ making a call. 1RSUHÂż[1RSUHÂż[LVDSSHQGHGWRWKHIURQWRIWKHGLDOLQJQXPEHUV,WLVVHWDVLQGHIDXOWVHWWLQJV 127 Main Digit Sequence: The call(s) can be called out via SIP or PSTN or ENUM. x: Any numeric number between 0 and 9. . ( period ): Repeat numeric number(s) between 0 and 9. * (asterisk sign): It is normal character â*Âś on phone key pad. Please check if special service(s) is provided by your VoIP Service Provider or your Local Telephone Service Provider. # (pound sign): It is normal character â#Âś on phone key pad. Please check if it is provided by your VoIP Service Provider or Local Telephone Service Provider for special service(s). #&XUUHQW3URÂżOH!Referring to the VoIP account registered on the VoIP WizardIRU3RUW <@ PSTN>: 0HDQLQJPDNLQJFDOO V YLDWKH3671OLQH <@ENUM>: 0HDQLQJPDNLQJD9R,36,3GLUHFWFDOOYLD(QXPEHU Âł(180´ WRDQ(180 callee. Electronic1XPEHU (180 XVHVWKH'16 'RPDLQNetwork System) based technology to map between a traditional phone number 3671 WRDQ,QWHUQHWDGGUHVVHV6,385/7KH(180 QXPEHUPXVWEHUHJLVWHUHGYLDDSXEOLF(180VLWHRU\RXU9R,36HUYLFH3URYLGHU <@ SIPgateway>: It is used for the Intelligent Call Routing feature where you need to set up \RXU6,3DFFRXQWRQWKH9R,38VHUGHÂżQHG3URÂżOHVOLQNRQWKH9R,3:L]DUGSDJH*RWRWKH9R,3 :L]DUGLQWKLVPDQXDOIRUPRUHinformation. Dial-Plan Examples: x. Description $Q\GLJLWQXPEHUEHWZHHQDQGLQYDULDEOHOHQJWK0D[LPXP length is 16. xxx Any 3 digit number only between 0 and 9. Total length is 3. Note: No period is needed (.) xxxx. Any number between 0 and 9 with variable length but no shorter than 3GLJLWV0D[LPXPOHQJWKLV 123x. $Q\QXPEHU VWDUWLQJZLWK0D[LPXPOHQJWKLV [xâŚx]x. For example: [124]x. [x-x]x. For example: [1-3]x. $Q\QXPEHU VWDUWLQJZLWKRURU0D[LPXPOHQJWKLV 16. $Q\QXPEHU VWDUWLQJZLWKQXPEHUWR0D[LPXPOHQJWKLV 16. x[x-x]x. For example: 9[4-6]8x. Any number (0-9) starting with 9, the second number between DQGWKLUGQXPEHU0D[LPXPOHQJWKLV Special Dial Plan Examples: Description *xx*x. Starting with â* signÂśDny two digit numbers DQ\QXPEHU LQYDULDEOHOHQJWK0D[LPXPOHQJWKLV *xx Starting with â* signÂśDny 2 digit numbers between 0 and 9. Total length including the * is 3. Note: No period is needed (.) 128 **xx*x. Starting with â** signÂśDny two digit numbers between 0 DQ\ number (0-9) LQYDULDEOHOHQJWK0D[LPXPOHQJWKLV #xx. Starting with â# signÂśDny digit number (0-9) in variable length but no shorter than 1 digits0D[LPXPOHQJWKLV ##xx*x. Starting with â## signÂśDny two digit numbers â* signÂśDQ\ number (0-9) LQYDULDEOHOHQJWK0D[LPXPOHQJWKLV 129 Call Feature 9R,3KDVDOOWKHEDVLFIHDWXUHVRIDWUDGLWLRQDOSKRQH%HVLGHVWKHSURYLGHGEDVLFIHDWXUHV9R,3 also comes with several enhanced features that allows you to further customize their settings to suit your personal needs such as call forwarding setting, call waiting time length, conference call feature, anonymous call feature and incoming no answer timer. Speed Dial 6SHHG'LDOFRPHVLQKDQG\WRVWRUHIUHTXHQWO\XVHGWHOHSKRQHQXPEHUVZKLFK\RXFDQSUHVV number from 0 to 9 and the pound sign (#) on the phone keypad to activate the function. For example, speed dial to phone number lists on 9, just press keypad 9 then #. Your router will automatically call out to number listed on entry 9. 130 Ring & Tone 7KLVVHFWLRQDOORZVDGYDQFHGXVHUWRFKDQJHWKHH[LVWLQJRUQHZO\GHÂżQHGSDUDPHWHUVIRUWKH various ring tones (dial tone, busy tone, answer tone and etc.) &RXQWU\6SHFLÂżF5LQJ 7RQH Region: Select a country ring-tone, from the drop-down list, where you are located. This VoIP router provides default parameter of ring tones according to different countries. The ring-tone SDUDPHWHUVDUHDXWRPDWLFDOO\GLVSOD\HGDIWHUHQWHULQJDVSHFLÂżFFRXQWU\,I\RXUFRXQWU\LVQRWLQ the list, you may manually create ring-tone parameters. Ring Parameters Ring Cadence (in ms): 5LQJFDGHQFHLVGHÂżQHGE\WKUHHÂżHOGV)UHTXHQF\2Q7LPH2II7LPH 2Q7LPH2II7LPHDQG2Q7LPH2II7LPH)UHTXHQF\LVVSHFLÂżHGLQ+HUW]7LPHLVJLYHQLQ milliseconds. 131 Tone Parameters You may need to check with your local telephone service provider for such information. Also, it is UHFRPPHQGHGWKDWWKLVRSWLRQEHFRQÂżJXUHGE\DGYDQFHd user unless you are instructed to do so. Click Apply to apply the settings. 132 QoS - Quality of Service 4R6IXQFWLRQKHOSV\RXWRFRQWURO\RXUQHWZRUNWUDIÂżFIRUHDFKDSSOLFDWLRQIURP/$1 (WKHUQHW DQGRU:LUHOHVV WR:$1 ,QWHUQHW ,WIDFLOLWDWHV\RXWRFRQWUROWKHGLIIHUHQWTXDOLW\DQGVSHHGRI through put for each application when the system is running with full loading of upstream. Here are the items within the QoS section: Prioritization, Outbound IP Throttling & Inbound IP Throttling (bandwidth management). Prioritization There are three priority settings to be provided in the Router: High Normal 7KHGHIDXOWLVQRUPDOSULRULW\IRUDOORIWUDIÂżFZLWKRXWVHWWLQJ Low And the balances of utilization for each priority are High (60%), Normal (30%) and Low (10%). 7RGHOHWHWKHDSSOLFDWLRQ\RXFDQFKRRVH'HOHWHRSWLRQDQGWKHQFOLFN(GLW'HOHWH Name: UVHUGHÂżQHGHVFULSWLRQWRLGHQWLI\WKLVQHZSROLF\DSSOLFDWLRQ Time Schedule: Scheduling your prioritization policy. Priority7KHSULRULW\JLYHQWRHDFKSROLF\DSSOLFDWLRQ,WVGHIDXOWVHWWLQJLVVHWWR+LJK\RXPD\ adjust this VHWWLQJWRÂżW\RXUSROLF\DSSOLFDWLRQ Protocol: The name of supported protocol. Source IP Address Range: The source IP address or range of packets to be monitored. Source Port: The source port of packets to be monitored. 133 Destination IP address Range: The destination IP address or range of packets to be monitored. Destination Port: The destination port of packets to be monitored. DSCP Marking'LIIHUHQWLDWHG6HUYLFHV&RGH3RLQW '6&3 LWLVWKHÂżUVWELWVLQWKH7R6E\WH '6&30DUNLQJDOORZVXVHUVWRDVVLJQVSHFLÂżFapplication WUDIÂżFto be executed in priority by the next Router based on the DSCP value. See Table 4 for DSCP Mapping Table. Note: To be sure the router(s) in the backbones network have the capability in executing and checking the DSCP through-out the QoS network. Table 4: DSCP Mapping Table DSCP Mapping Table :LUHOHVV $'6/5RXWHU Standard DSCP Disabled None %HVW(IIRUW %HVW(IIRUW Premium Express Forwarding (101110) Gold service (L) Class 1, Gold (001010) *ROGVHUYLFH 0 Class 1, Silver (001100) Gold service (H) &ODVV%URQ]H Silver service (L) Class 2, Gold (010010) 6LOYHUVHUYLFH 0 Class 2, Silver (010100) Silver service (H) &ODVV%URQ]H %URQ]HVHUYLFH / Class 3, Gold (011010) %URQ]HVHUYLFH 0 Class 3, Silver (011100) %URQ]HVHUYLFH + &ODVV%URQ]H Outbound IP Throttling (LAN to WAN) ,37KURWWOLQJDOORZV\RXWROLPLWWKHVSHHGRI,3WUDIÂżF7KHYDOXHHQWHUHGZLOOOLPLWWKHVSHHGRIWKH DSSOLFDWLRQWKDW\RXVHWWRWKHVSHFLÂżHGYDOXHÂśVPXOWLSOHRINESV Name: UVHUGHÂżQHGHVFULSWLRQWRLGHQWLI\WKLVQHZSROLF\name. Time Schedule: Scheduling your prioritization policy. Refer to Time Schedule for more 134 information. Protocol: The name of supported protocol. Rate Limit7ROLPLWWKHVSHHGRIRXWERXQGWUDIÂżF Source IP Address Range: The source IP address or range of packets to be monitored. Source Port(s): The source port of packets to be monitored. Destination IP Address Range: The destination IP address or range of packets to be monitored. Destination Port(s): The destination port of packets to be monitored. 135 Inbound IP Throttling (WAN to LAN) ,37KURWWOLQJDOORZV\RXWROLPLWWKHVSHHGRI,3WUDIÂżF7KHYDOXHHQWHUHGZLOOOLPLWWKHVSHHGRIWKH DSSOLFDWLRQWKDW\RXVHWWRWKHVSHFLÂżHGYDOXHÂśVPXOWLSOHRINESV Name: UVHUGHÂżQHGHVFULSWLRQWRLGHQWLI\WKLVQHZSROLF\DSSOLFDWLRQ Time Schedule: Scheduling your prioritization policy. Refer to Time Schedule for more information. Protocol: The name of supported protocol. Rate Limit7ROLPLWWKHVSHHGRIIRULQERXQGWUDIÂżF Source IP Address Range: The source IP address or range of packets to be monitored. Source Port(s): The source port of packets to be monitored. Destination IP Address Range: The destination IP address or range of packets to be monitored. Destination Port(s): The destination port of packets to be monitored. 136 Example: QoS for your Network Connection Diagram VoIP Normal PCs Restricted PC 137 Information and Settings Upstream: 928 kbps 'RZQVWUHDP0ESV VoIP User : 192.168.1.1 Normal Users : 192.168.1.2~192.168.1.5 Restricted User: 192.168.1.100 138 Mission-critical application 0RVWO\WKH931FRQQHFWLRQLVPLVVLRQFULWLFDODSSOLFDWLRQIRUGRLQJGDWDH[FKDQJHEHWZHHQKHDG DQGEUDQFKRIÂżFH The mission-critical application must be sent out smoothly without any dropping. Set priority as high level for preventing any other applications to saturate the bandwidth. Voice application 9RLFHLVODWHQF\VHQVLWLYHDSSOLFDWLRQ0RVW9R,3GHYLFHVDUHXVH6,3SURWRFRODQGWKHSRUWQXPEHU ZLOOEHDVVLJQHGE\6,3PRGXOHDXWRPDWLFDOO\%HWWHUWRXVHÂż[HG,3DGGUHVVIRUFDWFKLQJ9R,3 packets as high priority. $ERYHVHWWLQJVZLOOKHOSWRLPSURYHTXDOLW\RI\RXU9R,3VHUYLFHZKHQWUDIÂżFLVIXOOORDGLQJ Restricted Application Some of companies will setup FTP server for customer downloading or home user sharing their ÂżOHVE\XVLQJ)73 139 :LWKDERYHVHWWLQJVWKDWKHOSWROLPLWXWLOL]DWLRQRIXSVWUHDPRI)737LPHVFKHGXOHDOVRKHOS\RXWR only limit utilization at daytime. Advanced setting by using IP throttling :LWK,3WKURWWOLQJ\RXFDQVSHFLI\PRUHGHWDLOIRUDOORFDWLQJEDQGZLGWKHYHQWKHDSSOLFDWLRQVDUH located in the same level. Upstream: 928kbps (29*32kbps) 0LVVLRQFULWLFDO$SSOLFDWLRQNESV NESV Voice Application: 128kbps (4*32kbps) Restricted Application: 160kbps (5*32kbps) Other Applications: 448kbps (14*32kbps) NESV NESV 140 6RPHWLPH\RXUFXVWRPHUVRUIULHQGVPD\XSORDGWKHLUÂżOHVWR\RXU)73VHUYHUDQGWKDWZLOO saturate your downstream bandwidth. The settings below help you to limit bandwidth for the restricted application. 141 Virtual Server (known as Port Forwarding) ,Q7&3,3DQG8'3QHWZRUNVDSRUWLVDELWQXPEHUXVHGWRLGHQWLI\ZKLFKDSSOLFDWLRQSURJUDP (usually a server) incoming connections should be delivered to. Some ports have numbers that are pre-assigned to them by the IANA (the Internet Assigned Numbers Authority), and these are UHIHUUHGWRDVÂłZHOONQRZQSRUWV´6HUYHUVIROORZWKHZHOONQRZQSRUWDVVLJQPHQWVVRFOLHQWVFDQ locate them. ,I\RXZLVKWRUXQDVHUYHURQ\RXUQHWZRUNWKDWFDQEHDFFHVVHGIURPWKH:$1 LHIURPRWKHU machines on the Internet that are outside your local network), or any application that can accept LQFRPLQJFRQQHFWLRQV HJ3HHUWRSHHU33VRIWZDUHVXFKDVLQVWDQWPHVVDJLQJDSSOLFDWLRQV DQG33ÂżOHVKDULQJDSSOLFDWLRQV DQGDUHXVLQJ1$7 1HWZRUN$GGUHVV7UDQVODWLRQ WKHQ\RXZLOO XVXDOO\QHHGWRFRQÂżJXUH\RXUURXWHUWRIRUZDUGWKHVHLQFRPLQJFRQQHFWLRQDWWHPSWVXVLQJVSHFLÂżF ports to the PC on your network running the application. You will also need to use port forwarding if you want to host an online game server. The reason for this is that when using NAT, your publicly accessible IP address will be used by and SRLQWWR\RXUURXWHUZKLFKWKHQQHHGVWRGHOLYHUDOOWUDIÂżFWRWKHSULYDWH,3DGGUHVVHVXVHGE\\RXU 3&V3OHDVHVHHWKH:$1FRQÂżJXUDWLRQVHFWLRQRIWKLVPDQXDOIRUPRUHLQIRUPDWLRQRQ1$7 7KHGHYLFHFDQEHFRQÂżJXUHGDVDYLUWXDOVHUYHUVRWKDWUHPRWHXVHUVDFFHVVLQJVHUYLFHVVXFK DV:HERU)73VHUYLFHVYLDWKHSXEOLF :$1 ,3DGGUHVVFDQEHDXWRPDWLFDOO\UHGLUHFWHGWRORFDO VHUYHUVLQWKH/$1QHWZRUN'HSHQGLQJRQWKHUHTXHVWHGVHUYLFH 7&38'3SRUWQXPEHU WKH GHYLFHUHGLUHFWVWKHH[WHUQDOVHUYLFHUHTXHVWWRWKHDSSURSULDWHVHUYHUZLWKLQWKH/$1QHWZRUN 142 Add Virtual Server %HFDXVH1$7FDQDFWDVDÂłQDWXUDO´,QWHUQHWÂżUHZDOO\RXUURXWHUSURWHFWV\RXUQHWZRUNIURPEHLQJ accessed by outside users when using NAT, as all incoming connection attempts will point to your URXWHUXQOHVV\RXVSHFLÂżFDOO\FUHDWH9LUWXDO6HUYHUHQWULHVWRIRUZDUGWKRVHSRUWVWRD3&RQ\RXU network. :KHQ\RXUURXWHUQHHGVWRDOORZRXWVLGHXVHUVWRDFFHVVLQWHUQDOVHUYHUVHJDZHEVHUYHU)73 VHUYHU(PDLOVHUYHURUJDPHVHUYHUWKHURXWHUFDQDFWDVDÂłYLUWXDOVHUYHU´ Virtual Server > (GLW'0=+RVW Enabled: ,WDFWLYDWHV\RXU'0=IXQFWLRQ Disabled: $VVHWLQGHIDXOWVHWWLQJLWGLVDEOHVWKH'0=IXQFWLRQ Internal IP Address: *LYHDVWDWLF,3DGGUHVVWRWKH'0=+RVWZKHQEnabled radio button is FKHFNHG%HDZDUHWKDWWKLV,3ZLOOEHH[SRVHGWRWKH:$1,QWHUQHW List all existing PCs connecting to the network. You may assign a PC with IP address from this list. Select the Apply button to apply your changes. 145 Edit One-to-One NAT (Network Address Translation) 2QHWR2QH1$7PDSVDVSHFLÂżFSULYDWHORFDO,3DGGUHVVWRDJOREDOSXEOLF,3DGGUHVV ,I\RXKDYHPXOWLSOHSXEOLF:$1,3DGGUHVVHVIURP\RX,63\RXDUHHOLJLEOHIRU2QHWR2QH1$7 to utilize these IP addresses. *RWR&RQÂżJXUDWLRQ > Virtual Server > Edit One-to-one NAT NAT Type: Select desired NAT type. As set in default setting, it disables the One-to-One NAT function. Global IP Address: Subnet: 7KHVXEQHWRIWKHSXEOLF:$1,3DGGUHVVJLYHQE\\RXU,63,I\RXU,63KDVSURvided this information, you may insert it here. Otherwise, use IP Range method. IP Range: 7KH ,3 DGGUHVV UDQJH RI \RXU SXEOLF:$1 ,3 DGGUHVVHV )RU H[DPSOH ,3 192.168.1.1, end IP: 192.168.1.10 Select the Apply button to apply your changes. Check to create a new One-to-One NAT rule: 146 Application8VHUVGHÂżQHGGHVFULSWLRQWRLGHQWLI\WKLVHQWU\RUFOLFN VHOHFWH[LVWLQJSUHGHÂżQHGUXOHV drop-down menu to :SUHGHÂżQHGUXOHVDUHDYDLODEOH $SSOLFDWLRQ3URWRFRODQG([WHUQDO5HGLUHFW3RUWVZLOO EHÂżOOHGDIWHUWKHVHOHFWLRQ Protocol: It is the supported protocol for the virtual server. In addition to specifying the port number to be used, you will also need to specify the protocol used. The protocol used is GHWHUPLQHGE\WKHSDUWLFXODUDSSOLFDWLRQ0RVWDSSOLFDWLRQVZLOOXVH7&3RU8'3 Time Schedule: UserGHÂżQHGWLPHSHULRGWRHQDEOH\RXUYLUWXDOVHUYHU Incorrect Host Name: home.gateway or my.home.gateway ==> Correct) Embedded Web Server ( 2 Management IP Accounts) HTTP Port: 7KLVLVWKHSRUWQXPEHUWKHURXWHUÂśVHPEHGGHGZHEVHUYHU IRUZHEEDVHG FRQÂżJXUDWLRQ ZLOOXVH7KHGHIDXOWYDOXHLVWKHVWDQGDUG+773SRUW8VHUVPD\VSHFLI\DQ alternative if, for example, they are running a web server on a PC within their LAN. Management IP Address: You may specify an IP address allowed to logon and access the URXWHUÂśVZHEVHUYHU6HWWLQJWKH,3DGGUHVVWRZLOOGLVDEOH,3DGGUHVVUHVWULFWLRQVDOORZLQJ users to login from any IP address. Expire to auto-logout: 6SHFLI\DWLPHIUDPHIRUWKHV\VWHPWRDXWRORJRXWWKHXVHUÂśVFRQÂżJXUDWLRQ session. 155 For Example: User A changes HTTP port number to 100VSHFLÂżHVWKHLURZQ,3DGGUHVV of 192.168.1.55, and sets the logout time to be 100 seconds. The router will only allow User A access from the IP address 192.168.1.55WRORJRQWRWKH:HE*8,E\W\SLQJ http://192.168.1.254:100 in their web browser. After 100 seconds, the device will automatically logout User A. Universal Plug and Play (UPnP) UPnP offers peer-to-peer network connectivity for PCs and other network devices, along with control and data transfer between devices. UPnP offers many advantages for users running NAT routers through UPnP NAT Traversal, and on supported systems makes tasks such as port IRUZDUGLQJPXFKHDVLHUE\OHWWLQJWKHDSSOLFDWLRQFRQWUROWKHUHTXLUHGVHWWLQJVUHPRYLQJWKHQHHG IRUWKHXVHUWRFRQWURODGYDQFHGFRQÂżJXUDWLRQRIWKHLUGHYLFH %RWKWKHXVHUÂśV2SHUDWLQJ6\VWHPDQGWKHUHOHYDQWDSSOLFDWLRQPXVWVXSSRUW83Q3LQDGGLWLRQ WRWKHURXWHU:LQGRZV;3DQG:LQGRZV0HQDWLYHO\VXSSRUW83Q3 ZKHQWKHFRPSRQHQWLV LQVWDOOHG DQG:LQGRZVXVHUVPD\LQVWDOOWKH,QWHUQHW&RQQHFWLRQ6KDULQJFOLHQWIURP:LQGRZV ;3LQRUGHUWRVXSSRUW83Q3:LQGRZVGRHVQRWVXSSRUW83Q3 Disable: &KHFNWRGLVDEOHWKHURXWHUÂśV83Q3IXQFWLRQDOLW\ Enable: &KHFNWRHQDEOHWKHURXWHUÂśV83Q3IXQFWLRQDOLW\ UPnP Port: Its default setting is 2800. It is highly recommended for users to use this port value. If WKLVYDOXHFRQĂLFWVZLWKRWKHUSRUWVDOUHDG\EHLQJXVHG\RXPD\ZLVKWRFKDQJHWKHSRUW SNMP Access Control (Software on a PC within the LAN is required in order to utilize this function) â Simple Network Management Protocol. SNMP V1 and V2: Read Community: 6SHFLI\DQDPHWREHLGHQWLÂżHGDVWKH5HDG&RPPXQLW\DQGDQ,3DGGUHVV 7KLVFRPPXQLW\VWULQJZLOOEHFKHFNHGDJDLQVWWKHVWULQJHQWHUHGLQWKHFRQÂżJXUDWLRQÂżOH2QFHWKH string name is matched, user obtains this IP address will be able to view the data. Write Community: 6SHFLI\DQDPHWREHLGHQWLÂżHGDVWKH:ULWH&RPPXQLW\DQGDQ,3DGGUHVV 7KLVFRPPXQLW\VWULQJZLOOEHFKHFNHGDJDLQVWWKHVWULQJHQWHUHGLQWKHFRQÂżJXUDWLRQÂżOH2QFHWKH string name is matched, users from this IP address will be able to view and modify the data. Trap Community: 6SHFLI\DQDPHWREHLGHQWLÂżHGDVWKH7UDS&RPPXQLW\DQGDQ,3DGGUHVV 7KLVFRPPXQLW\VWULQJZLOOEHFKHFNHGDJDLQVWWKHVWULQJHQWHUHGLQWKHFRQÂżJXUDWLRQÂżOH2QFHWKH VWULQJQDPHLVPDWFKHGXVHUVIURPWKLV,3DGGUHVVZLOOEHVHQW61037UDSV SNMP V3: 6SHFLI\DQDPHDQGSDVVZRUGIRUDXWKHQWLFDWLRQ$QGGHÂżQHWKHDFFHVVULJKWIURPLGHQWLÂżHG,3 address. Once the authentication has succeeded, users from this IP address will be able to view and modify the data. SNMP Version: SNMPv2c and SNMPv3 6103YFLVWKHFRPELQDWLRQRIWKHHQKDQFHGSURWRFROIHDWXUHVRI6103YZLWKRXWWKH6103Y VHFXULW\7KHÂłF´FRPHVIURPWKHIDFWWKDW6103YFXVHVWKH6103YFRPPXQLW\VWULQJSDUDGLJP 156 IRUÂłVHFXULW\´EXWLVZLGHO\DFFHSWHGDVWKH6103YVWDQGDUG 6103YLVDVWURQJDXWKHQWLFDWLRQPHFKDQLVPDXWKRUL]DWLRQZLWKÂżQHJUDQXODULW\IRUUHPRWH monitoring. Traps supported: Cold Start, Authentication Failure. 7KHIROORZLQJ0,%VDUHVXSSRUWHG From RFC 1213 (MIB-II)System group From RFC 1472 (PPP/Security MIB) System group PPP security group Interface group Address Translation group From RFC 1473 (PPP/IP MIB) PPP IP group IP group ICMP Group From RFC 1474 (PPP/Bridge MIB) 333%ULGJHJURXS TCP group UDP group EGP (not applicable) From RFC 1573 (IfMIB) LI0,%2EMHFWVJURXS Transmission 6103JURXS From RFC 1695 (atmMIB) DWP0,%2EMHFWV From RFC 1650 (EtherLike-MIB) dot3stats From RFC 1907 (SNMPv2) only snmpSetSerialNo OID From RFC 1493 (Bridge MIB) GRWG%DVHJURXS dot1 dTp group GRW G6WS JURXS LI FRQÂżJXUHG DV VSDQning tree) From RFC 1471 (PPP/LCP MIB) pppLink group pppLgr group (not applicable) 157 IGMP ,*03NQRZQDV,QWHUQHW*URXS0DQDJHPHQW3URWRFROLVXVHGWRPDQDJHPHQWKRVWVIURP multicast group. IGMP Forwarding: Accepting multicast packet. Default is set to Enable. IGMP Snooping: Allowing switched Ethernet to check and make correct forwarding decisions. Default is set to Disable. VLAN Bridge This section allows you to create VLAN group and specify the member. Edit: Edit your member ports in selected VLAN group. Create VLAN: To create another VLAN group. 158 Logout 7RH[LWWKHURXWHUZHELQWHUIDFHFKRRVH/RJRXW3OHDVHVDYH\RXUFRQÂżJXUDWLRQVHWWLQJEHIRUH logging out of the system. %HDZDUHWKDWWKHURXWHUFRQÂżJXUDWLRQLQWHUIDFHFDQRQO\EHDFFHVVHGE\RQH3&DWDWLPH Therefore when a PC has logged into the system interface, the other users cannot access the system interface until the current user has logged out of the system. If the previous user forgets to ORJRXWWKHVHFRQG3&FDQRQO\DFFHVVWKHURXWHUZHELQWHUIDFHDIWHUDXVHUGHÂżQHGDXWRORJRXW period which is by default 3 minutes. You can however modify the value of the auto logout period XVLQJWKH$GYDQFHG!'HYLFH0DQDJHPHQWVHFWLRQRIWKHURXWHUZHELQWHUIDFH3OHDVHVHHWKH Advanced section of this manual for more information. 159 Chapter 5: Troubleshooting If your router is not functioning properly, please refer to the suggested solutions provided in this chapter. If your problems persist or the suggested solutions do not meet your needs, please kindly FRQWDFW\RXUVHUYLFHSURYLGHURU%LOOLRQIRUVXSSRUW Problems with the router Problem Suggested Action None of the LEDs lit when the router is turned on. Check the connection between the router and the adapter. If the problem persists, most likely it is due to the malfunction of your hardware. Please contact \RXUVHUYLFHSURYLGHURU%LOOLRQIRUWHFKQLFDOVXSSRUW You have forgotten your login username Try the default username & password (Please refer or password to Chapter 3). If this fails, restore your router to its default setting by pressing the reset button for more than 6 seconds. Problems with WAN interface Problem Suggested Action Initialization of PVC connection (line- 0DNHVXUHWKDWWKHWHOHSKRQHFDEOHLVSURSHUO\FRQsync)fail nected between the ADSL port and the wall jack. The ADSL LED on the front panel should lit. Check that your VPI, VCI, encapsulation type and type of multiplexing settings are the same as those provided by your ISP. Reboot the router GE. If you still have problem, you may need to verify these settings with your ISP. Frequent loss of ADSL linesync 0DNHVXUHWKDWDOOGHYLFHV HJWHOHSKRQHID[PD(disconnection) chine, analogue modems) that are connected to the WHOHSKRQHOLQHDV\RXUURXWHUKDYHDOLQHÂżOWHUFRQnected between them and the wall outlet (unless your are using a Central Splitter or Central Filter installed by DTXDOLÂżHGDQGOLFHQVHGHOHFWULFLDQ 0DNHVXUHWKDWDOOO OLQHÂżOWHUVDUHFRUUHFWO\LQVWDOOHGDVPLVVLQJOLQHÂżOWHUV RULQFRUUHFWLQVWDOODWLRQRIOLQHÂżOWHUVFDQFDXVH$'6/ FRQQHFWLRQSUREOHPLQFOXGLQJIUHTXHQWGLVFRQQHFtions. 160 Problem with LAN interface Problem Cannot PING any PC on LAN Suggested Action Check the Ethernet LEDs on the front panel. The LED should be on for the port that has a PC connected. If it does not lit, check to see if the cable between your router and the 3&LVSURSHUO\FRQQHFWHG0DNHVXUH\RXKDYHÂżUVWXQLQVWDOOHG\RXUÂżUHZDOOSURJUDPEHIRUHWURXEOHVKRRWLQJ Verify that the IP address and the subnet mask are consistent for both the router and the workstations. 161 Appendix: Product Support & Contact Following the suggestions listed in the Troubleshooting section of the user manual can help you solve most of your problems. However if your problems persist or you come across other technical issues that are not listed in the Troubleshooting section, please contact the dealer from where you purchased your product. Contact Billion Worldwide: http://www.billion.com 0$&26LVDUHJLVWHUHG7UDGHPDUNRI$SSOH&RPSXWHU,QF :LQGRZV:LQGRZV17:LQGRZV:LQGRZV0H:LQGRZV;3DQG:LQGRZV9LVWDDUHUHJLVWHUHG 7UDGHPDUNVRI0LFURVRIW&RUSRUDWLRQ 162
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.6 Linearized : No XMP Toolkit : 3.1-702 Producer : Acrobat Distiller 7.0.5 (Windows) Create Date : 2009:01:08 10:13:45+08:00 Modify Date : 2009:02:12 09:31:04+08:00 Metadata Date : 2009:02:12 09:31:04+08:00 Creator Tool : PScript5.dll Version 5.2.2 Thumbnail Format : JPEG Thumbnail Width : 256 Thumbnail Height : 256 Thumbnail Image : (Binary data 8549 bytes, use -b option to extract) Document ID : uuid:6774CAF629DDDD1196C7E5E4281DE8D9 Instance ID : uuid:2f0fa562-6be3-45d6-9401-4f9f5e7b5dd5 Derived From Instance ID : uuid:08489aae-f982-40f8-986a-9142677df4fe Derived From Document ID : uuid:91D04DD429DDDD11AD44F79E60AF5F11 Format : application/pdf Title : 銴ˊ -BiPAC 7404VGOX_User manual(980108)-2.pdf Creator : admin Has XFA : No Page Count : 84 Author : adminEXIF Metadata provided by EXIF.tools