D Link IR652A1 XTreme N Gigabit Home Router User Manual User s manual
D Link Corporation XTreme N Gigabit Home Router User s manual
D Link >
Contents
- 1. User Manual Part 1
- 2. User Manual Part 2
User Manual Part 1
USER MANUAL DIR-652 VERSION 1.0 Preface D-Link reserves the right to revise this publication and to make changes in the content hereof without obligation to notify any person or organization of such revisions or changes. Manual Revisions 1.0 January 20, 2010 Ĺ+PKVKCNXGTUKQP Trademarks D-Link and the D-Link logo are trademarks or registered trademarks of D-Link Corporation or its subsidiaries in the United States or other countries. All other company or product names mentioned herein are trademarks or registered trademarks of their respective companies. Copyright Š 2008-2010 by D-Link Systems, Inc. All rights reserved. This publication may not be reproduced, in whole or in part, without prior expressed written permission from D-Link Systems, Inc. D-Link DIR-652 User Manual Table of Contents Table of Contents Preface........................................................................... i Manual Revisions ..................................................... i Trademarks .............................................................. i Product Overview ........................................................ 1 Package Contents ................................................... 1 System Requirements ............................................. 1 Introduction .............................................................. 2 Features .................................................................. 3 Hardware Overview ................................................. 4 Connections....................................................... 4 LEDs .................................................................. 5 Installation.................................................................... 6 Before you Begin ..................................................... 6 Wireless Installation Considerations........................ 7 Getting Started ........................................................ 8 %QPĹżIWTCVKQP ............................................................... 9 9GDDCUGF%QPĹżIWTCVKQP7VKNKV[ .............................. 9 Setup Wizard ................................................... 10 /CPWCN%QPĹżIWTCVKQP....................................... 14 Dynamic (Cable) .......................................... 14 PPPoE (DSL) ............................................... 15 PPTP............................................................ 16 L2TP............................................................. 18 Static (assigned by ISP)............................... 20 D-Link DIR-652 User Manual Wireless Settings ............................................. 21 Network Settings.............................................. 22 DHCP Server Settings ................................. 23 DHCP Reservation....................................... 25 Virtual Server ................................................... 27 Port Forwarding ............................................... 29 Application Rules ............................................. 30 QoS Engine ..................................................... 31 Network Filters................................................. 33 Access Control................................................. 34 Access Control Wizard................................. 34 Website Filters ................................................. 37 Inbound Filters ................................................. 38 Firewall Settings .............................................. 39 SPI ............................................................... 39 NAT Endpoint Filtering ................................. 39 DMZ ............................................................. 39 SPI ............................................................... 40 NAT Endpoint Filtering ................................. 40 DMZ ............................................................. 40 Routing ............................................................ 41 Advanced Wireless Settings ............................ 42 Transmit Power ............................................ 42 Mode ........................................................... 42 WISH Settings ................................................. 43 ii Table of Contents Wi-Fi Protected Setup (WPS) .......................... 45 Advanced Network Settings............................. 47 UPnP............................................................ 47 Internet Ping Block ....................................... 47 Internet Port Speed ...................................... 47 Multicast Streams......................................... 47 Guest Zone ...................................................... 48 IPV6 ................................................................. 49 Link-Local Connectivity ................................ 49 Static IPv6 (Stateful) .................................... 50 Static IPv6 (Stateless).................................. 51 DHCPv6 (Stateful)........................................ 52 DHCPv6 (Stateless) ..................................... 53 IPv6 over PPPoE (Stateful).......................... 54 IPv6 over PPPoE (Stateless) ....................... 56 6 to 4 Tunneling (Stateful)............................ 58 6 to 4 Tunneling (Stateless) ......................... 59 IPv6 in IPv4 Tunneling (Stateful).................. 60 IPv6 in IPv4 Tunneling (Stateless) ............... 61 Administrator Settings...................................... 62 Time Settings................................................... 64 SysLog............................................................. 65 Email Settings.................................................. 66 System Settings............................................... 68 Update Firmware ............................................. 69 DDNS............................................................... 70 System Check.................................................. 71 D-Link DIR-652 User Manual Schedules ........................................................ 72 Device Information........................................... 73 Logs ................................................................. 74 Statistics .......................................................... 75 Internet Sessions ............................................. 75 Wireless ........................................................... 76 IPv6.................................................................. 76 Support ............................................................ 77 Wireless Security....................................................... 78 What is WPA? ....................................................... 78 Wireless Security Setup Wizard ............................ 79 %QPĹżIWTG92#2GTUQPCN 25- ............................ 82 %QPĹżIWTG92#'PVGTRTKUG 4#&+75 ................... 83 Using WindowsÂŽ 7 and WPS for Wireless %QPĹżIWTCVKQP ......................................................... 85 Connecting to a Wireless Network Using WindowsÂŽ 7............................................................................. 89 Connecting to a Wireless Network Using Windows VistaÂŽ .................................................................... 92 Connecting to a Wireless Network ........................ 94 Using WindowsÂŽ XP............................................... 94 6TQWDNGUJQQVKPI ........................................................ 96 Wireless Basics ....................................................... 100 What is Wireless? ................................................ 101 Tips ...................................................................... 103 Wireless Modes ................................................... 104 iii Table of Contents 0GVYQTMKPI$CUKEU .................................................. 105 Check your IP address ........................................ 105 Statically Assign an IP address ........................... 106 6GEJPKECN5RGEKĹżECVKQPU......................................... 107 %GTVKĹżECVKQPU............................................................ 108 D-Link DIR-652 User Manual iv Section 1 - Product Overview Product PackageOverview Contents Ĺ&.KPM&+49KTGNGUU0)KICDKV*QOG Router Ĺ&GVCEJCDNG#PVGPPCU Ĺ2QYGT#FCRVGT Ĺ'VJGTPGV%CDNG%#6 Ĺ%&41/YKVJ/CPWCN Note: Using a power supply with a different voltage rating than the one included with the DIR-652 will cause damage and void the warranty. System Requirements Ĺ'VJGTPGVDCUGF%CDNGQT&5.OQFGO Ĺ9KPFQYUÂŽ, Macintosh, or Linux-based operating system with an installed Ethernet adapter, or an 802.11n, 802.11g, or 802.11b wireless adapter Ĺ+PVGTPGV'ZRNQTGT/Q\KNNC(KTGHQZQT5CHCTK YKVJ,CXCQTJKIJGT QTJKIJGT HQTEQPĹżIWTCVKQP Ĺ+PUVCNNCVKQP9K\CTFTGSWKTGU9KPFQYUÂŽ XP with Service Pack 2 D-Link DIR-652 User Manual Section 1 - Product Overview Introduction TOTAL PERFORMANCE Combines award winning router features and 802.11n wireless technology to provide the best wireless performance. TOTAL SECURITY The most complete set of security features including Active Firewall and WPA2 to protect your network against outside intruders. TOTAL COVERAGE Provides greater wireless signal rates even at farther distances for best-in-class Whole Home Coverage. ULTIMATE PERFORMANCE The D-Link Wireless N Gigabit Home Router (DIR-652) is a 802.11n compliant device that delivers real world performance of up to 650% faster than an 802.11g wireless connection (also faster than a 100Mbps wired Ethernet connection). Create a UGEWTGYKTGNGUUPGVYQTMVQUJCTGRJQVQUĹżNGUOWUKEXKFGQRTKPVGTUCPFPGVYQTMUVQTCIGVJTQWIJQWV[QWTJQOG%QPPGEVVJG Wireless N Gigabit Home Router to a cable or DSL modem and share your high-speed Internet access with everyone on the network. In addition, this Router includes a Quality of Service (QoS) engine that keeps digital phone calls (VoIP) and online gaming smooth and responsive, providing a better Internet experience. EXTENDED WHOLE HOME COVERAGE Powered by 802.11n technology, this high performance router provides superior coverage throughout your entire home while reducing dead spots. The Wireless N Gigabit Home Router is designed for use in bigger homes and for users who demand higher performance networking. Add a D-Link Wireless N notebook or desktop adapter and stay connected to your network from virtually anywhere in your home. TOTAL NETWORK SECURITY The Wireless N Gigabit Home Router supports all of the latest wireless security features to prevent unauthorized access, be it from over the wireless network or from the Internet. Support for WPA and WEP standards ensure that youâll be able to use the best possible encryption method, regardless of your client devices. In addition, this Wireless N Gigabit Home Router utilizes FWCNCEVKXGĹżTGYCNNU 52+CPF0#6 VQRTGXGPVRQVGPVKCNCVVCEMUHTQOCETQUUVJG+PVGTPGV /CZKOWOYKTGNGUUUKIPCNTCVGFGTKXGFHTQO+'''5VCPFCTFICPFPURGEKĹżECVKQPU#EVWCNFCVCVJTQWIJRWVYKNNXCT[0GVYQTMEQPFKVKQPUCPFGPXKTQPOGPVCN HCEVQTUKPENWFKPIXQNWOGQHPGVYQTMVTCHĹżEDWKNFKPIOCVGTKCNUCPFEQPUVTWEVKQPCPFPGVYQTMQXGTJGCFNQYGTCEVWCNFCVCVJTQWIJRWVTCVG'PXKTQPOGPVCNEQPFKVKQPU will adversely affect wireless signal range. D-Link DIR-652 User Manual Section 1 - Product Overview Features s &ASTER 7IRELESS .ETWORKING - The DIR-652 provides up to 300Mbps* wireless connection with other 802.11n wireless clients. This capability allows users to participate in real-time activities online, such as video streaming, online gaming, and real-time audio. The performance of this 802.11n wireless router gives you the freedom of wireless networking at speeds 650% faster than 802.11g. s #OMPATIBLE WITH G $EVICES - The DIR-652 is still fully compatible with the IEEE 802.11g standard, so it can connect with existing 802.11g PCI, USB and Cardbus adapters. !DVANCED &IREWALL &EATURES - The Web-based user interface displays a number of advanced network management features including: ĹContent Filtering'CUKN[CRRNKGFEQPVGPVĹżNVGTKPIDCUGFQP/#%#FFTGUU74.CPFQT&QOCKP Name. Ĺ&ILTER 3CHEDULING6JGUGĹżNVGTUECPDGUEJGFWNGFVQDGCEVKXGQPEGTVCKPFC[UQTHQTCFWTCVKQP of hours or minutes. Ĺ3ECURE -ULTIPLE#ONCURRENT 3ESSIONS - The DIR-652 can pass through VPN sessions. It supports multiple and concurrent IPSec and PPTP sessions, so users behind the DIR-652 can securely access corporate networks. s 5SER FRIENDLY 3ETUP 7IZARD - Through its easy-to-use Web-based user interface, the DIR-652 lets you control what information is accessible to those on the wireless network, whether from the Internet or from [QWTEQORCP[ĹUUGTXGT%QPĹżIWTG[QWTTQWVGTVQ[QWTURGEKĹżEUGVVKPIUYKVJKPOKPWVGU /CZKOWOYKTGNGUUUKIPCNTCVGFGTKXGFHTQO+'''5VCPFCTFICPFPURGEKĹżECVKQPU#EVWCNFCVCVJTQWIJRWVYKNNXCT[0GVYQTMEQPFKVKQPUCPFGPXKTQPOGPVCN HCEVQTUKPENWFKPIXQNWOGQHPGVYQTMVTCHĹżEDWKNFKPIOCVGTKCNUCPFEQPUVTWEVKQPCPFPGVYQTMQXGTJGCFNQYGTCEVWCNFCVCVJTQWIJRWVTCVG'PXKTQPOGPVCNEQPFKVKQPU will adversely affect wireless signal range. D-Link DIR-652 User Manual Section 1 - Product Overview Hardware Overview Connections Reset Pressing the Reset button restores the router to its original factory default settings. ,!. 0ORTS Connect Ethernet devices such as computers, switches, and hubs. D-Link DIR-652 User Manual Internet Port 6JGCWVQ/&+/&+:+PVGTPGVRQTVKU the connection for the Ethernet cable to the cable or DSL modem. 0OWER 2ECEPTOR Receptor for the supplied power adapter. Section 1 - Product Overview Hardware Overview LEDs Status LED A solid light indicates connection on the Internet port. This LED blinks during data transmission. Power LED A solid light indicates a proper connection to the power supply. D-Link DIR-652 User Manual WLAN LED A solid light indicates that the wireless segment is ready. This LED blinks during wireless data transmission. Local Network LEDs A solid light indicates a connection to an Ethernet-enabled computer on ports 1-4. This LED blinks during data transmission. Section 2 - Installation Installation This section will walk you through the installation process. Placement of the router is very important. Do not place the router in an enclosed area such as a closet, cabinet, or in the attic or garage. Before you Begin 2NGCUGEQPĹżIWTGVJGTQWVGTYKVJVJGEQORWVGTVJCVYCUNCUVEQPPGEVGFFKTGEVN[VQ[QWTOQFGO#NUQ[QWECPQPN[WUG the Ethernet port on your modem. If you were using the USB connection before using the router, then you must turn off your modem, disconnect the USB cable and connect an Ethernet cable to the Internet port on the router, and then turn the modem back on. In some cases, you may need to call your ISP to change connection types (USB to Ethernet). If you have DSL and are connecting via PPPoE, make sure you disable or uninstall any PPPoE software such as WinPoet, Broadjump, or Enternet 300 from your computer or you will not be able to connect to the Internet. D-Link DIR-652 User Manual Section 2 - Installation Wireless Installation Considerations The D-Link wireless router lets you access your network using a wireless connection from virtually anywhere within VJG QRGTCVKPI TCPIG QH [QWT YKTGNGUU PGVYQTM -GGR KP OKPF JQYGXGT VJCV VJG PWODGT VJKEMPGUU CPF NQECVKQP QH walls, ceilings, or other objects that the wireless signals must pass through, may limit the range. Typical ranges vary depending on the types of materials and background RF (radio frequency) noise in your home or business. The key to maximizing wireless range is to follow these basic guidelines: -GGR VJG PWODGT QH YCNNU CPF EGKNKPIU DGVYGGP VJG &.KPM TQWVGT CPF QVJGT PGVYQTM FGXKEGU VQ C minimum - each wall or ceiling can reduce your adapterâs range from 3-90 feet (1-30 meters.) Position your devices so that the number of walls or ceilings is minimized. 2. Be aware of the direct line between network devices. A wall that is 1.5 feet thick (.5 meters), at a 45-degree angle appears to be almost 3 feet (1 meter) thick. At a 2-degree angle it looks over 42 feet (14 meters) thick! Position devices so that the signal will travel straight through a wall or ceiling (instead of at an angle) for better reception. 3. Building Materials make a difference. A solid metal door or aluminum studs may have a negative effect on range. Try to position access points, wireless routers, and computers so that the signal passes through drywall or open doorways. Materials and objects such as glass, steel, metal, walls with insulation, water ĹżUJVCPMU OKTTQTUĹżNGECDKPGVUDTKEMCPFEQPETGVGYKNNFGITCFG[QWTYKTGNGUUUKIPCN -GGR [QWT RTQFWEV CYC[ CV NGCUV HGGV QT OGVGTU HTQO GNGEVTKECN FGXKEGU QT CRRNKCPEGU VJCV generate RF noise. 5. If you are using 2.4GHz cordless phones or X-10 (wireless products such as ceiling fans, lights, and home security systems), your wireless connection may degrade dramatically or drop completely. Make sure your 2.4GHz phone base is as far away from your wireless devices as possible. The base transmits a signal even if the phone in not in use. D-Link DIR-652 User Manual Section 2 - Installation Getting Started The DIR-652 includes a Quick Router Setup Wizard CD. Follow the simple steps below to run the Setup Wizard to guide you quickly through the installation process. Insert the included CD-ROM into your CD-ROM drive. The step-by-step instructions that follow are shown in WindowsÂŽ XP. The steps and screens are similar for the other Windows operating systems. If the CD Autorun function does not automatically start on your computer, go to Start > Run.... In the run box type âD:\D-Link.exeâ (where D: represents the drive letter of your CD-ROM drive). When the autorun screen appears, click on the Start button. Note: It is recommended to write down the SSID and Security Key, followed by the login password on the provided CD holder. D-Link DIR-652 User Manual 5GEVKQP%QPĹżIWTCVKQP ConďŹguration 6JKU UGEVKQP YKNN UJQY [QW JQY VQ EQPĹżIWTG [QWT PGY &.KPM YKTGNGUU TQWVGT WUKPI VJG YGDDCUGF EQPĹżIWTCVKQP utility. 7EB BASED #ONlGURATION 5TILITY 6QCEEGUUVJGEQPĹżIWTCVKQPWVKNKV[QRGPCYGDDTQYUGTUWEJ as Internet Explorer and enter the IP address of the router (192.168.0.1). You may also connect using the NetBIOS name in the address bar (HTTPDLINKROUTER). Select Admin from the drop-down menu and then enter your password. Leave the password blank by default. If you get a 0AGE #ANNOT BE $ISPLAYED error, please refer to the 4ROUBLESHOOTING section for assistance. D-Link DIR-652 User Manual 5GEVKQP%QPĹżIWTCVKQP 3ETUP 7IZARD You may click 3ETUP 7IZARDVQSWKEMN[EQPĹżIWTG[QWTTQWVGT If you want to enter your settings without running the wizard, click Manual ConďŹguration and skip to page 14. Click ,AUNCH )NTERNET #ONNECTION 3ETUP 7IZARD to begin. +H[QWYCPVVQEQPĹżIWTG[QWTYKTGNGUUUGVVKPIUENKEM,AUNCH 7IRELESS 3ECURITY 3ETUP 7IZARD and skip to page 63. D-Link DIR-652 User Manual 10 5GEVKQP%QPĹżIWTCVKQP Click Next to continue. Create a new password and then click Next to continue. Select your time zone from the drop-down menu and then click Next to continue. Select the type of Internet connection you use and then click Next to continue. D-Link DIR-652 User Manual 11 5GEVKQP%QPĹżIWTCVKQP If you selected Dynamic, you may need to enter the MAC address of the computer that was last connected directly to your modem. If you are currently using that computer, click Clone Your PCâs MAC Addres and then click Next to continue. The Host Name is optional but may be required by some ISPs. The default host name is the device name of the Router and may be changed. If you selected PPPoE, enter your PPPoE username and password. Click Next to continue. Select Static if your ISP assigned you the IP address, subnet mask, gateway, and DNS server addresses. Note: Make sure to remove your PPPoE software from your computer. The software is no longer needed and will not work through a router. If you selected PPTP, enter your PPTP username and password. Click Next to continue. D-Link DIR-652 User Manual 12 5GEVKQP%QPĹżIWTCVKQP If you selected L2TP, enter your L2TP username and password. Click Next to continue. If you selected Static, enter your network settings supplied by your Internet provider. Click Next to continue. Click ConnectVQUCXG[QWTUGVVKPIU1PEGVJGTQWVGTKUĹżPKUJGFTGDQQVKPI click Continue. Please allow 1-2 minutes to connect. Close your browser window and reopen it to test your Internet connection. It may take a few tries to initially connect to the Internet. D-Link DIR-652 User Manual 13 5GEVKQP%QPĹżIWTCVKQP Manual ConďŹguration $YNAMIC #ABLE My Internet Select $YNAMIC )0 $(#0 to obtain IP Address information automatically #ONNECTION from your ISP. Select this option if your ISP does not give you any IP numbers to use. This option is commonly used for cable modem services such as Comcast and Cox. Enable Advanced Domain Name System (DNS) services enhances your Advanced Internet performance by getting you the information and web pages $.3 3ERVICE you are looking for faster and more reliably. In addition, it improves your overall Internet experience by correcting many common typo (OST .AME mistakes automatically, taking you where you intended to go and saving you valuable time. Disclaimer: D-Link makes no warranty as to the availability, reliability, functionality and operation of the Advanced DNS service or its features. The Host Name is optional but may be required by some ISPs. Leave blank if you are not sure. Use Check the box if you are having problems obtaining an IP address 5NICASTING from your ISP. 0RIMARY Secondary Enter the Primary and secondary DNS server IP addresses assigned by your ISP. These addresses are usually obtained $.3 3ERVER CWVQOCVKECNN[HTQO[QWT+52.GCXGCVKH[QWFKFPQVURGEKĹżECNN[TGEGKXGVJGUGHTQO[QWT+52 -45 /CZKOWO6TCPUOKUUKQP7PKV[QWOC[PGGFVQEJCPIGVJG/67HQTQRVKOCNRGTHQTOCPEGYKVJ[QWTURGEKĹżE+52KUVJG default MTU. MAC The default MAC Address is set to the Internet portâs physical interface MAC address on the Broadband Router. It is not !DDRESS recommended that you change the default MAC address unless required by your ISP. You can use the Clone Your PCâs MAC Address button to replace the Internet portâs MAC address with the MAC address of your Ethernet card. D-Link DIR-652 User Manual 14 5GEVKQP%QPĹżIWTCVKQP )NTERNET 3ETUP 000O% $3, Choose PPPoE (Point to Point Protocol over Ethernet) if your ISP uses a PPPoE connection. Your ISP will provide you with a username and password. This option is typically used for DSL services. Make sure to remove your PPPoE software from your computer. The software is no longer needed and will not work through a router. My Internet Select 000O% 5SERNAME0ASSWORD from the drop-down menu. #ONNECTION !DDRESS -ODE Select Static if your ISP assigned you the IP address, subnet mask, gateway, and DNS server addresses. In most cases, select Dynamic. )0 !DDRESS Enter the IP address (Static PPPoE only). 5SER .AME Enter your PPPoE user name. 0ASSWORD Enter your PPPoE password and then retype the password in the next box. 3ERVICE .AME Enter the ISP Service Name (optional). Reconnection Select either Always on, On demand, or Manual. -ODE Maximum Idle Enter the Primary and Secondary DNS Server Addresses (Static PPPoE 4IME only). $.3 !DDRESSES Enter a maximum idle time during which the Internet connection is maintained during inactivity. To disable this feature, enable Autoreconnect. -45 Maximum Transmission Unit - you may need to change the MTU for QRVKOCNRGTHQTOCPEGYKVJ[QWTURGEKĹżE+52KUVJGFGHCWNV/67 -!# !DDRESS The default MAC Address is set to the Internet portâs physical interface MAC address on the Broadband Router. It is not recommended that you change the default MAC address unless required by your ISP. You can use the Clone Your PCâs MAC Address button to replace the Internet portâs MAC address with the MAC address of your Ethernet card. D-Link DIR-652 User Manual 15 5GEVKQP%QPĹżIWTCVKQP )NTERNET 3ETUP PPTP Choose PPTP (Point-to-Point-Tunneling Protocol) if your ISP uses a PPTP connection. Your ISP will provide you with a username and password. This option is typically used for DSL services. !DDRESS -ODE Select Static if your ISP assigned you the IP address, subnet mask, gateway, and DNS server addresses. In most cases, select Dynamic. 0040 )0 !DDRESS Enter the IP address (Static PPTP only). PPTP Subnet Enter the Primary and Secondary DNS Server Addresses (Static -ASK PPTP only). 0040 'ATEWAY Enter the Gateway IP Address provided by your ISP. 0040 3ERVER )0 Enter the Server IP provided by your ISP (optional). 5SERNAME Enter your PPTP username. 0ASSWORD Enter your PPTP password and then retype the password in the next box. 2ECONNECT -ODE Select either Always on, On demand, or Manual. Maximum Idle Enter a maximum idle time during which the Internet connection is 4IME maintained during inactivity. To disable this feature, enable Autoreconnect. $.3 3ERVERS The DNS server information will be supplied by your ISP (Internet Service Provider.) -45 Maximum Transmission Unit - you may need to change the MTU HQTQRVKOCNRGTHQTOCPEGYKVJ[QWTURGEKĹżE+52KUVJGFGHCWNV/67 D-Link DIR-652 User Manual 16 5GEVKQP%QPĹżIWTCVKQP MAC !DDRESS The default MAC Address is set to the Internet portâs physical interface MAC address on the Broadband Router. It is not recommended that you change the default MAC address unless required by your ISP. You can use the Clone Your PCâs MAC Address button to replace the Internet portâs MAC address with the MAC address of your Ethernet card. D-Link DIR-652 User Manual 17 5GEVKQP%QPĹżIWTCVKQP )NTERNET 3ETUP ,40 Choose L2TP (Layer 2 Tunneling Protocol) if your ISP uses a L2TP connection. Your ISP will provide you with a username and password. This option is typically used for DSL services. !DDRESS -ODE Select Static if your ISP assigned you the IP address, subnet mask, gateway, and DNS server addresses. In most cases, select Dynamic. ,40 )0 !DDRESS Enter the L2TP IP address supplied by your ISP (Static only). ,40 3UBNET -ASK Enter the Subnet Mask supplied by your ISP (Static only). ,40 'ATEWAY Enter the Gateway IP Address provided by your ISP. ,40 3ERVER )0 Enter the Server IP provided by your ISP (optional). 5SERNAME Enter your L2TP username. 0ASSWORD Enter your L2TP password and then retype the password in the next box. 2ECONNECT -ODE Select either Always on, On demand, or Manual. Maximum Idle Enter a maximum idle time during which the Internet connection 4IME is maintained during inactivity. To disable this feature, enable Auto-reconnect. $.3 3ERVERS Enter the Primary and Secondary DNS Server Addresses (Static L2TP only). D-Link DIR-652 User Manual 18 5GEVKQP%QPĹżIWTCVKQP -45 /CZKOWO6TCPUOKUUKQP7PKV[QWOC[PGGFVQEJCPIGVJG/67HQTQRVKOCNRGTHQTOCPEGYKVJ[QWTURGEKĹżE+52KU the default MTU. Clone MAC The default MAC Address is set to the Internet portâs physical interface MAC address on the Broadband Router. It is not !DDRESS recommended that you change the default MAC address unless required by your ISP. You can use the Clone Your PCâs MAC Address button to replace the Internet portâs MAC address with the MAC address of your Ethernet card. D-Link DIR-652 User Manual 19 5GEVKQP%QPĹżIWTCVKQP )NTERNET 3ETUP 3TATIC ASSIGNED BY )30 Select Static IP Address if all the Internet portâs IP information is provided to you by your ISP. You will need to enter in the IP address, UWDPGVOCUMICVGYC[CFFTGUUCPF&05CFFTGUU GU RTQXKFGFVQ[QWD[[QWT+52'CEJ+2CFFTGUUGPVGTGFKPVJGĹżGNFUOWUVDGKPVJG appropriate IP form, which are four octets separated by a dot (x.x.x.x). The Router will not accept the IP address if it is not in this format. )0 !DDRESS Enter the IP address assigned by your ISP. 3UBNET -ASK Enter the Subnet Mask assigned by your ISP. $EFAULT 'ATEWAY Enter the Gateway assigned by your ISP. $.3 3ERVERS The DNS server information will be supplied by your ISP (Internet Service Provider.) -45 Maximum Transmission Unit - you may need to change the MTU for optimal performance with [QWTURGEKĹżE+52KUVJGFGHCWNV/67 -!# !DDRESS The default MAC Address is set to the Internet portâs physical interface MAC address on the Broadband Router. It is not recommended that you change the default MAC address unless required by your ISP. You can use the Clone Your PCâs MAC Address button to replace the Internet portâs MAC address with the MAC address of your Ethernet card. D-Link DIR-652 User Manual 20 5GEVKQP%QPĹżIWTCVKQP Wireless Settings %NABLE 7IRELESS Check the box to enable the wireless function. If you do not want to use wireless, uncheck the box to disable all the wireless functions. 3CHEDULE The schedule of time when the wireless settings rules will be enabled. The schedule may be set to Always, which will allow the particular service to always be enabled. You can create your own times in the Tools > 3CHEDULES section. Wireless 5GTXKEG5GV+FGPVKĹżGT 55+& KUVJGPCOGQH[QWTYKTGNGUUPGVYQTM%TGCVG .ETWORK .AME a name using up to 32 characters. The SSID is case-sensitive. Enable Auto The setting can be selected to allow the DIR-652 to choose the channel #HANNEL 3CAN with the least amount of interference. Wireless Indicates the channel setting for the DIR-652. By default the channel is #HANNEL UGVVQ6JG%JCPPGNECPDGEJCPIGFVQĹżVVJGEJCPPGNUGVVKPIHQTCP existing wireless network or to customize the wireless network. If you enable !UTO #HANNEL 3CAN, this option will be greyed out. -ODE Select one of the following: G /NLY - Select if all of your wireless clients are 802.11g. N /NLY - Select only if all of your wireless clients are 802.11n. -IXED N AND G - Select if you are using a mix of 802.11n and 11g wireless clients. #HANNEL 7IDTH Select the Channel Width: !UTO - This is the default setting. Select if you are using both 802.11n and non-802.11n wireless devices. -(Z - Select if you are not using any 802.11n wireless clients. -(Z - Select if using only 802.11n wireless clients. Transmission Select the transmit rate. It is strongly suggested to select "EST !UTO for best performance. 2ATE 6ISIBILITY 3TATUS Select Invisible if you do not want the SSID of your wireless network to be broadcasted by the DIR-652. If Invisible is selected, the SSID of the DIR-652 will not be seen by Site Survey utilities so your wireless clients will have to know the SSID of your DIR-652 D-Link DIR-652 User Manual 21 5GEVKQP%QPĹżIWTCVKQP Network Settings 6JKUUGEVKQPYKNNCNNQY[QWVQEJCPIGVJGNQECNPGVYQTMUGVVKPIUQHVJGTQWVGTCPFVQEQPĹżIWTGVJG&*%2UGVVKPIU )0 !DDRESS Enter the IP address of the router. The default IP address is 192.168.0.1. If you change the IP address, once you click !PPLY, you will need to enter the new IP address in your browser to get back into the EQPĹżIWTCVKQPWVKNKV[ 3UBNET -ASK Enter the Subnet Mask. The default subnet mask is 255.255.255.0. ,OCAL $OMAIN Enter the Domain name (Optional). %NABLE $.3 2ELAY Uncheck the box to transfer the DNS server information from your ISP to your computers. If checked, your computers will use the router for a DNS server. D-Link DIR-652 User Manual 22 5GEVKQP%QPĹżIWTCVKQP DHCP Server Settings DHCP stands for Dynamic Host Control Protocol. The DIR-652 has a built-in DHCP server. The DHCP Server will automatically assign CP+2CFFTGUUVQVJGEQORWVGTUQPVJG.#0RTKXCVGPGVYQTM$GUWTGVQUGV[QWTEQORWVGTUVQDG&*%2ENKGPVUD[UGVVKPIVJGKT6%2+2 UGVVKPIUVQĹ1DVCKPCP+2#FFTGUU#WVQOCVKECNN[Ĺ9JGP[QWVWTP[QWTEQORWVGTUQPVJG[YKNNCWVQOCVKECNN[NQCFVJGRTQRGT6%2+2UGVVKPIU provided by the DIR-652. The DHCP Server will automatically allocate an unused IP address from the IP address pool to the requesting computer. You must specify the starting and ending address of the IP address pool. Enable DHCP Check this box to enable the DHCP server on 3ERVER your router. Uncheck to disable this function. DHCP IP Address Enter the starting and ending IP addresses for 2ANGE the DHCP serverâs IP assignment. Note: If you statically (manually) assign IP addresses to your computers or devices, make sure the IP addresses are outside of this range or you may have an IP conďŹict. DHCP Lease The length of time for the IP address lease. 4IME Enter the Lease time in minutes. Always Enable this feature to broadcast your networks "ROADCAST &*%2UGTXGTVQ.#09.#0ENKGPVU NetBIOS NetBIOS allows LAN hosts to discover all !NNOUNCEMENT other computers within the network, enable this feature to allow the DHCP Server to offer 0GV$+15EQPĹżIWTCVKQPUGVVKPIU Learn NetBIOS Enable this feature to allow WINS information to FROM 7!. be learned from the WAN side, disable to allow OCPWCNEQPĹżIWTCVKQP D-Link DIR-652 User Manual 23 5GEVKQP%QPĹżIWTCVKQP .ET")/3 3COPE 6JKUHGCVWTGCNNQYUVJGEQPĹżIWTCVKQPQHC0GV$+15ĹFQOCKPĹPCOGWPFGTYJKEJPGVYQTMJQUVUQRGTCVGU6JKUUGVVKPIJCUPQ GHHGEVKHVJGĹ.GCTP0GV$+15KPHQTOCVKQPHTQO9#0ĹKUCEVKXCVGFĹ NetBIOS Mode Select the different type of NetBIOS node: Broadcast only, 0OINT TO 0OINT, -IXED MODE, and Hybrid. 4YPE 0RIMARY Enter your Primary (and Secondary) WINS IP address(es). Secondary WINS )0 !DDRESS D-Link DIR-652 User Manual 24 5GEVKQP%QPĹżIWTCVKQP DHCP Reservation If you want a computer or device to always have the same IP address assigned, you can create a DHCP reservation. The router will assign the IP address only to that computer or device. Note: This IP address must be within the DHCP IP Address Range. %NABLE Check this box to enable the reservation. #OMPUTER .AME Enter the computer name or select from the drop-down menu and click . )0 !DDRESS Enter the IP address you want to assign to the computer or device. This IP Address must be within the DHCP IP Address Range. -!# !DDRESS Enter the MAC address of the computer or device. #OPY 9OUR 0#S If you want to assign an IP address to the -!# !DDRESS computer you are currently on, click this button VQRQRWNCVGVJGĹżGNFU 3AVE Click Save to save your entry. You must click Save Settings at the top to activate your reservations. Number of In this section you can see what LAN devices Dynamic DHCP are currently leasing IP addresses. #LIENTS 2EVOKE Click RevokeVQECPEGNVJGNGCUGHQTCURGEKĹżE LAN device and free an entry in the lease table. Do this only if the device no longer needs the leased IP address, because, for example, it has been removed from the network. D-Link DIR-652 User Manual 25 5GEVKQP%QPĹżIWTCVKQP Note: The Revoke option will not disconnect a PC with a current network session from the network; you would need to use MAC Address Filter to do that. Revoke will only free up a DHCP Address for the very next requester. If the previous owner is still available, those two devices may both receive an IP Address ConďŹict error, or the second device may still not receive an IP Address; in that case, you may still need to extend the âDHCP IP Address Rangeâ to address the issue, it is located in the DHCP Server section. 2ESERVE The Reserve option converts this dynamic IP allocation into a DHCP Reservation and adds the corresponding entry to the DHCP Reservations List. D-Link DIR-652 User Manual 26 5GEVKQP%QPĹżIWTCVKQP Virtual Server 6JG&+4ECPDGEQPĹżIWTGFCUCXKTVWCNUGTXGTUQVJCVTGOQVGWUGTUCEEGUUKPI9GDQT(62UGTXKEGUXKCVJGRWDNKE+2CFFTGUUECPDG automatically redirected to local servers in the LAN (Local Area Network). 6JG&+4ĹżTGYCNNHGCVWTGĹżNVGTUQWVWPTGEQIPK\GFRCEMGVUVQRTQVGEV[QWT.#0PGVYQTMUQCNNEQORWVGTUPGVYQTMGFYKVJVJG&+4 are invisible to the outside world. If you wish, you can make some of the LAN computers accessible from the Internet by enabling Virtual Server. Depending on the requested service, the DIR-652 redirects the external service request to the appropriate server within the LAN network. 6JG&+4KUCNUQECRCDNGQHRQTVTGFKTGEVKQPOGCPKPIKPEQOKPIVTCHĹżEVQCRCTVKEWNCTRQTVOC[DGTGFKTGEVGFVQCFKHHGTGPVRQTVQPVJG server computer. Each virtual service that is created will be listed at the bottom of the screen in the Virtual Servers List. There are RTGFGĹżPGFXKTVWCNUGTXKEGUCNTGCF[KPVJGVCDNG;QWOC[WUGVJGOD[GPCDNKPIVJGOCPFCUUKIPKPIVJGUGTXGT+2VQWUGVJCVRCTVKEWNCT virtual service. For a list of ports for common applications, please visit HTTPSUPPORTDLINKCOMFAQVIEWASPPROD?ID. D-Link DIR-652 User Manual 27 5GEVKQP%QPĹżIWTCVKQP This will allow you to open a single port. If you would like to open a range of ports, refer to the next page. .AME Enter a name for the rule or select an application from the drop-down menu. Select an application CPFENKEMVQRQRWNCVGVJGĹżGNFU )0 !DDRESS Enter the IP address of the computer on your local network that you want to allow the incoming service to. If your computer is receiving an IP address automatically from the router (DHCP), you computer will be listed in the âComputer Nameâ drop-down menu. Select your computer and click <<. 0RIVATE 0ORT Enter the port that you want to open next to 0UBLIC 0ORT Private Port and Public Port. The private and public ports are usually the same. The public port is the port seen from the Internet side, and the private port is the port being used by the application on the computer within your local network. 0ROTOCOL 4YPE Select TCP, UDP, or "OTH or from the drop-down menu. 3CHEDULE The schedule of time when the Virtual Server Rule will be enabled. The schedule may be set to Always, which will allow the particular service to always be enabled. You can create your own times in the Tools > 3CHEDULES section. )NBOUND &ILTER Select Allow All (most common) or a created +PDQWPFĹżNVGT;QWOC[ETGCVG[QWTQYPKPDQWPF ĹżNVGTUKPVJGAdvanced > Inbound Filter page. D-Link DIR-652 User Manual 28 5GEVKQP%QPĹżIWTCVKQP Port Forwarding This will allow you to open a single port or a range of ports. .AME Enter a name for the rule or select an application from the drop-down menu. Select an application and click <<VQRQRWNCVGVJGĹżGNFU )0 !DDRESS Enter the IP address of the computer on your local network that you want to allow the incoming service to. If your computer is receiving an IP address automatically from the router (DHCP), you computer will be listed in the âComputer Nameâ drop-down menu. Select your computer and click <<. 4#05$0 'PVGT VJG 6%2 CPFQT 7&2 RQTV QT RQTVU VJCV you want to open. You can enter a single port or a range of ports. Seperate ports with a common. Example: 24,1009,3000-4000 3CHEDULE The schedule of time when the Virtual Server Rule will be enabled. The schedule may be set to Always, which will allow the particular service to always be enabled. You can create your own times in the Tools > 3CHEDULES section. )NBOUND &ILTER Select Allow All (most common) or a created +PDQWPFĹżNVGT;QWOC[ETGCVG[QWTQYPKPDQWPF ĹżNVGTUKPVJGAdvanced > Inbound Filter page. D-Link DIR-652 User Manual 29 5GEVKQP%QPĹżIWTCVKQP !PPLICATION 2ULES Some applications require multiple connections, such as Internet gaming, video conferencing, Internet telephony and others. These CRRNKECVKQPUJCXGFKHĹżEWNVKGUYQTMKPIVJTQWIJ0#6 0GVYQTM#FFTGUU6TCPUNCVKQP 5RGEKCN#RRNKECVKQPUOCMGUUQOGQHVJGUGCRRNKECVKQPU work with the DIR-652. If you need to run applications that require multiple connections, specify the port normally associated with an CRRNKECVKQPKPVJGĹ6TKIIGT2QTVĹĹżGNFUGNGEVVJGRTQVQEQNV[RGCU6%2QT7&2VJGPGPVGTVJGĹżTGYCNN RWDNKE RQTVUCUUQEKCVGFYKVJVJG VTKIIGTRQTVVQQRGPVJGOHQTKPDQWPFVTCHĹżE 6JG&+4RTQXKFGUUQOGRTGFGĹżPGFCRRNKECVKQPUKPVJGVCDNGQPVJGDQVVQOQHVJGYGDRCIG5GNGEVVJGCRRNKECVKQP[QWYCPVVQWUG and enable it. .AME Enter a name for the rule. You may select a RTGFGĹżPGF CRRNKECVKQP HTQO VJG FTQRFQYP menu and click <<. 4RIGGER This is the port used to trigger the application. It can be either a single port or a range of ports. 4RAFlC 4YPE Select the protocol of the trigger port (TCP, UDP, or Both). &IREWALL This is the port number on the Internet side that will be used to access the application. You may FGĹżPG C UKPING RQTV QT C TCPIG QH RQTVU ;QW can use a comma to add multiple ports or port ranges. 4RAFlC 4YPE 5GNGEV VJG RTQVQEQN QH VJG ĹżTGYCNN RQTV 6%2 UDP, or Both). 3CHEDULE The schedule of time when the Application Rule will be enabled. The schedule may be set to Always, which will allow the particular service to always be enabled. You can create your own times in the Tools > 3CHEDULES section. D-Link DIR-652 User Manual 30 5GEVKQP%QPĹżIWTCVKQP QoS Engine The QoS Engine option helps improve your network gaming performance by prioritizing applications. By default the QoS Engine settings CTGFKUCDNGFCPFCRRNKECVKQPRTKQTKV[KUPQVENCUUKĹżGFCWVQOCVKECNN[ Enable TrafďŹc This option is disabled by default. Enable this 3HAPING option for better performance and experience with online games and other interactive applications, such as VoIP. !UTOMATIC 5PLINK This option is enabled by default when the QoS 3PEED Engine option is enabled. This option will allow your router to automatically determine the uplink speed of your Internet connection. -EASURED 5PLINK This displays the detected uplink speed. 3PEED -ANUAL 5PLINK The speed at which data can be transferred 3PEED from the router to your ISP. This is determined D[[QWT+52+52ĹUQHVGPURGGFCUCFQYPNQCF WRNQCF RCKT (QT GZCORNG /DKVU-DKVU Using this example, you would enter 284. Alternatively you can test your uplink speed with a service such as www.dslreports.com. D-Link DIR-652 User Manual 31 5GEVKQP%QPĹżIWTCVKQP Enable QoS This option is disabled by default. Enable this %NGINE option for better performance and experience with online games and other interactive applications, such as VoIP. Automatic This option is enabled by default. This will #LASSIlCATION allow your router to automatically determine the network priority of running programs. Dynamic This option should be enabled when you have &RAGMENTATION a slow Internet uplink. It helps to reduce the impact that large low priority network packets can have on more urgent ones. D-Link DIR-652 User Manual 32 5GEVKQP%QPĹżIWTCVKQP Network Filters Use MAC (Media Access Control) Filters to allow or deny LAN (Local Area Network) computers by their MAC addresses from accessing the Network. You can either manually add a MAC address or select the MAC address from the list of clients that are currently connected to the Broadband Router. ConďŹgure MAC Select Turn MAC Filtering Off, allow MAC &ILTERING addresses listed below, or deny MAC addresses listed below from the drop-down menu. -!# !DDRESS 'PVGTVJG/#%CFFTGUU[QWYQWNFNKMGVQĹżNVGT 6QĹżPFVJG/#%CFFTGUUQPCEQORWVGTRNGCUG refer to the Networking Basics section in this manual. Select a DHCP client from the drop-down menu $(#0 #LIENT ,IST and click << to copy that MAC Address. D-Link DIR-652 User Manual 33 5GEVKQP%QPĹżIWTCVKQP Access Control The Access Control section allows you to control access in and out of your network. Use this feature as Parental Controls to only grant CEEGUUVQCRRTQXGFUKVGUNKOKVYGDCEEGUUDCUGFQPVKOGQTFCVGUCPFQTDNQEMCEEGUUHTQOCRRNKECVKQPUNKMG22WVKNKVKGUQTICOGU !DD 0OLICY Click the Add Policy button to start the Access Control Wizard. !CCESS #ONTROL 7IZARD Click Next to continue with the wizard. D-Link DIR-652 User Manual 34 5GEVKQP%QPĹżIWTCVKQP Enter a name for the policy and then click Next to continue. Select a schedule (I.E. Always) from the drop-down menu and then click Next to continue. Enter the following information and then click Next to continue. s !DDRESS 4YPE - Select IP address, MAC address, or Other Machines. s IP Address - Enter the IP address of the computer you want to apply the rule to. D-Link DIR-652 User Manual 35 5GEVKQP%QPĹżIWTCVKQP 5GNGEVVJGĹżNVGTKPIOGVJQFCPFVJGPENKEMNext to continue. Enter the rule: Enable - Check to enable the rule. Name - Enter a name for your rule. Dest IP Start - Enter the starting IP address. Dest IP End - Enter the ending IP address. Protocol - Select the protocol. Dest Port Start - Enter the starting port number. Dest Port End - Enter the ending port number. To enable web logging, select Enabled. Click Save to save the access control rule. D-Link DIR-652 User Manual 36 5GEVKQP%QPĹżIWTCVKQP Website Filters 9GDUKVG(KNVGTUCTGWUGFVQFGP[.#0EQORWVGTUHTQOCEEGUUKPIURGEKĹżEYGDUKVGUD[VJG74.QTFQOCKP#74.KUCURGEKCNN[HQTOCVVGF VGZVUVTKPIVJCVFGĹżPGUCNQECVKQPQPVJG+PVGTPGV+HCP[RCTVQHVJG74.EQPVCKPUVJGDNQEMGFYQTFVJGUKVGYKNNPQVDGCEEGUUKDNGCPFVJG web page will not display. To use this feature, enter the text string to be blocked and click . The text to be blocked will appear in the list. To delete the text, click #LEAR THE ,IST "ELOW. 7EBSITE 52, Enter the keywords or URLs that you want to $OMAIN block (or allow). Any URL with the keyword in it will be blocked. D-Link DIR-652 User Manual 37 5GEVKQP%QPĹżIWTCVKQP Inbound Filters 6JG+PDQWPF(KNVGTQRVKQPKUCPCFXCPEGFOGVJQFQHEQPVTQNNKPIFCVCTGEGKXGFHTQOVJG+PVGTPGV9KVJVJKUHGCVWTG[QWECPEQPĹżIWTGKPDQWPF FCVCĹżNVGTKPITWNGUVJCVEQPVTQNFCVCDCUGFQPCP+2CFFTGUUTCPIG+PDQWPF(KNVGTUECPDGWUGFYKVJ8KTVWCN5GTXGT2QTV(QTYCTFKPIQT Remote Administration features. .AME 'PVGTCPCOGHQTVJGKPDQWPFĹżNVGTTWNG !CTION Select Allow or Deny. %NABLE Check to enable rule. 3OURCE )0 3TART Enter the starting IP address. Enter 0.0.0.0 if you do not want to specify an IP range. 3OURCE )0 %ND E n t e r t h e e n d i n g I P a d d r e s s . E n t e r 255.255.255.255 if you do not want to specify and IP range. 3AVE Click the Save button to apply your settings. You must click Save Settings at the top to save the settings. Inbound Filter This section will list any rules that are created. 2ULES ,IST You may click the Edit icon to change the UGVVKPIUQTGPCDNGFKUCDNGVJGTWNGQTENKEMVJG Delete icon to remove the rule. D-Link DIR-652 User Manual 38 5GEVKQP%QPĹżIWTCVKQP Firewall Settings #ĹżTGYCNNRTQVGEVU[QWTPGVYQTMHTQOVJGQWVUKFGYQTNF6JG&.KPM&+4QHHGTUCĹżTGYCNNV[RGHWPEVKQPCNKV[6JG52+HGCVWTGJGNRU prevent cyber attacks. Sometimes you may want a computer exposed to the outside world for certain types of applications. If you choose to expose a computer, you cam enable DMZ. DMZ is short for Demilitarized Zone. This option will expose the chosen computer completely to the outside world. %NABLE 30) SPI (Stateful Packet Inspection, also known as F[PCOKERCEMGVĹżNVGTKPI JGNRUVQRTGXGPVE[DGT attacks by tracking more state per session. It XCNKFCVGUVJCVVJGVTCHĹżERCUUKPIVJTQWIJVJG session conforms to the protocol. SPI .!4 %NDPOINT &ILTERING DMZ .!4 %NDPOINT Select one of the following for TCP and UDP ports: &ILTERING %NDPOINT )NDEPENDENT #P[ KPEQOKPI VTCHĹżE sent to an open port will be forwarded to the application that opened the port. The port will close if idle for 5 minutes. Address Restricted+PEQOKPIVTCHĹżEOWUVOCVEJ the IP address of the outgoing connection. Address + Port Restriction+PEQOKPIVTCHĹżEOWUV match the IP address and port of the outgoing connection. D-Link DIR-652 User Manual 39 5GEVKQP%QPĹżIWTCVKQP %NABLE $-: (OST If an application has trouble working from behind the router, you can expose one computer to the Internet and run the application on that computer. Note: Placing a computer in the DMZ may expose that computer to a variety of security risks. Use of this option is only recommended as a last resort. )0 !DDRESS Specify the IP address of the computer on the LAN that you want to have unrestricted Internet communication. If this computer obtains itâs IP address automatically using DHCP, be sure to make a static reservation on the Basic > DHCP page so that the IP address of the DMZ machine does not change. D-Link DIR-652 User Manual SPI .!4 %NDPOINT &ILTERING DMZ 40 5GEVKQP%QPĹżIWTCVKQP Routing 6JG4QWVKPIQRVKQPKUCPCFXCPEGFOGVJQFQHEWUVQOK\KPIURGEKĹżETQWVGUQHFCVCVJTQWIJ[QWTPGVYQTM $ESTINATION )0 Enter the IP address of packets that will take this route. .ETMASK Enter the netmask of the route, please note that the octets must match your destination IP address. 'ATEWAY Enter your next hop gateway to be taken if this route is used. -ETRIC The route metric is a value from 1 to 16 that indicates the cost of using this route. A value 1 is the lowest cost and 15 is the highest cost. )NTERFACE Select the interface that the IP packet must use to transit out of the router when this route is used. D-Link DIR-652 User Manual 41 5GEVKQP%QPĹżIWTCVKQP Advanced Wireless Settings Transmit Power Mode 4RANSMIT 0OWER Set the transmit power of the antennas. "EACON 0ERIOD Beacons are packets sent by an Access Point to synchronize a wireless network. Specify a value. 100 is the default setting and is recommended. 243 4HRESHOLD This value should remain at its default setting QH+HKPEQPUKUVGPVFCVCĆQYKUCRTQDNGO QPN[COKPQTOQFKĹżECVKQPUJQWNFDGOCFG &RAGMENTATION 6JGHTCIOGPVCVKQPVJTGUJQNFYJKEJKUURGEKĹżGF in bytes, determines whether packets will be fragmented. Packets exceeding the 2346 byte setting will be fragmented before transmission. 2346 is the default setting. $4)- )NTERVAL &GNKXGT[ 6TCHĹżE +PFKECVKQP /GUUCIG KU VJG default setting. A DTIM is a countdown informing clients of the next window for listening to broadcast and multicast messages. 7,!. 0ARTITION Enable this option to prevent associated wireless clients from communicating with each other. 7-- &UNCTION WMM is QoS for your wireless network. This will improve the quality of video and voice applications for your wireless clients. 3HORT ') Check this box to reduce the guard interval time therefore increasing the data capacity. However, itâs less reliable and may create higher data loss. D-Link DIR-652 User Manual 42 5GEVKQP%QPĹżIWTCVKQP WISH Settings WISH is short for Wireless Intelligent Stream Handling, a technology developed to enhance your experience of using a wireless network D[RTKQTKVK\KPIVJGVTCHĹżEQHFKHHGTGPVCRRNKECVKQPU %NABLE 7)3( Enable this option if you want to allow WISH to RTKQTKVK\G[QWTVTCHĹżE (440 Allows the router to recognize HTTP transfers for many common audio and video streams CPF RTKQTKVK\G VJGO CDQXG QVJGT VTCHĹżE 5WEJ streams are frequently used by digital media players. Windows Media Enables the router to recognize certain audio #ENTER and video streams generated by a Windows Media Center PC and to prioritize these above QVJGTVTCHĹżE5WEJUVTGCOUCTGWUGFD[U[UVGOU known as Windows Media Extenders, such as the Xbox 360. !UTOMATIC When enabled, this option causes the router to CWVQOCVKECNN[CVVGORVVQRTKQTKVK\GVTCHĹżEUVTGCOU that it doesnât otherwise recognize, based on the behaviour that the streams exhibit. This acts to deprioritize streams that exhibit bulk VTCPUHGTEJCTCEVGTKUVKEUUWEJCUĹżNGVTCPUHGTU YJKNGNGCXKPIKPVGTCEVKXGVTCHĹżEUWEJCUICOKPI or VoIP, running at a normal priority. D-Link DIR-652 User Manual 43 5GEVKQP%QPĹżIWTCVKQP 7)3( 2ULES #9+5*4WNGKFGPVKĹżGUCURGEKĹżEOGUUCIGĆQY CPF CUUKIPU C RTKQTKV[ VQ VJCV ĆQY (QT OQUV CRRNKECVKQPUVJGRTKQTKV[ENCUUKĹżGTUGPUWTGVJG TKIJVRTKQTKVKGUCPFURGEKĹżE9+5*4WNGUCTGPQV required. WISH supports overlaps between rules. If more VJCPQPGTWNGOCVEJGUHQTCURGEKĹżEOGUUCIG ĆQY VJG TWNG YKVJ VJG JKIJGUV RTKQTKV[ YKNN DG used. .AME Create a name for the rule that is meaningful to you. 0RIORITY 6JG RTKQTKV[ QH VJG OGUUCIG ĆQY KU GPVGTGF JGTG6JGHQWTRTKQTKVKGUCTGFGĹżPGFCU "+ Background (least urgent) "% Best Effort. 6) Video 6/ Voice (most urgent) 0ROTOCOL The protocol used by the messages. (OST )0 2ANGE 6JG TWNG CRRNKGU VQ C ĆQY QH OGUUCIGU HQT which one computerâs IP address falls within the range set here. (OST 0ORT 2ANGE 6JG TWNG CRRNKGU VQ C ĆQY QH OGUUCIGU HQT which hostâs port number is within the range set here. D-Link DIR-652 User Manual 44 5GEVKQP%QPĹżIWTCVKQP 7I &I 0ROTECTED 3ETUP 703 9K(K2TQVGEVGF5GVWR 925 5[UVGOKUCUKORNKĹżGFOGVJQFHQTUGEWTKPI[QWTYKTGNGUUPGVYQTMFWTKPIVJGĹ+PKVKCNUGVWRĹCUYGNNCUVJG Ĺ#FF0GY&GXKEGĹRTQEGUUGU6JG9K(K#NNKCPEG 9(# JCUEGTVKĹżGFKVCETQUUFKHHGTGPVRTQFWEVUCUYGNNCUOCPWHCEVWTGU6JGRTQEGUUKU just as easy, as depressing a button for the Push-Button Method or correctly entering the 8-digit code for the PIN code Method. The time TGFWEVKQPKPUGVWRCPFGCUGQHWUGCTGSWKVGDGPGĹżEKCNYJKNGVJGJKIJGUVYKTGNGUU5GEWTKV[UGVVKPIQH92#KUCWVQOCVKECNN[WUGF %NABLE Enable the Wi-Fi Protected Setup feature. Lock Wireless Locking the wireless security settings prevents 3ECURITY 3ETTINGS the settings from being changed by the Wi-Fi Protected Setup feature of the router. Devices can still be added to the network using Wi-Fi Protected Setup. However, the settings of the network will not change once this option is checked. 0). 3ETTINGS A PIN is a unique number that can be used to add the router to an existing network or to create a new network. The default PIN may be printed on the bottom of the router. For extra security, a new PIN can be generated. You can restore the default PIN at any time. Only the Administrator (âadminâ account) can change or reset the PIN. #URRENT 0). Shows the current value of the routerâs PIN. 'ENERATE .EW 0). Creates a random number that is a valid PIN. This becomes the routerâs PIN. You can then use this PIN when creating a connection using the WPS-PIN method. Reset PIN to Restores the default PIN of the router. $EFAULT D-Link DIR-652 User Manual 45 5GEVKQP%QPĹżIWTCVKQP Add Wireless This Wizard helps you add wireless devices to 3TATION the wireless network. The wizard will either display the wireless network settings to guide you through manual EQPĹżIWTCVKQPRTQORV[QWVQGPVGTVJG2+0HQT VJGFGXKEGQTCUM[QWVQRTGUUVJGEQPĹżIWTCVKQP button on the device. If the device supports 9K(K2TQVGEVGF5GVWRCPFJCUCEQPĹżIWTCVKQP button, you can add it to the network by pressing VJG EQPĹżIWTCVKQP DWVVQP QP VJG FGXKEG CPF then the on the router within 60 seconds. The UVCVWU.'&QPVJGTQWVGTYKNNĆCUJVJTGGVKOGU if the device has been successfully added to the network. There are several ways to add a wireless device to your network. A âregistrarâ controls access to the wireless network. A registrar only allows devices onto the wireless network if you have entered the PIN, or pressed a special Wi-Fi Protected Setup button on the device. The router acts as a registrar for the network, although other devices may act as a registrar as well. Add Wireless Device Start the wizard. 7IZARD D-Link DIR-652 User Manual 46 5GEVKQP%QPĹżIWTCVKQP Advanced Network Settings 50N0 3ETTINGS To use the Universal Plug and Play (UPnPâ˘) feature click on Enabled. UPNP provides compatibility with networking equipment, software and peripherals. PPPoE This feature enables the Router to allow a 0ASS 4HROUGH âdial-upâ or separate bridged PPP connection to an individual PC. In this instance the Router will serve as a bridge. )NTERNET 0ING Unchecking the box will not allow the DIR-652 to respond to pings. Blocking the Ping may provide some extra security from hackers. Check the box to allow the Internet port to be âpinged.â UPnP Internet Ping Block )NTERNET 0ORT 3PEED Multicast Streams )NTERNET 0ORT 3PEED You may set the port speed of the Internet port to 10Mbps, 100Mbps, 1000Mbps, or Auto /DRU5QOGQNFGTECDNGQT&5. modems may require you to set the port speed to 10Mbps. -ULTICAST STREAMS %JGEMVJGDQZVQCNNQYOWNVKECUVVTCHĹżEVQRCUU through the router from the Internet. D-Link DIR-652 User Manual 47 5GEVKQP%QPĹżIWTCVKQP Guest Zone The Guest Zone feature will allow you to create temporary zones that can be used by guests to access the Internet. These zones will be separate from your main wireless network. %NABLE 'UEST :ONE Check to enable the Guest Zone feature. 3CHEDULE The schedule of time when the Guest Zone will be active. The schedule may be set to Always, which will allow the particular service to always be enabled. You can create your own times in the section, or by clicking the Tools > 3CHEDULES button. 7IRELESS "AND This shows which wireless band will be used for the Guest Zone. Wireless Network Enter a wireless network name (SSID) that is .AME different from your main wireless network. Enable Routing Check to allow network connectivity between "ETWEEN :ONES the different zones created. 3ECURITY -ODE Select the type of security or encryption you would like to enable for the guest zone. D-Link DIR-652 User Manual 48 5GEVKQP%QPĹżIWTCVKQP IPV6 ,INK ,OCAL #ONNECTIVITY -Y )0V #ONNECTION Select Link-Local Only from the dropdown menu. LAN IPv6 Displays the IPv6 address of the !DDRESS 3ETTINGS router. D-Link DIR-652 User Manual 49 5GEVKQP%QPĹżIWTCVKQP 3TATIC )0V 3TATEFUL )0V #ONNECTION 4YPE Select Static IPv6 from the drop-down menu. WAN IPv6 Enter the address settings supplied by !DDRESS 3ETTINGS your Internet provider (ISP). ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. ,INK ,OCAL !DDRESS Displays the Routerâs LAN Link-Local Address. %NABLE !UTOCONlGURATION %JGEM VQ GPCDNG VJG #WVQEQPĹżIWTCVKQP feature. !UTOCONlGURATION 4YPE Select Stateful (DHCPv6) or Stateless. Refer to the next page for Stateless. )0V !DDRESS 2ANGE 3TART Enter the start IPv6 Address for the DHCPv6 range for your local computers. )0V !DDRESS 2ANGE %ND Enter the end IPv6 Address for the DHCPv6 range for your local computers. )0V !DDRESS ,IFETIME Enter the IPv6 Address Lifetime (in minutes). D-Link DIR-652 User Manual 50 5GEVKQP%QPĹżIWTCVKQP 3TATIC )0V 3TATELESS )0V #ONNECTION 4YPE Select Static IPv6 from the drop-down menu. WAN IPv6 Address Enter the address settings supplied by 3ETTINGS your Internet provider (ISP). ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. ,INK ,OCAL Displays the Routerâs LAN Link-Local !DDRESS Address. Enable %JGEM VQ GPCDNG VJG #WVQEQPĹżIWTCVKQP !UTOCONlGURATION feature. AutoconďŹguration Select Stateless. Refer to the previous 4YPE page for Stateful. Router Advertisement Enter the Router Advertisement Lifetime ,IFETIME (in minutes). D-Link DIR-652 User Manual 51 5GEVKQP%QPĹżIWTCVKQP $(#0V 3TATEFUL )0V #ONNECTION 4YPE Select DHCPv6 from the drop-down menu. )0V $.3 3ETTINGS Select either Obtain DNS server address automatically or Use the HQNNQYKPI&05#FFTGUU. 0RIMARY3ECONDARY $.3 Enter the primary and secondary DNS !DDRESS server addresses. ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. ,INK ,OCAL !DDRESS Displays the Routerâs LAN Link-Local Address. %NABLE !UTOCONlGURATION %JGEM VQ GPCDNG VJG #WVQEQPĹżIWTCVKQP feature. !UTOCONlGURATION 4YPE Select Stateful (DHCPv6) or Stateless. Refer to the next page for Stateless. )0V !DDRESS 2ANGE 3TART Enter the start IPv6 Address for the DHCPv6 range for your local computers. )0V !DDRESS 2ANGE %ND Enter the end IPv6 Address for the DHCPv6 range for your local computers. )0V !DDRESS ,IFETIME Enter the IPv6 Address Lifetime (in minutes). D-Link DIR-652 User Manual 52 5GEVKQP%QPĹżIWTCVKQP $(#0V 3TATELESS )0V #ONNECTION 4YPE Select DHCPv6 from the drop-down menu. )0V $.3 3ETTINGS Select either Obtain DNS server address automatically or Use the HQNNQYKPI&05#FFTGUU. 0RIMARY3ECONDARY $.3 Enter the primary and secondary DNS !DDRESS server addresses. ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. ,INK ,OCAL !DDRESS Displays the Routerâs LAN Link-Local Address. %NABLE !UTOCONlGURATION %JGEM VQ GPCDNG VJG #WVQEQPĹżIWTCVKQP feature. !UTOCONlGURATION 4YPE Select Stateless. Refer to the previous page for Stateful. Router Advertisement Enter the Router Advertisement Lifetime ,IFETIME (in minutes). D-Link DIR-652 User Manual 53 5GEVKQP%QPĹżIWTCVKQP )0V OVER 000O% 3TATEFUL )0V #ONNECTION 4YPE Select PPPoE from the drop-down menu. 000O% Enter the PPPoE account settings supplied by your Internet provider (ISP). !DDRESS -ODE Select Static if your ISP assigned you the IP address, subnet mask, gateway, and DNS server addresses. In most cases, select Dynamic. )0 !DDRESS Enter the IP address (Static PPPoE only). 5SER .AME Enter your PPPoE user name. 0ASSWORD Enter your PPPoE password and then retype the password in the next box. 3ERVICE .AME E n t e r t h e I S P S e r v i c e N a m e (optional). 2ECONNECTION -ODE Select either Always-on, On-Demand, or Manual. -AXIMUM )DLE 4IME Enter a maximum idle time during which the Internet connection is maintained during inactivity. To disable this feature, enable Auto-reconnect. D-Link DIR-652 User Manual 54 5GEVKQP%QPĹżIWTCVKQP )0V $.3 3ETTINGS Select either Obtain DNS server address automatically or Use the HQNNQYKPI&05#FFTGUU. 0RIMARY3ECONDARY $.3 Enter the primary and secondary DNS !DDRESS server addresses. ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. ,INK ,OCAL !DDRESS Displays the Routerâs LAN Link-Local Address. %NABLE !UTOCONlGURATION %JGEMVQGPCDNGVJG#WVQEQPĹżIWTCVKQP feature. !UTOCONlGURATION 4YPE S e l e c t S t a t e f u l ( D H C P v 6 ) o r Stateless. Refer to the next page for Stateless. )0V !DDRESS 2ANGE 3TART Enter the start IPv6 Address for the DHCPv6 range for your local computers. )0V !DDRESS 2ANGE %ND Enter the end IPv6 Address for the DHCPv6 range for your local computers. )0V !DDRESS ,IFETIME Enter the IPv6 Address Lifetime (in minutes). D-Link DIR-652 User Manual 55 5GEVKQP%QPĹżIWTCVKQP )0V OVER 000O% 3TATELESS )0V #ONNECTION 4YPE Select PPPoE from the drop-down menu. 000O% Enter the PPPoE account settings supplied by your Internet provider (ISP). !DDRESS -ODE Select Static if your ISP assigned you the IP address, subnet mask, gateway, and DNS server addresses. In most cases, select Dynamic. )0 !DDRESS Enter the IP address (Static PPPoE only). 5SER .AME Enter your PPPoE user name. 0ASSWORD Enter your PPPoE password and then retype the password in the next box. 3ERVICE .AME E n t e r t h e I S P S e r v i c e N a m e (optional). 2ECONNECTION -ODE Select either Always-on, On-Demand, or Manual. -AXIMUM )DLE 4IME Enter a maximum idle time during which the Internet connection is maintained during inactivity. To disable this feature, enable Auto-reconnect. D-Link DIR-652 User Manual 56 5GEVKQP%QPĹżIWTCVKQP )0V $.3 3ETTINGS Select either Obtain DNS server address automatically or Use the HQNNQYKPI&05#FFTGUU. 0RIMARY3ECONDARY $.3 Enter the primary and secondary !DDRESS DNS server addresses. ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. ,INK ,OCAL !DDRESS Displays the Routerâs LAN Link-Local Address. %NABLE !UTOCONlGURATION %JGEMVQGPCDNGVJG#WVQEQPĹżIWTCVKQP feature. !UTOCONlGURATION 4YPE Select Stateful (DHCPv6) or Stateless. Router Advertisement Enter the Router Advertisement ,IFETIME Lifetime (in minutes). D-Link DIR-652 User Manual 57 5GEVKQP%QPĹżIWTCVKQP TO 4UNNELING 3TATEFUL )0V #ONNECTION 4YPE Select 6 to 4 from the drop-down menu. TO 3ETTINGS Enter the IPv6 settings supplied by your Internet provider (ISP). 0RIMARY3ECONDARY $.3 Enter the primary and secondary DNS !DDRESS server addresses. ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. ,INK ,OCAL !DDRESS Displays the Routerâs LAN Link-Local Address. %NABLE !UTOCONlGURATION %JGEM VQ GPCDNG VJG #WVQEQPĹżIWTCVKQP feature. !UTOCONlGURATION 4YPE Select Stateful (DHCPv6) or Stateless. Refer to the next page for Stateless. )0V !DDRESS 2ANGE 3TART Enter the start IPv6 Address for the DHCPv6 range for your local computers. )0V !DDRESS 2ANGE %ND Enter the end IPv6 Address for the DHCPv6 range for your local computers. )0V !DDRESS ,IFETIME Enter the IPv6 Address Lifetime (in minutes). D-Link DIR-652 User Manual 58 5GEVKQP%QPĹżIWTCVKQP TO 4UNNELING 3TATELESS )0V #ONNECTION 4YPE Select 6 to 4 from the drop-down menu. TO 3ETTINGS Enter the IPv6 settings supplied by your Internet provider (ISP). 0RIMARY3ECONDARY $.3 Enter the primary and secondary DNS !DDRESS server addresses. ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. ,INK ,OCAL !DDRESS Displays the Routerâs LAN Link-Local Address. %NABLE !UTOCONlGURATION %JGEM VQ GPCDNG VJG #WVQEQPĹżIWTCVKQP feature. !UTOCONlGURATION 4YPE Select Stateless. Refer to the previous page for Stateful. Router Advertisement Enter the Router Advertisement Lifetime ,IFETIME (in minutes). D-Link DIR-652 User Manual 59 5GEVKQP%QPĹżIWTCVKQP )0V IN )0V 4UNNELING 3TATEFUL )0V #ONNECTION 4YPE Select IPv6 in IPv4 Tunnel from the dropdown menu. )0V IN )0V 4UNNEL Enter the settings supplied by your Internet 3ETTINGS provider (ISP). ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. )0V ,INK ,OCAL Displays the Routerâs LAN Link-Local !DDRESS Address. %NABLE !UTOCONlGURATION %JGEM VQ GPCDNG VJG #WVQEQPĹżIWTCVKQP feature. !UTOCONlGURATION 4YPE Select Stateful (DHCPv6) or Stateless. Refer to the next page for Stateless. )0V !DDRESS ,IFETIME Enter the IPv6 Address Lifetime (in minutes). D-Link DIR-652 User Manual 60 5GEVKQP%QPĹżIWTCVKQP )0V IN )0V 4UNNELING 3TATELESS -Y )0V #ONNECTION Select IPv6 in IPv4 Tunnel from the dropdown menu. )0V IN )0V 4UNNEL Enter the settings supplied by your Internet 3ETTINGS provider (ISP). ,!. )0V !DDRESS Enter the LAN (local) IPv6 address for the router. ,!. ,INK ,OCAL !DDRESS Displays the Routerâs LAN Link-Local Address. %NABLE !UTOCONlGURATION %JGEM VQ GPCDNG VJG #WVQEQPĹżIWTCVKQP feature. !UTOCONlGURATION 4YPE Select Stateful (DHCPv6) or Stateless. Refer to the previous page for Stateful. )0V !DDRESS 2ANGE 3TART Enter the start IPv6 Address for the DHCPv6 range for your local computers. )0V !DDRESS 2ANGE %ND Enter the end IPv6 Address for the DHCPv6 range for your local computers. Router Advertisement Enter the Router Advertisement Lifetime ,IFETIME (in minutes). D-Link DIR-652 User Manual 61 5GEVKQP%QPĹżIWTCVKQP Administrator Settings This page allows you to adjust the Admin and User account settings. The Admin account can view and change settings, while the User account can only view settings and cannot make any changes. Only the admin account has the ability to change both admin and user account passwords. After making your changes, click the 5CXG5GVVKPIU button. !DMIN 0ASSWORD Enter a new password for the Administrator Login Name. The administrator can make changes to the settings. 5SER 0ASSWORD Enter the new password for the User login. If you login as the User, you cannot change the settings (you can only view them). 'ATEWAY .AME Enter a name for the DIR-652 router. %NABLE 'RAPHICAL Enables a challenge-response test to require !UTHENTICATION users to type letters or numbers from a distorted image displayed on the screen to prevent online hackers and unauthorized users from gaining access to your routerâs network settings. Enable HTTPS Check to enable HTTPS to connect to the 3ERVER router securely. Enable Remote Remote management allows the DIR-652 -ANAGEMENT VQDGEQPĹżIWTGFHTQOVJG+PVGTPGVD[CYGD browser. A username and password is still required to access the Web-Management interface. In general, only a member of your network can browse the built-in web pages to perform Administrator tasks. This feature enables you to perform Administrator tasks from the remote (Internet) host. D-Link DIR-652 User Manual 62 5GEVKQP%QPĹżIWTCVKQP 2EMOTE !DMIN 0ORT The port number used to access the DIR652. 'ZCORNGJVVRZZZZYJGTGCUZZZZ is the Internet IP address of the DIR-652 and 8080 is the port used for the Web Management interface. If you have enabled and checked, you must enter as part of the URL to access the router remotely. Remote Admin ;QWOC[UGNGEVĹ#NNQY#NNĹVQCNNQYCNNVTCHĹżE )NBOUND &ILTER QTĹ&GP[#NNĹVQFGP[CNNVTCHĹżE;QWOC[CNUQ URGEKH[C[QWTQYPWUGTEQPĹżIWTGF+PDQWPF Filter. To set an Inbound Filter, simply click the Inbound Filter link and complete the instructions on that page. $ETAILS This area will display the Inbound Filter that is currently in place. D-Link DIR-652 User Manual 63 5GEVKQP%QPĹżIWTCVKQP Time Settings 6JG6KOG%QPĹżIWTCVKQPQRVKQPCNNQYU[QWVQEQPĹżIWTGWRFCVGCPFOCKPVCKPVJGEQTTGEVVKOGQPVJGKPVGTPCNU[UVGOENQEM(TQOVJKU UGEVKQP[QWECPUGVVJGVKOG\QPGVJCV[QWCTGKPCPFUGVVJG6KOG5GTXGT&C[NKIJV5CXKPIECPCNUQDGEQPĹżIWTGFVQCWVQOCVKECNN[CFLWUV the time when needed. 4IME :ONE Select the Time Zone from the drop-down menu. $AYLIGHT 3AVING To select Daylight Saving time manually, select enabled or disabled, and enter a start date and an end date for daylight saving time. Enable NTP is short for Network Time Protocol. NTP .40 3ERVER synchronizes computer clock times in a network of computers. Check this box to use a NTP server. This will only connect to a server on the Internet, not a local server. .40 3ERVER 5SED Enter the NTP server or select one from the drop-down menu. -ANUAL To manually input the time, enter the values KPVJGUGĹżGNFUHQTVJG;GCT/QPVJ&C[*QWT Minute, and Second and then click Set Time. You can also click #OPY 9OUR #OMPUTERS 4IME Settings. D-Link DIR-652 User Manual 64 5GEVKQP%QPĹżIWTCVKQP SysLog The Broadband Router keeps a running log of events and activities occurring on the Router. You may send these logs to a SysLog server on your network. Enable Logging to Check this box to send the router logs to a 3YS,OG 3ERVER SysLog Server. SysLog Server IP The address of the SysLog server that will be !DDRESS used to send the logs. You may also select your computer from the drop-down menu (only if receiving an IP address from the router via DHCP). D-Link DIR-652 User Manual 65 5GEVKQP%QPĹżIWTCVKQP Email Settings 6JG GOCKN HGCVWTG ECP DG WUGF VQ UGPF VJG U[UVGO NQI ĹżNGU TQWVGT CNGTV OGUUCIGU CPF ĹżTOYCTG WRFCVG PQVKĹżECVKQP VQ [QWT GOCKN address. Enable Email When this option is enabled, router activity logs .OTIlCATION are e-mailed to a designated e-mail address. &ROM %MAIL !DDRESS This e-mail address will appear as the sender YJGP[QWTGEGKXGCNQIĹżNGQTĹżTOYCTGWRITCFG PQVKĹżECVKQPXKCGOCKN 4O %MAIL !DDRESS Enter the e-mail address where you want the e-mail sent. SMTP Server Enter the SMTP server address for sending !DDRESS e-mail. If your SMTP server requires authentication, select this option. Enable Check this box if your SMTP server requires !UTHENTICATION authentication. !CCOUNT .AME Enter your account for sending e-mail. 0ASSWORD Enter the password associated with the account. Re-type the password associated with the account. D-Link DIR-652 User Manual 66 5GEVKQP%QPĹżIWTCVKQP /N ,OG &ULL When this option is selected, logs will be sent via e-mail when the log is full. /N 3CHEDULE Selecting this option will send the logs via e-mail according to schedule. 3CHEDULE This option is enabled when On Schedule is selected. You can select a schedule from the NKUVQHFGĹżPGFUEJGFWNGU6QETGCVGCUEJGFWNG go to 4OOLS 3CHEDULES. D-Link DIR-652 User Manual 67 5GEVKQP%QPĹżIWTCVKQP System Settings Save to Local Use this option to save the current router (ARD $RIVE EQPĹżIWTCVKQPUGVVKPIUVQCĹżNGQPVJGJCTFFKUM of the computer you are using. First, click the 5CXG DWVVQP ;QW YKNN VJGP UGG C ĹżNG FKCNQI YJGTG[QWECPUGNGEVCNQECVKQPCPFĹżNGPCOG for the settings. Load from Local Use this option to load previously saved (ARD $RIVE router configuration settings. First, use the $TQYUG EQPVTQN VQ ĹżPF C RTGXKQWUN[ UCXG ĹżNG QHEQPĹżIWTCVKQPUGVVKPIU6JGPENKEMVJG.QCF button to transfer those settings to the router. Restore to 6JKUQRVKQPYKNNTGUVQTGCNNEQPĹżIWTCVKQPUGVVKPIU &ACTORY $EFAULT back to the settings that were in effect at the time the router was shipped from the factory. Any settings that have not been saved will be lost, including any rules that you have created. If [QWYCPVVQUCXGVJGEWTTGPVTQWVGTEQPĹżIWTCVKQP settings, use the Save button above. 2EBOOT $EVICE Click to reboot the router. D-Link DIR-652 User Manual 68 5GEVKQP%QPĹżIWTCVKQP 5PDATE &IRMWARE ;QWECPWRITCFGVJGĹżTOYCTGQHVJG4QWVGTJGTG/CMGUWTGVJGĹżTOYCTG[QWYCPVVQWUGKUQPVJGNQECNJCTFFTKXGQHVJGEQORWVGT Click on Browse VQNQECVGVJGĹżTOYCTGĹżNGVQDGWUGFHQTVJGWRFCVG2NGCUGEJGEMVJG&.KPMUWRRQTVUKVGHQTĹżTOYCTGWRFCVGUCVJVVR UWRRQTVFNKPMEQO;QWECPFQYPNQCFĹżTOYCTGWRITCFGUVQ[QWTJCTFFTKXGHTQOVJG&.KPMUWRRQTVUKVG &IRMWARE 5PGRADE Click on #HECK /NLINE .OW FOR ,ATEST &IRMWARE Version to find out if there is an updated ĹżTOYCTGKHUQFQYPNQCFVJGPGYĹżTOYCTGVQ your hard drive. "ROWSE #HVGT[QWJCXGFQYPNQCFGFVJGPGYĹżTOYCTG click BrowseVQNQECVGVJGĹżTOYCTGWRFCVGQP your hard drive. Click 5PLOAD to complete the ĹżTOYCTGWRITCFG D-Link DIR-652 User Manual 69
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.6 Linearized : Yes Encryption : Standard V2.3 (128-bit) User Access : Print, Copy, Extract, Print high-res XMP Toolkit : 3.1-701 Modify Date : 2010:07:19 11:30:11+08:00 Create Date : 2010:07:19 11:29:48+08:00 Metadata Date : 2010:07:19 11:30:11+08:00 Creator Tool : PScript5.dll Version 5.2 Format : application/pdf Title : User's manual.pdf Creator : WendyLiao Document ID : uuid:37f7f50c-5766-40d2-9cdc-5d3d64c57721 Instance ID : uuid:78f3eedd-fce9-4114-bfd4-f46b684a1ccc Producer : Acrobat Distiller 7.0 (Windows) Page Count : 74 Author : WendyLiaoEXIF Metadata provided by EXIF.tools