user manual
Table of Contents Table of Contents Package Contents ......................................................................1 System Requirements ...........................................................1 Features................................................................................. 2 Hardware Overview ...............................................................3 Connections .................................................................... 3 LEDs and USB Port ........................................................ 4 Installation...................................................................................5 Before you Begin ...................................................................5 Wireless Installation Considerations...................................... 6 Wall Mounting Your Device ...................................................7 Connect to Cable/DSL/Satellite Modem ................................ 8 Connect to Another Router .................................................... 9 %QPĹżIWTCVKQP ............................................................................11 9GDDCUGF%QPĹżIWTCVKQP7VKNKV[ .......................................... 11 Setup Wizard ................................................................ 12 Internet Setup ............................................................... 18 Static (assigned by ISP) ...........................................19 Dynamic....................................................................20 PPPoE .....................................................................21 Wireless Setup.............................................................. 23 LAN Setup..................................................................... 30 DHCP Server Settings .................................................. 31 Time and Date .............................................................. 32 Parental Control ............................................................ 33 Port Forwarding ............................................................ 34 Port Mapping................................................................. 35 SNMP............................................................................36 QoS Engine................................................................... 37 QoS Engine................................................................... 37 D-Link DIR-615 User Manual Filter Rules.................................................................... 38 Firewall & DMZ ............................................................. 39 Advanced Wireless ....................................................... 40 Advanced Network........................................................ 42 Routing..........................................................................43 TR-069 ..........................................................................44 Device Administration ................................................... 46 Save and Restore ......................................................... 48 Firmware Update .......................................................... 49 DDNS Setting................................................................ 50 System Check............................................................... 51 Schedules .....................................................................52 Log Settings .................................................................. 53 Device Info ....................................................................54 Log ................................................................................55 Statistics........................................................................56 Active Session ............................................................. 56 Wireless ........................................................................57 Help...............................................................................58 9KTGNGUU5GEWTKV[......................................................................59 What is WEP?......................................................................59 %QPĹżIWTG9'2 ....................................................................60 What is WPA?......................................................................61 %QPĹżIWTG92#25-CPF92#25- ................................. 62 %QPĹżIWTG92#92#25- ................................................63 %QPĹżIWTG92#92#CPF92#92# 4#&+75 .......... 64 %QPPGEVVQC9KTGNGUU0GVYQTM...............................................65 Using WindowsÂŽ XP.............................................................65 %QPĹżIWTG9'2 ....................................................................66 Table of Contents %QPĹżIWTG92#25-............................................................68 5GVVKPI7R9K(K2TQVGEVKQP .....................................................70 9%0KP9KPFQYU8KUVC ....................................................70 +PKVKCN4QWVGT%QPĹżIWTCVKQPHQT9K(K2TQVGEVKQP .................. 70 5GVVKPI7RC%QPĹżIWTGF4QWVGT........................................... 71 %JCPIKPIVJG%QORWVGT0COGCPF,QKPKPIC9QTMITQWR ... %QPĹżIWTKPIVJG+2#FFTGUUKP8KUVC .......................................74 5GVVKPI7RC%QPPGEVKQPQT0GVYQTM9KTGNGUUN[ ................... 77 %QPPGEVKPIVQC5GEWTGF9KTGNGUU0GVYQTM 9'292#25- 92#25- ............................................................................ %QPPGEVKPIVQCP7PUGEWTGF9KTGNGUU0GVYQTM.................... 86 6TQWDNGUJQQVKPI .......................................................................90 9KTGNGUU$CUKEU ........................................................................94 What is Wireless? ................................................................95 Tips ...................................................................................... 97 Wireless Modes ...................................................................98 0GVYQTMKPI$CUKEU ...................................................................99 Check your IP address ........................................................99 Statically Assign an IP address .........................................100 6GEJPKECN5RGEKĹżECVKQPU........................................................101 D-Link DIR-615 User Manual ii Section 1 - Product Overview Package Contents Ĺ&.KPM&+49KTGNGUU4QWVGT Ĺ2QYGT#FCRVGT Ĺ'VJGTPGV%CDNG Ĺ/CPWCNCPF9CTTCPV[QP%& 0QVGUsing a power supply with a different voltage rating than the one included with the DIR-615 will cause damage and void the warranty for this product. 0QVG#NYC[UCVVCEJVJGRQYGTEQTFRNWIVQVJGRQYGTUWRRN[DGHQTGKPUGTVKPI the power cord and connected power supply to the wall outlet. 5[UVGO4GSWKTGOGPVU Ĺ'VJGTPGVDCUGF%CDNGQT&5./QFGO Ĺ%QORWVGTUYKVJ9KPFQYUÂŽ/CEKPVQUJÂŽQT.KPWZDCUGFQRGTCVKPIU[UVGOUYKVJCPKPUVCNNGF'VJGTPGV adapter Ĺ+PVGTPGV'ZRNQTGTQT(KTGHQZQTCDQXG HQTEQPĹżIWTCVKQP D-Link DIR-615 User Manual Section 1 - Product Overview (GCVWTGU Ĺ(CUVGT9KTGNGUU0GVYQTMKPI - The DIR-615 provides up to 300Mbps* wireless connection with other PYKTGNGUUENKGPVU6JKUECRCDKNKV[CNNQYUWUGTUVQRCTVKEKRCVGKPTGCNVKOGCEVKXKVKGUQPNKPGUWEJCU XKFGQUVTGCOKPIQPNKPGICOKPICPFTGCNVKOGCWFKQ Ĺ%QORCVKDNGYKVJDCPFI&GXKEGU - The DIR-615 is still fully compatible with the IEEE DCPF+'''IUVCPFCTFUQKVECPEQPPGEVYKVJGZKUVKPIDCPF+'''I2%+ USB and Cardbus adapters. Ĺ#FXCPEGF(KTGYCNN(GCVWTGU - The Web-based user interface displays a number of advanced network management features including: Ĺ %QPVGPV (KNVGTKPI 'CUKN[ CRRNKGF EQPVGPV ĹżNVGTKPI DCUGF QP /#% #FFTGUU 74. CPFQT Domain Name. Ĺ (KNVGT 5EJGFWNKPI 6JGUG ĹżNVGTU ECP DG UEJGFWNGF VQ DG CEVKXG QP EGTVCKP FC[U QT HQT C duration of hours or minutes. Ĺ5GEWTG/WNVKRNG%QPEWTTGPV5GUUKQPU - The DIR-615 can pass through VPN sessions. It UWRRQTVUOWNVKRNGCPFEQPEWTTGPV+25GECPF2262UGUUKQPUUQWUGTUDGJKPFVJG&+4 can securely access corporate networks. Ĺ7UGTHTKGPFN[5GVWR9K\CTF6JTQWIJKVUGCU[VQWUG9GDDCUGFWUGTKPVGTHCEGVJG&+4NGVU[QW EQPVTQNYJCVKPHQTOCVKQPKUCEEGUUKDNGVQVJQUGQPVJGYKTGNGUUPGVYQTMYJGVJGTHTQOVJG+PVGTPGVQTHTQO [QWTEQORCP[ĹUUGTXGT%QPĹżIWTG[QWTTQWVGTVQ[QWTURGEKĹżEUGVVKPIUYKVJKPOKPWVGU /CZKOWOYKTGNGUUUKIPCNTCVGFGTKXGFHTQO+'''5VCPFCTFICPF&TCHVPURGEKĹżECVKQPU#EVWCNFCVCVJTQWIJRWVYKNNXCT[0GVYQTMEQPFKVKQPUCPF GPXKTQPOGPVCNHCEVQTUKPENWFKPIXQNWOGQHPGVYQTMVTCHĹżEDWKNFKPIOCVGTKCNUCPFEQPUVTWEVKQPCPFPGVYQTMQXGTJGCFNQYGTCEVWCNFCVCVJTQWIJRWVTCVG'PXKTQPOGPVCN conditions will adversely affect wireless signal range. D-Link DIR-615 User Manual Section 1 - Product Overview *CTFYCTG 1XGTXKGY D-Link DIR-615 User Manual Section 1 - Product Overview *CTFYCTG1XGTXKGY .'&UCPF75$2QTV D-Link DIR-615 User Manual Section 2 - Installation Installation This section will walk you through the installation process. Placement of the router is very important. Do not place the TQWVGTKPCPGPENQUGFCTGCUWEJCUCENQUGVECDKPGVQTKPVJGCVVKEQTICTCIG $GHQTG[QW$GIKP 2NGCUGEQPĹżIWTGVJGTQWVGTYKVJVJGEQORWVGTVJCVYCUNCUVEQPPGEVGFFKTGEVN[VQ[QWTOQFGO#NUQ[QWECPQPN[WUG VJG'VJGTPGVRQTVQP[QWTOQFGO+H[QWYGTGWUKPIVJG75$EQPPGEVKQPDGHQTGWUKPIVJGTQWVGTVJGP[QWOWUVVWTPQHH [QWTOQFGOFKUEQPPGEVVJG75$ECDNGCPFEQPPGEVCP'VJGTPGVECDNGVQVJG9#0RQTVQPVJGTQWVGTCPFVJGPVWTP VJGOQFGODCEMQP+PUQOGECUGU[QWOC[PGGFVQECNN[QWT+52VQEJCPIGEQPPGEVKQPV[RGU 75$VQ'VJGTPGV +H[QWJCXG&5.CPFCTGEQPPGEVKPIXKC222Q'OCMGUWTG[QWFKUCDNGQTWPKPUVCNNCP[222Q'UQHVYCTGUWEJCU 9KP2QGV$TQCFLWORQT'VJGTPGVHTQO[QWTEQORWVGTQT[QWYKNNPQVDGCDNGVQEQPPGEVVQVJG+PVGTPGV D-Link DIR-615 User Manual Section 2 - Installation 9KTGNGUU+PUVCNNCVKQP%QPUKFGTCVKQPU The D-Link wireless router lets you access your network using a wireless connection from virtually anywhere within VJG QRGTCVKPI TCPIG QH [QWT YKTGNGUU PGVYQTM -GGR KP OKPF JQYGXGT VJCV VJG PWODGT VJKEMPGUU CPF NQECVKQP QH YCNNUEGKNKPIUQTQVJGTQDLGEVUVJCVVJGYKTGNGUUUKIPCNUOWUVRCUUVJTQWIJOC[NKOKVVJGTCPIG6[RKECNTCPIGUXCT[ depending on the types of materials and background RF (radio frequency) noise in your home or business. The key VQOCZKOK\KPIYKTGNGUUTCPIGKUVQHQNNQYVJGUGDCUKEIWKFGNKPGU 1.-GGR VJG PWODGT QH YCNNU CPF EGKNKPIU DGVYGGP VJG &.KPM TQWVGT CPF QVJGT PGVYQTM FGXKEGU VQ C minimum - each wall or ceiling can reduce your adapterâs range from 3-90 feet (1-30 meters.) Position your devices so that the number of walls or ceilings is minimized. $G CYCTG QH VJG FKTGEV NKPG DGVYGGP PGVYQTM FGXKEGU # YCNN VJCV KU HGGV VJKEM OGVGTU CV C 45-degree angle appears to be almost 3 feet (1 meter) thick. At a 2-degree angle it looks over 42 feet (14 meters) thick! Position devices so that the signal will travel straight through a wall or ceiling (instead of at an angle) for better reception. 3. Building Materials make a difference. A solid metal door or aluminum studs may have a negative effect on TCPIG6T[VQRQUKVKQPCEEGUURQKPVUYKTGNGUUTQWVGTUCPFEQORWVGTUUQVJCVVJGUKIPCNRCUUGUVJTQWIJ FT[YCNNQTQRGPFQQTYC[U/CVGTKCNUCPFQDLGEVUUWEJCUINCUUUVGGNOGVCNYCNNUYKVJKPUWNCVKQPYCVGT ĹżUJVCPMU OKTTQTUĹżNGECDKPGVUDTKEMCPFEQPETGVGYKNNFGITCFG[QWTYKTGNGUUUKIPCN 4.-GGR [QWT RTQFWEV CYC[ CV NGCUV HGGV QT OGVGTU HTQO GNGEVTKECN FGXKEGU QT CRRNKCPEGU VJCV generate RF noise. 5.+H[QWCTGWUKPI)*\EQTFNGUURJQPGUQT: YKTGNGUURTQFWEVUUWEJCUEGKNKPIHCPUNKIJVUCPF JQOGUGEWTKV[U[UVGOU [QWTYKTGNGUUEQPPGEVKQPOC[FGITCFGFTCOCVKECNN[QTFTQREQORNGVGN[/CMG sure your 2.4GHz phone base is as far away from your wireless devices as possible. The base transmits a signal even if the phone in not in use. D-Link DIR-615 User Manual Section 2 - Installation %QPPGEVVQ%CDNG&5.5CVGNNKVG/QFGO +H[QWCTGEQPPGEVKPIVJGTQWVGTVQCECDNG&5.UCVGNNKVGOQFGORNGCUGHQNNQYVJGUVGRUDGNQY 1. Place the router in an open and central location. Do not plug the power adapter into the router. 6WTPVJGRQYGTQHHQP[QWTOQFGO+HVJGTGKUPQQPQHHUYKVEJVJGPWPRNWIVJGOQFGOĹURQYGTCFCRVGT5JWVFQYP your computer. 3. Unplug the Ethernet cable (that connects your computer to your modem) from your computer and place it into the WAN port on the router. 4. Plug an Ethernet cable into one of the four LAN ports on the router. Plug the other end into the Ethernet port on your computer. 5. Turn on or plug in your modem. Wait for the modem to boot (about 30 seconds). 6. Plug the power adapter to the router and connect to an outlet or power strip. Wait about 30 seconds for the router to boot. 7. Turn on your computer. 8. 8GTKH[VJGNKPMNKIJVUQPVJGTQWVGT6JGRQYGTNKIJV9#0NKIJVCPFVJG.#0NKIJV VJGRQTVVJCV[QWTEQORWVGTKU RNWIIGFKPVQ UJQWNFDGNKV+HPQVOCMGUWTG[QWTEQORWVGTOQFGOCPFTQWVGTCTGRQYGTGFQPCPFXGTKH[VJGECDNG connections are correct. 9.5MKRVQRCIGVQEQPĹżIWTG[QWTTQWVGT D-Link DIR-615 User Manual Section 2 - Installation %QPPGEVVQ#PQVJGT4QWVGT +H[QWCTGEQPPGEVKPIVJG&.KPMTQWVGTVQCPQVJGTTQWVGTVQWUGCUCYKTGNGUUCEEGUURQKPVCPFQTUYKVEJ[QWYKNNJCXG to do the following before connecting the router to your network: Ĺ&KUCDNG72P2⢠Ĺ&KUCDNG&*%2 Ĺ%JCPIGVJG.#0+2CFFTGUUVQCPCXCKNCDNGCFFTGUUQP[QWTPGVYQTM6JG.#0RQTVUQPVJGTQWVGTECPPQV accept a DHCP address from your other router. 6QEQPPGEVVQCPQVJGTTQWVGTRNGCUGHQNNQYVJGUVGRUDGNQY 1. Plug the power into the router. Connect one of your computers to the router (LAN port) using an Ethernet cable. /CMGUWTG[QWT+2CFFTGUUQPVJGEQORWVGTKUZZZ YJGTGZZZKUDGVYGGPCPF 2NGCUGUGGVJG 0GVYQTMKPI$CUKEUUGEVKQPHQTOQTGKPHQTOCVKQP+H[QWPGGFVQEJCPIGVJGUGVVKPIUYTKVGFQYP[QWTGZKUVKPIUGVVKPIU DGHQTGOCMKPICP[EJCPIGU+POQUVECUGU[QWTEQORWVGTUJQWNFDGUGVVQTGEGKXGCP+2CFFTGUUCWVQOCVKECNN[KP which case you will not have to do anything to your computer. Open a web browser and enter JVVR and press 'PVGT9JGPVJGNQIKPYKPFQYCRRGCTUUGVVJGWUGT name to CFOKPCPFNGCXGVJGRCUUYQTFDQZGORV[%NKEM1- to continue. 3. Click on #FXCPEGF and then click #FXCPEGF0GVYQTM7PEJGEMVJG'PCDNG72P2EJGEMDQZ%NKEM5CXG5GVVKPIU to continue. 4. Click 5GVWR and then click 0GVYQTM5GVVKPIU7PEJGEMVJG'PCDNG&*%25GTXGTUGTXGTEJGEMDQZ%NKEM5CXG 5GVVKPIU to continue. 5. 7PFGT4QWVGT5GVVKPIUGPVGTCPCXCKNCDNG+2CFFTGUUCPFVJGUWDPGVOCUMQH[QWTPGVYQTM%NKEM5CXG5GVVKPIU to UCXG[QWTUGVVKPIU7UGVJKUPGY+2CFFTGUUVQCEEGUUVJGEQPĹżIWTCVKQPWVKNKV[QHVJGTQWVGTKPVJGHWVWTG%NQUGVJG browser and change your computerâs IP settings back to the original values as in Step 1. D-Link DIR-615 User Manual Section 2 - Installation 6. Disconnect the Ethernet cable from the router and reconnect your computer to your network. 7. Connect an Ethernet cable in one of the LAN ports of the router and connect it to your other router. Do not plug anything into the WAN port of the D-Link router. 8. ;QWOC[PQYWUGVJGQVJGTVJTGG.#0RQTVUVQEQPPGEVQVJGT'VJGTPGVFGXKEGUCPFEQORWVGTU6QEQPĹżIWTG[QWT YKTGNGUUPGVYQTMQRGPCYGDDTQYUGTCPFGPVGTVJG+2CFFTGUU[QWCUUKIPGFVQVJGTQWVGT4GHGTVQVJG%QPĹżIWTCVKQP and 9KTGNGUU 5GEWTKV[ sections for more information on setting up your wireless network. D-Link DIR-615 User Manual 10 5GEVKQP%QPĹżIWTCVKQP %QPĹżIWTCVKQP 6JKU UGEVKQP YKNN UJQY [QW JQY VQ EQPĹżIWTG [QWT PGY &.KPM YKTGNGUU TQWVGT WUKPI VJG YGDDCUGF EQPĹżIWTCVKQP utility. 9GDDCUGF%QPĹżIWTCVKQP7VKNKV[ 6QCEEGUUVJGEQPĹżIWTCVKQPWVKNKV[QRGPCYGDDTQYUGT UWEJCU+PVGTPGV'ZRNQTGTCPFGPVGTVJG+2CFFTGUUQH the router (192.168.0.1). Enter the user name (admin) and your password. Leave the password blank by default. If you get a 2CIG%CPPQVDG&KURNC[GFGTTQTRNGCUG refer to the 6TQWDNGUJQQVKPI section for assistance. D-Link DIR-615 User Manual 11 5GEVKQP%QPĹżIWTCVKQP 5GVWR9K\CTF You may run the setup wizard from the opening Internet Setup window to quickly set up your router. Click +PVGTPGV%QPPGEVKQP 5GVWR9K\CTFCPFVJGĹżTUV window of the wizard will open. Click 0GZV to continue. %TGCVGCPGYRCUUYQTFCPFVJGPENKEM0GZV to continue. D-Link DIR-615 User Manual 12 5GEVKQP%QPĹżIWTCVKQP Select your time zone and prefered NTP Server from VJGFTQRFQYPOGPWUCPFVJGPENKEM0GZV to continue. Select the type of Internet connection you use and then click 0GZV to continue. If selecting &*%2%QPPGEVKQP &[PCOKE+2#FFTGUU idntify VLAN in the 8.#0 +& ĹżGNF ;QW OC[ PGGF VQ enter the MAC address of the computer that was last connected directly to your modem. If you are currently WUKPIVJCVEQORWVGTENKEM%NQPG/#%#FFTGUU and then 0GZV to continue. The *QUV 0COG is optional but may be required by some ISPs. The default host name is the device name of the Router and may be changed. D-Link DIR-615 User Manual 13 5GEVKQP%QPĹżIWTCVKQP If selecting 7UGTPCOG 2CUUYQTF %QPPGEVKQP 222Q' GPVGT 8.#0 +& RTQXKFGF D[ VJG +52 +H VJG +52FQGUPĹVRTQXKFGCURGEKĹżGF+2CFFTGUUKPHQTOCVKQP simply enter your PPPoE username and password. Click the 5VCVKE +2 radio button if the ISP assigned [QW VJG +2 CFFTGUU UWDPGV OCUM CPF UVCTVGPF LAN IP address. Enter the required information in IP 7PPWODGTGF #FFTGUU +2 7PPWODGTGF 0GVOCUM .#05VCTV+2 and .#0'PF+2. Click 0GZV to continue. Note: Make sure to remove your PPPoE software from your computer. The software is no longer needed and will not work through a router. If selecting 5VCVKE+2#FFTGUU%QPPGEVKQPGPVGT[QWT network settings provided by your ISP. Click 0GZV to continue. D-Link DIR-615 User Manual 14 5GEVKQP%QPĹżIWTCVKQP Click ConnectVQIQVQVJGPGZVRCIG Click 9KTGNGUU%QPPGEVKQP5GVWR9K\CTF to open the YK\CTFYKPFQYQHEQPĹżIWTKPIYKTGNGUUEQPPGEVKQP%NKEM 4GDQQV to directly restart the Router. If clicking 4GDQQVthe Router will save the new settings and reboot. Please allow 1-2 minutes for rebooting. 9JGP VJG TQWVGT JCU ĹżPKUJGF TGDQQVKPI VJG QRGPKPI window will be displayed. If clicking 9KTGNGUU %QPPGEVKQP 5GVWR 9K\CTF VJKU window will open. Click 0GZV to continue. D-Link DIR-615 User Manual 15 5GEVKQP%QPĹżIWTCVKQP 'PVGTC9KTGNGUU0GVYQTM0COGCNUQMPQYPCU55+& KPVJGVGZVDQZ%NKEM#WVQOCVKECNN[CUUKIPCPGVYQTM MG[ 4GEQOOGPFGF or /CPWCNN[CUUKPICPGVYQTM MG[HQTVJGYKTGNGUUUGEWTKV[MG[CPFWUGVJGEJGEMDQZ VQUGNGEVVJGFGUKTGFNGXGNQHYKTGNGUUUGEWTKV[9'2 WPA. and then click 0GZV to continue. If selecting Manually assign a network key in the RTGXKQWUYKPFQYVJKUYKPFQYYKNNQRGP'PVGTCYKTGNGUU UGEWTKV[RCUUYQTFKPVJG0GVYQTM-G[DQZ%NKEM0GZV to continue. This window displays a summary of your wireless security settings. Please print this out or record this information in a safe place and then click 5CXG to continue. D-Link DIR-615 User Manual 16 5GEVKQP%QPĹżIWTCVKQP The Router will save the new settings and reboot. Please allow 1-2 minutes for rebooting. When the router JCU ĹżPKUJGF TGDQQVKPI VJG QRGPKPI 9KTGNGUU 5GVWR window is displayed. D-Link DIR-615 User Manual 17 5GEVKQP%QPĹżIWTCVKQP +PVGTPGV5GVWR +H[QWYCPVVQEQPĹżIWTGVJG4QWVGTOCPWCNN[YKVJQWVWUKPIVJG YK\CTFENKEMVJG/CPWCN+PVGTPGV%QPPGEVKQP5GVWR button. 6JKUYKPFQYYKNNFKURNC[HQT[QWEQPĹżIWTGVJG+PVGTPGVEQPPGEVKQP manually. Tick 'PCDNG #EEGUU 2QKPV /QFG if you want to change the Router to an access point. +P +PVGTPGV %QPPGEVKQP 6[RG UGEVKQP [QW OC[ EJQQUG WR VQ 4 WAN connections from the 9#0 %QPPGEVKQP drop-down OGPWCPFEJQQUGQPGQHVJGOCUVJGWUKPIQPGD[VKEMKPI9#0 %QPPGEVKQP'PCDNG. You can also choose the WAN Connection /QFGDGVYGGPTQWVGTCPFDTKFIGCPFGPVGTVJG8.#0+&5GNGEV the Internet connection type from /[+PVGTPGV%QPPGEVKQPKU FTQRFQYP NKUV CPF FKHHGTGPV EQPĹżIWTCVKQPU DCUGF QP XCTKQWU connection types will display below. D-Link DIR-615 User Manual 18 5GEVKQP%QPĹżIWTCVKQP +PVGTPGV5GVWR 5VCVKE CUUKIPGFD[+52 5GNGEV5VCVKE+2#FFTGUUKHCNN9#0+2KPHQTOCVKQPKURTQXKFGFVQ[QWD[[QWT+52;QWYKNNPGGFVQGPVGTKPVJG+2CFFTGUUUWDPGVOCUM ICVGYC[CFFTGUUCPF&05CFFTGUU GU RTQXKFGFVQ[QWD[[QWT+52'CEJ+2CFFTGUUGPVGTGFKPVJGĹżGNFUOWUVDGKPVJGCRRTQRTKCVG+2 HQTOYJKEJCTGHQWTQEVGVUUGRCTCVGFD[CFQV ZZZZ 6JG4QWVGTYKNNPQVCEEGRVVJG+2CFFTGUUKHKVKUPQVKPVJKUHQTOCV +2#FFTGUU Enter the IP address assigned by your ISP. 5WDPGV/CUM Enter the Subnet Mask assigned by your ISP. +52)CVGYC[ Enter the Gateway assigned by your ISP. #FFTGUU /#%#FFTGUU The default MAC Address is set to the WANâs physical interface MAC address on the Broadband Router. It is not recommended that you change the default MAC address unless required by your ISP. %NQPG/#% The default MAC address is set to the WANâs physical #FFTGUU interface MAC address on the Broadband Router. You can use the %NQPG/#%#FFTGUU button to copy the MAC address of the Ethernet Card installed by your ISP and replace the WAN MAC address with the MAC address of the router. It is not recommended that you change the default MAC address unless required by your ISP. 2TKOCT[&05 Enter the Primary DNS (Domain Name Server) server IP address assigned by your ISP. #FFTGUU 5GEQPFCT[&05 Enter the Secondary DNS server IP address assigned by your ISP. This is optional. #FFTGUU /67 /CZKOWO6TCPUOKUUKQP7PKV[QWOC[PGGFVQEJCPIGVJG/67HQTQRVKOCNRGTHQTOCPEGYKVJ[QWTURGEKĹżE+521492 is the default MTU. D-Link DIR-615 User Manual 19 5GEVKQP%QPĹżIWTCVKQP +PVGTPGV5GVWR &[PCOKE Choose Dynamic IP Address to obtain IP Address information automatically from your ISP. Select this option if your ISP does not give you any IP numbers to use. This option is commonly used for Cable modem services. *QUV0COG The Host Name is optional but may be required by some ISPs. The default host name is the device name of the Router and may be changed. /#%#FFTGUU The default MAC Address is set to the WANâs physical interface MAC address on the Broadband Router. It is not recommended that you change the default MAC address unless required by your ISP. %NQPG/#% The default MAC address is set to the WANâs physical #FFTGUU interface MAC address on the Broadband Router. Click the %NQPG/#%#FFTGUU button to copy the MAC address of the Ethernet Card installed by your ISP and replace the WAN MAC address with the MAC address of the router. It is not recommended that you change the default MAC address unless required by your ISP. &05#FFTGUU Enter the Primary and Secondary DNS Server Addresses. /67 /CZKOWO6TCPUOKUUKQP7PKV;QWOC[PGGFVQEJCPIG VJG/67HQTQRVKOCNRGTHQTOCPEGYKVJ[QWTURGEKĹżE+52 D-Link DIR-615 User Manual 20 5GEVKQP%QPĹżIWTCVKQP +PVGTPGV5GVWR 222Q' Choose PPPoE (Point to Point Protocol over Ethernet) if your ISP uses a PPPoE connection. Your ISP will provide you with a username and password. This option is typically used for DSL services. Make sure to remove your PPPoE software from your computer. The software is no longer needed and will not work through a router. 222Q' Select &[PCOKE (most common) or 5VCVKE. Select 5VCVKE KH [QWT +52 CUUKIPGF [QW VJG +2 CFFTGUU UWDPGV OCUM ICVGYC[CPF&05UGTXGTCFFTGUUGU 7UGT0COG Enter your PPPoE user name. 2CUUYQTF Enter your PPPoE password. %QPĹżTO Retype the new password. 2CUUYQTF 5GTXKEG0COG Enter the ISP Service Name (optional). +27PPWODGTGF Enter the IP address (Static PPPoE only). #FFTGUU +27PPWODGTGF Enter the IP netmask (Static PPPoE only). 0GVOCUM .#0+2 Enter Start and End LAN IP address. &05 Click 4GEKGXG&05HTQO+52 to get the DNS automatically. Click 'PVGT&05/CPWCNN[ to enter the DNS information below. &05 Enter the Primary and Secondary DNS Server Addresses. #FFTGUUGU D-Link DIR-615 User Manual 21 5GEVKQP%QPĹżIWTCVKQP /CZKOWO+FNG 'PVGTCOCZKOWOKFNGVKOGFWTKPIYJKEJVJG+PVGTPGVEQPPGEVKQPKUOCKPVCKPGFFWTKPIKPCEVKXKV[6QFKUCDNGVJKUHGCVWTG 6KOG enable Auto-reconnect. /67 /CZKOWO6TCPUOKUUKQP7PKV;QWOC[PGGFVQEJCPIGVJG/67HQTQRVKOCNRGTHQTOCPEGYKVJ[QWTURGEKĹżE+521492 is the default MTU. Connection Select either #NYC[UQP/CPWCNQT%QPPGEVQP FGOCPF. /QFG5GNGEV D-Link DIR-615 User Manual 22 5GEVKQP%QPĹżIWTCVKQP 9KTGNGUU5GVWR 9KTGNGUUUGVVKPIUHQTVJGTQWVGTOC[DGEQPĹżIWTGF OCPWCNN[QTD[WUKPICYK\CTF6QWUGVJGYK\CTF click the 9KTGNGUU%QPPGEVKQP5GVWR9K\CTF button and then follow the steps that are described below. 6QEQPĹżIWTGVJGYKTGNGUUUGVVKPIUOCPWCNN[ENKEMVJG /CPWCN9KTGNGUU%QPPGEVKQP 5GVWRbutton. The parameters for this window are described later in this section. The Wireless Security section that directly HQNNQYUVJKU%QPĹżIWTCVKQPUGEVKQPRTQXKFGUCFFKVKQPCN GZRNCPCVKQP HQT JQY VQ EQPĹżIWTG VJG 9'2 92# 92# CPF 92#92# YKTGNGUU UGEWTKV[ OQFG options. If you want to have more wireless network PCOG CNUQ MPQYP CU 55+& ENKEM VJG /WNVKRNG 9KTGNGUUPGVYQTM0COG5GVWR button. D-Link DIR-615 User Manual 23 5GEVKQP%QPĹżIWTCVKQP Click 9KTGNGUU %QPPGEVKQP 5GVWR 9K\CTF to start wireless setup wizard. Click 0GZV to continue. 'PVGTC9KTGNGUU0GVYQTM0COGCNUQMPQYPCU55+& KPVJGVGZVDQZ%NKEM#WVQOCVKECNN[CUUKIPCPGVYQTM MG[ 4GEQOOGPFGF or /CPWCNN[CUUKPICPGVYQTM MG[HQTVJGYKTGNGUUUGEWTKV[MG[CPFWUGVJGEJGEMDQZ VQUGNGEVVJGFGUKTGFNGXGNQHYKTGNGUUUGEWTKV[9'2 WPA. and then click 0GZV to continue. If selecting Manually assign a network key in the RTGXKQWUYKPFQYVJKUYKPFQYYKNNQRGP'PVGTCYKTGNGUU UGEWTKV[RCUUYQTFKPVJG0GVYQTM-G[DQZ%NKEM0GZV to continue. D-Link DIR-615 User Manual 24 5GEVKQP%QPĹżIWTCVKQP This window displays a summary of your wireless security settings. Please print this out or record this information in a safe place and then click 5CXG to continue. The Router will save the new settings and reboot. Please allow 1-2 minutes for rebooting. When the router JCU ĹżPKUJGF TGDQQVKPI VJG QRGPKPI 9KTGNGUU 5GVWR window is displayed. D-Link DIR-615 User Manual 25 5GEVKQP%QPĹżIWTCVKQP 9K(K 6QKORNGOGPV9K(KRTQVGEVKQPQT9%0VKEMVJG'PCDNG 2TQVGEVGF EJGEMDQZENKEMGKVJGT)GPGTCVG0GY2+0or 4GUGV2+0VQ 5GVWR &GHCWNVCPFVJGPEQPĹżIWTGVJG9K(KUGVVKPIUDGNQY2NGCUG see the Setting Up Wi-Fi Protection (WCN 2.0 in Windows 8KUVC UGEVKQPNCVGTKPVJKUOCPWCNHQTFGVCKNGFEQPĹżIWTCVKQP information. 'PCDNG %JGEMVJGDQZVQGPCDNGVJGYKTGNGUUHWPEVKQP+H[QWFQ PQVYCPVVQWUGYKTGNGUUWPEJGEMVJGDQZVQFKUCDNGCNNVJG wireless functions. 'PCDNG9KTGNGUU Indicates the channel setting for the DIR-615. By default %JCPPGN the channel is set to 6. The Channel can be changed to ĹżVVJGEJCPPGNUGVVKPIHQTCPGZKUVKPIYKTGNGUUPGVYQTMQT to customize the wireless network. The #WVQ %JCPPGN 5GNGEVKQP setting can be selected to allow the DIR-615 to choose the channel with the least amount of interference. 6TCPUOKUUKQP Use the drop-down menu to select the appropriate 4CVG Transmission Rate in Mbits per second. Many users will YCPVVQWUGVJGFGHCWNVUGVVKPIBest (automatic). 9KTGNGUU 5GTXKEG5GV+FGPVKĹżGT 55+& KUVJGPCOGQH[QWTYKTGNGUU 0GVYQTM0COG network. Once created and enabled a name in Multiple 9KTGNGUU0GVYQTM0COG 55+&U YKPFQY[QWOC[UGNGEVHTQOVJGFTQRFQYPOGPW 9//'PCDNG 'PCDNG9K(K/WNVKOGFKCVQGPLQ[DCUKESWCNKV[QHUGTXKEGHGCVWTGU9//RTKQTKVK\GUVTCHĹżECEEQTFKPIVQHQWTCEEGUUECVGIQTKGU XQKEGXKFGQDGUVGHHQTVCPFDCEMITQWPF 'PCDNG*KFFGP Check this option if you would not like the SSID of your wireless network to be broadcasted by the DIR-615. If this option is 9KTGNGUU EJGEMGFVJG55+&QHVJG&+4YKNNPQVDGUGGPD[5KVG5WTXG[WVKNKVKGUUQ[QWTYKTGNGUUENKGPVUYKNNJCXGVQMPQYVJG55+& of your DIR-615 in order to connect to it. D-Link DIR-615 User Manual 26 5GEVKQP%QPĹżIWTCVKQP 1. To enable Enable WPA/WPA2 Wireless Security (enhanced). 0GZV VQ %KRJGT 6[RG UGNGEV TKIP AES or AUTO(TKIP/AES). 3.0GZVVQ25-'#2UGNGEVPSK. 4.0GZVVQ0GVYQTM-G[GPVGTCRCUURJTCUG6JG key is an alpha-numeric password between 8 and 63 characters long. The password can include symbols (!?*&_) and spaces. Make sure you enter VJKU MG[ GZCEVN[ VJG UCOG QP CNN QVJGT YKTGNGUU clients. 5. Click 5CXG5GVVKPIU to save your settings. If you CTGEQPĹżIWTKPIVJGTQWVGTYKVJCYKTGNGUUCFCRVGT [QWYKNNNQUGEQPPGEVKXKV[WPVKN[QWGPCDNG92# 92# QT 92#92# YJKEJGXGT QH VJG VJTGG options you have selected above) on your adapter and enter the same network key as you did on the router. D-Link DIR-615 User Manual 27 5GEVKQP%QPĹżIWTCVKQP 1. To enable Enable WPA/WPA2 Wireless Security (enhanced). 0GZV VQ %KRJGT 6[RG UGNGEV TKIP AES or AUTO(TKIP/AES). 3.0GZVVQ25-'#2UGNGEVEAP. 4.0GZVVQ4#&+755GTXGT+2#FFTGUU enter the IP address of your RADIUS server. 5.0GZVVQ2QTVGPVGTVJGRQTV[QWCTGWUKPIYKVJ[QWT RADIUS server. 1812 is the default port. 6.0GZVVQ5JCTGF5GETGVGPVGTVJGUGEWTKV[MG[ 7. Click 5CXG5GVVKPIU to save your settings. D-Link DIR-615 User Manual 28 5GEVKQP%QPĹżIWTCVKQP 1.6Q GPCDNG 92# 92# QT 92#92# HQT C 4#&+75 UGTXGT PGZV VQ 5GEWTKV[ /QFG select Enable WPA Only Wireless Security (enhanced), Enable WPA2 Only Wireless Security (enhanced), or Enable WPA/WPA2 Wireless Security (enhanced). 0GZV VQ %KRJGT 6[RG UGNGEV TKIP AES or Auto. 3.0GZVVQ25-'#2UGNGEVEAP. 4.0GZVVQ4#&+755GTXGT enter the +2#FFTGUU of your RADIUS server. 5.0GZVVQ2QTVGPVGTVJGRQTV[QWCTGWUKPIYKVJ[QWT RADIUS server. 1812 is the default port. 6.0GZVVQ5JCTGF5GETGVGPVGTVJGUGEWTKV[MG[ 7.+H[QWJCXGCUGEQPFCT[4#&+75UGTXGTGPVGTKVU +2CFFTGUURQTVCPFUGETGVMG[ 8. Click 5CXG5GVVKPIU to save your settings. D-Link DIR-615 User Manual 29 5GEVKQP%QPĹżIWTCVKQP .#05GVWR 6JKUUGEVKQPYKNNCNNQY[QWVQEJCPIGVJGNQECNPGVYQTMUGVVKPIUQHVJGTQWVGTCPFVQEQPĹżIWTGVJG&*%2UGVVKPIU 4QWVGTIP Enter the IP address of the router. The default #FFTGUU IP address is 192.168.0.1. +H [QW EJCPIG VJG +2 CFFTGUU QPEG [QW ENKEM #RRN[[QWYKNNPGGFVQGPVGTVJGPGY+2CFFTGUU KP[QWTDTQYUGTVQIGVDCEMKPVQVJGEQPĹżIWTCVKQP utility. &GHCWNV5WDPGV Enter the Subnet Mask. The default subnet mask /CUM is 255.255.255.0. .QECN&QOCKP Enter the Domain name (Optional). 0COG 'PCDNG&05 %JGEM VJG DQZ VQ VTCPUHGT VJG &05 UGTXGT 4GNC[ information from your ISP to your computers. If WPEJGEMGF[QWTEQORWVGTUYKNNWUGVJGTQWVGT for a DNS server. 4GHGTVQVJGPGZVRCIGHQT&*%2KPHQTOCVKQP D-Link DIR-615 User Manual 30 5GEVKQP%QPĹżIWTCVKQP &*%25GTXGT5GVVKPIU DHCP stands for Dynamic Host Control Protocol. The DIR-615 has a built-in DHCP server. The DHCP Server will automatically assign an IP address to the computers on the LAN/private network. Be sure to set your computers to be DHCP clients by setting their TCP/IP settings to âObtain an IP Address Automatically.â When you turn your computers QPVJG[YKNNCWVQOCVKECNN[NQCFVJGRTQRGT6%2+2 settings provided by the DIR-615. The DHCP Server will automatically allocate an unused IP address from the IP address pool to the requesting computer. You must specify the starting and ending address of the IP address pool. 'PCDNG&*%2 %JGEMVJGDQZVQGPCDNGVJG&*%2UGTXGTQP 5GTXGT your router. Uncheck to disable this function. &*%2+2 Enter the starting and ending IP addresses for #FFTGUU4CPIG the DHCP serverâs IP assignment. &*%2.GCUG The length of time for the IP address lease. 6KOG Enter the Lease time in minutes. D-Link DIR-615 User Manual 31 5GEVKQP%QPĹżIWTCVKQP 6KOGCPF&CVG 6JKUUGEVKQPYKNNCNNQY[QWVQEQPĹżIWTGWRFCVGCPFOCKPVCKPVJGEQTTGEVVKOGQPVJGKPVGTPCNU[UVGOENQEM Time Select the Time Zone from the drop-down5EJGFWNGU section. D-Link DIR-615 User Manual 33 5GEVKQP%QPĹżIWTCVKQP 2QTV(QTYCTFKPI This will allow you to open a single port or a range of ports. 4WNG %JGEMVJGDQZVQGPCDNGFVJGTWNG 0COG Enter a name for the rule. +2#FFTGUU Enter the IP address of the computer on your local network that you want to allow the incoming service to. 5VCTV2QTV Enter the port or ports that you want to open. If 'PF2QTV [QWYCPVVQQRGPQPGRQTVGPVGTVJGUCOGRQTVKP DQVJDQZGU 6TCHĹżE6[RG Select TCPUDPQTAny D-Link DIR-615 User Manual 34 5GEVKQP%QPĹżIWTCVKQP 2QTV/CRRKPI Port Mapping allows you to redirect the LAN ports or SSIDs to WAN connection. 'PCDNG2QTV Tick to enable port mapping function. /CRRKPI +PVGTHCEG This column displays the available LAN port and SSIDs 9#0 Use the drop-down menu to select which WAN %QPPGEVKQP connection will be used for port mapping. D-Link DIR-615 User Manual 35 5GEVKQP%QPĹżIWTCVKQP 50/2 SNMP (Simple Network Management Protocol) is used to monitor and control a network. 50/2#IGPV Click the 'PCDNG radio button to enable a network-management software. 'PCDNG50/2 6JG OCPCIGOGPV CIGPV ECP UGPF CP GXGPV PQVKĹżECVKQP 6TCRU to the management system to identify the occurrence of EQPFKVKQPUUWEJCUVJTGUJQNFVJCVGZEGGFUCRTGFGVGTOKPGF XCNWG6KEMVJGEJGEMDQZVQGPCDNGVJGHWPEVKQP This section allows you to add client community for SNMP #FF access. Click 5CXG#RRN[ to add the community to the %QOOWPKV[ 'ZKUVKPI %QOOWPKV[ UGEVKQP +P VJKU UGEVKQP [QW OC[ remove or edit the community. 0COG Use the drop-down menu to select the community name between 2WDNKE and 2TKXCVG. 2GTOKUUKQPU Use the drop-down menu to select the access right between 4GCFQPN[ and 4GCF9TKVG. &GUVKPCVKQP+2 Enter the destination IP address to launch trap message. #FFTGUU %QOOWPKV[ 7UGVJGFTQRFQYPOGPWVQUGNGEVVJGGZKUVKPIEQOOWPKV[PCOG 5GVVKPIU 8GTUKQP Use the drop-down menu to select between 50/2X and 50/2XE. D-Link DIR-615 User Manual 36 5GEVKQP%QPĹżIWTCVKQP 3Q5'PIKPG The QoS Engine option helps improve your network gaming performance by prioritizing applications. By default the 3Q5'PIKPGUGVVKPIUCTGFKUCDNGFCPFCRRNKECVKQPRTKQTKV[KUPQVENCUUKĹżGFCWVQOCVKECNN[ 'PCDNG3Q5 This option is disabled by default. Enable this option for 'PIKPG DGVVGTRGTHQTOCPEGCPFGZRGTKGPEGYKVJQPNKPGICOGUCPF QVJGTKPVGTCEVKXGCRRNKECVKQPUUWEJCU8Q+2 The speed at which data can be transferred from the router /CPWCN7RNKPM to your ISP. This is determined by your ISP. ISPâs often 5RGGF speed as a download/upload RCKT(QTGZCORNG/DKVU-DKVU7UKPIVJKUGZCORNG you would enter 284. Alternatively you can test your uplink speed with a service such as www.dslreports.com. Connection $[ FGHCWNV VJG TQWVGT CWVQOCVKECNN[ FGVGTOKPGU YJGVJGT 6[RG VJGWPFGTN[KPIEQPPGEVKQPKUCPZ&5.(TCOGTGNC[PGVYQTM or some other connection type (such as cable modem or 'VJGTPGV CPFKVFKURNC[UVJGTGUWNVCU&GVGEVGFZ&5.QT (TCOG4GNC[0GVYQTM+H[QWJCXGCPWPWUWCNPGVYQTMEQPPGEVKQPKPYJKEJ[QWCTGCEVWCNN[EQPPGEVGFXKCZ&5.DWVHQTYJKEJ [QWEQPĹżIWTGGKVJGTĹ5VCVKEĹQTĹ&*%2ĹKPVJG+PVGTPGVUGVVKPIUUGVVKPIVJKUQRVKQPVQZ&5.QT1VJGT(TCOG4GNC[0GVYQTM GPUWTGUVJCVVJGTQWVGTYKNNTGEQIPK\GVJCVKVPGGFUVQUJCRGVTCHĹżEUNKIJVN[FKHHGTGPVN[KPQTFGTVQIKXGVJGDGUVRGTHQTOCPEG Choosing Z&5.QT1VJGT(TCOG4GNC[0GVYQTM causes the measured uplink speed to be reported slightly lower than before QPUWEJEQPPGEVKQPUDWVIKXGUOWEJDGVVGTTGUWNVU &GVGEVGFZ&5. When Connection Type is set to #WVQFGVGEVVJGCWVQOCVKECNN[FGVGEVGFEQPPGEVKQPV[RGKUFKURNC[GFJGTG QT1VJGT(TCOG 4GNC[0GVYQTM D-Link DIR-615 User Manual 37 5GEVKQP%QPĹżIWTCVKQP (KNVGT4WNGU 6JG(KNVGT4WNGUCNNQYU[QWVQEQPĹżIWTG+2QT/#%CFFTGUUQHCPGVYQTMCFCRVGTCPFCNNQYQTFGP[KVUPGVYQTMCEEGUU at certain time. /#%+2 Enter the MAC or IP address of a network #FFTGUU CFCRVGTHQTCĹżNVGTTWNG &GUVKPCVKQP Enter a port or range of ports of TCP or UDP 2QTV HQTVJGĹżNVGTTWNG 6TCHĹżE6[RG 5GNGEVCVTCHĹżEV[RG TCPUDPQTAny) that will DGWUGFHQTVJGĹżNVGTTWNG #EVKQP Use the drop-down menu to select #NNQY or &GP[ the network access. 5EJGFWNG Select #NYC[U VQ CRRN[ HQT VJKU ĹżNVGT TWNG CNN VJGVKOGQTUGNGEVQPGQHVJGUEJGFWNGFVKOG 6JG UEJGFWNGF VKOG UJQWNF DG EQPĹżIWTGF KP /CKPVGPCPEG > 5EJGFWNGU section in advance. D-Link DIR-615 User Manual 38 5GEVKQP%QPĹżIWTCVKQP (KTGYCNN&/< 6JKUUGEVKQPYKNNCNNQY[QWVQUGVWRKPUKFGCPFQWVUKFGĹżTGYCNN6JGQWVUKFGĹżTGYCNNECPEJQQUGXCTKQWUYJKEJRCTV you want to prevernt from. 'PCDNG.#0VQ 6KEMVQGPCDNGVJGĹżTGYCNNHTQO.#0VQ9#0 9#0(KTGYCNN 9#0 5GNGEVVJG9#0%QPPGEVKQP[QWYCPVVQUGVWRVJGĹżTGYCNN %QPPGEVKQP 6KEMVQGPCDNGVJGĹżTGYCNNHTQO9#0VQ.#0 'PCDNG9#0VQ .#0(KTGYCNN Tick &/<'PCDNGEJGEMDQZVQGPCDNG&/<CPFGPVGTCP &/< IP adrees of a computer in the IPĹżGNFVQDGCEEGUUKDNGVQ +PVGTPGVVTCHĹżE &Q5#VVCEM DoS (Denial-of-service) attack makes the computer resources unavailabel for intened users. Tick the 'PCDNG &Q5#VVCEM2TGXGPVKQPEJGEMDQZVQGPCDNGVJGHWPEVKQP CPFVKEMVJGTGUVQHVJGEJGEMDQZGUVQRTGXGPVHTQOXCTKQWU type of DoS attack. 2QUV5ECP Post scan attack targets the opening ports and attacks those #VVCEM ports. Tick the 'PCDNG2QUV5ECP#VVCEM2TGXGPVKQP check DQZVQGPCDNGVJGHWPEVKQPCPFVKEMVJGTGUVQHVJGEJGEM DQZGUVQRTGXGPVHTQOXCTKQWUV[RGQHRQUVUECPCVVCEM 5GTXKEG(KNVGT Service FilterTick the 'PCDNG 5GTXKEG (KNVGT $NQEMKPI EJGEMDQZVQGPCDNGVJGHWPEVKQPCPFVKEMVJGTGUVQHVJG EJGEMDQZGUVQFGP[VJGCEEGUUHTQOXCTKQWUVQQNU D-Link DIR-615 User Manual 39 5GEVKQP%QPĹżIWTCVKQP #FXCPEGF9KTGNGUU This window allows you to change the behavior of the 802.11g wireless radio from the standard settings. Please be aware that any changes to the factory default settings may adversely affect the behavior of your network. 6TCPUOKV Set the transmit power of the antennas. 2QYGT $GCEQP Beacons are packets sent by an Access Point to synchronize KPVGTXCN a wireless network. Specify a value. 100 is the default setting and is recommended. 4656JTGUJQNF This value should remain at its default setting of 2346. If KPEQPUKUVGPVFCVCĆQYKUCRTQDNGOQPN[COKPQTOQFKĹżECVKQP should be made. (TCIOGPVCVKQP 6JGHTCIOGPVCVKQPVJTGUJQNFYJKEJKUURGEKĹżGFKPD[VGU determines whether packets will be fragmented. Packets GZEGGFKPIVJGD[VGUGVVKPIYKNNDGHTCIOGPVGFDGHQTG transmission. 2346 is the default setting. &6+/+PVGTXCN &GNKXGT[6TCHĹżE+PFKECVKQP/GUUCIG 1KUVJGFGHCWNVUGVVKPI#&6+/KUCEQWPVFQYPKPHQTOKPIENKGPVUQHVJGPGZVYKPFQYHQT listening to broadcast and multicast messages. 2TGCODNG6[RG 5GNGEV5JQTVQT.QPI2TGCODNG6JG2TGCODNGFGĹżPGUVJGNGPIVJQHVJG%4%DNQEM %[ENKE4GFWPFCPE[%JGEMKUCEQOOQP technique for detecting data transmission errors) for communication between the wireless router and the roaming wireless PGVYQTMCFCRVGTU#WVQKUVJGFGHCWNVUGVVKPI0QVG*KIJPGVYQTMVTCHĹżECTGCUUJQWNFWUGVJGUJQTVGTRTGCODNGV[RG %65/QFG CTS (Clear To Send) is a function used to minimize collisions among wireless devices on a wireless local area network (LAN). CTS will make sure the wireless network is clear before a wireless client attempts to send wireless data. Enabling CTS will add overhead and may lower wireless through put. 0QPG CTS is typically used in a pure 802.11g environment. If CTS is UGVVQĹ0QPGĹKPCOKZGFOQFGGPXKTQPOGPVRQRWNCVGFD[DENKGPVUYKTGNGUUEQNNKUKQPUOC[QEEWTHTGSWGPVN[#NYC[U CTS will always be used to make sure the wireless LAN is clear before sending data. #WVQ CTS will monitor the wireless PGVYQTMCPFCWVQOCVKECNN[FGEKFGYJGVJGTVQKORNGOGPV%65DCUGFQPVJGCOQWPVQHVTCHĹżECPFEQNNKUKQPUVJCVQEEWTUQP the wireless network. D-Link DIR-615 User Manual 40 5GEVKQP%QPĹżIWTCVKQP 9KTGNGUU/QFG Select one of the following: P1PN[ - Select only if all of your wireless clients are 802.11n. /KZGF ID - Select if you are using both 802.11b and 802.11g wireless clients. /KZGF PID 5GNGEVKH[QWCTGWUKPICOKZQHPICPFDYKTGNGUUENKGPVU %JCPPGN9KFVJ Select the Channel Width: /*\ - Select if you are not using any 802.11n wireless clients. This is the default setting. /*\ #WVQ - Select if you are using both 802.11n and non-802.11n wireless devices. 5JQTV)+ %JGEMVJKUDQZVQTGFWEGVJGIWCTFKPVGTXCNVKOGVJGTGHQTGKPETGCUKPIVJGFCVCECRCEKV[*QYGXGTKVĹUNGUUTGNKCDNGCPFOC[ create higher data loss. D-Link DIR-615 User Manual 41 5GEVKQP%QPĹżIWTCVKQP #FXCPEGF0GVYQTM This window allows you to change the LAN settings. Please be aware that any changes to the factory default settings may affect the behavior of your network. 'PCDNG72P2 To use the Universal Plug and Play (UPnPâ˘) HGCVWTG VKEM VJKU EJGEMDQZ 7202 RTQXKFGU EQORCVKDKNKV[YKVJPGVYQTMKPIGSWKROGPVUQHVYCTG and peripherals. 9#02QTV You may set the port speed of the WAN port to 5RGGF 10Mbps100MbpsQT10/100Mbps Auto. Some older cable or DSL modems may require you to set the port speed to 10Mbps. 'PCDNG 6KEMVJGEJGEMDQZVQCNNQYOWNVKECUVVTCHĹżEVQRCUU /WNVKECUV through the router from the Internet. 5VTGCOU 9KTGNGUU 6KEM VJG EJGEM DQZ VQ CNNQY YKTGNGUU OWNVKECUV 'PJCPEG/QFG VTCHĹżEVQRCUUVJTQWIJVJGTQWVGT D-Link DIR-615 User Manual 42 5GEVKQP%QPĹżIWTCVKQP 4QWVKPI 6JKUQRVKQPCNNQYU[QWVQFGĹżPGĹżZGFTQWVGUVQFGĹżPGFFGUVKPCVKQPU 'PCDNG 6KEM VJKU EJGEMDQZ VQ GPCDNG QT FKUCDNG ĹżZGF TQWVGUVQFGĹżPGFFGUVKPCVKQPU +PVGTHCEG Use the drop-down menu to choose the WAN or WAN (Physical Port) Interface the IP packet must use to transit out of the Router. Destination: The IP address of the packets that will take this route. Subnet Mask: The subnet of the IP address of the packets that will take this route. Gateway: 5RGEKĹżGUVJGPGZVJQRVQDGVCMGPKHVJKUTQWVGKU used. D-Link DIR-615 User Manual 43 5GEVKQP%QPĹżIWTCVKQP 64 64 9#0/CPCIGOGPV2TQVQEQN CNNQYUVJGTGOQVGUGTXGTVQEQPPGEVVQVJGFGXKEGCPFEQPĹżIWTGVJGFGXKEG 9JGPWUKPIVJKUHWPEVKQPWUWCNN[VJGTQWVGTPGGFUVQJCXGCRJ[UKECN+2CFFTGUU9KVJ645670[QWECPGXGTP EQPĹżIWTGVJGTQWVGTYJGPKVKUDGJKPF0#6 'PCDNG64 6KEMVJKUEJGEMDQZVQGPCDNG64HWPEVKQP 'PCDNG64 Tick this to enable TR-069 function from LAN (TQO.#0 instead of WAN port. Username: Enter the username for the remote server to be able to login to the router. Password: Enter the password for the remote server to be able to login to the router ACS URL: 'PVGTVJG+2CFFTGUUQH#%5 #WVQEQPĹżIWTCVKQP Server). Default ACS URL: Enter the IP address of default ACS. CPE URL: Enter the IP Address of the CPE (Customerpremises equipment). Periodic Inform 6KEM VJG EJGEM DQZ VQ UGPF VJG KPHQTOCVKQP Enable: periodically. Periodic Infrom The duration for sending the information. Interval: Periodic Inform Configure the specific time and date to start Time: sending the information. D-Link DIR-615 User Manual 44 5GEVKQP%QPĹżIWTCVKQP Enable STUN: 6KEMVJGEJGEMDQZVQGPCDNGVJG5670HWPEVKQPHQT64 STUN Server Enter the IP address of a STUN server. Address: STUN Server Port: Enter the port of the STUN server. STUN Server User Enter the username of the STUN server. Name: STUN Server Enter the password of the STUN server Password: Local Listen Port Enter a port of the router that allow STUN server to get through. D-Link DIR-615 User Manual 45 5GEVKQP%QPĹżIWTCVKQP &GXKEG#FOKPKUVTCVKQP This window will allow you to change the Administrator password. You can also enable Remote Management. #FOKPKUVTCVQT Enter a new password for the Administrator Login Name 2CUUYQTF CPFVJGPTGV[RGVJGPGYRCUUYQTFKPVJG%QPĹżTO2CUUYQTF VGZVDQZ 6JG CFOKPKUVTCVQT ECP OCMG EJCPIGU VQ VJG settings. 7UGT.QIKP Enter a new Login Name for the User account. 0COG 7UGT2CUUYQTF Enter a new password for the User Login Name and then TGV[RGVJGPGYRCUUYQTFKPVJG%QPĹżTO2CUUYQTFVGZVDQZ The administrator can make changes to the settings. 'PCDNG4GOQVG 4GOQVGOCPCIGOGPVCNNQYUVJG&+4VQDGEQPĹżIWTGF /CPCIGOGPV from the Internet by a web browser. A username and password is still required to access the Web-Management KPVGTHCEG+PIGPGTCNQPN[COGODGTQH[QWTPGVYQTMECP browse the built-in web pages to perform Administrator tasks. This feature enables you to perform Administrator tasks from the remote (Internet) host. +2#NNQYGFVQ The Internet IP address of the computer that has access to #EEGUU VJG$TQCFDCPF4QWVGT+H[QWNGCXGVJKUĹżGNFDNCPMQTV[RG 0.0.0.0VJGPCP[EQORWVGTYKNNDGCDNGVQCEEGUUVJG4QWVGT This would present a security risk and is not recommended. 2QTV 6JGRQTVPWODGTWUGFVQCEEGUUVJG&+4(QTGZCORNG JVVRZZZZYJGTGCUZZZZKUVJG9#0+2CFFTGUU of the DIR-615 and 8080 is the port used for the Web-Management interface. 'PCDNG4GOQVG 6KEMVJKUEJGEMDQZVQCNNQYVJGTGOQVG55*VQDGCDNGVQEQPĹżIWTG&+4 55* D-Link DIR-615 User Manual 46 5GEVKQP%QPĹżIWTCVKQP 4GOQVG%QPVTQN 'PVGTC+2CFFTGUUVJCVVJGTGOQVG55*YKVJVJKU+2CFFTGUUECPCEEGUUVJGTQWVGT+H[QWNGCXGVJKUĹżGNFDNCPMQTV[RG0.0.0.0 +2#FFTGUU then any computer will be able to access the Router. This would present a security risk and is not recommended. 2QTV The port number used to access the DIR-615. 'PCDNG4GOQVG 6KEMVJKUEJGEMDQZVQCNNQYVJGTGOQVG6GNPGVVQDGCDNGVQEQPĹżIWTG&+4 6GNPGV 4GOQVG%QPVTQN 'PVGTC+2CFFTGUUVJCVVJGTGOQVG6GNPGVYKVJVJKU+2CFFTGUUECPCEEGUUVJGTQWVGT+H[QWNGCXGVJKUĹżGNFDNCPMQTV[RG +2#FFTGUU VJGPCP[EQORWVGTYKNNDGCDNGVQCEEGUUVJG4QWVGT6JKUYQWNFRTGUGPVCUGEWTKV[TKUMCPFKUPQVTGEQOOGPFGF D-Link DIR-615 User Manual 47 5GEVKQP%QPĹżIWTCVKQP 5CXGCPF4GUVQTG 6JKUYKPFQYCNNQYU[QWVQUCXG[QWTEQPĹżIWTCVKQPĹżNGVQCJCTFFTKXGNQCFEQPĹżIWTCVKQPUGVVKPIUHTQOCJCTFFTKXG and restore the Routerâs factory default settings. 5CXG5GVVKPIU Use this option to save the current router VQ.QECN*CTF EQPĹżIWTCVKQPUGVVKPIUVQCĹżNGQPVJGJCTFFKUMQHVJG &TKXG EQORWVGT[QWCTGWUKPI(KTUVENKEMVJG5CXG button. ;QWYKNNVJGPUGGCĹżNGFKCNQIYJGTG[QWECPUGNGEV CNQECVKQPCPFĹżNGPCOGHQTVJGUGVVKPIU .QCF5GVVKPIU Use this option to load previously saved router HTQO.QECN EQPHKIWTCVKQP UGVVKPIU (KTUV WUG VJG $TQYUG *CTF&TKXG EQPVTQNVQĹżPFCRTGXKQWUN[UCXGĹżNGQHEQPĹżIWTCVKQP UGVVKPIU6JGPENKEMVJG7RNQCF5GVVKPIUbutton to transfer those settings to the Router. 4GUVQTGVQ 6JKU QRVKQP YKNN TGUVQTG CNN EQPĹżIWTCVKQP UGVVKPIU (CEVQT[&GHCWNV back to the settings that were in effect at the time 5GVVKPIU the router was shipped from the factory. Any settings VJCVJCXGPQVDGGPUCXGFYKNNDGNQUVKPENWFKPICP[ rules that you have created. If you want to save the EWTTGPVTQWVGTEQPĹżIWTCVKQPUGVVKPIUWUGVJG5CXG button above. 4GDQQVU Click the 4GDQQV button on the left side of the window to restart the Router. D-Link DIR-615 User Manual 48 5GEVKQP%QPĹżIWTCVKQP (KTOYCTG7RFCVG ;QWECPWRITCFGVJGĹżTOYCTGQHVJG4QWVGTJGTG/CMGUWTGVJGĹżTOYCTG[QWYCPVVQWUGKUQPVJGNQECNJCTFFTKXGQH the computer. Click on $TQYUGVQNQECVGVJGĹżTOYCTGĹżNGVQDGWUGFHQTVJGWRFCVG2NGCUGEJGEMVJG&.KPMUWRRQTV UKVGHQTĹżTOYCTGWRFCVGUCVJVVRUWRRQTVFNKPMEQO;QWECPFQYPNQCFĹżTOYCTGWRITCFGUVQ[QWTJCTFFTKXGHTQOVJG D-Link support site. (KTOYCTG Click the %JGEM0QY button (or the link at the top 7RITCFG QH VJG YKPFQY VQ ĹżPF QWV KH VJGTG KU CP WRFCVGF ĹżTOYCTGKHUQFQYPNQCFVJGPGYĹżTOYCTGVQ[QWT hard drive. $TQYUG #HVGT [QW JCXG FQYPNQCFGF VJG PGY ĹżTOYCTG click $TQYUGKPVJKUYKPFQYVQNQECVGVJGĹżTOYCTG update on your hard drive. Click 5CXG5GVVKPIU to EQORNGVGVJGĹżTOYCTGWRITCFG D-Link DIR-615 User Manual 49 5GEVKQP%QPĹżIWTCVKQP &&055GVVKPI The router supports DDNS (Dynamic Domain Name Service). The Dynamic DNS service allows a dynamic public IP CFFTGUUVQDGCUUQEKCVGFYKVJCUVCVKEJQUVPCOGKPCP[QHVJGOCP[FQOCKPUCNNQYKPICEEGUUVQCURGEKĹżGFJQUVHTQO various locations on the Internet. This is enabled to allow remote access to a host by clicking a hyperlinked URL in the HQTOĹJQUVPCOGF[PFPUQTIĹ/CP[+52UCUUKIPRWDNKE+2CFFTGUUGUWUKPI&*%2VJKUECPOCMGKVFKHĹżEWNVVQNQECVG CURGEKĹżEJQUVQPVJG.#0WUKPIUVCPFCTF&05+HHQTGZCORNG[QWCTGTWPPKPICRWDNKEYGDUGTXGTQT820UGTXGTQP [QWT.#0VJKUGPUWTGUVJCVVJGJQUVECPDGNQECVGFHTQOVJG+PVGTPGVKHVJGRWDNKE+2CFFTGUUEJCPIGU&&05TGSWKTGU that an account be setup with one of the supported DDNS providers. 'PCDNG&&05 6KEMVJG'PCDNG&&05EJGEMDQZVQGPCDNGUWRRQTV for DDNS. 5GTXGT Select one of the DDNS registration organizations #FFTGUU form those listed in the pull-down menu. Available servers include dlinkddns.com(Free), DynDns. org(Custom), Dyn.Dns.org(free), and Dyn.Dns. org(Static). *QUV0COG Enter the host name of the DDNS server. 7UGTPCOG Enter the username given to you by your DDNS server. 2CUUYQTF Enter the password or key given to you by your DDNS server. D-Link DIR-615 User Manual 50 5GEVKQP%QPĹżIWTCVKQP 5[UVGO%JGEM This tool is used to verify the physical connectivity on both the LAN and the WAN interfaces. The Ping Test can be used to test the status of the Internet. 8KTVWCN%CDNG VCT is an advanced feature that integrates a 6GUVGT 8%6 LAN cable tester on every Ethernet port on the +PHQ router. Through the graphical user interface )7+ 8%6 ECP DG WUGF VQ TGOQVGN[ FKCIPQUG CPF TGRQTV ECDNG HCWNVU UWEJ CU QRGPU UJQTVU UYCRU CPF KORGFCPEG OKUOCVEJ 6JKU HGCVWTG UKIPKĹżECPVN[TGFWEGUUGTXKEGECNNUCPFTGVWTPUD[ allowing users to easily troubleshoot their cable connections. 2KPI6GUV The Ping Test is used to send Ping packets to test if a computer is on the Internet. Enter the IP #FFTGUUVJCV[QWYKUJVQ2KPICPFENKEMPing. D-Link DIR-615 User Manual 51 5GEVKQP%QPĹżIWTCVKQP 5EJGFWNGU 6JG4QWVGTCNNQYUVJGWUGTVJGCDKNKV[VQOCPCIGUEJGFWNGTWNGUHQTXCTKQWUĹżTGYCNNCPFRCTGPVCNEQPVTQNHGCVWTGUQP VJKUYKPFQY1PEG[QWJCXGĹżPKUJGFEQPĹżIWTKPIVJGPGYUEJGFWNGTWNGENKEMVJG5CXG5GVVKPIU button at the top of the window. 0COG Enter a name for the new schedule rule. &C[ U %JQQUG VJG FGUKTGF FC[ U GKVJGT #NN 9GGM QT 5GNGEV&C[U+HVJGNCVVGTKUUGNGEVGFRNGCUGWUGVJG EJGEMDQZGUFKTGEVN[DGNQYVQURGEKH[VJGKPFKXKFWCN days. #NN&C[JTU 6KEMVJKUEJGEMDQZKHVJGPGYUEJGFWNGTWNGCRRNKGU to the full 24-hour period. 5VCTV6KOG If the new schedule rule does not apply to the full 'PF6KOG JQWTRGTKQFWPVKEMVJGRTGXKQWUEJGEMDQZCPF VJGPGPVGTCURGEKĹżEDGIKPPKPICPFGPFKPIVKOG D-Link DIR-615 User Manual 52 5GEVKQP%QPĹżIWTCVKQP .QI5GVVKPIU 6JGU[UVGONQIFKURNC[UEJTQPQNQIKECNGXGPVNQIFCVCURGEKĹżGFD[VJGTQWVGTWUGT;QWOC[CNUQUCXGCUKORNGVGZVĹżNG containing the log to your computer. Click the 5CXGDWVVQPCPFHQNNQYVJGRTQORVUVQUCXGVJGĹżNG 5CXG.QI(KNG Click on the 5CXG button link on this window to UCXGVJGNQIĹżNGVQ[QWTNQECNJCTFFTKXG 5[UNQI5GTXGT ENKEMVJGEJGEMDQZVQUCXGVJGNQIKPVJGNQIUGTXGT in the LAN side. .QI6[RG %NKEMVJGEJGEMDQZ GU QHVJGV[RGQHNQIKPHQTOCVKQP .GXGN requested: Ĺ5[UVGO(KTGYCNN5GEWTKV[4QWVGT 5VCVWU%TKVKECN9CTPKPICPF+PHQTOCVKQPĹ 5GPFD[/CKN Enter the your SNTP server name(or IP address) and enter your mail address before sending your system log by mail. D-Link DIR-615 User Manual 53 5GEVKQP%QPĹżIWTCVKQP &GXKEG+PHQ 6JKU YKPFQY FKURNC[U VJG EWTTGPV KPHQTOCVKQP HQT VJG &+4 +V YKNN FKURNC[ VJG .#0 9#0 CPF 9KTGNGUU information. If your WAN connection is set up for a Dynamic IP address then a &*%2 4GNGCUG button and a &*%2 4GPGY button will be displayed. Use &*%24GNGCUG to disconnect from your ISP and use &*%24GPGY to connect to your ISP. +H [QWT 9#0 EQPPGEVKQP KU UGV WR HQT 222Q' C Connect button and a &KUEQPPGEV button will be displayed. Use &KUEQPPGEV to drop the PPPoE connection and use Connect to establish the PPPoE connection. .#0 Displays the MAC address and the private (local) IP settings for the router. 9#0 Displays the MAC address and the public IP settings for the router. 9KTGNGUUDisplays the wireless MAC address and your 0 YKTGNGUU UGVVKPIU UWEJ CU 55+& %JCPPGN CPF Encryption status. D-Link DIR-615 User Manual 54 5GEVKQP%QPĹżIWTCVKQP Log This window allows you to view a log of activities on the Router. This is especially helpful detecting unauthorized network usage. (KTUV2CIG 8KGYVJGĹżTUVRCIGQHVJGNQI .CUV2CIG View the last page of the log. 2TGXKQWU View the previous page. 0GZV 8KGYVJGPGZVRCIG %NGCT Clear the log. Link to Log Click this button to go directly to the Log Settings 5GVVKPIU window (/CKPVGPCPEG > .QI5GVVKPIU). D-Link DIR-615 User Manual 55 5GEVKQP%QPĹżIWTCVKQP 5VCVKUVKEU 6JGYKPFQYDGNQYFKURNC[UVJG6TCHĹżE5VCVKUVKEU*GTG[QWECPXKGYVJGCOQWPVQHRCEMGVUVJCVRCUUVJTQWIJVJG&+4 QPDQVJVJG9#0CPFVJG.#0RQTVU6JGVTCHĹżEEQWPVGTYKNNTGUGVKHVJGFGXKEGKUTGDQQVGF #EVKXG5GUUKQP The NAPT Active Session table displays a list of all active conversations between WAN computers and LAN computers. D-Link DIR-615 User Manual 56 5GEVKQP%QPĹżIWTCVKQP 9KTGNGUU The wireless client table displays a list of current connected wireless clients. This table also displays the connection time and MAC address of the connected wireless client. D-Link DIR-615 User Manual 57 5GEVKQP%QPĹżIWTCVKQP *GNR Click the desired hyperlink to get more information about how to use the Router. D-Link DIR-615 User Manual 58 Section 4 - Security 9KTGNGUU5GEWTKV[ This section will show you the different levels of security you can use to protect your data from intruders. The DIR-615 offers the following types of security: Ĺ92# 9K(K2TQVGEVGF#EEGUU Ĺ92# 9K(K2TQVGEVGF#EEGUU Ĺ9'2 9KTGF'SWKXCNGPV2TKXCE[ Ĺ92#25- 2TG5JCTGF-G[ Ĺ92#25- 2TG5JCTGF-G[ 9JCVKU9'2! WEP stands for Wired Equivalent Privacy. It is based on the IEEE 802.11 standard and uses the RC4 encryption algorithm. WEP provides security by encrypting data over your wireless network so that it is protected as it is transmitted from one wireless device to another. 6QICKPCEEGUUVQC9'2PGVYQTM[QWOWUVMPQYVJGMG[6JGMG[KUCUVTKPIQHEJCTCEVGTUVJCV[QWETGCVG9JGP WUKPI9'2[QWOWUVFGVGTOKPGVJGNGXGNQHGPET[RVKQP6JGV[RGQHGPET[RVKQPFGVGTOKPGUVJGMG[NGPIVJDKV GPET[RVKQPTGSWKTGUCNQPIGTMG[VJCPDKVGPET[RVKQP-G[UCTGFGĹżPGFD[GPVGTKPIKPCUVTKPIKP*': JGZCFGEKOCN WUKPIEJCTCEVGTU#( QT#5%++ #OGTKECP5VCPFCTF%QFGHQT+PHQTOCVKQP+PVGTEJCPIGĹCNRJCPWOGTKEEJCTCEVGTU format. ASCII format is provided so you can enter a string that is easier to remember. The ASCII string is converted to *':HQTWUGQXGTVJGPGVYQTM(QWTMG[UECPDGFGĹżPGFUQVJCV[QWECPEJCPIGMG[UGCUKN[ D-Link DIR-615 User Manual 59 Section 4 - Security %QPĹżIWTG9'2 It is recommended to enable encryption on your wireless router before your wireless network adapters. Please establish wireless connectivity before enabling encryption. Your wireless signal may degrade when enabling encryption due to the added overhead. 1. .QIKPVQVJGYGDDCUGFEQPĹżIWTCVKQPD[QRGPKPICYGDDTQYUGTCPFGPVGTKPIVJG+2CFFTGUUQHVJGTQWVGT Click on9KTGNGUU5GVWR on the left side. 0GZVVQ5GEWTKV[/QFGUGNGEVEnable WEP Wireless Security (basic). 3. 0GZV VQ #WVJGPVKECVKQP UGNGEV GKVJGT Shared Key or Open. Shared Key is recommended as it provides greater security when WEP is enabled. 4. Select either 64Bit or 128Bit encryption from the drop-down OGPWPGZVVQ9'2'PET[RVKQP. 5. 0GZVVQ&GHCWNV-G[6[RGUGNGEVWEP Key 1 and enter a WEP MG[VJCV[QWETGCVG/CMGUWTG[QWGPVGTVJKUMG[GZCEVN[QP all your wireless devices. You may enter up to four different keys either using Hex or ASCII. Hex is recommended (letters A-F and numbers 0-9 are valid). In ASCII all numbers and letters are valid. 6. Click 5CXG5GVVKPIUVQUCXG[QWTUGVVKPIU+H[QWCTGEQPĹżIWTKPIVJGTQWVGTYKVJCYKTGNGUUCFCRVGT[QWYKNNNQUG connectivity until you enable WEP on your adapter and enter the same WEP key as you did on the router. D-Link DIR-615 User Manual 60 Section 4 - Security 9JCVKU92#! 92#QT9K(K2TQVGEVGF#EEGUUKUC9K(KUVCPFCTFVJCVYCUFGUKIPGFVQKORTQXGVJGUGEWTKV[HGCVWTGUQH9'2 9KTGF Equivalent Privacy). 6JGVYQOCLQTKORTQXGOGPVUQXGT9'2 Ĺ+ORTQXGFFCVCGPET[RVKQPVJTQWIJVJG6GORQTCN-G[+PVGITKV[2TQVQEQN 6-+2 6-+2UETCODNGUVJGMG[U WUKPICJCUJKPICNIQTKVJOCPFD[CFFKPICPKPVGITKV[EJGEMKPIHGCVWTGGPUWTGUVJCVVJGMG[UJCXGPĹV been tampered with. WPA2 is based on 802.11i and uses Advanced Encryption Standard (AES) instead QH6-+2 Ĺ7UGTCWVJGPVKECVKQPYJKEJKUIGPGTCNN[OKUUKPIKP9'2VJTQWIJVJGGZVGPUKDNGCWVJGPVKECVKQPRTQVQEQN '#2 9'2 TGIWNCVGU CEEGUU VQ C YKTGNGUU PGVYQTM DCUGF QP C EQORWVGTĹU JCTFYCTGURGEKĹżE /#% CFFTGUUYJKEJKUTGNCVKXGN[UKORNGVQDGUPKHHGFQWVCPFUVQNGP'#2KUDWKNVQPCOQTGUGEWTGRWDNKEMG[ encryption system to ensure that only authorized network users can access the network. 92#25-92#25-WUGUCRCUURJTCUGQTMG[VQCWVJGPVKECVG[QWTYKTGNGUUEQPPGEVKQP6JGMG[KUCPCNRJCPWOGTKE password between 8 and 63 characters long. The password can include symbols (!?*&_) and spaces. This key must DGVJGGZCEVUCOGMG[GPVGTGFQP[QWTYKTGNGUUTQWVGTQTCEEGUURQKPV 92#92#KPEQTRQTCVGUWUGTCWVJGPVKECVKQPVJTQWIJVJG'ZVGPUKDNG#WVJGPVKECVKQP2TQVQEQN '#2 '#2KUDWKNVQPC more secure public key encryption system to ensure that only authorized network users can access the network. D-Link DIR-615 User Manual 61 Section 4 - Security %QPĹżIWTG92#25-CPF92#25It is recommended to enable encryption on your wireless Router before your wireless network adapters. Please establish wireless connectivity before enabling encryption. Your wireless signal may degrade when enabling encryption due to the added overhead. 1. .QIKPVQVJGYGDDCUGFEQPĹżIWTCVKQPD[QRGPKPICYGDDTQYUGT and entering the IP address of the router (192.168.0.1). Click on 9KTGNGUU5GVWR on the left side. 0GZV VQ 5GEWTKV[ /QFG UGNGEV Enable WPA Only Wireless Security (enhanced) or Enable WPA2 Only Wireless Security (enhanced). 3.0GZVVQ%KRJGT/QFGUGNGEVTKIP AES or Both. 4.0GZVVQ25-'#2UGNGEVPSK. 5.0GZVVQ0GVYQTM-G[GPVGTCMG[ RCUURJTCUG 6JGMG[KUCP alpha-numeric password between 8 and 63 characters long. The password can include symbols (!?*&_) and spaces. Make sure you enter VJKUMG[GZCEVN[VJGUCOGQPCNNQVJGTYKTGNGUUENKGPVU 6. Click 5CXG5GVVKPIUVQUCXG[QWTUGVVKPIU+H[QWCTGEQPĹżIWTKPI VJG4QWVGTYKVJCYKTGNGUUCFCRVGT[QWYKNNNQUGEQPPGEVKXKV[WPVKN[QWGPCDNG92#25-QT92#25-QP[QWT adapter and enter the same passphrase as you did on the Router. D-Link DIR-615 User Manual 62 Section 4 - Security %QPĹżIWTG92#92#25It is recommended to enable encryption on your wireless Router before your wireless network adapters. Please establish wireless connectivity before enabling encryption. Your wireless signal may degrade when enabling encryption due to the added overhead. 1. .QIKPVQVJGYGDDCUGFEQPĹżIWTCVKQPD[QRGPKPICYGDDTQYUGT and entering the IP address of the router (192.168.0.1). Click on 9KTGNGUU5GVWR on the left side. 0GZV VQ 5GEWTKV[ /QFG UGNGEV Enable WPA/WPA2 Wireless Security (enhanced). 3.0GZVVQ%KRJGT/QFGUGNGEVTKIP AES or Both. 4.0GZVVQ25-'#2UGNGEVPSK. 5.0GZVVQ0GVYQTM-G[GPVGTCMG[ RCUURJTCUG 6JGMG[KUCPCNRJCPWOGTKERCUUYQTF between 8 and 63 characters long. The password can include symbols (!?*&_) and spaces. /CMGUWTG[QWGPVGTVJKUMG[GZCEVN[VJGUCOGQPCNNQVJGTYKTGNGUUENKGPVU 6. Click 5CXG5GVVKPIUVQUCXG[QWTUGVVKPIU+H[QWCTGEQPĹżIWTKPIVJG4QWVGTYKVJCYKTGNGUUCFCRVGT[QWYKNNNQUG EQPPGEVKXKV[WPVKN[QWGPCDNG92#92#25-QP[QWTCFCRVGTCPFGPVGTVJGUCOGRCUURJTCUGCU[QWFKFQPVJG Router. D-Link DIR-615 User Manual 63 Section 4 - Security %QPĹżIWTG92#92#CPF92#92# 4#&+75 It is recommended to enable encryption on your wireless router before your wireless network adapters. Please establish wireless connectivity before enabling encryption. Your wireless signal may degrade when enabling encryption due to the added overhead. 1. .QIKPVQVJGYGDDCUGFEQPĹżIWTCVKQPD[QRGPKPICYGDDTQYUGTCPFGPVGTKPIVJG+2CFFTGUUQHVJGTQWVGT Click on9KTGNGUU5GVVKPIU on the left side. 0GZVVQ5GEWTKV[/QFGUGNGEVEnable WPA Only Wireless Security (enhanced), Enable WPA2 Only Wireless Security (enhanced), or Enable WPA/WPA2 Wireless Security (enhanced). 3.0GZVVQ%KRJGT6[RGUGNGEVTKIPAES or Auto. 4.0GZVVQ25-'#2UGNGEVEAP. 5.0GZVVQ4#&+755GTXGT enter the +2#FFTGUU of your RADIUS server. 6.0GZVVQ2QTVGPVGTVJGRQTV[QWCTGWUKPIYKVJ[QWT RADIUS server. 1812 is the default port. 7.0GZVVQ5JCTGF5GETGVGPVGTVJGUGEWTKV[MG[ 8.+H[QWJCXGCUGEQPFCT[4#&+75UGTXGTGPVGTKVU+2 CFFTGUURQTVCPFUGETGVMG[ 9. Click 5CXG5GVVKPIU to save your settings. D-Link DIR-615 User Manual 64 Section 5 - Connecting to a Wireless Network %QPPGEVVQC9KTGNGUU0GVYQTM 7UKPI9KPFQYUÂŽ XP WindowsÂŽ:2WUGTUOC[WUGVJGDWKNVKPYKTGNGUUWVKNKV[ 5GVVKPIU > %QPVTQN2CPGN. Double-click the +PVGTPGV1RVKQPU Icon. From the 5GEWTKV[VCD click the button to restore the settings to their defaults. Ĺ%NKEMVJGConnection tab and set the dial-up option to Never Dial a Connection. Click the .#05GVVKPIU button. Make sure nothing is checked. Click 1-. Ĺ)QVQVJG#FXCPEGF tab and click the button to restore these settings to their defaults. Click 1- three times. Ĺ%NQUG[QWTYGDDTQYUGT KHQRGP CPFQRGPKV Ĺ#EEGUUVJGYGDOCPCIGOGPV1RGP[QWTYGDDTQYUGTCPFGPVGTVJG+2CFFTGUUQH[QWT&.KPMTQWVGTKPVJGCFFTGUU bar. This should open the login page for your the web management. Ĺ+H[QWUVKNNECPPQVCEEGUUVJGEQPĹżIWTCVKQPWPRNWIVJGRQYGTVQVJGTQWVGTHQTUGEQPFUCPFRNWIDCEMKP9CKV CDQWVUGEQPFUCPFVT[CEEGUUKPIVJGEQPĹżIWTCVKQP+H[QWJCXGOWNVKRNGEQORWVGTUVT[EQPPGEVKPIWUKPICFKHHGTGPV computer. 9JCVECP+FQKH+HQTIQVO[RCUUYQTF! +H[QWHQTIQV[QWTRCUUYQTF[QWOWUVTGUGV[QWTTQWVGT7PHQTVWPCVGN[VJKURTQEGUUYKNNEJCPIGCNN[QWTUGVVKPIUDCEM to the factory defaults. 6QTGUGVVJGTQWVGTNQECVGVJGTGUGVDWVVQP JQNG QPVJGTGCTRCPGNQHVJGWPKV9KVJVJGTQWVGTRQYGTGFQPWUGC paperclip to hold the button down for 10 seconds. Release the button and the router will go through its reboot process. 9CKVCDQWVUGEQPFUVQCEEGUUVJGTQWVGT6JGFGHCWNV+2CFFTGUUKU9JGPNQIIKPIKPVJGWUGTPCOGKU CFOKPCPFNGCXGVJGRCUUYQTFDQZGORV[ D-Link DIR-615 User Manual 91 Section 12 - Troubleshooting 9J[ECPĹV+EQPPGEVVQEGTVCKPUKVGUQTUGPFCPFTGEGKXGGOCKNUYJGPEQPPGEVKPIVJTQWIJO[TQWVGT! +H[QWCTGJCXKPICRTQDNGOUGPFKPIQTTGEGKXKPIGOCKNQTEQPPGEVKPIVQUGEWTGUKVGUUWEJCUG$C[DCPMKPIUKVGUCPF *QVOCKNYGUWIIGUVNQYGTKPIVJG/67KPKPETGOGPVUQHVGP 'ZGVE 0QVG#1.&5. WUGTUOWUVWUG/67QH 6QĹżPFVJGRTQRGT/675K\G[QWĹNNJCXGVQFQCURGEKCNRKPIQHVJGFGUVKPCVKQP[QWĹTGVT[KPIVQIQVQ#FGUVKPCVKQP EQWNFDGCPQVJGTEQORWVGTQTC74. Ĺ%NKEMQP5VCTV and then click 4WP. Ĺ9KPFQYUÂŽCPF/GWUGTUV[RGKPEQOOCPF (WindowsÂŽ06CPF:2WUGTUV[RGKPEOF) and press 'PVGT(or click 1-). Ĺ1PEGVJGYKPFQYQRGPU[QWĹNNPGGFVQFQCURGEKCNRKPI7UGVJGHQNNQYKPIU[PVCZ RKPI=WTN?=H?=N?=/67XCNWG? 'ZCORNGRKPI[CJQQEQOHN D-Link DIR-615 User Manual 92 Section 12 - Troubleshooting ;QWUJQWNFUVCTVCVCPFYQTM[QWTYC[FQYPD[GCEJVKOG1PEG[QWIGVCTGRN[IQWRD[WPVKN[QWIGVC HTCIOGPVGFRCEMGV6CMGVJCVXCNWGCPFCFFVQVJGXCNWGVQCEEQWPVHQTVJGXCTKQWU6%2+2JGCFGTU(QTGZCORNG NGVUUC[VJCVYCUVJGRTQRGTXCNWGVJGCEVWCN/67UK\GYQWNFDGYJKEJKUVJGQRVKOWOHQTVJGPGVYQTM weâre working with (1452+28=1480). 1PEG[QWĹżPF[QWT/67[QWECPPQYEQPĹżIWTG[QWTTQWVGTYKVJVJGRTQRGT/67UK\G To change the MTU rate on your router follow the steps below: Ĺ1RGP[QWTDTQYUGTGPVGTVJG+2CFFTGUUQH[QWTTQWVGT CPFENKEM1-. Ĺ'PVGT[QWTWUGTPCOG CFOKP CPFRCUUYQTF DNCPMD[FGHCWNV %NKEM1-VQGPVGTVJGYGDEQPĹżIWTCVKQP page for the device. Ĺ%NKEMQP5GVWR and then click /CPWCN%QPĹżIWTG. Ĺ6QEJCPIGVJG/67GPVGTVJGPWODGTKPVJG/67ĹżGNFCPFENKEMVJG5CXG5GVVKPIU button to save your settings. Ĺ6GUV [QWT GOCKN +H EJCPIKPI VJG /67 FQGU PQV TGUQNXG VJG RTQDNGO EQPVKPWG EJCPIKPI VJG /67 KP increments of ten. D-Link DIR-615 User Manual 93 #RRGPFKZ#9KTGNGUU$CUKEU 9KTGNGUU$CUKEU D-Link wireless products are based on industry standards to provide easy-to-use and compatible high-speed wireless EQPPGEVKXKV[YKVJKP[QWTJQOGDWUKPGUUQTRWDNKECEEGUUYKTGNGUUPGVYQTMU5VTKEVN[CFJGTKPIVQVJG+'''UVCPFCTF VJG&.KPMYKTGNGUUHCOKN[QHRTQFWEVUYKNNCNNQY[QWVQUGEWTGN[CEEGUUVJGFCVC[QWYCPVYJGPCPFYJGTG[QWYCPV KV;QWYKNNDGCDNGVQGPLQ[VJGHTGGFQOVJCVYKTGNGUUPGVYQTMKPIFGNKXGTU A wireless local area network (WLAN) is a cellular computer network that transmits and receives data with radio signals KPUVGCFQHYKTGU9KTGNGUU.#0UCTGWUGFKPETGCUKPIN[KPDQVJJQOGCPFQHĹżEGGPXKTQPOGPVUCPFRWDNKECTGCUUWEJ CUCKTRQTVUEQHHGGUJQRUCPFWPKXGTUKVKGU+PPQXCVKXGYC[UVQWVKNK\G9.#0VGEJPQNQI[CTGJGNRKPIRGQRNGVQYQTMCPF EQOOWPKECVGOQTGGHĹżEKGPVN[+PETGCUGFOQDKNKV[CPFVJGCDUGPEGQHECDNKPICPFQVJGTĹżZGFKPHTCUVTWEVWTGJCXGRTQXGP VQDGDGPGĹżEKCNHQTOCP[WUGTU Wireless users can use the same applications they use on a wired network. Wireless adapter cards used on laptop and desktop systems support the same protocols as Ethernet adapter cards. 7PFGTOCP[EKTEWOUVCPEGUKVOC[DGFGUKTCDNGHQTOQDKNGPGVYQTMFGXKEGUVQNKPMVQCEQPXGPVKQPCN'VJGTPGV.#0KP QTFGTVQWUGUGTXGTURTKPVGTUQTCP+PVGTPGVEQPPGEVKQPUWRRNKGFVJTQWIJVJGYKTGF.#0#9KTGNGUU4QWVGTKUCFGXKEG used to provide this link. D-Link DIR-615 User Manual 94 #RRGPFKZ#9KTGNGUU$CUKEU 9JCVKU9KTGNGUU! Wireless or Wi-Fi technology is another way of connecting your computer to the network without using wires. Wi-Fi WUGUTCFKQHTGSWGPE[VQEQPPGEVYKTGNGUUN[UQ[QWJCXGVJGHTGGFQOVQEQPPGEVEQORWVGTUCP[YJGTGKP[QWTJQOG QTQHĹżEGPGVYQTM 9J[&.KPM9KTGNGUU? &.KPMKUVJGYQTNFYKFGNGCFGT CPFCYCTFYKPPKPI FGUKIPGT FGXGNQRGT CPF OCPWHCEVWTGT QH PGVYQTMKPI RTQFWEVU D-Link delivers the performance you need at a price you can afford. D-Link has all the products you need to build your network. *QYFQGUYKTGNGUUYQTM! 9KTGNGUUYQTMUUKOKNCTVQJQYEQTFNGUURJQPGYQTMVJTQWIJTCFKQUKIPCNUVQVTCPUOKVFCVCHTQOQPGRQKPV#VQRQKPV B. But wireless technology has restrictions as to how you can access the network. You must be within the wireless network range area to be able to connect your computer. There are two different types of wireless networks Wireless .QECN#TGC0GVYQTM 9.#0 CPF9KTGNGUU2GTUQPCN#TGC0GVYQTM 92#0 9KTGNGUU.QECN#TGC0GVYQTM 9.#0 +PCYKTGNGUUNQECNCTGCPGVYQTMCFGXKEGECNNGFCP#EEGUU2QKPV #2 EQPPGEVUEQORWVGTUVQVJGPGVYQTM6JGCEEGUU RQKPVJCUCUOCNNCPVGPPCCVVCEJGFVQKVYJKEJCNNQYUKVVQVTCPUOKVFCVCDCEMCPFHQTVJQXGTTCFKQUKIPCNU9KVJCP KPFQQTCEEGUURQKPVCUUGGPKPVJGRKEVWTGVJGUKIPCNECPVTCXGNWRVQHGGV9KVJCPQWVFQQTCEEGUURQKPVVJGUKIPCN ECPTGCEJQWVWRVQOKNGUVQUGTXGRNCEGUNKMGOCPWHCEVWTKPIRNCPVUKPFWUVTKCNNQECVKQPUEQNNGIGCPFJKIJUEJQQN ECORWUGUCKTRQTVUIQNHEQWTUGUCPFOCP[QVJGTQWVFQQTXGPWGU D-Link DIR-615 User Manual 95 #RRGPFKZ#9KTGNGUU$CUKEU 9KTGNGUU2GTUQPCN#TGC0GVYQTM 92#0 Bluetooth is the industry standard wireless technology used for WPAN. Bluetooth devices in WPAN operate in a range up to 30 feet away. %QORCTGFVQ9.#0VJGURGGFCPFYKTGNGUUQRGTCVKQPTCPIGCTGDQVJNGUUVJCP9.#0DWVKPTGVWTPKVFQGUPĹVWUG PGCTN[CUOWEJRQYGTYJKEJOCMGUKVKFGCNHQTRGTUQPCNFGXKEGUUWEJCUOQDKNGRJQPGU2UJGCFRJQPGUNCRVQRU URGCMGTUCPFQVJGTFGXKEGUVJCVQRGTCVGQPDCVVGTKGU 9JQWUGUYKTGNGUU! 9KTGNGUUVGEJPQNQI[CUDGEQOGUQRQRWNCTKPTGEGPV[GCTUVJCVCNOQUVGXGT[QPGKUWUKPIKVYJGVJGTKVĹUHQTJQOG QHĹżEGDWUKPGUU&.KPMJCUCYKTGNGUUUQNWVKQPHQTKV Home Ĺ)KXGUGXGT[QPGCVJQOGDTQCFDCPFCEEGUU Ĺ5WTHVJGYGDEJGEMGOCKNKPUVCPVOGUUCIGCPFGVE Ĺ)GVUTKFQHVJGECDNGUCTQWPFVJGJQWUG Ĺ5KORNGCPFGCU[VQWUG 5OCNN1HĹżEGCPF*QOG1HĹżEG Ĺ5VC[QPVQRQHGXGT[VJKPICVJQOGCU[QWYQWNFCVQHĹżEG Ĺ4GOQVGN[CEEGUU[QWTQHĹżEGPGVYQTMHTQOJQOG Ĺ5JCTG+PVGTPGVEQPPGEVKQPCPFRTKPVGTYKVJOWNVKRNGEQORWVGTU Ĺ0QPGGFVQFGFKECVGQHĹżEGURCEG D-Link DIR-615 User Manual 96 #RRGPFKZ#9KTGNGUU$CUKEU 9JGTGKUYKTGNGUUWUGF! 9KTGNGUUVGEJPQNQI[KUGZRCPFKPIGXGT[YJGTGPQVLWUVCVJQOGQTQHĹżEG2GQRNGNKMGVJGHTGGFQOQHOQDKNKV[CPFKVĹU becoming so popular that more and more public facilities now provide wireless access to attract people. The wireless connection in public places is usually called âhotspotsâ. 7UKPIC&.KPM%CTFDWU#FCRVGTYKVJ[QWTNCRVQR[QWECPCEEGUUVJGJQVURQVVQEQPPGEVVQ+PVGTPGVHTQOTGOQVG NQECVKQPUNKMGCKTRQTVUJQVGNUEQHHGGUJQRUNKDTCTKGUTGUVCWTCPVUCPFEQPXGPVKQPEGPVGTU 9KTGNGUUPGVYQTMKUGCU[VQUGVWRDWVKH[QWĹTGKPUVCNNKPIKVHQTVJGĹżTUVVKOGKVEQWNFDGSWKVGCVCUMPQVMPQYKPIYJGTGVQ start. Thatâs why weâve put together a few setup steps and tips to help you through the process of setting up a wireless network. 6KRU *GTGCTGCHGYVJKPIUVQMGGRKPOKPFYJGP[QWKPUVCNNCYKTGNGUUPGVYQTM %GPVTCNK\G[QWTTQWVGTQT#EEGUU2QKPV Make sure you place the router/access point in a centralized location within your network for the best performance. Try VQRNCEGVJGTQWVGTCEEGUURQKPVCUJKIJCURQUUKDNGKPVJGTQQOUQVJGUKIPCNIGVUFKURGTUGFVJTQWIJQWV[QWTJQOG +H[QWJCXGCVYQUVQT[JQOG[QWOC[PGGFCTGRGCVGTVQDQQUVVJGUKIPCNVQGZVGPFVJGTCPIG (QTVJGYKTGNGUUTGRGCVGTVJGTGCTGVYQV[RGUQHTGRGCVGTKP&.KPMHQTWUGTVQUGNGEV 7PKXGTUCNTGRGCVGT+VCEVUCUCP#2CPFCYKTGNGUU56#CVVJGUCOGVKOG+VECPUWRRQTVCNN#2CPFYKTGNGUU56# if they work in the same wireless channel. #2TGRGCVGT #2YKVJ9&5 QPN[TGRGCVUCOGOQFGNQTNKOKVGFOQFGNUYJKEJDCUGQPVJGUCOGRTQRTKGVCT[ protocol. 2NGCUGEJQQUGCWPKXGTUCNTGRGCVGTVQDQQUVVJGUKIPCNVQGZVGPFVJGTCPIG D-Link DIR-615 User Manual 97 #RRGPFKZ#9KTGNGUU$CUKEU 9KTGNGUU/QFGU 'NKOKPCVG+PVGTHGTGPEG 2NCEGJQOGCRRNKCPEGUUWEJCUEQTFNGUUVGNGRJQPGUOKETQYCXGUCPFVGNGXKUKQPUCUHCTCYC[CURQUUKDNGHTQOVJG TQWVGTCEEGUURQKPV6JKUYQWNFUKIPKĹżECPVN[TGFWEGCP[KPVGTHGTGPEGVJCVVJGCRRNKCPEGUOKIJVECWUGUKPEGVJG[QRGTCVG on same frequency. 5GEWTKV[ &QPĹVNGV[QWPGZVFQQTPGKIJDQTUQTKPVTWFGTUEQPPGEVVQ[QWTYKTGNGUUPGVYQTM5GEWTG[QWTYKTGNGUUPGVYQTMD[VWTPKPI on the WPA or WEP security feature on the router. Refer to product manual for detail information on how to set it up. There are basically two modes of networking: Ĺ+PHTCUVTWEVWTGĹ#NNYKTGNGUUENKGPVUYKNNEQPPGEVVQCPCEEGUURQKPVQTYKTGNGUUTQWVGT Ĺ#F*QEĹ&KTGEVN[EQPPGEVKPIVQCPQVJGTEQORWVGTHQTRGGTVQRGGTEQOOWPKECVKQPWUKPIYKTGNGUUPGVYQTM CFCRVGTUQPGCEJEQORWVGTUWEJCUVYQQTOQTG90#YKTGNGUUPGVYQTM%CTFDWUCFCRVGTU #P+PHTCUVTWEVWTGPGVYQTMEQPVCKPUCP#EEGUU2QKPVQTYKTGNGUUTQWVGT#NNVJGYKTGNGUUFGXKEGUQTENKGPVUYKNNEQPPGEV to the wireless router or access point. #P#F*QEPGVYQTMEQPVCKPUQPN[ENKGPVUUWEJCUNCRVQRUYKVJYKTGNGUUECTFDWUCFCRVGTU#NNVJGCFCRVGTUOWUVDGKP Ad-Hoc mode to communicate. D-Link DIR-615 User Manual 98 #RRGPFKZ$0GVYQTMKPI$CUKEU 0GVYQTMKPI$CUKEU %JGEM[QWT+2CFFTGUU #HVGT[QWKPUVCNN[QWTPGY&.KPMCFCRVGTD[FGHCWNVVJG6%2+2UGVVKPIUUJQWNFDGUGVVQQDVCKPCP+2CFFTGUUHTQO C&*%2UGTXGT KGYKTGNGUUTQWVGT CWVQOCVKECNN[6QXGTKH[[QWT+2CFFTGUURNGCUGHQNNQYVJGUVGRUDGNQY Click on 5VCTV > 4WP+PVJGTWPDQZV[RGcmd and click 1-. #VVJGRTQORVV[RGipconďŹg and press 'PVGT. 6JKUYKNNFKURNC[VJG+2CFFTGUUUWDPGVOCUMCPF the default gateway of your adapter. +H VJG CFFTGUU KU EJGEM [QWT CFCRVGT KPUVCNNCVKQP UGEWTKV[ UGVVKPIU CPF VJG UGVVKPIU QP[QWTTQWVGT5QOGĹżTGYCNNUQHVYCTGRTQITCOU may block a DHCP request on newly installed adapters. If you are connecting to a wireless network at a JQVURQV GIJQVGNEQHHGGUJQRCKTRQTV RNGCUGEQPVCEVCPGORNQ[GGQTCFOKPKUVTCVQTVQXGTKH[VJGKTYKTGNGUUPGVYQTM settings. D-Link DIR-615 User Manual 99 #RRGPFKZ$0GVYQTMKPI$CUKEU 5VCVKECNN[#UUKIPCP+2CFFTGUU +H[QWCTGPQVWUKPIC&*%2ECRCDNGICVGYC[TQWVGTQT[QWPGGFVQCUUKIPCUVCVKE+2CFFTGUURNGCUGHQNNQYVJGUVGRU below: 5VGR WindowsÂŽ XP - Click on 5VCTV > %QPVTQN2CPGN > 0GVYQTM%QPPGEVKQPU. WindowsÂŽ(TQOVJGFGUMVQRTKIJVENKEM/[0GVYQTM2NCEGU > 2TQRGTVKGU. 5VGR Right-click on the .QECN#TGC%QPPGEVKQP which represents your D-Link network adapter and select 2TQRGTVKGU. 5VGR Highlight +PVGTPGV2TQVQEQN 6%2+2 and click 2TQRGTVKGU. 5VGR Click 7UGVJGHQNNQYKPI+2CFFTGUU and enter an IP address that is on the same subnet as your network or the LAN IP address on your router. 'ZCORNG +H VJG TQWVGTyU .#0 +2 CFFTGUU KU OCMG [QWT +2 CFFTGUU 192.168.0.X where X is a number between 2 and 99. Make sure that the number you choose is not in use on the network. Set Default Gateway the same as the LAN IP address of your router (192.168.0.1). Set Primary DNS the same as the LAN IP address of your router (192.168.0.1). The Secondary DNS is not needed or you may enter a DNS server from your ISP. 5VGR Click 1- twice to save your settings. D-Link DIR-615 User Manual 100 #RRGPFKZ%6GEJPKECN5RGEKĹżECVKQPU 6GEJPKECN5RGEKĹżECVKQPU 5VCPFCTFU Ĺ+'''I Ĺ+'''D Ĺ+'''PFTCHV Ĺ+''' Ĺ+'''W Ĺ 9KTGNGUU5KIPCN4CVGU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU 5GEWTKV[ Ĺ92#9K(K2TQVGEVGF#EEGUU 6-+2/+% +8'ZRCPUKQP5JCTGF-G[#WVJGPVKECVKQP ĹZ ĹDKV9'2 Ĺ2+02$%925 /QFWNCVKQP6GEJPQNQI[ D&555&$25-&325-%%I3#/3#/$25-325-YKVJ1(&/ P3#/3#/$25-325-YKVJ1(&/ D-Link DIR-615 User Manual 4GEGKXGT5GPUKVKXKV[ 802.11n HT20 Ĺ/DRU1(&/2'4ĹF$O HT40 Ĺ/DRU1(&/2'4ĹF$O 802.11b and 802.11g Ĺ/DRU1(&/2'4F$O Ĺ/DRU1(&/2'4F$O Ĺ/DRU1(&/2'4F$O Ĺ/DRU1(&/2'4F$O Ĺ/DRU1(&/2'4F$O Ĺ/DRU1(&/2'4F$O Ĺ/DRU%%-2'4F$O Ĺ/DRU1(&/2'4F$O Ĺ/DRU1(&/2'4F$O Ĺ/DRU%%-2'4F$O Ĺ/DRU&325-2'4F$O Ĺ/DRU&$25-2'4F$O 8202CUU6JTQWIJ/WNVK5GUUKQPU Ĺ2262 Ĺ+25GE &GXKEG/CPCIGOGPV Ĺ9GDDCUGF+PVGTPGV'ZRNQTGTXQTNCVGT0GVUECRG0CXKICVQT XQTNCVGTQTQVJGT,CXCGPCDNGFDTQYUGTU Ĺ&*%25GTXGTCPF%NKGPV 101 #RRGPFKZ%6GEJPKECN5RGEKĹżECVKQPU 9KTGNGUU(TGSWGPE[4CPIG 2.4GHz to 2.497GHz (802.11b) 2.4GHz to 2.4835GHZ (802.11g and 802.11n) Wireless Operating Range2 Ĺ+PFQQTUWRVQHV OGVGTU Ĺ1WVFQQTUWRVQHV OGVGTU 9KTGNGUU6TCPUOKV2QYGT #8)2QYGT DF$O /CZ IF$O /CZ PF$O /CZ 5CHGV[CPF'OKUUKQPU FCC Part 15B/ 15C/ MPE IC RSS-210 NCC LP0002 .'&U Ĺ2QYGT Ĺ5VCVWU Ĺ+PVGTPGV Ĺ9.#0 9KTGNGUU%QPPGEVKQP Ĺ.#0 'ZVGTPCN#PVGPPC6[RG 6YQĹżZGFTGXGTUG5/#GZVGTPCNCPVGPPC &KOGPUKQPU Ĺ.OO #FXCPEGF(KTGYCNN(GCVWTGU Ĺ9OO Ĺ0#6YKVJ8202CUUVJTQWIJ 0GVYQTM#FFTGUU6TCPUNCVKQP Ĺ*OO Ĺ/#%(KNVGTKPI Ĺ+2(KNVGTKPI Weight Ĺ74.(KNVGTKPI 0.246kg Ĺ&QOCKP$NQEMKPI Ĺ5EJGFWNKPI 1RGTCVKPI6GORGTCVWTG 32°F to 129 °F ( 0°C to 40°C) *WOKFKV[ OCZKOWO PQPEQPFGPUKPI /CZKOWOYKTGNGUUUKIPCNTCVGFGTKXGFHTQO+'''5VCPFCTFDICPFPURGEKĹżECVKQPU#EVWCNFCVCVJTQWIJRWVYKNNXCT[0GVYQTM EQPFKVKQPUCPFGPXKTQPOGPVCNHCEVQTUKPENWFKPIXQNWOGQHPGVYQTMVTCHĹżEDWKNFKPIOCVGTKCNUCPFEQPUVTWEVKQPCPFPGVYQTMQXGTJGCFNQYGTCEVWCN data throughput rate. Environmental factors will adversely affect wireless signal range. D-Link DIR-615 User Manual 102 
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf Linearized : No Page Count : 106 PDF Version : 1.6 Has XFA : No XMP Toolkit : XMP toolkit 2.9.1-14, framework 1.6 About : uuid:012b3e6b-2ffc-4016-b98f-cca4e0ce2a4b Modify Date : 2009:09:08 20:47:18+08:00 Create Date : 2009:09:08 20:44:43+08:00 Metadata Date : 2009:09:08 20:47:18+08:00 Document ID : uuid:cdd2e44e-1d77-4b66-9ef5-d99725e915bd Format : application/pdf Title : untitled Producer : Acrobat Distiller 6.0.1 (Windows)EXIF Metadata provided by EXIF.tools