D Link IR652A1 XTreme N Gigabit Home Router User Manual User s manual
D Link Corporation XTreme N Gigabit Home Router User s manual
D Link >
Contents
- 1. User Manual Part 1
- 2. User Manual Part 2
User Manual Part 2
| Download: |  |
| Mirror Download [FCC.gov] | |
| Document ID | 1315443 |
| Application ID | MGqXZHrOa9IldN6C1CCUvw== |
| Document Description | User Manual Part 2 |
| Short Term Confidential | No |
| Permanent Confidential | No |
| Supercede | No |
| Document Type | User Manual |
| Display Format | Adobe Acrobat PDF - pdf |
| Filesize | 150.84kB (1885487 bits) |
| Date Submitted | 2010-07-21 00:00:00 |
| Date Available | 2010-07-21 00:00:00 |
| Creation Date | 2010-07-19 11:30:19 |
| Producing Software | Acrobat Distiller 7.0 (Windows) |
| Document Lastmod | 2010-07-19 11:30:24 |
| Document Title | User's manual.pdf |
| Document Creator | PScript5.dll Version 5.2 |
| Document Author: | WendyLiao |
5GEVKQP%QPĹżIWTCVKQP DDNS The DDNS feature allows you to host a server (Web, FTP, Game Server, etcâŚ) using a domain name that you have purchased (www. whateveryournameis.com) with your dynamically assigned IP address. Most broadband Internet Service Providers assign dynamic (changing) IP addresses. Using a DDNS service provider, your friends can enter in your domain name to connect to your server no matter what your IP address is. Enable Dynamic Check this box to enable DDNS updates. $.3 3ERVER !DDRESS Choose your DDNS provider from the drop down menu. (OST .AME Enter the Host Name that you registered with your DDNS service provider. 5SERNAME OR +EY Enter the Username for your DDNS account. 0ASSWORD OR +EY Enter the Password for your DDNS account. 4IMEOUT Enter a time (in hours). D-Link DIR-652 User Manual 70 5GEVKQP%QPĹżIWTCVKQP 3YSTEM #HECK 0ING 4EST The Ping Test is used to send Ping packets to test if a computer is on the Internet. Enter the IP Address that you wish to Ping, and click 2KPI. 0ING 2ESULTS The results of your ping attempts will be displayed here. D-Link DIR-652 User Manual 71 5GEVKQP%QPĹżIWTCVKQP 3CHEDULES .AME Enter a name for your new schedule. $AYS Select a day, a range of days, or All Week to include every day. 4IME Enter a start and end time for your schedule, or check !LL $AY HRS to set the schedule to run all day (for the selected days). 3AVE Click Save to save your schedule. You must click at the top for your schedules to go into effect. 3CHEDULE The list of schedules will be listed here. Click 2ULES ,IST the Edit icon to make changes or click the Delete icon to remove the schedule. D-Link DIR-652 User Manual 72 5GEVKQP%QPĹżIWTCVKQP Device Information This page displays the current information for the DIR-652. It will display the LAN, WAN (Internet), and Wireless information. If your Internet connection is set up for a Dynamic IP address then a Release button and a Renew button will be displayed. Use Release to disconnect from your ISP and use Renew to connect to your ISP. If your Internet connection is set up for PPPoE, a Connect button and a Disconnect button will be displayed. Use Disconnect to drop the PPPoE connection and use Connect to establish the PPPoE connection. 'ENERAL Displays the routerâs time and firmware version. 7!. Displays the MAC address and the public IP settings for the router. ,!. Displays the MAC address and the private (local) IP settings for the router. 7IRELESS ,!. Displays the wireless MAC address and your wireless settings such as SSID and Channel. ,!. #OMPUTERS Displays computers and devices that are connected to the router via Ethernet and that are receiving an IP address assigned by the router (DHCP). IGMP Multicast Displays the Multicast Group IP Address. -EMBERSHIPS D-Link DIR-652 User Manual 73 5GEVKQP%QPĹżIWTCVKQP Logs The router automatically logs (records) events of interest in its internal memory. If there isnât enough internal memory for all events, logs of older events are deleted, but logs of the most recent events are retained. The Logs option allows you to view the router logs. You can FGĹżPGYJCVV[RGUQHGXGPVU[QWYCPVVQXKGYCPFVJGNGXGNQHVJGGXGPVUVQXKGY6JKUTQWVGTCNUQJCUGZVGTPCN5[UNQI5GTXGTUWRRQTVUQ [QWECPUGPFVJGNQIĹżNGUVQCEQORWVGTQP[QWTPGVYQTMVJCVKUTWPPKPIC5[UNQIWVKNKV[ ,OG 4YPE You can select the types of messages that you want to display from the log. System Activity, Debug Information, Attacks, Dropped Packets, and Notice messages can be selected. !PPLY ,OG 3ETTINGS 9KNNĹżNVGTVJGNQITGUWNVUUQVJCVQPN[VJGUGNGEVGF .OW message types appear. 2EFRESH Updates the log details on the screen so it displays any recent activity. #LEAR Clears all of the log contents. %MAIL .OW This option will send a copy of the router log to VJGGOCKNCFFTGUUEQPĹżIWTGFKPVJGTools > E-mail screen. 3AVE ,OG 6JKUQRVKQPYKNNUCXGVJGTQWVGTVQCNQIĹżNGQP your computer. D-Link DIR-652 User Manual 74 5GEVKQP%QPĹżIWTCVKQP Statistics 6JGUETGGPDGNQYFKURNC[UVJG6TCHĹżE5VCVKUVKEU*GTG[QWECPXKGYVJGCOQWPVQHRCEMGVUVJCVRCUUVJTQWIJVJG&+4QPDQVJVJG+PVGTPGV CPFVJG.#0RQTVU6JGVTCHĹżEEQWPVGTYKNNTGUGVKHVJGFGXKEGKUTGDQQVGF Internet Sessions D-Link DIR-652 User Manual 75 5GEVKQP%QPĹżIWTCVKQP Wireless The wireless client table displays a list of current connected wireless clients. This table also displays the connection time and MAC address of the connected wireless clients. IPv6 The IPv6 details page displays full details of IPv6 clients that are connected when IPv6 is enabled. D-Link DIR-652 User Manual 76 5GEVKQP%QPĹżIWTCVKQP 3UPPORT D-Link DIR-652 User Manual 77 Section 4 - Security Wireless Security This section will show you the different levels of security you can use to protect your data from intruders. The DIR-652 offers the following types of security: Ĺ92# 9K(K2TQVGEVGF#EEGUU Ĺ92# 9K(K2TQVGEVGF#EEGUU Ĺ92#25- 2TG5JCTGF-G[ Ĺ92#25- 2TG5JCTGF-G[ 7HAT IS 70! WPA, or Wi-Fi Protected Access, is a Wi-Fi standard that was designed to improve the security features of WEP (Wired Equivalent Privacy). The 2 major improvements over WEP: Ĺ+ORTQXGFFCVCGPET[RVKQPVJTQWIJVJG6GORQTCN-G[+PVGITKV[2TQVQEQN 6-+2 6-+2UETCODNGUVJGMG[U using a hashing algorithm and, by adding an integrity-checking feature, ensures that the keys havenât been tampered with. WPA2 is based on 802.11i and uses Advanced Encryption Standard (AES) instead QH6-+2 Ĺ7UGTCWVJGPVKECVKQPYJKEJKUIGPGTCNN[OKUUKPIKP9'2VJTQWIJVJGGZVGPUKDNGCWVJGPVKECVKQPRTQVQEQN '#2 9'2 TGIWNCVGU CEEGUU VQ C YKTGNGUU PGVYQTM DCUGF QP C EQORWVGTĹU JCTFYCTGURGEKĹżE /#% address, which is relatively simple to be sniffed out and stolen. EAP is built on a more secure public-key encryption system to ensure that only authorized network users can access the network. 92#25-92#25-WUGUCRCUURJTCUGQTMG[VQCWVJGPVKECVG[QWTYKTGNGUUEQPPGEVKQP6JGMG[KUCPCNRJCPWOGTKE password between 8 and 63 characters long. The password can include symbols (!?*&_) and spaces. This key must be the exact same key entered on your wireless router or access point. 92#92#KPEQTRQTCVGUWUGTCWVJGPVKECVKQPVJTQWIJVJG'ZVGPUKDNG#WVJGPVKECVKQP2TQVQEQN '#2 '#2KUDWKNVQPC more secure public key encryption system to ensure that only authorized network users can access the network. D-Link DIR-652 User Manual 78 Section 4 - Security 7IRELESS 3ECURITY 3ETUP 7IZARD To run the security wizard, click on Setup at the top and then click ,AUNCH 7IRELESS 3ECURITY 3ETUP 7IZARD. Click Next to continue. D-Link DIR-652 User Manual 79 Section 4 - Security 'PVGTVJG55+& 5GTXKEG5GV+FGPVKĹżGT 6JG55+&KUVJGPCOGQH[QWT wireless network. Create a name using up to 32 characters. The SSID is case-sensitive. Select the level of security for your wireless network: Ĺ$GUV92##WVJGPVKECVKQP Ĺ$GVVGT92##WVJGPVKECVKQP Ĺ0QPG0QUGEWTKV[ Click Next to continue. If you selected Best or Better, enter a password between 8-63 characters. If you selected Good, enter 13 characters or 26 Hex digits. Click Next to continue. D-Link DIR-652 User Manual 80 Section 4 - Security If you selected Better, the following screen will show you your Pre-Shared -G[VQGPVGTQP[QWTYKTGNGUUENKGPVU Click SaveVQĹżPKUJVJG5GEWTKV[9K\CTF If you selected Best, the following screen will show you your Pre-Shared -G[VQGPVGTQP[QWTYKTGNGUUENKGPVU Click SaveVQĹżPKUJVJG5GEWTKV[9K\CTF If you selected WPA-Enterprise, the RADIUS information will be displayed. Click SaveVQĹżPKUJVJG5GEWTKV[9K\CTF D-Link DIR-652 User Manual 81 Section 4 - Security #ONlGURE 70! 0ERSONAL 03+ It is recommended to enable encryption on your wireless router before your wireless network adapters. Please establish wireless connectivity before enabling encryption. Your wireless signal may degrade when enabling encryption due to the added overhead. Log into the web-based configuration by opening a web browser and entering the IP address of the router (192.168.0.1). Log into the web-based configuration by opening a web browser and entering the IP address of the router (192.168.0.1). Click on 3ETUP and then click Wireless Settings on the left side. 2. Next to Security Mode, select 70! 0ERSONAL. 3. Next to WPA Mode, select Auto, 70! /NLY, or WPA Only. Use Auto if you have wireless clients using both WPA and WPA2. 4. Next to Group Key Update Interval, enter the amount of time before the group key used for broadcast and multicast data is changed (3600 is default). 5. Next to Pre-Shared Key, enter a key (passphrase). The key is entered as a pass-phrase in ASCII format at both ends of the wireless connection. The pass-phrase must be between 8-63 characters. 6. Click Save Settings VQ UCXG [QWT UGVVKPIU +H [QW CTG EQPĹżIWTKPI VJG TQWVGT YKVJ C YKTGNGUU CFCRVGT [QW YKNN NQUG EQPPGEVKXKV[WPVKN[QWGPCDNG92#25-QP[QWTCFCRVGTCPFGPVGTVJGUCOGRCUURJTCUGCU[QWFKFQPVJGTQWVGT D-Link DIR-652 User Manual 82 Section 4 - Security #ONlGURE 70! %NTERPRISE 2!$)53 It is recommended to enable encryption on your wireless router before your wireless network adapters. Please establish wireless connectivity before enabling encryption. Your wireless signal may degrade when enabling encryption due to the added overhead. .QIKPVQVJGYGDDCUGFEQPĹżIWTCVKQPD[QRGPKPICYGDDTQYUGTCPFGPVGTKPIVJG+2CFFTGUUQHVJGTQWVGT Click on 3ETUP and then click Wireless Settings on the left side. 2. Next to Security Mode, select 70! %NTERPRISE. 3. Next to WPA Mode, select Auto, 70! /NLY, or WPA Only. Use Auto if you have wireless clients using both WPA and WPA2. 4. Next to Group Key Update Interval, enter the amount of time before the group key used for broadcast and multicast data is changed (3600 is default). 5. Next to Authentication Timeout, enter the amount of time before a client is required to re-authenticate (60 minutes is default). 6. Next to RADIUS Server IP Address enter the IP Address of your RADIUS server. 7. Next to RADIUS Server Port, enter the port you are using with your RADIUS server. 1812 is the default port. 8. Next to RADIUS Server Shared Secret, enter the security key. 9. If the MAC Address Authentication box is selected then the user will need to connect from the same computer whenever logging into the wireless network. 10. Click Advanced to enter settings for a secondary RADIUS Server. 11. Click !PPLY 3ETTINGS to save your settings. D-Link DIR-652 User Manual 83 Section 4 - Security D-Link DIR-652 User Manual 84 Section 5 - Connecting to a Wireless Network Using WindowsÂŽ 7 and WPS for Wireless ConďŹguration 6JGHQNNQYKPIUVGRUCNNQY[QWVQEQPĹżIWTG[QWT&+4YKTGNGUUPGVYQTMUGVVKPIUWUKPI9KPFQYUÂŽ 7 through WPS. 1. Click the Start button and select Computer from the Start menu. 2. Click the Network option. D-Link DIR-652 User Manual 85 Section 5 - Connecting to a Wireless Network 3. Double-click the DIR-652 router. 4. Input the WPS PIN number (displayed in the Advanced > Wi-Fi Protected Setup section in the Routerâs Web UI) and click Next. D-Link DIR-652 User Manual 86 Section 5 - Connecting to a Wireless Network 5. Type a name for your wireless network. 6QEQPĹżIWTGCFXCPEGFUGVVKPIUENKEMVJG icon. Click Next to continue. D-Link DIR-652 User Manual 87 Section 5 - Connecting to a Wireless Network 7. The following window will appear while the Router is being EQPĹżIWTGF 9CKVHQTVJGEQPĹżIWTCVKQPVQEQORNGVG #HVGTEQPĹżIWTCVKQPKUEQORNGVGCYKPFQYYKNNCRRGCTVJCV[QWT wireless network has been set up successfully. Make a note of the security key as you may need to provide this security key when adding an older wireless device to the network in the future. Click Close to complete WPS setup. D-Link DIR-652 User Manual 88 Section 5 - Connecting to a Wireless Network Connecting to a Wireless Network Using WindowsÂŽ 7 +V KU TGEQOOGPFGF VJCV [QW GPCDNG YKTGNGUU UGEWTKV[ 92#92# QP [QWT YKTGNGUU TQWVGT QT CEEGUU RQKPV DGHQTG EQPĹżIWTKPI[QWTYKTGNGUUCFCRVGT+H[QWCTGLQKPKPICPGZKUVKPIPGVYQTM[QWYKNNPGGFVQMPQYVJGUGEWTKV[MG[QT passphrase being used. 1. Click on the wireless icon in the system tray in the lowerright corner of your screen. Wireless Icon 2. The utility will display any available wireless networks in your area. D-Link DIR-652 User Manual 89 Section 5 - Connecting to a Wireless Network 3. Highlight the wireless network (SSID) you would like to connect to and click the Connect button. 4. The following window appears while your computer tries to connect to the router. D-Link DIR-652 User Manual 90 Section 5 - Connecting to a Wireless Network 5. If your wireless network uses encryption such as WEP or 92#92#GPVGTVJGGPET[RVKQPRCUUYQTFRCUURJTCUG for your wireless network and click Connect. It may take 20-30 seconds to connect to the wireless network. If the connection fails, please verify that the key or passphrase is exactly the same as on the wireless router. D-Link DIR-652 User Manual 91 Section 5 - Connecting to a Wireless Network Connecting to a Wireless Network Using Windows VistaÂŽ +V KU TGEQOOGPFGF VJCV [QW GPCDNG YKTGNGUU UGEWTKV[ 92#92# QP [QWT YKTGNGUU TQWVGT QT CEEGUU RQKPV DGHQTG EQPĹżIWTKPI[QWTYKTGNGUUCFCRVGT+H[QWCTGLQKPKPICPGZKUVKPIPGVYQTM[QWYKNNPGGFVQMPQYVJGUGEWTKV[MG[QT passphrase being used. 1. Open the Windows VistaÂŽ Wireless Utility by right-clicking on the wireless computer icon in the system tray in the lower right corner of the screen. Select Connect to a network. 2. The utility will display any available wireless networks in your area. Highlight the wireless network (SSID) you would like to connect to and click Connect. If you get a good signal but cannot access the Internet, EJGEM[QWT6%2+2UGVVKPIUHQT[QWTYKTGNGUUCFCRVGT 4GHGTVQVJG0GVYQTMKPI$CUKEU section in this manual for more information. D-Link DIR-652 User Manual 92 Section 5 - Connecting to a Wireless Network 3.+H [QWT YKTGNGUU PGVYQTM WUGU GPET[RVKQPUWEJ CU 9'2 QT 92# 92#GPVGTVJGGPET[RVKQPRCUUYQTFRCUURJTCUGHQT[QWTYKTGNGUU network and click Connect. It may take 20-30 seconds to connect to the wireless network. If the connection fails, please verify that the key or passphrase is exactly the same as on the wireless router. D-Link DIR-652 User Manual 93 Section 5 - Connecting to a Wireless Network Connecting to a Wireless Network Using WindowsÂŽ XP WindowsÂŽ:2WUGTUOC[WUGVJGDWKNVKPYKTGNGUUWVKNKV[Settings > Control Panel. Double-click the )NTERNET /PTIONS Icon. From the Security tab, click the button to restore the settings to their defaults. Ĺ%NKEMVJGConnection tab and set the dial-up option to Never Dial a Connection. Click the LAN Settings button. Make sure nothing is checked. Click OK. Ĺ)QVQVJGAdvanced tab and click the button to restore these settings to their defaults. Click OK three times. Ĺ%NQUG[QWTYGDDTQYUGT KHQRGP CPFQRGPKV Ĺ#EEGUUVJGYGDOCPCIGOGPV1RGP[QWTYGDDTQYUGTCPFGPVGTVJG+2CFFTGUUQH[QWT&.KPMTQWVGTKPVJGCFFTGUU bar. This should open the login page for your the web management. Ĺ+H[QWUVKNNECPPQVCEEGUUVJGEQPĹżIWTCVKQPWPRNWIVJGRQYGTVQVJGTQWVGTHQTUGEQPFUCPFRNWIDCEMKP9CKV CDQWVUGEQPFUCPFVT[CEEGUUKPIVJGEQPĹżIWTCVKQP+H[QWJCXGOWNVKRNGEQORWVGTUVT[EQPPGEVKPIWUKPICFKHHGTGPV computer. 7HAT CAN ) DO IF ) FORGOT MY PASSWORD If you forgot your password, you must reset your router. Unfortunately this process will change all your settings back to the factory defaults. To reset the router, locate the reset button (hole) on the rear panel of the unit. With the router powered on, use a paperclip to hold the button down for 10 seconds. Release the button and the router will go through its reboot process. Wait about 30 seconds to access the router. The default IP address is 192.168.0.1. When logging in, the username is admin and leave the password box empty. D-Link DIR-652 User Manual 97 Section 6 - Troubleshooting 7HY CANT ) CONNECT TO CERTAIN SITES OR SEND AND RECEIVE EMAILS WHEN CONNECTING THROUGH MY ROUTER If you are having a problem sending or receiving email, or connecting to secure sites such as eBay, banking sites, and Hotmail, we suggest lowering the MTU in increments of ten (Ex. 1492, 1482, 1472, etc). Note: AOL DSL+ users must use MTU of 1400. 6QĹżPFVJGRTQRGT/675K\G[QWĹNNJCXGVQFQCURGEKCNRKPIQHVJGFGUVKPCVKQP[QWĹTGVT[KPIVQIQVQ#FGUVKPCVKQP could be another computer, or a URL. Ĺ%NKEMQPStart and then click Run. Ĺ9KPFQYUÂŽ 95, 98, and Me users type in command (WindowsÂŽ NT, 2000, XP and VistaÂŽ users type in cmd) and press Enter (or click OK). Ĺ1PEGVJGYKPFQYQRGPU[QWĹNNPGGFVQFQCURGEKCNRKPI7UGVJGHQNNQYKPIU[PVCZ PING ;URL= ; F= ; L= ;-45 VALUE= Example: PING YAHOOCOM F L D-Link DIR-652 User Manual 98 Section 6 - Troubleshooting You should start at 1472 and work your way down by 10 each time. Once you get a reply, go up by 2 until you get a HTCIOGPVGFRCEMGV6CMGVJCVXCNWGCPFCFFVQVJGXCNWGVQCEEQWPVHQTVJGXCTKQWU6%2+2JGCFGTU(QTGZCORNG lets say that 1452 was the proper value, the actual MTU size would be 1480, which is the optimum for the network weâre working with (1452+28=1480). 1PEG[QWĹżPF[QWT/67[QWECPPQYEQPĹżIWTG[QWTTQWVGTYKVJVJGRTQRGT/67UK\G To change the MTU rate on your router follow the steps below: Ĺ1RGP[QWTDTQYUGTGPVGTVJG+2CFFTGUUQH[QWTTQWVGT CPFENKEMOK. Ĺ'PVGT[QWTWUGTPCOG CFOKP CPFRCUUYQTF DNCPMD[FGHCWNV %NKEMOKVQGPVGTVJGYGDEQPĹżIWTCVKQP page for the device. Ĺ%NKEMQP3ETUP and then click Manual ConďŹgure. Ĺ6QEJCPIGVJG/67GPVGTVJGPWODGTKPVJG/67ĹżGNFCPFENKEMSave Settings to save your settings. Ĺ6GUV[QWT GOCKN +HEJCPIKPI VJG /67FQGU PQV TGUQNXG VJG RTQDNGO EQPVKPWG EJCPIKPI VJG /67KP increments of ten. D-Link DIR-652 User Manual 99 Appendix A - Wireless Basics Wireless Basics D-Link wireless products are based on industry standards to provide easy-to-use and compatible high-speed wireless connectivity within your home, business or public access wireless networks. Strictly adhering to the IEEE standard, the D-Link wireless family of products will allow you to securely access the data you want, when and where you want it. You will be able to enjoy the freedom that wireless networking delivers. A wireless local area network (WLAN) is a cellular computer network that transmits and receives data with radio signals KPUVGCFQHYKTGU9KTGNGUU.#0UCTGWUGFKPETGCUKPIN[KPDQVJJQOGCPFQHĹżEGGPXKTQPOGPVUCPFRWDNKECTGCUUWEJ as airports, coffee shops and universities. Innovative ways to utilize WLAN technology are helping people to work and EQOOWPKECVGOQTGGHĹżEKGPVN[+PETGCUGFOQDKNKV[CPFVJGCDUGPEGQHECDNKPICPFQVJGTĹżZGFKPHTCUVTWEVWTGJCXGRTQXGP VQDGDGPGĹżEKCNHQTOCP[WUGTU Wireless users can use the same applications they use on a wired network. Wireless adapter cards used on laptop and desktop systems support the same protocols as Ethernet adapter cards. Under many circumstances, it may be desirable for mobile network devices to link to a conventional Ethernet LAN in order to use servers, printers or an Internet connection supplied through the wired LAN. A Wireless Router is a device used to provide this link. D-Link DIR-652 User Manual 100 Appendix A - Wireless Basics 7HAT IS 7IRELESS Wireless or Wi-Fi technology is another way of connecting your computer to the network without using wires. Wi-Fi uses radio frequency to connect wirelessly, so you have the freedom to connect computers anywhere in your home QTQHĹżEGPGVYQTM 7HY $ ,INK 7IRELESS? D-Link is the worldwide leader and award winning designer, developer, and manufacturer of networking products. D-Link delivers the performance you need at a price you can afford. D-Link has all the products you need to build your network. (OW DOES WIRELESS WORK Wireless works similar to how cordless phone work, through radio signals to transmit data from one point A to point B. But wireless technology has restrictions as to how you can access the network. You must be within the wireless network range area to be able to connect your computer. There are two different types of wireless networks Wireless Local Area Network (WLAN), and Wireless Personal Area Network (WPAN). 7IRELESS ,OCAL !REA .ETWORK 7,!. In a wireless local area network, a device called an Access Point (AP) connects computers to the network. The access point has a small antenna attached to it, which allows it to transmit data back and forth over radio signals. With an indoor access point as seen in the picture, the signal can travel up to 300 feet. With an outdoor access point the signal can reach out up to 30 miles to serve places like manufacturing plants, industrial locations, college and high school campuses, airports, golf courses, and many other outdoor venues. 7IRELESS 0ERSONAL !REA .ETWORK 70!. Bluetooth is the industry standard wireless technology used for WPAN. Bluetooth devices in WPAN operate in a range up to 30 feet away. D-Link DIR-652 User Manual 101 Appendix A - Wireless Basics Compared to WLAN the speed and wireless operation range are both less than WLAN, but in return it doesnât use nearly as much power which makes it ideal for personal devices, such as mobile phones, PDAs, headphones, laptops, speakers, and other devices that operate on batteries. 7HO USES WIRELESS Wireless technology as become so popular in recent years that almost everyone is using it, whether itâs for home, QHĹżEGDWUKPGUU&.KPMJCUCYKTGNGUUUQNWVKQPHQTKV Home Ĺ)KXGUGXGT[QPGCVJQOGDTQCFDCPFCEEGUU Ĺ5WTHVJGYGDEJGEMGOCKNKPUVCPVOGUUCIGCPFGVE Ĺ)GVUTKFQHVJGECDNGUCTQWPFVJGJQWUG Ĺ5KORNGCPFGCU[VQWUG Small OfďŹce and Home OfďŹce Ĺ5VC[QPVQRQHGXGT[VJKPICVJQOGCU[QWYQWNFCVQHĹżEG Ĺ4GOQVGN[CEEGUU[QWTQHĹżEGPGVYQTMHTQOJQOG Ĺ5JCTG+PVGTPGVEQPPGEVKQPCPFRTKPVGTYKVJOWNVKRNGEQORWVGTU Ĺ0QPGGFVQFGFKECVGQHĹżEGURCEG D-Link DIR-652 User Manual 102 Appendix A - Wireless Basics 7HERE IS WIRELESS USED 9KTGNGUUVGEJPQNQI[KUGZRCPFKPIGXGT[YJGTGPQVLWUVCVJQOGQTQHĹżEG2GQRNGNKMGVJGHTGGFQOQHOQDKNKV[CPFKVĹU becoming so popular that more and more public facilities now provide wireless access to attract people. The wireless connection in public places is usually called âhotspotsâ. Using a D-Link Cardbus Adapter with your laptop, you can access the hotspot to connect to Internet from remote locations like: Airports, Hotels, Coffee Shops, Libraries, Restaurants, and Convention Centers. 9KTGNGUUPGVYQTMKUGCU[VQUGVWRDWVKH[QWĹTGKPUVCNNKPIKVHQTVJGĹżTUVVKOGKVEQWNFDGSWKVGCVCUMPQVMPQYKPIYJGTGVQ start. Thatâs why weâve put together a few setup steps and tips to help you through the process of setting up a wireless network. 4IPS Here are a few things to keep in mind, when you install a wireless network. #ENTRALIZE YOUR ROUTER OR !CCESS 0OINT /CMGUWTG[QWRNCEGVJGTQWVGTCEEGUURQKPVKPCEGPVTCNK\GFNQECVKQPYKVJKP[QWTPGVYQTMHQTVJGDGUVRGTHQTOCPEG6T[ VQRNCEGVJGTQWVGTCEEGUURQKPVCUJKIJCURQUUKDNGKPVJGTQQOUQVJGUKIPCNIGVUFKURGTUGFVJTQWIJQWV[QWTJQOG If you have a two-story home, you may need a repeater to boost the signal to extend the range. Eliminate Interference Place home appliances such as cordless telephones, microwaves, and televisions as far away as possible from the TQWVGTCEEGUURQKPV6JKUYQWNFUKIPKĹżECPVN[TGFWEGCP[KPVGTHGTGPEGVJCVVJGCRRNKCPEGUOKIJVECWUGUKPEGVJG[QRGTCVG on same frequency. Security Donât let you next-door neighbors or intruders connect to your wireless network. Secure your wireless network by turning on the WPA or WEP security feature on the router. Refer to product manual for detail information on how to set it up. D-Link DIR-652 User Manual 103 Appendix A - Wireless Basics Wireless Modes There are basically two modes of networking: ĹInfrastructure â All wireless clients will connect to an access point or wireless router. Ĺ!D (OC â Directly connecting to another computer, for peer-to-peer communication, using wireless network adapters on each computer, such as two or more DIR-652 wireless network Cardbus adapters. An Infrastructure network contains an Access Point or wireless router. All the wireless devices, or clients, will connect to the wireless router or access point. An Ad-Hoc network contains only clients, such as laptops with wireless CardBus adapters. All the adapters must be in Ad-Hoc mode to communicate. D-Link DIR-652 User Manual 104 Appendix B - Networking Basics Networking Basics #HECK YOUR )0 ADDRESS #HVGT[QWKPUVCNN[QWTPGY&.KPMCFCRVGTD[FGHCWNVVJG6%2+2UGVVKPIUUJQWNFDGUGVVQQDVCKPCP+2CFFTGUUHTQO a DHCP server (i.e. wireless router) automatically. To verify your IP address, please follow the steps below. Click on Start > Run. In the run box type cmd and click /+ (Windows VistaÂŽ users type cmd in the 3TART 3EARCH box.) At the prompt, type ipconďŹg and press Enter. This will display the IP address, subnet mask, and the default gateway of your adapter. If the address is 0.0.0.0, check your adapter installation, security settings, and the settings QP[QWTTQWVGT5QOGĹżTGYCNNUQHVYCTGRTQITCOU may block a DHCP request on newly installed adapters. If you are connecting to a wireless network at a hotspot (e.g. hotel, coffee shop, airport), please contact an employee or administrator to verify their wireless network settings. D-Link DIR-652 User Manual 105 Appendix B - Networking Basics Statically Assign an IP address +H[QWCTGPQVWUKPIC&*%2ECRCDNGICVGYC[TQWVGTQT[QWPGGFVQCUUKIPCUVCVKE+2CFFTGUURNGCUGHQNNQYVJGUVGRU below: 3TEP Windows VistaÂŽ: WindowsÂŽ XP: WindowsÂŽ 2000: Click on Start > Control Panel > Network and Internet > .ETWORK AND 3HARING #ENTER > Manage Network #ONNECTIONS Click on Start > Control Panel > Network Connections. From the desktop, right-click My Network Places > 0ROPERTIES. 3TEP Right-click on the Local Area Connection which represents your D-Link network adapter and select 0ROPERTIES. 3TEP Highlight )NTERNET 0ROTOCOL 4#0)0 and click 0ROPERTIES. 3TEP Click 5SE THE FOLLOWING )0 ADDRESS and enter an IP address that is on the same subnet as your network or the LAN IP address on your router. %XAMPLE If the router´s LAN IP address is 192.168.0.1, make your IP address 192.168.0.X where X is a number between 2 and 99. Make sure that the number you choose is not in use on the network. Set Default Gateway the same as the LAN IP address of your router (192.168.0.1). Set Primary DNS the same as the LAN IP address of your router (192.168.0.1). The Secondary DNS is not needed or you may enter a DNS server from your ISP. 3TEP Click OK twice to save your settings. D-Link DIR-652 User Manual 106 #RRGPFKZ%6GEJPKECN5RGEKĹżECVKQPU 4ECHNICAL 3PECIlCATIONS Standards Ĺ+'''P Ĺ+'''I Ĺ+''' Ĺ+'''W Frequency Range Ĺ)*\VQ)*\ Security Ĺ92#2GTUQPCN Ĺ92#2GTUQPCN Ĺ92#'PVGTRTKUG Ĺ92#'PVGTRTKUG %XTERNAL !NTENNA 4YPE Ĺ6YQ FGVCEJCDNGTGXGTUG5/##PVGPPCU 4RANSMITTER /UTPUT 0OWER 7l[hW][ ĹF$O LEDs Ĺ2QYGT5VCVWU Ĺ9.#0 Ĺ+PVGTPGV Ĺ.#0 Wireless Signal Rates* )%%% N (4 Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU )%%% G Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU Ĺ/DRU /PERATING 4EMPERATURE Ĺu(VQu( u%VQu% Humidity ĹOCZKOWO PQPEQPFGPUKPI Safety & Emissions Ĺ(%% Ĺ%' Dimensions Ĺ. KPEJGU Ĺ9 KPEJGU Ĺ* KPEJGU /CZKOWOYKTGNGUUUKIPCNTCVGFGTKXGFHTQO+'''5VCPFCTFICPFPURGEKĹżECVKQPU#EVWCNFCVCVJTQWIJRWVYKNNXCT[0GVYQTMEQPFKVKQPUCPFGPXKTQPOGPVCN HCEVQTUKPENWFKPIXQNWOGQHPGVYQTMVTCHĹżEDWKNFKPIOCVGTKCNUCPFEQPUVTWEVKQPCPFPGVYQTMQXGTJGCFNQYGTCEVWCNFCVCVJTQWIJRWVTCVG'PXKTQPOGPVCNHCEVQTUYKNN adversely affect wireless signal range. D-Link DIR-652 User Manual 107 #RRGPFKZ&%GTVKĹżECVKQPU CertiďŹcations #% -ARK 7ARNING This is a Class B product. In a domestic environment, this product may cause radio interference, in which case the user may be required to take adequate measures. &## 3TATEMENT This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses, and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communication. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: Ĺ4GQTKGPVQTTGNQECVGVJGTGEGKXKPICPVGPPC Ĺ+PETGCUGVJGUGRCTCVKQPDGVYGGPVJGGSWKROGPVCPFTGEGKXGT Ĺ%QPPGEVVJGGSWKROGPVKPVQCPQWVNGVQPCEKTEWKVFKHHGTGPVHTQOVJCVVQYJKEJVJGTGEGKXGTKUEQPPGEVGF Ĺ%QPUWNVVJGFGCNGTQTCPGZRGTKGPEGFTCFKQ68VGEJPKEKCPHQTJGNR &## #AUTION #P[EJCPIGUQTOQFKĹżECVKQPUPQVGZRTGUUN[CRRTQXGFD[VJGRCTV[TGURQPUKDNGHQTEQORNKCPEGEQWNFXQKFVJGWUGTĹUCWVJQTKV[VQQRGTCVG this equipment. This device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions: (1) This device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation. )-0/24!.4 ./4)#% &## 2ADIATION %XPOSURE 3TATEMENT This equipment complies with FCC radiation exposure limits set forth for an uncontrolled environment. This equipment should be installed and operated with minimum distance 20cm between the radiator & your body. This transmitter must not be co-located or operating in conjunction with any other antenna or transmitter. 6JGCXCKNCDKNKV[QHUQOGURGEKĹżEEJCPPGNUCPFQTQRGTCVKQPCNHTGSWGPE[DCPFUCTGEQWPVT[FGRGPFGPVCPFCTGĹżTOYCTGRTQITCOOGFCV VJGHCEVQT[VQOCVEJVJGKPVGPFGFFGUVKPCVKQP6JGĹżTOYCTGUGVVKPIKUPQVCEEGUUKDNGD[VJGGPFWUGT D-Link DIR-652 User Manual 108
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.6 Linearized : Yes Encryption : Standard V2.3 (128-bit) User Access : Print, Copy, Extract, Print high-res XMP Toolkit : 3.1-701 Modify Date : 2010:07:19 11:30:24+08:00 Create Date : 2010:07:19 11:30:19+08:00 Metadata Date : 2010:07:19 11:30:24+08:00 Creator Tool : PScript5.dll Version 5.2 Format : application/pdf Title : User's manual.pdf Creator : WendyLiao Document ID : uuid:fdb31935-66f2-4792-bab1-2c638d4ebc3c Instance ID : uuid:e6937472-9925-4a81-8562-99dd0811e62f Producer : Acrobat Distiller 7.0 (Windows) Page Count : 39 Author : WendyLiaoEXIF Metadata provided by EXIF.tools