GTBR13_cover M_spine20_5 91355 9789241564656 Eng

User Manual: 91355

Open the PDF directly: View PDF PDF.
Page Count: 306

DownloadGTBR13_cover M_spine20_5 91355 9789241564656 Eng
Open PDF In BrowserView PDF
Warning: This report is out-of-date. In particular, entire
time-series of TB disease burden estimates are updated
every year. For the latest data and analysis, please see
the most recent edition of the global TB report.

Global
tuberculosis
report
2013

WHO Library Cataloguing-in-Publication Data
Global tuberculosis report 2013.
1.Tuberculosis – epidemiology. 2.Tuberculosis, Pulmonary – prevention and control. 3.Tuberculosis – economics.
4.Tuberculosis, Multidrug-Resistant. 5.Annual reports. I.World Health Organization.
ISBN 978 92 4 156465 6

(NLM classification: WF 300)

© World Health Organization 2013
All rights reserved. Publications of the World Health Organization are available on the WHO web site (www.who.int) or can be purchased from
WHO Press, World Health Organization, 20 Avenue Appia, 1211 Geneva 27, Switzerland (tel.: +41 22 791 3264; fax: +41 22 791 4857; e-mail:
bookorders@who.int). Requests for permission to reproduce or translate WHO publications – whether for sale or for non-commercial distribution
– should be addressed to WHO Press through the WHO web site (www.who.int/about/licensing/copyright_form/en/index.html).
The designations employed and the presentation of the material in this publication do not imply the expression of any opinion whatsoever on
the part of the World Health Organization concerning the legal status of any country, territory, city or area or of its authorities, or concerning
the delimitation of its frontiers or boundaries. Dotted lines on maps represent approximate border lines for which there may not yet be full
agreement.
The mention of specific companies or of certain manufacturers’ products does not imply that they are endorsed or recommended by the World
Health Organization in preference to others of a similar nature that are not mentioned. Errors and omissions excepted, the names of proprietary
products are distinguished by initial capital letters.
All reasonable precautions have been taken by the World Health Organization to verify the information contained in this publication. However,
the published material is being distributed without warranty of any kind, either expressed or implied. The responsibility for the interpretation
and use of the material lies with the reader. In no event shall the World Health Organization be liable for damages arising from its use.
Cover design by Tom Hiatt, Western Pacific Regional Office and Irwin Law, WHO headquarters. The front cover illustrates the latest status of
global progress for five indicators that are part of the Millennium Development Goals framework. These are the incidence rate of tuberculosis
disease per 100 000 population per year, the prevalence of tuberculosis disease per 100 000 population, the tuberculosis mortality rate per 100
000 population per year, the case detection rate (the number of cases detected and reported to national tuberculosis programmes divided by
the estimated incidence) and the treatment success rate for new TB patients started on treatment. Each pair of shapes represents both the most
recent level of the indicator and a baseline year against which progress is measured. For incidence (green and dark orange), prevalence (grey and
pink) and mortality (light orange and light blue), the top of the combined height of each pair of shapes shows the level in 1990. The lower of the
two shapes in each pair shows the level in 2012. For the case detection rate, the combined height of each pair of shapes (dark blue and brown)
shows the level in 2012 and the lower of the two shapes (dark blue) illustrates the level in 1995. For the treatment success rate (red and yellow),
the combined height of each pair shows the level in 2011 and the lower of the two shapes (red) shows the level in 1995. More information about
these indicators and progress towards global targets are provided in Chapter 2 and Chapter 3 of the Global Tuberculosis Report 2013.
Designed by minimum graphics
Printed in France
WHO/HTM/TB/2013.11

Contents

Abbreviations

iv

Acknowledgements

v

Executive summary

ix

Chapter 1. Introduction

1

Chapter 2. The burden of disease caused by TB

6

%JCRVGT 6$ECUGPQVKßECVKQPUCPFVTGCVOGPVQWVEQOGU



Chapter 4. Drug-resistant TB

45

Chapter 5. Diagnostics and laboratory strengthening

59

%JCRVGT #FFTGUUKPIVJGEQGRKFGOKEUQH6$CPF*+8



Chapter 7. Financing

75

%JCRVGT 4GUGCTEJCPFFGXGNQROGPV



Annexes
1. Methods used to estimate the global burden of disease caused by TB

99

 %QWPVT[RTQßNGU



 4GIKQPCNRTQßNGU



4. Key indicators for the world, WHO regions and individual countries

145

GLOBAL TUBERCULOSIS REPORT 2013

iii

Abbreviations

ACSM
ACTG
ADR
AFB
AIDS
ARI
ART
BCG
BRICS
CDR
CEM
CFR
CFU
CPT
CBC
DOTS
DR-TB
DRS
DST
DS-TB
DTLC
EBA
ECDC
ERR
EU
FDA
FIND
GDP
GLC
GLI
GNI
HBC
HIV
HR
ICD-10
IDRI
IGRA
IPAQT
IPT
IRR
LED
LPA

iv

Advocacy, Communication and Social
Mobilization
AIDS Clinical Trials Group
adverse drug reactions
acid-fast bacilli
acquired immunodeficiency syndrome
annual risk of infection
antiretroviral therapy
Bacille-Calmette-Guérin
Brazil, Russian Federation, India, China,
South Africa
case detection rate
cohort event monitoring
case fatality rate
colony-forming units
co-trimoxazole preventive therapy
community-based care
the basic package that underpins the Stop
TB Strategy
drug-resistant tuberculosis
drug resistance surveillance
drug susceptibility testing
drug-susceptible tuberculosis
District TB and Leprosy Coordinator
early bactericidal activity
European Centre for Disease Prevention and
Control
electronic recording and reporting
European Union
Food and Drug Administration
Foundation for Innovative New Diagnostics
gross domestic product
Green Light Committee
Global Laboratory Initiative
gross national income
high-burden country
human immunodeficiency virus
Hazard ratio
International Classification of Diseases
(10th revision)
Infectious Disease Research Institute
interferon-gamma release assay
Initiative for Promoting Affordable, Quality
TB Tests
isoniazid preventive therapy
incidence rate ratio
light-emitting diode
line-probe assay

GLOBAL TUBERCULOSIS REPORT 2013

LTBI
MDG
MDR-TB
MNCH
NAAT
NAP
NFM
NTP
OECD

latent TB infection
Millennium Development Goal
multidrug-resistant tuberculosis
maternal, newborn and child health
nucleic acid amplification test
national AIDS programme
new funding model
national tuberculosis [control] programme
Organisation for Economic Co-operation and
Development
OR
Operational research
PAL
Practical Approach to Lung health
PCR
polymerase chain reaction
PDA
personal digital assistant
PEPFAR US President’s Emergency Plan for AIDS Relief
POC
point of care
PPM
public–private mix
QMS
quality management system
rGLC
Regional Green Light Committee
RNTCP
Revised National TB Control Programme
[India]
rRNA
ribosomal ribonucleic acid
RR
relative risk
RR-TB
rifampicin-resistant tuberculosis
SD
standard deviation
SITT
Integrated Tuberculosis Information System
SRL
supranational reference laboratory
STAG-TB Strategy and Technical Advisory Group for TB
TAG
Treatment Action Group
TB
tuberculosis
TB-MAC TB Modelling and Analysis Consortium
TB-TEAM Tuberculosis Technical Assistance Mechanism
TBVI
Tuberculosis Vaccine Initiative
TFM
transitional funding mechanism
TST
tuberculin skin test
UHC
universal health coverage
UN
United Nations
UNAIDS Joint United Nations Programme on HIV/AIDS
UNITAID international facility for the purchase of
diagnostics and drugs for diagnosis and
treatment of HIV/AIDS, malaria and TB
USAID
United States Agency for International
Development
UNPD
United Nations Population Division
VR
vital registration
WHO
World Health Organization
XDR-TB extensively drug-resistant tuberculosis
ZN
Ziehl Neelsen

Acknowledgements

This global tuberculosis (TB) report was produced by a core
team of 15 people: Annabel Baddeley, Anna Dean, Hannah Monica Dias, Dennis Falzon, Katherine Floyd, Inés
Garcia, Philippe Glaziou, Tom Hiatt, Irwin Law, Christian
Lienhardt, Linh Nguyen, Charalambos Sismanidis, Hazim
Timimi, Wayne van Gemert and Matteo Zignol. The team
was led by Katherine Floyd. Overall guidance was provided
by the Director of the Global TB Programme, Mario Raviglione.
The data collection forms (long and short versions)
were developed by Philippe Glaziou and Hazim Timimi,
with input from staff throughout the WHO Global TB
Programme. Hazim Timimi led and organized all aspects
of data management. Inés Garcia and Andrea Pantoja
conducted all review and follow-up of financial data. The
review and follow-up of all other data was done by a team
of reviewers. This included Annabel Baddeley, Annemieke
Brands, Andrea Braza, Katsura Danno, Anna Dean, Hannah Monica Dias, Dennis Falzon, Wayne van Gemert, Soleil
Labelle, Knut Lönnroth, Linh Nguyen, Salah Ottmani,
Hazim Timimi, Fraser Wares and Matteo Zignol at WHO
headquarters; Amal Bassili from the Eastern Mediterranean Regional Office; and Suman Jain, Sai Pothapregada,
Nino Mdivani, Eliud Wandwalo and Mohammed Yassin
from the Global Fund. Data for the European Region were
collected and validated jointly by the WHO Regional Office
for Europe and the European Centre for Disease Prevention and Control (ECDC); we thank in particular Encarna
Gimenez, Vahur Hollo and Csaba Ködmön from ECDC for
providing validated data files and Andrei Dadu from the
WHO Regional Office for Europe for his substantial contribution to follow-up and validation of data for all European countries. Review of TB/HIV data was undertaken in
collaboration with Michel Beusenberg, Chika Hayashi, Lisa
Nelson and Michelle Williams from the WHO HIV department. Victoria Bendaud, Josephine Dy, and Taavi Erkkola
from UNAIDS managed the process of data collection from
national AIDS programmes, provided a TB/HIV dataset
and worked closely with WHO staff to review and validate
TB/HIV data.
Philippe Glaziou and Charalambos Sismanidis prepared
estimates of TB disease burden and associated figures and
tables (Chapter 2), with support from Tom Hiatt. Particular
thanks are due to Carel Pretorius (Futures Institute), who
worked closely with Philippe Glaziou on analyses and related estimates of TB mortality among HIV-positive people,
as well as to Dennis Falzon for coordinating a systematic
review that was used to produce estimates of mortality

related to multidrug-resistant TB (MDR-TB) and to Harish
Nair and Luciana Brondi from the University of Edinburgh
for conducting this review. Tom Hiatt prepared all figures
and tables on TB notification and treatment outcome data
(Chapter 3). Anna Dean, Dennis Falzon and Matteo Zignol
analysed data and prepared the figures and tables related to
drug-resistant TB (Chapter 4), with input from Charalambos Sismanidis. Tom Hiatt and Wayne van Gemert prepared
figures and tables on laboratory strengthening and the rollout of new diagnostics (Chapter 5). Annabel Baddeley, Katsura Danno, Tom Hiatt and Linh Nguyen analysed TB/HIV
programmatic data and prepared the associated figures and
tables (Chapter 6). Inés Garcia and Andrew Siroka analysed
financial data, and prepared the associated figures and
tables (Chapter 7). Christian Lienhardt, Christopher Gilpin
and Karin Weyer prepared the figures on the pipelines for
new TB drugs, diagnostics and vaccines (Chapter 8), with
input from the respective Working Groups of the Stop TB
Partnership. Tom Hiatt coordinated the finalization of all
figures and tables and was the focal point for communications with the graphic designer.
The writing of the main part of the report was led by
Katherine Floyd, with contributions from Dennis Falzon,
Philippe Glaziou, Irwin Law, Ikushi Onozaki, and Charalambos Sismanidis (Chapter 2); Hannah Monica Dias, Wayne
van Gemert, Haileyesus Getahun, Thomas Joseph, Mukund
Uplekar and Lana Tomaskovic (Chapter 3); and Inés Garcia and Christian Gunneberg (Chapter 7). Chapter 4, on
drug-resistant TB, was prepared by Anna Dean, Dennis Falzon and Matteo Zignol, with input from Katherine Floyd,
Philippe Glaziou and Charalambos Sismanidis. Chapter 5,
on diagnostics and laboratory strengthening, was prepared
by Wayne van Gemert, with input from Christopher Gilpin,
Fuad Mirzayev and Karin Weyer. Chapter 6 was prepared by
Annabel Baddeley, Haileyesus Getahun, Linh Nguyen and
Katherine Floyd. Chapter 8, on research and development,
was led by Christian Lienhardt, with inputs from Christopher Gilpin, Karin Weyer and Katherine Floyd. Chapter
8 was carefully reviewed by the chairs and secretariats of
the Working Groups of the Stop TB Partnership. Particular
thanks are due to Michael Brennan, Uli Fruth and Jennifer
Woolley (new vaccines); Daniela Cirillo (new diagnostics);
and Barbara Laughon and Mel Spigelman (new TB drugs).
The report team is also grateful to Emily Bloss (US Centers
for Disease Control and Prevention) and Hillary Kipruto (WHO Country Office, Kenya) for their contributions
to content related to strengthening of TB surveillance in
Chapter 2, including a case study of the introduction of

GLOBAL TUBERCULOSIS REPORT 2013

v

electronic recording and reporting in Kenya; to Rajendra
Yadav and Masami Fujita (WHO Country Office, Cambodia)
for their contribution to an analysis of the integration of
TB, HIV and mother and child health services in Cambodia
(Chapter 6); and to various internal and external reviewers
for useful comments and suggestions on advanced drafts
of chapter text.
The special supplement on the “Countdown to 2015” that
accompanies the global report was prepared by Anna Dean,
Hannah Monica Dias, Katherine Floyd, Irwin Law, Mario
Raviglione, Diana Weil and Karin Weyer, with valuable
inputs from many people at global, regional and country
levels. We thank in particular Sai Pothapregada and Eliud
Wandwalo from the Global Fund, who facilitated discussions with and inputs from many Fund Portfolio Managers.
Annex 1, which explains methods used to produce estimates of the burden of disease caused by TB, was written
by Philippe Glaziou and Charalambos Sismanidis with
very helpful input from Carel Pretorius. We thank Colin
Mathers of the WHO Mortality and Burden of Disease team
for his careful review. The country profiles that appear in
Annex 2 and the regional profiles that appear in Annex 3
were prepared by Hazim Timimi. Annex 4, which contains
a wealth of global, regional and country-specific data from
the global TB database, was prepared by Tom Hiatt and
Hazim Timimi.
We thank Pamela Baillie in the Global TB Programme’s
monitoring and evaluation team for impeccable administrative support, Doris Ma Fat from the WHO Mortality
and Burden of Disease team for providing TB mortality
data extracted from the WHO Mortality Database, and
Peter Ghys, Mary Mahy and Karen Stanecki (UNAIDS) for
providing epidemiological data that were used to estimate
HIV-associated TB mortality.
The entire report was edited by Tim France (Inis Communication). We thank him for his excellent work. We also
thank, as usual, Sue Hobbs for her excellent work on the
design and layout of this report. Her contribution, as in
previous years, was greatly appreciated.
The principal source of financial support for WHO work
on global TB monitoring and evaluation is the United States
Agency for International Development (USAID), without
which it would be impossible to produce the Global Tuberculosis Report. Production of the report was also supported
by the governments of Japan and the Republic of Korea. We
acknowledge with gratitude their support.
In addition to the core report team and those mentioned
above, the report benefited from the input of many staff
working in WHO regional and country offices and hundreds
of people working for national TB programmes or within
national surveillance systems who contributed to the
reporting of data and to the review of report material prior
to publication. These people are listed below, organized by
WHO region. We thank them all for their invaluable contribution and collaboration, without which this report could
not have been produced.
Among the WHO staff not already mentioned above, we

vi

GLOBAL TUBERCULOSIS REPORT 2013

thank in particular Khurshid Alam Hyder, Daniel Kibuga,
Rafael López Olarte, André Ndongosieme, Wilfred Nkhoma
and Henriette Wembanyama for their major contribution
to facilitation of data collection, validation and review.

9*1staHHinregionalandcoWntr[oHßces
WHO African Region
Harura Adamu, Boubacar Ould Abdel Aziz, Esther Aceng,
Inacio Alvarenga, Balde Amadou, Ayodele Awe, Sanni Babatunde, Bazie Babou, Nayé Bah, Marie Barouan, Abera Bekele,
Norbert Bidounga, Gaël Claquin, Augusto da Cruz Claudina, Peter Clement, Noel Djemadji, Ismael Hassen Endris,
Amos Omoniyi Fadare, Louisa Ganda, Boingotlo Gasennelwe, Patrick Hazangwe, Joseph Imoko, Michael Jose,
Joel Kangangi, Katherine Lao, Nzuzi Katondi, Bah Keita,
Daniel Kibuga, Hillary Kipruto, Désiré Aristide Komangoya
Nzonzo, Sharmila Lareef-Jah, Frank Lule, Mwendaweli
Maboshe, Mbemba Leonard, Richard Mbumba, Julie Mugabekazi, André Ndongosieme, Denise Nkezimana, Wilfred
Nkhoma, Nicolas Nkiere, Ghislaine Nkone Asseko, Ishmael
Nyasulu, Laurence Nyiramasarabwe, Samuel Ogiri, Daniel
Olusoti, Amos Omoniyi, Chijioke Osakwe, Felicia Owusu-Antwi, Philips Patrobas, Kalpeshsinh Rahevar, Bacary
Sambou, Kefas Samson, Neema Simkoko, Desta Tiruneh,
Alexis Tougordi, Henriette Wembanyama.

WHO Region of the Americas
Monica Alonso Gonzalez, Angel Manuel Alvarez, Luis
Gerardo Castellanos, Gerardo de Cossio, Rachel Eersel,
Marcos Espinal, Ingrid García, Mirtha Del Granado, Rosalinda Hernández, Vidalia Lesmo, Rafael López Olarte,
Wilmer Marquiño, Thais dos Santos, Alfonso Tenorio, Jorge
Victoria, Anna Volz.

WHO Eastern Mediterranean Region
Mohamed Abdel Aziz, Ali Akbar, Samiha Baghdadi, Amal
Bassili, Najwa El Emam, Hamida Khattabi, Aayid Munim,
Ghulam Nabi Kazi, Ali Reza Aloudel, Gabriele Riedner,
Karam Shah, Sindani Ireneaus Sebit, Bashir Suleiman,
Rahim Taghizadeh.

WHO European Region
Martin van den Boom, Brenda van den Bergh, Andreea
Cassandra Butu, Silvu Ciobanu, Pierpaolo de Colombani,
Andrei Dadu, Irina Danilova, Masoud Dara, Jamshid
Gadoev, Gayane Ghukasyan, Sayohat Hasanova, Arax Hovhannesyan, Saliya Karymbaeva, Mehmet Kontas, Kristin
Kremer, Dmitriy Pashkevich, Valiantsin Rusovich, Bogdana Shcherbak-Verlan, Javahir Suleymanova, Szabolcs
Szigeti, Melita Vujnovic.

WHO South-East Asia Region
Mohammad Akhtar, Vikarunnesa Begum, Erwin Cooreman, Deki, Khurshid Alam Hyder, Navaratnasingam
Janakan, Kim Tong Hyok, La Win Maung, Jorge Luna, Partha Mandal, Amaya Maw-Naing, Giampaolo Mezzabotta,

Bo Myint, Ye Myint, Eva Nathanson, Rajesh Pandav, Razia
Pendse, Sri Prihatini, K Rezwan, Rim Kwang Il, Hwang Kum
Ryong, Mukta Sharma, Aminath Shenalin, Achuthan Nair
Sreenivas, Chawalit Tantinimitkul, Wangchuk Lungten.

9*19GUVGTP2CEKßE4GIKQP
Shalala Ahmadova, Niño Dayanghirang, Asaua Faasino,
Salu Failauga, Ogtay Gozalov, Cornelia Hennig, Tom Hiatt,
Tauhid Islam, Narantuya Jadambaa, Ridha Jebeniani, Sung
Hye Kim, Miwako Kobayashi, Woo-Jin Lew, Katsunori
Osuga, Khanh Pham, Fabio Scano, Jacques Sebert, Catharina van Weezenbeek, Rajendra Yadav, Dongbao Yu.

National respondents who contributed to
reporting and verißcation oH data
WHO African Region
Abdou-Salam Abderemane, Ouédraogo Adama, Abdelrahim Barka Abderramane, Jean Louis Abena Foe, Sofiane
Alihalassa, Arlindo Amaral, Kouamé Amenan, Séverin
Anagonou, Younoussa Assoumani, Georges Bakaswa, Adama Marie Bangoura, Jorge Noel Barreto, Ballé Boubakar,
Victor Bonkoungou, Frank Adae Bonsu, Miguel Camara,
Evangelista Chisakaitwa, Ernest Cholopray, Nkemdilim
Chukwueme, Catherine Cooper, Swasilanne da Silva, B. de
Sousa Bandeira, Isaias Dambe, Davi Kokou Mawulé, Serge
Diagbouga, Aicha Diakité, Awa Helene Diop, Sicelo Dlamini, Themba Dlamini, Thaddée Ndikumana, Oumou Fofana,
Susan Gacheri, Evariste Gasana, Michel Gasana, Sandile
Ginindza, Martin Gninafon, Nii Nortey Hanson-Nortey,
Adama Jallow, Saffa Kamara, Madou Kane, Henry Kanyerere, Nathan Kapata, Biruck Kebede, Kerram Aziza, Deogratias Kibambazi, Patrick Konwuloh, Jacquemin Kouakou,
Popaul Kulonga, Rossin Lebeke, Lillian Ishengoma, Llang
Bridget Maama-Maime, Marcel Lougue, Maxime Lunga,
Ghislaine Mabeluanga Tshitenge, Jocelyn Mahoumbou,
Angelo Makpenon, David Mametja, Ivan Manhiça, Tseliso
Marata, Farai Mavhunga, Mba Bekolo Frenk José Mathieu,
Salem Salem Mohameden, Louine Morel, Youwaoga Isidore
Moyenga, James Mpunga, Frank Mugabe, Kenneth Mugisha, Clifford Munyandi, Lindiwe Mvusi, Aboubacar Mzembaba, Ronald Ncube, Fulgence Ndayikengurukiye, Yvon
Martial Ngana, Antoine Ngoulou, Lourenço Nhocuana,
Blasdus Franz Njako, Emmanuel Nkiligi, M Nkou, Joshua Obasanya, Davidson Ogunade, Hermann Ongouo,
Abdelhadi Oumar, Issoufou Ousmane, Maria Conceição
Palma, Victor Pereira, Thato Raleting, Sahondra Jeanine
Randriambeloson, Rujeedawa Mohammed Fezul, Samey
Agbenyegan, Charles Sandy, Kebba D Sanneh, Marie Sarr
Diouf, Mineab Sebhatu, Mamie Shoma, Angele Shoma
Matota, René Simalo, Joseph Sitienei, Nicholas Siziba,
Philippe Takongo, Celstino Francisco Teixeira, Mohamed
Abdallahi Traoré, Nassiama Traoré, Kassim Traoré, Alie
Wurie, Eucher Dieudonné Yazipo, Ranivomahefa Myrienne
Bakoliarisoa Zanajohary, Abbas Zezai, Eric Ismaël Zoungrana.

WHO Region of the Americas
Christian Acosta, Shalauddin Ahmed, Valentina Antonieta Alarcon Guizado, Xochil Alemán de Cruz, Kiran kumar
Alla, Valeria Almanza Torrez, Mirian Alvarez, Raúl Álvarez, Aisha Andrewin, A. Alister Antoine, Chris Archibald,
Carlos Alberto Marcos Ayala Luna, Wiedjaiprekash Balesar, Draurio Barreira, Patricia Bartholomay, Soledad Beltrame, María del Carmen Bermúdez, Lynrod Brooks, Marta
Calona de Abrego, Martín Castellanos Joya, Jorge Castillo
Carbajal, Kenneth Castro, Judith Cazares, Gemma Chery,
Carlos Cuadra, Ofelia Cuevas, D’Auvergne Cleophas, Jose
Davy, Cecilia de Arango, Eva de Weever-Lista, Camille Deleveaux, Dy-Juan De Roza, Roger Duncan, España Cedeño
Mercedes, Manuel Salvador España Rueda, Fernandez
Hugo, Cecilia Figueroa Benites, Victor Gallant, Julio Garay
Ramos, Sarita Aguirre García, Izzy Gerstenbluth, Margarita Godoy, Roscio Gómez, Ilse Maria Góngora Rivas, Silvino González, Yaskara Halabi, Kevin Harvey, Dorothea
Hazel, Maria Henry, Tania Herrera, Carla Jeffries, Dihadenys Lemus Molina, Athelene Linton, Maria Josefa Llanes
Cordero, Marvin Andres Maldonado Rivera, Maldonado
Saavedra Andrea, Marcelino Belkys, Eva Martìnez, María
de Lourdes Martínez Olivares, Zeidy Mata Azofeifa, Joan
McLeod-Simon, Timothy McLaughlin-Munroe, Roque
Miramontes, Leilawatie Mohammed, Jeetendra Mohanlall,
Ernesto Moreno, Francis Morey, Willy Morose, Michael
Owen, Cheryl Peek-Ball, Janelle Pickering, Tomasa Portillo, Irad Potter, Manohar Singh Rajamanickam, Dottin
Ramoutar, Anna Esther Reyes Godoy, Paul Ricketts, Jorge
Rodriguez De Marco, Myrian Román, Nilda de Romero,
Carolyn Russell, Wilmer Salazar, Deborah Stijnberg, Sutton
Jackurlyn, Torres Clarita, Maribelle Tromp, William Turner, Melissa Valdez, Daniel Vázquez, Nestor Vera, Michael
Williams, David Yost, Oritta Zachariah.

WHO Eastern Mediterranean Region
Fadhil Abbas, Mohammad S Abouzeid, Khaled Abu Ruhman, Nadia Abu Sabra, Ahmadi Shahnaz, Mohamed Redha
Al Lawati, Al Saidi Fatmah, Samia Ali Alagab, Abdelbary
Abdullah Ahmed Al-Hammadi, Abdullatif Al-Khal, Saeed
Al Saffar, Kifah Alshaqeldi, Bahnasy Samir, Bennani Kenza, Kinaz Cheikh, Walid Daoud, Mohamed Furjani, Amal
Galal, Dhikrayet Gamara, Assia Haissama Mohamed, Hiba
Kamal Hamad Elneel, Kaalthoom Hassan, Hawa Hassan
Guessod, Lou Joseph, Onwar Otien Jwodh Chol, Basharat
Khan, Joseph Lasu, Sayed Daoud Mahmoodi, Khadiga Adam Mohammed, Mokhtar Alaa, Mulham Mustafa,
Nasehi Mahshid, Ejaz Qadeer, Mohammad Khalid Seddiq,
Sghiar Mohammed, Mohemmed Tabena, Tamara Tayeb,
Najib Abdul aziz Abdullah Thabit, Seddik Walha, Yaacoub
Hiam.

WHO European Region
Abildaev Tleukhan Shildebaevich, Mokhonim Abdulloeva,
Ibrahim Abubakar, Rafig Abuzarov, Nurhan Albayrak,
Natavan Alikhanova, Avtandil Alisherov, Ewa Augustynowicz-

GLOBAL TUBERCULOSIS REPORT 2013

vii

Kopeć, Ekkehardt Altpeter, Laura Anderson, Delphine
Antoine, Trude Margrete Arnesen, Rusudan Aspindzelashvili, Andrei Astrovko, Elizabeta Bachiyska, Anna Ivanovna
Barbova, Yana Besstraschnova, Venera Lazarevna Bismilda, Oktam Ikramovich Bobokhojaev, Olivera Bojovic, Eric
C. Böttger, Bonita Brodhun, Noa Cedar, Daniel Chemtob,
Domnica Ioana Chiotan, Ana Ciobanu, Nico Cioran, Andra
Cirule, Thierry Comolet, Radmila Curcic, Manfred Danilovitš, Edita Davidaviciene, Hayk Davtyan, Pava Dimitrijevic,
António Diniz, Francis Drobniewski, Raquel Duarte, Mladen Duronjic, Connie Erkens, Jennifer Fernandez Garcia,
Lyalya Gabbasova, Viktor Gasimov, Lárus Jón Guðmundsson, Gennady Gurevich, Walter Haas, Hasan Hafizi, Evgeny Hanyukov, Armen Hayrapetyan, Peter Helbling, Sven
Hoffner, Daniela Homorodean, Jahongir Jurakhonovich
Ismoilov, Mamuka Japaridze, Vincent Jarlier, Soledad
Jiménez Pajares, Jerker Jonsson, Abdullat Kadyrov, Gulmira Kalmambetova, Dmitry Klymuk, Maria KorzeniewskaKosela, Ainura Koshoeva, Košnik Mitja, Gabor Kovacs,
Tiina Kummik, Nino Lomtadze, Stevan Lučić, Jasminka
Maglajllic, Turid Mannsåker, Mathys Vanessa, Rafail Mehdiyev, Rukije Mehmeti, Donika Mema, Vladimir Milanov,
Alvard Mirzoyan, Gjyle Mulliqi, Gulnora Murmusaeva,
Seher Musaonbasioglu, Ucha Nanava, Zdenka Novakova,
Joan O’Donnell, Analita Pace Asciak, Clara Palma Jordana,
Elena Pavlenko, Olga Pavlova, Monique Perrin, Edita Pimkina, Monika Polanova, Georgeta Gilda Popescu, Gordana
Radosavljevic Asic, Bozidarka Rakocevic, Thomas Rendal,
Vija Riekstina, Jerome Robert, Elena Rodríguez Valín, Tom
Rogers, Elena Romancenco, Kazimierz Roszkowski-Sliz,
Sabine Rüsch-Gerdes, Branislava Savic, Gérard Scheiden,
Hasia Kaidar Shwartz, Anabela Silva, Girts Skenders, Cathrine Slorbak, Erika Slump, Hanna Soini, Ivan Solovic, Dick
van Soolingen, Flemming Stenz, Sergey Sterlikov, Jana
Svecova, Svetina Šorli Petra, Silva Tafaj, Talevski Stefan,
Odorina Tello Anchuela, Mirzagaleb Tillyashaykhov, Aida

viii

GLOBAL TUBERCULOSIS REPORT 2013

Ustamujic, Gulnoz Uzakova, Tonka Varleva, Piret Viiklepp,
Cveta Vragoterova, Gerard de Vries, Jiri Wallenfels, Wanlin Maryse, Pierre Weicherding, Aysegul Yildirim, Zakoska
Maja, Oksana Zalutskaya, Ilona Zemanová, Manca Žolnir
Dovč, Hasan Zutic.

WHO South-East Asia Region
Shina Ahmed, Aminath Aroosha, Choe Kum Song,
Emdadul Hoque, RS Gupta, Sirinapha Jittimanee, Suksont
Jittimanee, Niraj Kulshrestha, Constantino Lopes, Thandar Lwin, Dyah Erti Mustikawati, Tin Zar Naing, Chawetsan Namwat, Md Nuruzzaman Haque, Nirupa Pallewatta,
Rajendra Prasad Pant, Kiran Rade, Dyah Armi Riana, Chewang Rinzin, Sudath Samaraweera, Gamini Senevirathne,
Janaka Thilakarathne, Sabino Viegas, Bimal Kumar Yadav.

9*19GUVGTP2CEKßE4GIKQP
Paul Aia, Cecilia Teresa T. Arciaga, Nemia Bainivalu, Christina Bareja, Risa J. Bukbuk, Cheng Shiming, Phonenaly
Chittamany, Chou Kuok Hei, Nese Ituaso Conway, Du
Xin, Mayleen J. Ekiek, Fanai Saen, Rangiau Fariu, Ludovic
Floury, Louise Fonua, Jiloris Frederick Dony, Anna Marie
Celina Garfin, Go Un-Yeong, Shakti Gounder, Anie Haryani Hj Abdul Rahman, Noel Itogo, Tom Jack, Seiya Kato,
Khin Mar Kyi Win, Lamar Daniel, Leo Lim, Liza Lopez,
Sakiusa Mainawalala, Henri-Pierre Mallet, Tan Eang Mao,
Markleen Tagaro, Serafi Moa, Suzana Mohd Hashim, Nguyen Binh Hoa, Nguyen Viet Nhung, Nou Chanly, Ochirbat
Batbayar, Connie Bieb Olikong, Park Yoon-Sung, Nukutau
Pokura, Waimanu Pulu, Purev Nasanjargal, Rabauliman
Marcelina, Bereka Reiher, Bernard Rouchon, Temilo Seono,
Tokuaki Shobayashi, Vita A. Skilling, Grant Storey, Phannasinh Sylavanh, Kenneth Reuee Tabutoa, Tam Cheuk
Ming, Kyaw Thu, Tieng Sivanna, Tong Ka Io, Rosalind Vianzon, Wang Yee Tang, Wang Lixia.

Executive summary

Tuberculosis (TB) remains a major global health problem.
In 2012, an estimated 8.6 million people developed TB and
1.3 million died from the disease (including 320 000 deaths
among HIV-positive people).1 The number of TB deaths is
unacceptably large given that most are preventable.
Nearly 20 years after the WHO declaration of TB as a
global public health emergency, major progress has been
made towards 2015 global targets set within the context
of the Millennium Development Goals (MDGs). Two years
ahead of the deadline, the Global Tuberculosis Report 2013
and accompanying supplement Countdown to 2015 assess
progress towards the 2015 targets and the top priority
actions needed to achieve and/or move beyond them.

C17N6&19N 61  key ßndings
On track:
 The rate of new TB cases has been falling worldwide for
about a decade, achieving the MDG global target. TB
incidence rates are also falling in all six WHO regions.
The rate of decline (2% per year) remains slow.
 Globally by 2012, the TB mortality rate had been reduced
by 45% since 1990. The target to reduce deaths by 50%
by 2015 is within reach.
 Two WHO regions have already achieved the 2015 targets for reduced incidence, prevalence and mortality: the
Region of the Americas and the Western Pacific Region.
 Of the 22 high TB burden countries (HBCs) that account
for about 80% of the world’s TB cases,2 seven have met
all 2015 targets for reductions in TB incidence, prevalence and mortality. Four more HBCs are on track to do
so by 2015.

Off track:
 By 2012, the level of active TB disease in the community
(prevalence) had fallen by 37% globally since 1990. The
target of a 50% reduction by 2015 is not expected to be
achieved.
 The African and European regions are currently not on
track to achieve the mortality and prevalence targets.
 Among the 22 HBCs, 11 are not on track to reduce incidence, prevalence and mortality in line with targets.
Reasons include resource constraints, conflict and instability, and generalized HIV epidemics.
 Progress towards targets for diagnosis and treatment
of multidrug-resistant TB (MDR-TB) is far off-track.
Worldwide and in most countries with a high burden of
MDR-TB, less than 25% of the people estimated to have
MDR-TB were detected in 2012.

 Many countries have made considerable progress to
address the TB/HIV co-epidemic. However, globallevel targets for HIV testing among TB patients and
provision of antiretroviral therapy (ART) to those who
are HIV-positive have not been reached.

Five priority actions required to accelerate progress
towards 2015 targets:
1. Reach the missed cases. About 3 million people who
developed TB in 2012 were missed by national notification systems. Key actions needed to detect people with
the illness and ensure that that they get the right treatment and care include: expanded services (including
rapid tests) throughout health systems bolstered by the
support of nongovernmental organizations, community
workers and volunteers to diagnosis and report cases;
intensified collaboration with public hospitals and private health facilities who are treating patients but not
reporting; instituting mandatory notification of cases in
more countries; and better data compilation.
2. Address MDR-TB as a public health crisis. In high
MDR-TB burden countries, increased capacity to diagnose
MDR-TB must be matched with supplies of quality drugs
and scaled-up country capacity to deliver effective treatment and care. This will require high-level political will
and leadership and more collaboration among partners,
including drug regulatory authorities, donor and technical agencies, civil society and the pharmaceutical industry.
3. Accelerate the response to TB/HIV. The top priority is to increase coverage of ART for HIV-positive TB
patients towards the 100% target. Expanded coverage of
TB preventive treatment among people living with HIV
is the second priority.
4. Increase financing to close all resource gaps. An
estimated US$ 7–8 billion per year is required for a full
response to the TB epidemic in low- and middle-income
countries in 2014 and 2015 (excluding research and
development for new TB diagnostics, drugs and vaccines). Funding in 2013 is about US$ 6 billion. Increases in both domestic and donor financing are needed to
close the gap of up to US$ 2 billion per year, including
via the full replenishment of the Global Fund in 2013.
Progress remains fragile and could be reversed without
adequate funding.
5. Ensure rapid uptake of innovations. The fast uptake
of new tools and strategies for better diagnosis, treatment and prevention of all forms of TB can be accelerated
by country-specific operational research and translation
of findings into policy and practice.
GLOBAL TUBERCULOSIS REPORT 2013

ix

ADDITIONAL FINDINGS
The report is based primarily on data provided by WHO’s
Member States. In 2013, data were reported by 178 Member States and a total of 197 countries and territories that
collectively have more than 99% of the world’s TB cases.

Burden of disease
The current global picture of TB shows continued
progress, but not fast enough.
 An estimated 1.1 million (13%) of the 8.6 million people who developed TB in 2012 were HIV-positive. About
75% of these cases were in the African Region.
 Globally in 2012, an estimated 450 000 people developed MDR-TB and there were an estimated 170 000
deaths from MDR-TB .
 Most TB cases and deaths occur among men, but TB
remains among the top three killers of women worldwide. There were an estimated 410 000 TB deaths among
women in 2012, including 160 000 among HIV-positive
women. Half of the HIV-positive people who died from
TB in 2012 were women. Of the estimated 8.6 million new
TB cases worldwide in 2012, 2.9 million were women.
 There were an estimated 530 000 TB cases among
children (under 15 years of age) and 74 000 TB deaths
(among HIV-negative children) in 2012 (6% and 8% of
the global totals, respectively).
 The majority of cases worldwide in 2012 were in the
South-East Asia (29%), African (27%) and Western Pacific (19%) regions. India and China alone accounted for
26% and 12% of total cases, respectively.
 The TB incidence rate at country level ranges substantially, with around 1000 or more cases per 100 000 people in South Africa and Swaziland, and fewer than 10
per 100 000 population in parts of the Americas, several
countries in western Europe, Japan, Australia and New
Zealand.

TB detection and treatment outcomes
Millions of people access effective TB care each year
but “missed cases” hold back gains.
 Between 1995 and 2012, 56 million people were successfully treated for TB in countries that had adopted WHO’s
global TB strategy, saving 22 million lives.
 In 2012, 6.1 million cases of TB were notified to national
TB programmes (NTPs). Of these, 5.7 million were people newly diagnosed in 2012 and 0.4 million were previously diagnosed TB patients whose treatment regimen
was changed.
 In 2011, the treatment success rate continued to be high
at 87% among all new TB cases.
 Notifications of TB cases have stabilized globally. In
2012, about 66% (5.7 million) of the estimated 8.6 million people who developed TB were notified as newly
diagnosed cases.

x

GLOBAL TUBERCULOSIS REPORT 2013

 About 75% of the estimated 2.9 million missed cases
– people who were either not diagnosed or diagnosed but
not reported to NTPs – were in 12 countries. In order of
total numbers, these were India (31% of the global total),
South Africa, Bangladesh, Pakistan, Indonesia, China,
Democratic Republic of the Congo, Mozambique, Nigeria, Ethiopia, the Philippines and Myanmar.
 Xpert® MTB/RIF, a rapid molecular diagnostic test,
is being rapidly adopted by countries to detect TB and
rifampicin-resistant TB. By end June 2013, 1402 testing
machines and 3.2 million test cartridges had been procured by 88 of the 145 countries eligible for concessional
prices.
 Treatment success rates for TB remain lowest in the
European Region, where in 2011 only 72% of new cases
were successfully treated.

MDR-TB and XDR-TB detection and treatment outcomes
Undetected cases and treatment coverage gaps constitute a public health crisis.
 Globally in 2012, data from drug resistance surveys and
continuous surveillance among notified TB cases suggest that 3.6% of newly diagnosed TB cases and 20% of
those previously treated for TB had MDR-TB. The highest levels of MDR-TB are found in eastern Europe and
central Asia, where in some countries more than 20%
of new TB cases and more than 50% of those previously
treated for TB have MDR-TB.
 A total of 94 000 TB patients eligible for MDR-TB treatment were detected in 2012: 84 000 people with confirmed MDR-TB (i.e. resistance to both rifampicin, the
most powerful TB drug, and isoniazid), plus 10 000
with rifampicin resistance detected using Xpert MTB/
RIF. This was a 42% increase in detected cases eligible
for treatment compared with 2011. The largest increases
between 2011 and 2012 were in India, South Africa and
Ukraine.
 Just over 77 000 people with MDR-TB were started on
second-line treatment in 2012, equivalent to 82% of
the 94 000 newly detected cases that were eligible for
treatment globally. Treatment coverage gaps for detected cases were much larger in some countries, especially
in the African Region (51% enrolled in treatment), and
widened in China, Pakistan and South Africa.
 At least one case of extensively drug-resistant TB (XDRTB) had been reported by 92 countries by the end of
2012. On average, an estimated 9.6% of MDR-TB cases
have XDR-TB.
 Globally, only 48% of MDR-TB patients in the 2010
cohort of detected cases were successfully treated,
reflecting high mortality rates and loss to follow-up. A
treatment success rate of 75% or more for patients with
MDR-TB was achieved in 34 of 107 countries.

Addressing TB-HIV
TB-HIV collaborative services are expanding, but
global targets are not yet in sight.
 The main interventions to reduce the burden of HIV in
TB patients are HIV testing and provision of ART and
cotrimoxazole preventive therapy (CPT) to those found
to be HIV-positive. The main interventions to reduce TB
among people living with HIV are regular screening for
TB among people in HIV care and provision of isoniazid
preventive therapy (IPT) to those without active TB who
meet eligibility criteria (estimated at 50% of those newly
enrolled in HIV care).
 Progress in the implementation of TB/HIV interventions was further consolidated in 2012. Globally, 46%
of TB patients knew their HIV status (up from 40% in
2011). In the African Region that has the highest TB/
HIV burden, 74% of TB patients knew their HIV status
(up from 69% in 2011). Among the 41 countries with the
highest TB/HIV burden, more than 85% of TB patients
knew their HIV status in 15 countries, and in 7 of these
countries over 90% of patients knew their HIV status.
 The coverage of ART among TB patients who were
known to be HIV-positive reached 57% in 2012, up from
49% in 2011. As in the past few years, about 80% of HIVpositive TB patients were treated with CPT.
 In 2012, 4.1 million people enrolled in HIV care were
reported to have been screened for TB, up from 3.5 million in 2011. Of the reported 1.6 million people newly
enrolled in HIV care in 2012, 0.5 million (31%) were
provided with IPT.

6$ßPCPEKPI
International donor funding and more domestic
investments are essential.
 Of the US$ 7‒8 billion per year required in low and
middle-income countries in 2014 and 2015, about two
thirds is needed for the detection and treatment of drugsusceptible TB, 20% for treatment of MDR-TB, 10%
for rapid diagnostic tests and associated laboratory
strengthening, and 5% for collaborative TB/HIV activities.

1

2

 Growth in domestic and international donor funding
has been clearly documented since 2002. There is capacity to further increase domestic funding, especially in
BRICS (Brazil, the Russian Federation, India, China and
South Africa) that have almost 50% of global TB cases.
 International donor funding reported by NTPs amounted to US$ 0.8 billion in 2013, about three-quarters of
which was from the Global Fund. To close resource gaps,
at least US$ 1.6 billion is needed in both 2014 and 2015.
 International donor funding is crucial in many countries, accounting for more than 50% of total funding in
the group of 17 HBCs excluding BRICS, and in all lowincome countries. The proportion is even higher in some
individual countries.

Research and development
New TB diagnostics, medicines and vaccines are crucial to end the global TB epidemic.
 More than 50 companies are involved in development of
new diagnostic tests.
 10 new or repurposed TB drugs are in late phases of clinical development. In late 2012, bedaquiline became the
first novel TB drug approved in 40 years. In June 2013,
WHO issued interim guidance for its use in treatment
of MDR-TB.
 There are 10 vaccines for TB prevention and two immunotherapeutic vaccines in the pipeline. In early 2013,
results from a Phase IIb proof-of-concept study of one of
the preventive vaccine candidates were published. While
efficacy was not superior to the Bacille-Calmette-Guérin
(BCG) vaccine alone, the study demonstrated that a
trial of a novel TB vaccine is feasible in a high TB burden
setting.
 Short, effective and well-tolerated treatments for latent
TB infection, a point-of-care diagnostic test, and an
effective post-exposure vaccine are needed to help end
the global TB epidemic.

The estimated number of TB deaths among HIV-positive people
in 2011 was 336 000. Estimates of TB deaths among HIV-positive
people for the entire period 1990‒2012 were updated in 2013 using
the Spectrum software, which has been used for more than a decade
to produce estimates of the burden of disease caused by HIV. In
2013, a TB module in Spectrum was available for the first time for
use in the country consultations on HIV burden estimates that are
organized by UNAIDS every two years. Estimation of the number
of TB cases living with HIV, and of the number of TB deaths among
HIV-positive people, was integrated into this process.
The 22 HBCs are Afghanistan, Bangladesh, Brazil, Cambodia,
China, the Democratic Republic of the Congo, Ethiopia, India,
Indonesia, Kenya, Mozambique, Myanmar, Nigeria, Pakistan, the
Philippines, the Russian Federation, South Africa, Thailand, Uganda, the United Republic of Tanzania, Viet Nam and Zimbabwe.

GLOBAL TUBERCULOSIS REPORT 2013

xi

%*#26'4

Introduction
BOX 1.1

Basic facts about TB
TB is an infectious disease caused by the bacillus
Mycobacterium tuberculosis. It typically affects the
lungs (pulmonary TB) but can affect other sites as well
(extrapulmonary TB). The disease is spread in the air when
people who are sick with pulmonary TB expel bacteria,
for example by coughing. In general, a relatively small
proportion of people infected with M. tuberculosis will
develop TB disease; however, the probability of developing
TB is much higher among people infected with HIV. TB is
also more common among men than women, and affects
mostly adults in the economically productive age groups.
The most common method for diagnosing TB worldwide
is sputum smear microscopy (developed more than 100
years ago), in which bacteria are observed in sputum
samples examined under a microscope. Following recent
breakthroughs in TB diagnostics, the use of rapid molecular
tests for the diagnosis of TB and drug-resistant TB is
increasing, as highlighted in Chapter 5 and Chapter 8
of this report. In countries with more developed laboratory
capacity, cases of TB are also diagnosed via culture methods
(the current reference standard).
Without treatment, TB mortality rates are high. In studies
of the natural history of the disease among sputum smearpositive/HIV-negative cases of pulmonary TB, around 70%
died within 10 years; among culture-positive (but smearnegative) cases, 20% died within 10 years.a
'HHGEVKXGFTWIVTGCVOGPVUYGTGßTUVFGXGNQRGFKPVJG
U6JGOQUVGHHGEVKXGßTUVNKPGCPVK6$FTWITKHCORKEKP
became available in the 1960s. The currently recommended
treatment for new cases of drug-susceptible TB is a sixOQPVJTGIKOGPQHHQWTßTUVNKPGFTWIUKUQPKC\KFTKHCORKEKP
GVJCODWVQNCPFR[TC\KPCOKFG6TGCVOGPVUWEEGUUTCVGUQH
QTOQTGHQTPGYECUGUCTGTGIWNCTN[TGRQTVGFVQ9*1
by Member States (Chapter 3). Treatment for multidrugTGUKUVCPV6$ /&46$ FGßPGFCUTGUKUVCPEGVQKUQPKC\KFCPF
rifampicin (the two most powerful anti-TB drugs) is longer,
and requires more expensive and more toxic drugs. For most
RCVKGPVUYKVJ/&46$VJGEWTTGPVTGIKOGPUTGEQOOGPFGF
by WHO last 20 months, and treatment success rates are
much lower (Chapter 4 (QTVJGßTUVVKOGKPHQWTFGECFGU
new TB drugs are starting to emerge from the pipeline and
combination regimens that include new compounds are
being tested in clinical trials, as discussed in Chapter 8.
There are several TB vaccines in Phase I or Phase II trials
(Chapter 8). For the time being, however, a vaccine that is
effective in preventing TB in adults remains elusive.
a

Tuberculosis (TB) remains a major global health problem.
It causes ill-health among millions of people each year and
ranks as the second leading cause of death from an infectious disease worldwide, after the human immunodeficiency virus (HIV). The latest estimates included in this
report are that there were 8.6 million new TB cases in 2012
and 1.3 million TB deaths (just under 1.0 million among
HIV-negative people and 0.3 million HIV-associated TB
deaths). Most of these TB cases and deaths occur among
men, but the burden of disease among women is also high.
In 2012, there were an estimated 2.9 million cases and
410 000 TB deaths among women, as well as an estimated 530 000 cases and 74 000 deaths among children.1 The
number of TB deaths is unacceptably large given that most
are preventable if people can access health care for a diagnosis and the right treatment is provided. Short-course regimens of first-line drugs that can cure around 90% of cases
have been available for decades.
These large numbers of cases and deaths notwithstanding, 20 years on from the 1993 World Health Organization
(WHO) declaration of TB as a global public health emergency, major progress has been made. Globally, the TB mortality rate (deaths per 100 000 population per year) has fallen
by 45% since 1990 and TB incidence rates (new cases per
100 000 population per year) are falling in most parts of
the world. In the 18 years since the launch of a new international strategy for TB care and control by WHO in the
mid-1990s (the DOTS strategy) and the subsequent global
rollout of DOTS and its successor (the Stop TB Strategy,2
Box 1.2), a cumulative total of 56 million people were successfully treated for TB between 1995 and 2012, saving
approximately 22 million lives.
The overarching goal of the Stop TB Strategy is to achieve
2015 global targets (shown in Box 1.2) for reductions in
the burden of disease caused by TB. The target set within
the United Nations (UN) Millennium Development Goals
(MDGs) is that TB incidence should be falling by 2015
(MDG Target 6.c). Besides incidence, four other TB indicators are included in the MDG monitoring framework:
the prevalence rate, the mortality rate, the case detection
rate (the number of notified cases divided by the estimated
number of incident cases in the same year, expressed as a
percentage), and the treatment success rate (the percentage
1

6KGOGTUOC'9GVCN0CVWTCNJKUVQT[QHVWDGTEWNQUKUFWTCVKQPCPF
HCVCNKV[QHWPVTGCVGFRWNOQPCT[VWDGTEWNQUKUKP*+8PGICVKXGRCVKGPVU
A systematic review. PLoS ONE  G
2

The estimated number of deaths among children excludes TB
deaths in HIV-positive children, for which estimates are not yet
available. Further details are provided in Chapter 2.
Raviglione M, Uplekar M. WHO’s new Stop TB strategy. The Lancet,
2006, 367: 952–5.

GLOBAL TUBERCULOSIS REPORT 2013

1

BOX 1.2

The Stop TB Strategy at a glance
THE STOP TB STRATEGY
VISION

A TB-free world

GOAL

To dramatically reduce the global burden of TB by 2015 in line with the Millennium Development Goals
(MDGs) and the Stop TB Partnership targets

OBJECTIVES

■ Achieve universal access to high-quality care for all people with TB
■ 4GFWEGVJGJWOCPUWHHGTKPICPFUQEKQGEQPQOKEDWTFGPCUUQEKCVGFYKVJ6$
■ Protect vulnerable populations from TB, TB/HIV and drug-resistant TB
■ Support development of new tools and enable their timely and effective use
■ Protect and promote human rights in TB prevention, care and control

TARGETS

■ /&)6CTIGVE*CNVCPFDGIKPVQTGXGTUGVJGKPEKFGPEGQH6$D[
■ 6CTIGVUNKPMGFVQVJG/&)UCPFGPFQTUGFD[VJG5VQR6$2CTVPGTUJKR
¿TGFWEGRTGXCNGPEGQHCPFFGCVJUFWGVQ6$D[EQORCTGFYKVJCDCUGNKPGQH
¿GNKOKPCVG6$CUCRWDNKEJGCNVJRTQDNGO FGßPGFCUECUGRGTOKNNKQPRQRWNCVKQPRGT[GCT

COMPONENTS
1. Pursue high-quality DOTS expansion and enhancement
C 5GEWTGRQNKVKECNEQOOKVOGPVYKVJCFGSWCVGCPFUWUVCKPGFßPCPEKPI
b. Ensure early case detection, and diagnosis through quality-assured bacteriology
E 2TQXKFGUVCPFCTFK\GFVTGCVOGPVYKVJUWRGTXKUKQPCPFRCVKGPVUWRRQTV
d. Ensure effective drug supply and management
e. Monitor and evaluate performance and impact
2. Address TB/HIV, MDR-TB, and the needs of poor and vulnerable populations
a. Scale up collaborative TB/HIV activities
D 5ECNGWRRTGXGPVKQPCPFOCPCIGOGPVQH/&46$
c. Address the needs of TB contacts, and of poor and vulnerable populations
3. Contribute to health system strengthening based on primary health care
C *GNRKORTQXGJGCNVJRQNKEKGUJWOCPTGUQWTEGFGXGNQROGPVßPCPEKPIUWRRNKGUUGTXKEGFGNKXGT[CPFKPHQTOCVKQP
b. Strengthen infection control in health services, other congregate settings and households
c. Upgrade laboratory networks, and implement the Practical Approach to Lung Health
F #FCRVUWEEGUUHWNCRRTQCEJGUHTQOQVJGTßGNFUCPFUGEVQTUCPFHQUVGTCEVKQPQPVJGUQEKCNFGVGTOKPCPVUQHJGCNVJ
4. Engage all care providers
a. Involve all public, voluntary, corporate and private providers through public–private mix approaches
b. Promote use of the International Standards for Tuberculosis Care
5. Empower people with TB, and communities through partnership
C 2WTUWGCFXQECE[EQOOWPKECVKQPCPFUQEKCNOQDKNK\CVKQP
b. Foster community participation in TB care, prevention and health promotion
c. Promote use of the Patients’ Charter for Tuberculosis Care
6. Enable and promote research
a. Conduct programme-based operational research
b. Advocate for and participate in research to develop new diagnostics, drugs and vaccines

2

GLOBAL TUBERCULOSIS REPORT 2013

FIGURE 1.1

Seventeen annual WHO global TB reports, 1997–2012
1997: First report:
epidemiology and
surveillance

2002: Added financing and
strategy for 22 high-burden
countries (HBCs)

2003: Financing
and strategy
(all countries)

of TB patients who are successfully treated). The Stop TB
Partnership adopted the MDG target and in addition set
global targets to halve TB prevalence and death rates by
2015 compared with their levels in 1990. The scale at which
interventions included in the Stop TB Strategy need to be
implemented to achieve the 2015 targets for reductions in
disease burden, and the associated funding requirements,
have been described in Global Plans developed by the Stop
TB Partnership. The latest plan covers the period 2011–
2015 and has a price tag of US$ 47 billion.1
As the MDG target year of 2015 approaches, work on a
post-2015 development framework is assuming increasing
prominence. In June 2013, a high-level panel established
by the UN Secretary General to provide recommendations
about the content of a post-2015 development framework,
including possible goals and targets, submitted its report.2
One of the twelve proposed goals for 2030 is to “Ensure
healthy lives”, under which a suggested target is to “Reduce
the burden of disease from HIV/AIDS, TB, malaria, neglected tropical diseases and priority noncommunicable diseases”. Important themes within the report are building on
the MDGs and equity, and for health specifically the importance of steady progress towards universal health coverage
(UHC) is highlighted.
In line with the development of a post-2015 development framework and in response to a request from Member
States, WHO began the process of developing a post-2015
global TB strategy in 2012. Following a series of consultations between June 2012 and July 2013, the draft strategy
includes the goal of ending the global TB epidemic by 2035,
with corresponding global targets for major reductions
in TB cases and deaths by 2035 and milestones for 2020,
2025 and 2030. Achieving the proposed targets is based on
three strategic pillars: integrated, patient-centred TB care

1

2

The Global Plan to Stop TB, 2011–2015. Geneva, World Health
Organization, 2010 (WHO/HTM/STB/2010.2). Available at
http://w w w.stoptb.org /assets/documents/global/plan/TB _
GlobalPlanToStopTB2011-2015.pdf
http://www.un.org/sg/management/beyond2015.shtml

July 2009: Online data collection introduced
December 2009: Short update to 2009 report in transition
to earlier reporting of data and report publication

and prevention; bold policies and supportive systems; and
intensified research and innovation. It is anticipated that
the strategy will be reviewed by the WHO Executive Board
in January 2014 and discussed at the World Health Assembly in May 2014.
In the context of global TB strategies and targets, WHO
has published a global TB report every year since 1997
(Figure 1.1). The main aim of the report is to provide a
comprehensive and up-to-date assessment of the TB epidemic and progress in prevention, diagnosis and treatment
of the disease at global, regional and country levels, based
primarily on data that are reported by countries and territories to WHO in annual rounds of global TB data collection (Box 1.3). This 2013 global TB report is the eighteenth
in the series of annual reports, and uses data reported by a
total of 197 countries and territories including 178 Member
States that account for over 99% of the world’s estimated
cases of TB (Table 1.1). With just over two years remaining
before the end of 2015, a special feature of this 2013 global
report is that it is accompanied by a supplement focused on
the ‘Countdown to 2015’ (Box 1.4).
The main part of the report contains seven major chapters. Each chapter is intended to stand alone, but links to
other chapters are highlighted where appropriate.
Chapter 2 contains the latest estimates of the burden of
disease caused by TB and assessment of progress towards
the 2015 targets at global, regional and country levels. Estimates for women and children specifically are given particular attention. Following new analytical and modelling
work in 2013, the chapter also contains new estimates of
the number of cases of and deaths from MDR-TB and of
HIV-related TB mortality. The latest status of efforts to
improve measurement of TB cases and deaths at country
level, with guidance and support from the WHO Global
Task Force on TB Impact Measurement, is described.
Chapter 3 presents data on the numbers of cases notified to NTPs and reported to WHO and their treatment
outcomes, including breakdowns of TB cases by type, sex
and age. Recent progress in increasing the reporting of
cases by private sector providers through engagement of

GLOBAL TUBERCULOSIS REPORT 2013

1310_0237_PM_003.indd 3

3

28/10/13 13:15

BOX 1.3

Data collected in the 2013 round of global TB data collection
&CVCYGTGTGSWGUVGFQPVJGHQNNQYKPIVQRKEU6$ECUGPQVKßECVKQPUCPFVTGCVOGPVQWVEQOGUKPENWFKPIDTGCMFQYPUD[6$ECUG
type, age, sex and HIV status; an overview of services for the diagnosis and treatment of TB; laboratory diagnostic services;
drug management; monitoring and evaluation; surveillance and surveys of drug-resistant TB; management of drug-resistant TB;
collaborative TB/HIV activities; TB infection control; engagement of all care providers in TB control; the budgets of national TB
EQPVTQNRTQITCOOGU 062U KPCPFWVKNK\CVKQPQHIGPGTCNJGCNVJUGTXKEGU JQURKVCNK\CVKQPCPFQWVRCVKGPVXKUKVU FWTKPI
treatment; and NTP expenditures in 2012. A shortened version of the online questionnaire was used for high-income countries (that
KUEQWPVTKGUYKVJCITQUUPCVKQPCNKPEQOGRGTECRKVCQHÜ75aaKPCUFGßPGFD[VJG9QTNF$CPM a and/or low-incidence
EQWPVTKGU FGßPGFCUEQWPVTKGUYKVJCPKPEKFGPEGTCVGQHECUGURGTaRQRWNCVKQPQTECUGUKPVQVCN 
Countries reported data using an online web-based system (www.stoptb.org/tme). The system was opened for reporting on 14
/CTEJYKVJCFGCFNKPGQH/C[HQTCNN9*1TGIKQPUGZEGRVVJG4GIKQPQHVJG#OGTKECU /C[ CPFVJG'WTQRGCP4GIKQP 
/C[ %QWPVTKGUKPVJG'WTQRGCP7PKQPUWDOKVPQVKßECVKQPFCVCVQCU[UVGOOCPCIGFD[VJG'WTQRGCP%GPVTGHQT&KUGCUG2TGXGPVKQP
and Control (ECDC). Data from the ECDC system were uploaded into the WHO online system.
Data were reviewed, and followed up with countries where appropriate, by a team of reviewers from WHO (headquarters and
TGIKQPCNQHßEGU CPFVJG)NQDCN(WPFVQ(KIJV#+&56WDGTEWNQUKUCPF/CNCTKC VJG)NQDCN(WPF 8CNKFCVKQPQHFCVCD[TGURQPFGPVU
was also encouraged via a series of in-built, real-time checks of submitted data as well as a summary report of apparent
inconsistencies or inaccuracies (this report can be generated at any time within the online system). Following corrections and
updates by countries, the data used for the main part of this report were the data available in July 2013. Annex 4 was produced on
1 October, by which time additional data had been reported by a few European countries.b
Besides the data reported through the standard TB questionnaire, data about screening for TB among people living with HIV and
RTQXKUKQPQHKUQPKC\KFRTGXGPVKXGVJGTCR[ +26 VQVJQUGYKVJQWVCEVKXG6$YGTGEQNNGEVGFD[VJG*+8FGRCTVOGPVKP9*1CPFVJG,QKPV
United Nations Programme on HIV/AIDS (UNAIDS). The data were jointly validated and imported into the global TB database.
a.
b.

JVVRFCVCYQTNFDCPMQTICDQWVEQWPVT[ENCUUKßECVKQPU
For this reason, there may be slight discrepancies between the main part of the report and Annex 4.

TABLE 1.1

Reporting of data in the 2013 round of global TB data collection
%17064+'5#0&6'44+614+'5
9*14')+10145'61(%17064+'5

07/$'4

/'/$'456#6'5

07/$'46*#64'2146'&#

07/$'4

07/$'46*#64'2146'&#

#HTKECP4GIKQP

46

45

46

45

'CUVGTP/GFKVGTTCPGCP4GIKQP

23

23

22

22

'WTQRGCP4GIKQPa

54

42

53

41

4GIKQPQHVJG#OGTKECU

46

46

35

35

5QWVJ'CUV#UKC4GIKQP

11

11

11

11

9GUVGTP2CEKßE4GIKQP

36

30

27

24

High-burden countries (HBCs)b

22

22

22

22

216

197

194

178

World
a

Countries that did not report by the deadlines were mostly low-incidence countries in Western Europe.
b 6JG*$%UCTG#HIJCPKUVCP$CPINCFGUJ$TC\KN%CODQFKC%JKPCVJG&GOQETCVKE4GRWDNKEQHVJG%QPIQ'VJKQRKC+PFKC+PFQPGUKC-GP[C/Q\CODKSWG/[CPOCT0KIGTKC
2CMKUVCPVJG2JKNKRRKPGUVJG4WUUKCP(GFGTCVKQP5QWVJ#HTKEC6JCKNCPF7ICPFCVJG7PKVGF4GRWDNKEQH6CP\CPKC8KGV0COCPF85% of estimated MDR-TB cases in the world
– the proportion of TB patients who were tested ranged
from 56 to 100% among new cases in 13 of the 14 European countries reporting data (17% in Tajikistan; no data
reported by Azerbaijan), and exceeded 60% among previously treated cases in nine of these countries. Among
non-European high MDR-TB burden countries, testing for
MDR-TB among new cases was highest in China (3.6%). In
previously treated cases, the coverage of testing was higher
and reached 10% in Indonesia and 12% in China and the
Philippines. In South Africa, 16% of TB cases overall were
tested for MDR-TB although DST data were not available
separately for new and previously treated cases. Five other
countries did not report data, including India, the country
estimated to have the highest number of MDR-TB cases
among notified TB patients (Table 4.2).
Among TB patients who were notified and confirmed to
have MDR-TB in 2012, 23% were reported to have DST performed for both fluoroquinolones and second-line injectable
drugs. Second-line DST coverage exceeded 90% in Armenia,
Bulgaria, the Democratic Republic of the Congo, Georgia
and Latvia. South Africa accounted for most of the global
cases for which second-line DST data were reported, as well
as the highest proportion observed in the African Region
(the regional figure drops from 62% to 1% when South Africa is excluded). Second-line DST reports were available for
53% of MDR-TB cases in the Western Pacific Region, 47% in
the Region of the Americas and 3–8% in the other regions.
Improving the coverage of diagnostic DST is urgently
needed to improve the detection of MDR-TB and XDR-TB.

TABLE 4.2

DST coverage among TB and MDR-TB cases, globally and for 27 high MDR-TB burden countries and WHO
regions, 2012
0'9$#%6'4+1.1)+%#..;215+6+8'%#5'5
07/$'49+6*
DSTa4'57.65

Armenia



#\GTDCKLCP
Bangladesh
Belarus
Bulgaria
China
&4%QPIQ

41

7.0

3.6



12



95

1 931

India



46

541

49

100

12

2 042



65

100

55





1.3


–

4.4

–

45

341

–

597



10



43

–
2

–

45

142

11 472

100


71

1.0

92

% OF CASES WITH
&564'57.65

142



Georgia

Lithuania

557



100

07/$'49+6*
DST b4'57.65

–


193

Latvia



27

90

469

-[TI[\UVCP



%10(+4/'&/&46$%#5'5

% OF CASES WITH
&564'57.65

2 164

Ethiopia

-C\CMJUVCPc

64

4'64'#6/'06%#5'5
07/$'49+6*
DSTa4'57.65

–

Estonia

Indonesia

% OF CASES WITH
&564'57.65

99
3.6



>100

10 443

93



57

662

61

511

53

666

97

100



106

96

1 017

100

350

100

210

77

–



11

Myanmar

–

–

Nigeria

11



94

1.2

–

Pakistan

461

0.4

154

1.3

–

35







–

Philippines
4GRWDNKEQH/QNFQXC

1 264

67

933

63

4WUUKCP(GFGTCVKQP

32 647

79

12 324

24

South Africa
Tajikistan
Ukraine
7\DGMKUVCP

–

High MDR-TB burden countries

345

50

356

21

7.7

16 225

21

3.1

11 303

62



47

17

496

66

5 925

72

2 703

56



30

–
2 216

#/4



'/4

1 990

'74



5'#4

1 352

924

72

77

#(4

Global

11 046

919

77 277

3.9
0.3
22
1.1
72
0.1

–

–



Viet Nam

–

–

–
42 851
3 969

1 617
37 774
2 292



3.3



136 630

5.1

59 267

23
7.6
41
0.7
10
8.7

–

51

3.2

2 523

6.7

1 619



2 365

53

19 245

23

Blank cells indicate data not reported.
– indicates values that cannot be calculated.
a &56KUHQTKUQPKC\KFCPFTKHCORKEKP
b &56KUHQTCàWQTQSWKPQNQPGCPFCUGEQPFNKPGKPLGEVCDNGFTWI
c #RQUUKDNGGZRNCPCVKQPHQTYJ[VJGRGTEGPVCIGHQTPGYECUGUKP-C\CMJUVCPGZEGGFUKUKPCFGSWCVGNKPMCIGUDGVYGGPENKPKECNCPFNCDQTCVQT[TGIKUVGTU

GLOBAL TUBERCULOSIS REPORT 2013

51

FIGURE 4.5

DST coverage among new cases and enrolment on MDR-TB treatment, compared with the targets in the Global
Plan to Stop TB, 2011–2015. Lines indicate the planned targets, blue squares show the situation in 2009–2012 and
orange circles the projected enrolments 2013–2015. Data on projected enrolments in 2015 were incomplete.
b. Enrolment on MDR-TB treatment
300 000

20

250 000
Number of patients

Percentage of cases

a. DST coverage among new bacteriologically-positive cases
25

15
10
5

2010

2011

2012

2013

2014

BOX 4.2

XDR-TB in Africa
+PCENWUVGTQH:&46$RCVKGPVUKPTWTCN5QWVJ#HTKEC
made international headlines.a All of the patients from this
cluster who were tested for HIV were found to be infected.
Most of these patients died very quickly. South Africa
TGOCKPUVJGEQWPVT[VJCVTGRQTVUVJGOQUV:&46$ECUGU
KPVJGYQTNFCPFCPPWCNPQVKßECVKQPUJCXGKPETGCUGFHTQO
KPVQKP#DQWVQH/&46$ECUGU
TGRQTVGFKPVJKUEQWPVT[JCXG:&46$
FIGURE B4.2.1

Treatment outcomes for 623 TB patients with XDRTB in South Africa, 2010
Completed 6%
Died 49%
Cured 12%

Not evaluated 17%
Treatment failed 8%

Lost to follow-up 9%

By the end of 2012, 15 countries in the African region had
KFGPVKßGFCPFTGRQTVGFCVNGCUVQPGECUGQH:&46$ Figure
4.4 +PVYQJKIJ/&46$DWTFGPEQWPVTKGUKPVJG
#HTKECP4GIKQP¿VJG&GOQETCVKE4GRWDNKEQHVJG%QPIQ
CPF0KIGTKC¿GCEJTGRQTVGFVJGKTßTUV:&46$ECUG5GXGP
#HTKECPEQWPVTKGUTGRQTVGFUVCTVKPI:&46$RCVKGPVUQP
treatment in 2011 or 2012, most of them in South Africa.
Treatment outcomes reported by South Africa reveal the very
low likelihood of a favourable outcome in such patients and
the high proportion of patients lost to or not evaluated by
the health services (see Figure B4.2.1).

100 000

0
2009

2015

)CPFJK04/QNN#5VWTO#92CYKPUMK4)QXGPFGT6.CNNQQ7GVCN
Extensively drug-resistant tuberculosis as a cause of death in patients
co-infected with tuberculosis and HIV in a rural area of South Africa. The
Lancet  ¿

GLOBAL TUBERCULOSIS REPORT 2013

2010

2011

2012

2013

2014

2015

This requires the strengthening of laboratory capacity, the
introduction of new rapid diagnostics and improved reporting from diagnostic centres (see Chapter 5). The identification of XDR-TB cases in countries worldwide (Box 4.2,
Figure 4.4) reflects the risk of acquisition of additional second-line drug resistance and the transmission of resistant
strains when TB care and prevention (including infection
control) are inadequate.

 0QVKßECVKQPQH/&46$ECUGUCPFGPTQNOGPV
on treatment
The low coverage of DST in many countries is one of the
main constraints limiting the detection of MDR-TB among
people diagnosed with TB. Globally, 83 715 cases of MDRTB were notified to WHO in 2012, with India, the Russian
Federation and South Africa reporting more than a half of
these cases (Table 4.3). In addition, just over 10 000 rifampicin-resistant TB (RR-TB) cases were reported to have
been detected using rapid molecular techniques.1 India,
Kyrgyzstan, the Philippines and Uzbekistan each reported
>500 of such cases.
The 83 715 reported cases of MDR-TB cases represented 28% of the 300 000 (range, 220 000–380 000) pulmonary TB patients estimated to have MDR-TB in 2012 (Table
4.3), up from 20% in 2011, and 19% of the 450 000 (range:
300 000‒600 000) estimated incident MDR-TB cases in
the world in 2012. Much of the increase between 2011 and
2012 was accounted for by India (4237 to 16 588), South
Africa (10 085 to 15 419)2 and Ukraine (4305 to 6934),
although increases were reported by a total of 17 high
MDR-TB burden countries and all WHO regions with the
exception of the Region of the Americas. In the Democratic
1

2

52

150 000

50 000

0
2009

a

200 000

These are in addition to other rifampicin-resistant cases detected
by Xpert MTB/RIF, which were included under MDR-TB notifications following subsequent testing for isoniazid resistance.
In South Africa, the number of cases detected was above the estimated number of cases among pulmonary TB patients; this could
reflect either that the estimates of the number of MDR-TB cases
among TB patients are too conservative and/or the absence of linkages between the clinical and laboratory registers.

TABLE 4.3

Estimated MDR-TB cases in 2012, notißed cases of MDR-TB and enrolments on MDR-TB treatment
2009–2012, and treatment outcome reporting for 2010 cohort, globally and for 27 high MDR-TB burden
countries and WHO regions
'56+/#6'&/&46$#/10)016+(+'&
27./10#4;6$%#5'5

BEST

Armenia

LOW

NOTIFIED CASES

HIGH

2009

250

220



#\GTDCKLCP



2 600

3 000

Bangladesh

4 200

3 100

5 200

Belarus

2 200

2 100

2 200

Bulgaria

156

1 342

2010

2011

/&46$%#5'5
4'2146'&9+6*
64'#6/'06176%1/'
#%1*146

%#5'5'041..'&10/&46$64'#6/'06

2012

2012
NOTIFIED /
ESTIMATED
(%)a

177

79

92

37

552



596

21

339

509

513

12

1 576

1 594

1 604

73

2009

2010

134

352

2011

2012

%b

N

154



101

132

75



592

406

263



339

390

513

329

97

200

1 446



1 442

91
100

100



130

43

56

55

49

49

43

56

42

36

56

59 000

52 000

66 000

474

2 792

1 601

3 007

5.1



1 222

1 155

1 906

1 222

44

2 900

670

5 100

91



121

65

2.2

176

191



179

105

121

70

56





63



62





63

75

54

64

102

Ethiopia

2 100

1 200

3 000

233

140

212



14



120

199



114



Georgia

630

570

690

369

359

475

346

55

266



737

665

504

140

64 000

49 000

79 000

1 660

2 967

4 237



26

1 136

2 967



14 143



74

6 900

5 200









6.2

20

142

260

426

140

77

China
&4%QPIQ
Estonia

India
Indonesia
-C\CMJUVCP





9 000

3 644









3 209

5 705

5 261

7 213

5 777



-[TI[\UVCP



1 600

1 900



566





53

545

566

492

790

441



Latvia

120

100

140

131



105

110

92

124



103

110



101

Lithuania

300

270

330

322

310

296

271

90

322

310

296

271

310

100

Myanmar

6 000

4 600

7 500



192

690



13

64

192

163

442





Nigeria

3 600

2 700

4 500



21

95

107

3.0

0

23



125

23

110

Pakistan

11 000

0

29 000

49

444

344

1 602

15



424

344

1 045

195

44

Philippines

13 000

10 000

16 000

1 073

522



679

5.2

501



2 397





150

4GRWDNKEQH/QNFQXC

1 700

1 600



1 069



1 001



53

334

791

765



4WUUKCP(GFGTCVKQP

46 000

43 000

49 000



13 692



13 612

30



13 692







34



6 900

9 400

9 070





15 419

>100

4 143

5 402

5 643

6 494



66

910



1 000

319

333

604

694

76

52

245



535

245

74

Ukraine



6 500

7 000



5 336

4 305

6 934

>100





4 950

7 672

3 902

73

7\DGMKUVCP

4 000

3 700

4 300

654

1 023





43

464





1 491



61

Viet Nam



3 000

4 600

217

101

601

273

7.2

307

101



713

97

96

270 000

180 000

350 000

40 798

47 772

52 813 75 301

28

24 521

38 942

49 663

69 320

28 793

60

#(4



14 000

62 000

10 741

9 340







5 994

7 209

7 467

9 303

6 166

66

#/4

7 100

4 500

9 600



2 661

3 474

2 967

42

3 153

3 249



3 102

2 374



'/4



0

42 000

496





2 236

12

707

967

756

1 602

676

77

'74

74 000

60 000





33 776

34 199



50

17 169



36 313

42 399

19 496



5'#4

90 000

71 000

110 000

2 560

3 942

6 615

19 202

21

2 040

3 901

4 597



3 113

79

924

74 000

57 000

91 000

2 059

4 295

4 394

4 473

6.0

1 429

2 210

4 946

5 070

2 456

57

300 000

220 000

380 000

46 897

54 887

61 907 83 715

28

30 492

45 872

57 166

77 321

34 281

62

South Africa
Tajikistan

High MDR-TB
burden countries

Global

–

Blank cells indicate data not reported.
– indicates values that cannot be calculated.
0QVKßGFECUGUQH/&46$KPCUCRGTEGPVCIGQHVJGDGUVGUVKOCVGQH/&46$ECUGUCOQPICNNECUGUQHRWNOQPCT[6$KPVJGUCOG[GCT6JGRGTEGPVCIGOC[GZEGGF
KHGUVKOCVGUQHVJGPWODGTQH/&46$CTGVQQEQPUGTXCVKXGCPFKHNKPMCIGDGVYGGPVJGENKPKECNCPFNCDQTCVQT[TGIKUVGTUKUKPCFGSWCVG
b 6JGRGTEGPVCIGQH/&46$ECUGUQTKIKPCNN[PQVKßGFKPYKVJQWVEQOGUTGRQTVGF6JGRGTEGPVCIGOC[GZEGGFCUCTGUWNVQHWRFCVGFKPHQTOCVKQPCDQWV/&46$
ECUGUKPKPCFGSWCVGNKPMCIGUDGVYGGPPQVKßECVKQPU[UVGOUHQT6$CPF/&46$CPFVJGKPENWUKQPKPVJGVTGCVOGPVEQJQTVQHECUGUQH/&46$ECUGUHTQOC[GCTRTKQTVQ
2010.
a

GLOBAL TUBERCULOSIS REPORT 2013

53

FIGURE 4.6

Number of MDR-TB cases estimated to occur among notißed pulmonary TB cases, 2012

MDR-TB cases
0–199
200–1999
2000–19 999
20 000–49 999
≥ 50 000
No data
Not applicable

Republic of the Congo, the Philippines and Viet Nam, which
detected less than 30% of their estimated burden in 2012,
MDR-TB notifications decreased between 2011 and 2012.
Of the MDR-TB cases reported globally in 2012, most (82%)
were detected in either the European Region (36 708), India
(16 588) or South Africa (15 419).
Countries detecting close to 100% of the TB patients estimated to have MDR-TB in 2012 included Estonia, Kazakhstan, Latvia, Lithuania, South Africa and Ukraine (Table
4.3). In the African and European Regions and the Region
of the Americas, about 50% of the TB patients estimated
to have MDR-TB were detected in 2012. The lowest figures
were in the two regions with the largest number of cases:
the South-East Asia region (21%) and the Western Pacific
Region (6%). India and China, the two countries estimated to have the largest numbers of TB patients with MDRTB (both over 50 000, Figure 4.6), strongly influence the
overall figures for the South-East Asia and Western Pacific
Regions. China and India, together with the Russian Federation – which ranks third globally in total cases of MDR-TB –
detected and reported less than one third of the TB patients
estimated to have MDR-TB (5%, 26% and 30% respectively).
The absolute numbers of TB cases started on second-line
treatment for MDR-TB increased from 30 492 in 2009 to
77 321 in 2012 (+154%). There was a 40% increase in enrolments between 2011 and 2012 in the 27 high MDR-TB
burden countries, which reflected progress in 20 of these
countries and especially in India, Kazakhstan and Ukraine
(Table 4.3). The ratio of the numbers of patients starting
treatment with second-line drug regimens for MDR-TB,
to those notified with MDR-TB in 2012, was 92% globally
54

GLOBAL TUBERCULOSIS REPORT 2013

(82% when RR-TB cases are included), but was lower in the
African (51%) and South-East Asia (83%) Regions (Table
4.3). Waiting lists of people requiring treatment for MDRTB are persisting or growing in several countries, particularly when additional RR-TB cases diagnosed using Xpert
MTB/RIF are taken into account. Diagnosis:treatment
gaps of 5% or more were evident in 14 of the high MDRTB burden countries in 2012 (Figure 4.7), and the ratio of
MDR-TB cases diagnosed to enrolments on MDR-TB treatment increased by more than 10% between 2011 and 2012
in China, Pakistan and South Africa. The number of XDRTB cases reported worldwide increased from 1464 to 2230
between 2011 and 2012. All the WHO regions reported
more XDR-TB cases enrolled on treatment in 2012 than in
2011, reaching 1557 globally in 2012.
Common constraints to treatment scale up include a
critical shortage of trained staff, insufficient availability
of second-line medications, inadequate numbers of facilities for treatment and monitoring, incomplete diagnosis
of patients and other weaknesses in the coordination of
activities required for effective programmatic management
of DR-TB. There is a global shortfall in capacity to place people diagnosed with MDR-TB on treatment, and increased
resources for the programmatic management of MDR-TB
are urgently required.
In a few countries, such as Georgia, the Russian Federation and Ukraine, enrolments have outstripped notifications of MDR-TB in recent years. Possible explanations for
this include frequent empirical treatment of TB patients
considered at risk of having MDR-TB but for whom a laboratory-confirmed diagnosis is missing, incomplete report-

FIGURE 4.7

MDR-TB cases (orange) and additional rifampicin-resistant TB cases (blue) detected compared with
TB cases enrolled on MDR-TB treatment (green) 2009–2012, globally and in 27 high MDR-TB burden
countries, 2009–2012
200

Armenia

Azerbaijan

600

Bangladesh

2500

Belarus

800
2000

150
600

400
1500

100

400

1000
200

50

200

0

0

Bulgaria

500
0

China

60

3000

40

2000

0

DR Congo

Estonia

200

100
80

150

60
100
40
20

1000
50

0

0

Ethiopia

0

Georgia

300

20
0

India

Indonesia

800

500
15000
400

200

600
300

10000

200
100

400

5000
100

0

Number of cases

8000

200

Kazakhstan

0

1000

Kyrgyzstan

150

0

Latvia

350
330

750

6000

100
4000

500

2000

250

0

0

Lithuania

310
290

50
270
0

Nigeria

Myanmar
800

250

Pakistan

Philippines

2000

2500

1500

2000

1000

1500

500

1000

0

500

300

600
200
400
100

200
0

0

Russian Federation

Republic of Moldova

South Africa

Tajikistan

20000

1100

800
15000

900

600
15000
10000

700
10000
500
300

5000

8000

Uzbekistan

Ukraine

400

5000

200

0

0

2000

800

1500

600

1000

400

500

200

Viet Nam
100 000

Global

80 000

6000
60 000
40 000
4000

0

2000
2009

2010

2011

2012

2009

20 000

0
2010

2011

2012

2009

2010

2011

2012

0
2009

2010

2011

GLOBAL TUBERCULOSIS REPORT 2013

2012

55

BOX 4.3

Pharmacovigilance for TB care
A PRACTICAL HANDBOOK
ON THE PHARMACOVIGILANCE
OF MEDICINES USED
IN THE TREATMENT OF
TUBERCULOSIS
ENHANCING THE SAFETY OF THE TB PATIENT

2JCTOCEQXKIKNCPEGKUFGßPGFD[
9*1CUÄThe science and actiXities
relatinI to the detection assessment
understandinI and preXention of
adXerse effects or any other druIrelated problem.”

#FXGTUGFTWITGCEVKQPU #&4U ECP
lead to a TB patient interrupting
treatment before completion, thus contributing to avoidable
morbidity, drug resistance, treatment failure, reduced
quality of life, or death. It is important to routinely monitor
VJGQEEWTTGPEGQH#&4UKP6$RCVKGPVUQPVTGCVOGPVKP062U
This is particularly relevant in the care of patients with
&46$CPFRCVKGPVUYJQCTG*+8RQUKVKXG
6JTGGCRRTQCEJGUVQRJCTOCEQXKIKNCPEGCTGKPWUG
 Spontaneous reporting. This involves the reporting of
#&4U¿GIQVQVQZKEKV[CUUQEKCVGFYKVJCOKPQIN[EQUKFGU
– to the national pharmacovigilance centre.
 Targeted spontaneous reporting. This is an extension
of spontaneous reporting that can be focused on the
UWTXGKNNCPEGQHUGTKQWUCFXGTUGGXGPVUKPURGEKßERCVKGPV
ITQWRUUWEJCURCVKGPVUYKVJ/&46$
 Cohort event monitoring (CEM). This is an active form of
surveillance, similar in design and management to an
epidemiological cohort study. CEM is particularly well
suited to the post-marketing surveillance of new drugs.
In 2012, WHO produced a handbook on pharmacovigilance
for TB.a WHO offers technical assistance to countries for
the introduction and strengthening of pharmacovigilance
in their programmes. The handbook explains how
pharmacovigilance can be effectively implemented in a TB
programme through key stakeholders, including regulators
and manufacturers, and provides a step-by-step approach
to identifying signals, assessing the relationship between
an event and a drug, determination of causality, acting on
QDUGTXCVKQPUCPFEQOOWPKECVKQPQHßPFKPIU
a

# practical handbook on the pharmacoXiIilance of medicines used in
the treatment of tuberculosis enhancinI the safety of the TB patient.
)GPGXC9QTNF*GCNVJ1TICPK\CVKQP www.who.int/medicines/
RWDNKECVKQPURJCTOCEQXKIKNCPEGAVD).

ing of laboratory data, or enrolment of ‘backlogs’ or waiting
lists of MDR-TB patients who were detected before 2012.
Among 119 countries reporting sex-disaggregated data
for enrolments, the median male:female ratio was 2. Most
countries that reported data on MDR-TB patient enrolments did not report the inclusion of any children. In the
44 countries that did, the proportion of children ranged
from <1% to 33% of total enrolments.
Many countries envisage increases in the number of
patients enrolled on treatment for MDR-TB between 2013
and 2015. However, global projections remain well below
Global Plan targets, partly as a result of slow rates of
increase as well as incomplete information regarding forecasts, notably for China (2015) and the Russian Federation

56

GLOBAL TUBERCULOSIS REPORT 2013

(2013) (Figure 4.5b). To reach the targets set out in the
Global Plan and advance towards universal access to treatment, a bold and concerted drive is still needed on many
fronts of TB care, particularly in the countries where the
burden is highest. The capacity to address this challenge has
increased in recent years as a result of the intensified technical assistance provided by international organizations.
With the reform of the Green Light Committee (GLC) structure in 2011, and the creation of regional level committees
(rGLCs) in all six WHO regions, international support to
national efforts to strengthen programmatic management
of DR-TB is now focused on devolving available resources
and technical assistance closer to countries.

4.2.3 Treatment outcomes for MDR-TB and XDR-TB
Standardized monitoring methods and indicators have
allowed countries to report MDR-TB treatment outcomes
in a comparable manner for several years. In 2013, the definitions for treatment outcomes were simplified and the
reporting requirements changed to allow for the inclusion
of RR-TB cases in the MDR-TB cohort (Box 4.4).
The number of cases reported in annual MDR-TB treatment outcome cohorts has tripled between 2007 and 2010,
reflecting increases in all regions (Figure 4.8). All high
MDR-TB burden countries have now reported treatment
outcomes for at least one annual cohort since 2007.
A total of 107 countries reported outcomes for more
than 34 000 MDR-TB cases started on treatment in 2010
(Table 4.3). This is equivalent to 62% of the number of
MDR-TB cases notified by countries in the same year. The
low proportion reflects weaknesses in reporting systems to
reconcile outcome data with notifications. The Global Plan
envisages that by 2015, all countries will report outcomes
for all notified MDR-TB cases. In 2010, only 71 countries
– including 13 high MDR-TB burden countries – reported
outcomes for a cohort whose size exceeded 80% of the original number of MDR-TB notifications in 2010.
Overall, the proportion of MDR-TB patients in the 2010
cohort who successfully completed treatment was 48%,
while 28% of cases were reported as lost to follow-up or had
no outcome information. Treatment success was highest in
the Eastern Mediterranean Region (56%), as well as in the
Region of the Americas (54%) where this proportion has
increased steadily since 2007 alongside a reduction in the
proportion of patients whose treatment outcome was not
evaluated. In the 2010 cohort, deaths were highest in the
African Region (17%) and the proportion of patients whose
treatment failed was highest in the European Region (11%).
The Global Plan’s target of achieving at least 75% treatment
success in MDR-TB patients by 2015 was only reached by
34/107 countries reporting outcomes for the 2010 cohort,
but included three high MDR-TB burden countries: Bangladesh, Ethiopia and Viet Nam.
Among a subset of 795 XDR-TB patients in 26 countries,
treatment success was 20% overall and 44% of patients
died; excluding South Africa, the figures were 27% and 28%
respectively (Box 4.2).

FIGURE 4.8

Treatment outcomes for patients diagnosed with MDR-TB by WHO region, 2007–2010 cohorts.
The total numbers of cases with outcome data are shown beside each bar.
Africa

The Americas

2007

4 570

2007

1 458

2008

5 496

2008

1 732

2009

6 143

2009

2 298

2010

6 166

2010

2 374

Eastern Mediterranean

Europe

2007

128

2007

4 097

2008

262

2008

6 904

2009

511

2009

12 131

2010

676

2010

19 496

South-East Asia

Western Pacific

2007

253

2007

453

2008

413

2008

758

2009

1 140

2009

1 027

2010

3 113

2010

2 456

0%

20%

40%

60%

80%

100%

Global
2007

10 959

2008

15 565

2009

23 250

2010

34 281

0%

20%

40%

60%

80%

Cured

Completed

Died

Treatment failed

Lost to follow-up

Not evaluated

100%

Progressing towards the target for treatment success
requires the scale up of treatment programmes globally,
enhancing the effectiveness of drug regimens, support to
patients to avoid treatment interruption and improved
data collection. In particular, countries need to analyse the
poor treatment outcomes observed in MDR-TB cases and
intensify measures to improve adherence and monitoring.
TB programmes need to apply a package of services for
MDR-TB patients that include free TB and ancillary medications, free laboratory testing, enablers and social support, and the use of short treatment regimens following
current WHO policy in selected patients. The treatment of
XDR-TB patients in particular remains very unsatisfactory
and more effective regimens for this condition are urgently
required.

4.2.4 Other aspects of MDR-TB programme
management
During their illness, patients with MDR-TB may be cared
for as either outpatients or within hospitals, usually secondary or tertiary facilities. WHO recommends that, where
possible, patients with MDR-TB should be treated using
ambulatory or community-based care rather than models
of care based principally on hospitalization.
National policies and practices differ in the predominant
model of care that is employed. Among the high MDR-TB
burden countries, the lowest level of hospitalization was
reported by the Philippines (5% of MDR-TB patients),
while levels in Eastern European countries ranged between
75 and 100% but were lower in Central Asia (30–50% in
Kazakhstan, Tajikistan and Uzbekistan). In the African
Region, there is wide variation in the extent to which
GLOBAL TUBERCULOSIS REPORT 2013

57

patients with MDR-TB are hospitalized, ranging from 10%
of patients (Democratic Republic of the Congo) to 100%
(Ethiopia and Nigeria). Globally, the average duration of
hospital stay ranged from 7 to 240 days (median: 84 days).
The number of visits to a health facility after diagnosis of

BOX 4.4

WHO deßnitions of treatment outcomes for
RR-TB, MDR-TB and XDR-TB
Cured Treatment completed as recommended by the
national policy without evidence of failure AND three or
more consecutive cultures taken at least 30 days apart are
negative after the intensive phase.
Treatment completed Treatment completed as
recommended by the national policy without evidence
of failure BUT no record that three or more consecutive
cultures taken at least 30 days apart are negative after the
intensive phase.
Treatment failed Treatment terminated or need for
permanent regimen change of at least two anti-TB drugs
DGECWUGQH
 lack of conversion by the end of the intensive phase; or
 bacteriological reversion in the continuation phase after
conversion to negative; or
 evidence of additional acquired resistance to
àWQTQSWKPQNQPGUQTUGEQPFNKPGKPLGEVCDNGFTWIUQT
 adverse drug reactions.
Died A patient who died for any reason during the course
of treatment.
Lost to follow-up A patient whose treatment was
interrupted for two consecutive months or more.
Not evaluated A patient for whom no treatment outcome
is assigned (this includes cases ‘transferred out’ to another
treatment unit and whose treatment outcome is unknown).
Successfully treated The sum of cured and treatment
completed.
Cohort #ITQWRQHRCVKGPVUYJGTG446$JCUDGGP
FKCIPQUGF KPENWFKPI/&46$CPF:&46$ CPFYJQYGTG
UVCTVGFQPCHWNNEQWTUGQHCUGEQPFNKPG/&46$FTWI
TGIKOGPFWTKPICURGEKßGFVKOGRGTKQF GIVJGEQJQTVQH
/&46$ECUGUTGIKUVGTGFKPVJGECNGPFCT[GCT 6JKU
group forms the denominator for calculating treatment
QWVEQOGU9KVJVJGTGXKUGFFGßPKVKQPUany patient found to
haXe druI-resistant TB and placed on second-line treatment
is remoXed from the druI-susceptible TB outcome cohort.
This means that management of the basic management unit
TB register and of the second-line TB treatment register
needs to be coordinated to ensure proper accounting of the
outcomes of treatment.
/QTGFGVCKNUQPVJGFGßPKVKQPQHEQPXGTUKQPTGXGTUKQPCPF
the end of the intensive phase are provided in the WHO
guidance.a
a



&eßnitions and reportinI framework for tuberculosis – 201 reXision
9*1*6/6$ )GPGXC9QTNF*GCNVJ1TICPK\CVKQP www.
YJQKPVKTKUDKVUVTGCOAGPIRFH).

GLOBAL TUBERCULOSIS REPORT 2013

MDR-TB also varies markedly among countries, from 30
or less (Bangladesh, the Democratic Republic of the Congo, Estonia, Pakistan, and Viet Nam) to over 600 (Bulgaria,
Indonesia, Latvia, Tajikistan and Uzbekistan).
Palliative and end-of-life care delivered through homebased or institutional services is fundamental to alleviate the suffering associated with MDR-TB, particularly in
patients with advanced disease that is not responding to
treatment. Only eleven high MDR-TB burden countries –10
in the European region plus South Africa – reported that
they provided such care within the scope of their NTPs.
When considered in the context of the poor outcomes
reported in patients with MDR-TB and especially XDR-TB,
this finding attests to the persistent, huge unmet need for
palliative care services in countries with the largest burdens of drug-resistant TB.
Among 18 high MDR-TB burden countries providing
information on the quality of second-line drugs in the public sector in 2012, two countries reported that all of the
drugs that they used conformed only to national regulatory
norms. In the other 16 countries, most reported conformity to international standards for all supplies of kanamycin
(11), capreomycin (9, with 2 other countries not using it),
levofloxacin (10, with 1 other not using it), ethionamide/
prothionamide (12), cycloserine/terizidone (11) and p-aminosalicylic acid (10, with 2 others not using it).
More information is required to adequately monitor TB
patients on MDR-TB treatment than is needed for drugsusceptible TB. The definitions for monitoring of RR-TB
and MDR-TB and their outcomes were revised in 2013
(see Chapter 3 and Box 4.4). The employment of electronic systems to manage patient data is therefore strongly
encouraged. One of the Global Plan’s targets is that all 27
high MDR-TB countries manage their data on treatment
of MDR-TB patients electronically by 2015. By 2012, 19
reported that national databases were in place for MDRTB patients (see Figure 2.16 in Chapter 2). These systems
differ markedly from one country to another, varying
from individual patient medical records accessible online
to the periodic collation of records from registers across
the country. Before introducing electronic systems to handle patient data, WHO recommends that NTPs undertake
a detailed assessment of their needs and expectations
and then try to match these with the best suited informatics solution. A fragmentary approach with parallel
systems dealing with different programme components
(for example, management of data for patients with drugsusceptible and drug-resistant TB in separate systems)
should be avoided. Guidance on the design and implementation of electronic systems for recording and reporting data
was produced by WHO and technical partners in 2012.1

4

Electronic recording and reporting for TB care and control. Geneva,
World Health Organization, 2013 (WHO/HTM/TB/2011.22).

%*#26'4

Diagnostics and laboratory
strengthening
KEY FACTS AND MESSAGES
■ The conventional laboratory tests for the diagnosis of
TB, which have been used for decades, are sputum smear
microscopy and bacterial culture. Diagnosis based on
cultured specimens is the reference standard but results
take weeks to obtain. Drug susceptibility testing (DST) on
EWNVWTGUKUWUGFVQFGVGEVTGUKUVCPEGVQßTUVCPFUGEQPFNKPG
TB drugs.
■ There have been important breakthroughs in TB
FKCIPQUVKEUKPTGEGPV[GCTU+P9*1GPFQTUGFVJGßTUV
rapid molecular test that can be used to simultaneously test
HQTRWNOQPCT[6$CPFTKHCORKEKPTGUKUVCPEG:RGTV® MTB/
4+(6JGUGPUKVKXKV[QHVJGVGUVKUOWEJDGVVGTVJCPUOGCT
microscopy and is comparable to solid culture. In 2013,
a review of the 2010 policy was initiated, to examine the
substantial body of new evidence on the use and positioning
QH:RGTV/6$4+(HQTVJGFKCIPQUKUQHRWNOQPCT[
extrapulmonary and paediatric TB. Updated guidance is
expected in 2014.
■ :RGTV/6$4+(KUDGKPITCRKFN[CFQRVGFD[EQWPVTKGU
$[VJGGPFQH,WPG)GPG:RGTVOCEJKPGUCPF
OKNNKQP:RGTV/6$4+(ECTVTKFIGUJCFDGGPRTQEWTGF
D[QHVJGEQWPVTKGUGNKIKDNGHQTEQPEGUUKQPCNRTKEGU
Almost half (49%) of reporting low- and middle-income
countries and territories indicated that WHO policy
IWKFCPEGQP:RGTV/6$4+(JCFDGGPKPEQTRQTCVGFKPVQ
VJGKTPCVKQPCNIWKFGNKPGU5QWVJ#HTKECKUVJGßTUVEQWPVT[VQ
CFQRV:RGTV/6$4+(CUVJGRTKOCT[FKCIPQUVKEVGUVHQT6$
replacing smear microscopy.
■ Laboratory capacity to conduct high-quality sputum
UOGCTOKETQUEQR[TGSWKTGUUKIPKßECPVUVTGPIVJGPKPI1PN[
14 of the 22 HBCs met the target of having 1 microscopy
EGPVTGRGTaRQRWNCVKQPKPCPFQPN[GKIJV
reported a programme for external quality assessment that
covered at least 95% of all centres in the country.
■ Globally, laboratory capacity to perform DST continues
to be low and is not growing quickly enough to ensure that
6$RCVKGPVUYKVJ/&46$CTGRTQORVN[FKCIPQUGF(TQO
2009 to 2012, the percentage of new and previously treated
TB patients receiving DST increased from 4% to 5% and
HTQOVQTGURGEVKXGN[6JG':2#0&6$RTQLGEV
which started in 2009 and has entered a phase of routine
testing in 25 countries, shows how it is possible to introduce
routine testing for drug resistance and achieve considerable
KPETGCUGUKPVJGPWODGTQH/&46$ECUGUFGVGEVGF
■ The national reference laboratory of Uganda has become
the newest member of the WHO/Global Laboratory Initiative
).+ 5WRTCPCVKQPCN4GHGTGPEG.CDQTCVQT[ 54. 0GVYQTM
ßNNKPICETKVKECNIGQITCRJKECNICRKP'CUV#HTKEC

The early, rapid and accurate detection of TB and drug resistance relies on a well-managed and equipped laboratory
network. Laboratory confirmation of TB and drug resistance is critical to ensure that people with TB signs and
symptoms are correctly diagnosed and have access to the
correct treatment as soon as possible.
The conventional laboratory tests for the diagnosis of
TB, which have been used for decades, are sputum smear
microscopy and culture. Diagnosis based on culture is the
reference standard but results take weeks to obtain. Drug
susceptibility testing (DST) on cultured specimens is the
conventional method used to detect resistance to first- and
second-line TB drugs. Following increased investments in
TB research and development in the past decade (Chapter
8), there have been important breakthroughs in TB diagnostics. In 2008, rapid molecular tests (line probe assays,
or LPAs) for detection of RR-TB and MDR-TB using positive sputum specimens or cultures were recommended by
WHO. In 2010, the first rapid molecular test that can be
used to simultaneously test for TB and rifampicin resistance, Xpert® MTB/RIF (Cepheid, Sunnyvale, CA, USA),
was recommended for diagnosis of pulmonary TB and
rifampicin resistance in adults. The sensitivity of the test
is much better than smear microscopy and similar to solid
culture.1
Although laboratories play a fundamental role in TB care
and control, only 57% of the 4.6 million new pulmonary
TB patients notified globally in 2012 were bacteriologically
confirmed using a WHO-recommended diagnostic method. Low coverage of laboratory confirmation may result in
people without TB needlessly being enrolled on TB treatment, while true TB cases are being missed. Furthermore,
the 5.7 million incident (new and relapse) TB patients diagnosed and notified to NTPs in 2012 represent only 66% of
the estimated 8.6 million incident TB cases globally. The
gap reflects both underreporting of diagnosed TB cases and
failure to diagnose cases at all; the latter can be attributed
in part to weak laboratory capacity in many countries.
Detection of TB without investigating for drug resistance can lead to poor treatment outcomes, additional and
unnecessary suffering and costs for patients and further
spread of drug-resistant strains. While there was a small
increase between 2011 and 2012, only 5.1% of new cases
and 8.7% of previously treated cases received DST in 2012.

1

Steingart KR et al. Xpert® MTB/RIF assay for pulmonary tuberculosis and rifampicin resistance in adults (Review). Cochrane Database of Systematic Reviews 2013, Issue 1. Art. No.: CD009593. 2013.

GLOBAL TUBERCULOSIS REPORT 2013

59

Of the 300 000 cases of MDR-TB estimated to exist among
notified TB patients with pulmonary TB in 2012 (i.e. the
group of patients known to NTPs and that could be tested
for drug resistance using WHO-recommended diagnostic
tests), only 83 715 received a laboratory-confirmed diagnosis of MDR-TB and were notified in 2012. In addition, just
over 10 000 RR-TB cases were detected using rapid molecular methods, though without results for isoniazid DST at
the time of reporting. Given the large burden of undiagnosed DR-TB, strengthening DST capacity is a high priority
for NTPs (see also Chapter 4).
This chapter has three parts. Section 5.1 summarizes
the key developments in WHO guidance on TB diagnostics
and laboratory strengthening during 2012–2013. Section
5.2 provides the status of laboratory capacity globally,
regionally and nationally based on data reported to WHO
by countries in 2013. The focus is on the 36 countries in
the combined list of 22 HBCs and 27 high MDR-TB burden
countries. Innovative public–private mix (PPM) laboratory
initiatives are highlighted as well. Section 5.3 describes
recent achievements in strengthening TB laboratories, covering incorporation of WHO guidance into policy and practice at country level and the latest status of progress of two
multinational projects (EXPAND-TB and TBXpert) that are
helping to introduce new diagnostics.

5.1

Developments in WHO policy guidance
on TB diagnostics and laboratory
strengthening, 2012–2013

WHO follows a systematic process for policy development
on TB diagnostics, involving synthesis of the available evidence through systematic reviews and meta-analyses where
possible, assessment of the evidence by an external Expert
Group using the GRADE approach,1 and development of
policy guidance2 for dissemination to Member States and
other stakeholders.3 Policy documents are reviewed every
3–5 years, and revised as necessary when new evidence
becomes available.
The first WHO policy guidance on the use of Xpert®
MTB/RIF was issued in December 2010. The recommendations were that Xpert MTB/RIF should be used as the
initial diagnostic test in individuals at risk of having MDRTB or HIV-associated TB (strong recommendation), and
that Xpert MTB/RIF could be used as a follow-on test to
microscopy in settings where MDR and/or HIV is of lesser
concern, especially in smear-negative specimens (this was
a conditional recommendation, recognizing major resource
implications). The 2010 recommendations applied to the
use of Xpert MTB/RIF in sputum specimens only, as data
on its performance (sensitivity and specificity) for testing
of extrapulmonary specimens at that time were limited.
The recommendations applied to children, but only based
on generalization of data from adults.
Following rapid uptake of Xpert MTB/RIF (see section
5.2), a substantial body of new evidence had been generated by 2013.4 This included much more data about the test’s
performance characteristics (sensitivity and specificity) in

60

GLOBAL TUBERCULOSIS REPORT 2013

a wide range of laboratory and epidemiological settings,
additional data on test accuracy in detection of extrapulmonary and paediatric TB, and more evidence about affordability and cost-effectiveness from early implementers in
a limited number of settings. WHO therefore embarked
on a review of policy guidance in 2013. Three systematic
reviews were commissioned on the sensitivity and specificity of Xpert MTB/RIF for the diagnosis of pulmonary and
extrapulmonary TB and RR-TB, in adults and children. A
review of published studies on the affordability and cost-effectiveness of Xpert MTB/RIF was also conducted.
An Expert Group convened by WHO met in May 2013
to review the expanded body of evidence, according to
GRADE procedures. Based on the outcomes of the review
and the recommendations of the Expert Group, which were
also supported by WHO’s Strategy and Technical Advisory
Group for TB (STAG-TB) in June 2013, updated WHO policy guidance was under development at the time that the
current report went to press. Upon finalization, the recommendations are expected to have a major impact on further
country adoption of Xpert MTB/RIF into diagnostic and
clinical algorithms.
Several other new TB diagnostic tests are on the horizon, in various stages of research and development (see
Chapter 8). Once data on their performance are available in
varying epidemiological settings, WHO will be in a position
to evaluate their performance and develop corresponding
policy guidance. A comprehensive list of existing WHO policy documents, including those on the use of microscopy,
culture, DST and non-commercial and molecular methods,
can be found at: http://www.who.int/tb/laboratory/policy_
statements
In addition to diagnostics, WHO
also develops guidance in other areas
of laboratory strengthening. In 2013,
the WHO Tuberculosis laboratory biosafety manual was issued, featuring a
risk-based approach that guides the
essential biosafety measures required
for performing different technical
procedures. The manual describes the
combination of good laboratory practices together with
administrative controls, containment principles, safety
equipment and laboratory facilities that are required to
minimize the generation of infectious aerosols and thus
prevent laboratory-acquired infections. The risk-based
approach to laboratory biosafety is framed around a threetiered system of ‘low’, ‘moderate’ and ‘high’ TB risk precautions:
1
2

3

4

www.gradeworkinggroup.org
WHO handbook for guideline development. Geneva, World Health
Organization, 2012.
WHO policies on TB diagnostics are available at: www.who.int/tb/
laboratory/policy_statements
Weyer K et al. Rapid molecular TB diagnosis: evidence, policy-making
and global implementation of Xpert® MTB/RIF. European Respiratory Journal. November 22, 2012, doi: 10.1183/09031936.00157212

 Low TB risk precautions. These apply to direct acid-fast
bacilli (AFB) microscopy and to Xpert MTB/RIF.
 Moderate TB risk precautions. These apply to the processing of sputum specimens for primary culture inoculation, direct testing (i.e. on sputum smear-positive
samples) using direct non-commercial drug susceptibility assays and LPAs.
 High TB risk precautions in TB containment laboratories. These apply to procedures used to manipulate cultures (solid and liquid) for identification and DST, and
for indirect testing (i.e. on culture isolates) using LPA
and non-commercial DST.

5.2

Status of laboratory capacity globally,
regionally and nationally

Diagnosis of TB in most low- and middle-income countries
still relies on low-cost sputum smear microscopy, despite its
relatively low sensitivity and inability to detect drug resistance. The Global Plan to Stop TB 2011–2015 includes the target that countries maintain at least one smear microscopy
centre per 100 000 population. Globally the target has been
met (1.1 centres per 100 000 population in 2012), but considerable disparities remain at regional and country levels
(Table 5.1). Eight of the 22 HBCs did not meet the target in
2012: Bangladesh, China, Myanmar, Nigeria, Pakistan, the
Russian Federation, South Africa and Viet Nam. Overall,
the Western Pacific and Eastern Mediterranean Regions
had less than one centre per 100 000 population.
Given the continued critical role of microscopy in
TB detection and monitoring of treatment, ensuring
high-quality performance of smear microscopy is essential.
Of the 153 countries and territories that reported data on
the number of smear microscopy centres in 2012, only 39%
indicated the existence of an external quality assessment
programme that covered all centres in the country. Among
the 22 HBCs, only three reported such a programme that
encompassed all centres in 2012 (Bangladesh, India and
Viet Nam), five reported a programme that included at least
95% of centres (Cambodia, China, Myanmar, the Russian
Federation and South Africa), and 14 reported a programme
that included at least 80% of centres.
In 2009, WHO recommended the use of the more sensitive fluorescent light-emitting diode (LED) microscopy as
a replacement for traditional Ziehl–Neelsen (ZN) microscopy. Globally the switch to LED microscopes has been
gradual, and they were reported to be present in only 2%
of microscopy centres in 2012. Overall in 2012, the African
Region was the most advanced in rolling out LED microscopes (6% of microscopy centres), led by South Africa
where 97% of microscopy centres were reported to have
them. Other HBCs in the African Region have shown significant increases in uptake from 2011 to 2012, including
the United Republic of Tanzania (3% to 17% of microscopy
centres) and Mozambique (<1% to 9%).
The current target in the Global Plan to Stop TB 2011–
2015 for both culture and DST (to at least rifampicin and
isoniazid) capacity is one laboratory per 5 million popu-

lation. In 2012, 14 of the 27 high MDR-TB burden countries did not reach the target (Table 5.1; there were two
additional countries that did not report data). Of these 27
countries, 9 reported more than one laboratory per 5 million population using LPAs – a high-throughput molecular
tool that can be used at central and regional levels to rapidly detect resistance to rifampicin and, in some cases, isoniazid. The nine countries comprise eight European countries
and South Africa.
Of the 147 countries and territories that reported
numbers of laboratories with capacity to perform DST, 22
indicated that such capacity did not exist in 2012. While
countries and territories with small TB patient populations
may find it more practical to send specimens to neighbouring countries for DST than to establish national capacity,
countries with larger patient populations should aim as
a priority to build sustainable DST capacity in-country
to allow timely diagnosis of drug-resistant strains. Eight
countries reported more than 1000 notified TB cases in
2012 yet reported having no capacity to perform DST:
Afghanistan, Chad, Eritrea, Guinea-Bissau, Liberia, Papua
New Guinea, Sierra Leone and Somalia.
Quality-assured DST is critical to ensure accurate detection of drug resistance for subsequent treatment decisions
and to avoid false diagnoses. Of the high TB and MDR-TB
burden countries that reported on external quality assessment coverage of DST laboratories (34 of 36), 27 (79%)
reported having a scheme that encompassed all DST laboratories. Of the 117 countries globally that reported on
external quality assessment coverage of DST laboratories,
70% (82 countries) reported such a scheme.
Given its high sensitivity to detect TB and rifampicin
resistance together with its ability to be placed at relatively low levels of laboratory networks, Xpert MTB/RIF has
been rapidly adopted by countries. By the end of June 2013,
3.2 million test cartridges and 1402 GeneXpert machines
(comprising 7553 machine modules) had been procured in
88 of the 145 countries eligible to purchase machines and
cartridges at concessional prices (Figure 5.1).1 The current
price per cartridge is US$ 9.98, following a novel financing
agreement reached in August 2012 between the manufacturer and the United States Agency for International Development (USAID), the United States President’s Emergency
Plan for AIDS Relief (PEPFAR), UNITAID and the Bill &
Melinda Gates Foundation. South Africa alone accounts
for 43% of the modules and 60% of the cartridges procured
globally, and is aiming to position Xpert MTB/RIF as a
replacement for microscopy for the diagnosis of TB. After
South Africa, leading procurers include India, Pakistan,
Zimbabwe and Nigeria.
The complete or partial replacement of microscopy
by Xpert MTB/RIF as the initial diagnostic test and the
increasing number of rifampicin-resistant cases being
detected by Xpert MTB/RIF will require adjustment of
countries’ smear, culture and DST capacities going forward.
1

http://www.who.int/tb/laboratory/mtbrifrollout/

GLOBAL TUBERCULOSIS REPORT 2013

61

TABLE 5.1

Laboratory capacity, 2012a
5/'#4/+%415%12;
2'4%'06#)'1(
.#$14#614+'5
USING LED
/+%415%12'5

07/$'41(
.#$14#614+'5

.#$14#614+'52'4
5 MILLION
POPULATION

07/$'4
OF
.#$14#614+'5

Afghanistan





603

2.0

2

2

0.3

0

0

0

0

1

Armenia





30

1.0

0

1

1.7

1

1.7

1

1.7

0

#\GTDCKLCP





72



4

7



3

1.6

1

0.5

7

Bangladesh





1 070

0.7

2

3



3



1



12

Belarus





196

2.1

2

29

15



4.3



4.3



$TC\KN





4 000

2.0

–

220

Bulgaria





34

0.5

0

31

Cambodia





214

1.4

10

3

5.5

.#$14#614+'5
2'4/+..+10
POPULATION

07/$'4
OF LABO4#614+'5

.#$14#614+'5
2'4/+..+10
POPULATION

:2'46
/6$4+(

HIGH
/&46$
$74&'0

NO 

.#$14#614+'5
2'4
POPULATION

.+0'241$'#55#;

HIGH
TB
$74&'0

;'5 

07/$'4
1(.#$14#614+'5

&47)575%'26+$+.+6;
TESTING

%7.674'

07/$'4
OF SITES

35

0.9



0.2

13

14

9.6

4

2.7

0

1.0

1

0.3

0

0

6

21

China







0.2

2

1 014

3.7

190

0.7

21



16

&4%QPIQ





1 522

2.3



4

0.3

2

0.2

1



26

Estonia





5

0.4

100

2

7.7

2

7.7

2

7.7

2

Ethiopia





2 531



0

5

0.3

1



5

0.3

7

Georgia





11

0.3

9

2

2.3

1

1.1

2

2.3

1

India







1.1

2

70

0.3



0.2

33

0.1

32

Indonesia





5 566

2.3

0

46

0.9

5

0.1

2



9

-C\CMJUVCP





466

2.9

0

22



22



11

3.4

4

Kenya







4.2



2

0.2

2

0.2

2

0.2

15

-[TI[\UVCP





122

2.2

0

11

3

2.7

2



7

16



0

4

1

2.4

1

2.4

2

–

–

1.2

9

3

0.6

2

10

Latvia





Lithuania





/Q\CODKSWG





Myanmar







0.9

14

2

0.2

Nigeria





1 314



2

5

0.1

300

9.7
–

–

–

0.4

0

0

12

2

0.2

2

0.2

3

3



4

0.1

32

Pakistan











7

0.2

4

0.1

2



15

Philippines





2 565

2.7



13

0.7

3

0.2

1



17

4GRWDNKEQH/QNFQXC





–

–

4WUUKCP(GFGTCVKQP





1 031

0.7

–

117

4.1

110



South Africa







0.4

97

15

1.4

15

1.4

–

–

–
–
15

1.4

100

Tajikistan







1.1

4

3

1.9

1

0.6

1

0.6

3

Thailand







1.6

6

65

4.9



1.3

12

0.9

14

Uganda





1 152

3.2



4

0.6

4

0.6

4

0.6

25

Ukraine









5



9.4

41

4.5

0

0

15

746CP\CPKC





945

2.0

17

4

0.4

1

0.1

3

0.3

13

7\DGMKUVCP





291

1.0

1

7

1.2

3

0.5

3

0.5

7

Viet Nam







0.9



25

1.4

2

0.1

2

0.1

22

95% of total funding per year)
meant that domestic funding dominated total funding for
TB globally (88–92% per year).
International donor funding in the 104 countries included in trend analyses grew from US$ 0.2 billion in 2002 to
US$ 0.5 billion in 2011. There was striking variation among
country groups in terms of the share of total funding provided from international donor sources. By 2011, donor
funding represented 39% of total funding in the 17 HBCs
excluding BRICS, which account for about one third of
the world’s TB cases; 42% of funding in African countries
excluding South Africa; and 67% of total funding in lowincome countries (25 of which are in Africa). The Global
Fund accounted for 64% of all donor funding reported by
countries during the decade 2002–2011.
Most funding was used for the diagnosis and treatment of drug-susceptible TB (over 85% each year). Small
amounts were used for diagnosis and treatment of MDRTB, although funding started to increase in BRICS, upper
middle-income countries, and countries in Europe and
Latin America around 2006.
Despite growth in funding from domestic and international donor sources, NTPs were not able to mobilize all the
funding that they estimated to be needed. Funding gaps
(i.e. the difference between assessments by NTPs of funding
needs for TB prevention, diagnosis and treatment and the
actual amount of funds mobilized) persisted, and increased
from US$ 257 million in 2002 to US$ 563 million in 2011. It
should be noted that the funding gaps reported by NTPs are
sometimes based on relatively conservative assessments of
funding needs. When national strategic plans with more

TABLE 7.1

125 countries included in analyses of TB ßnancing in 2013a,b
LOW-INCOME
QHPQVKßGFECUGUINQDCNN[

b

722'4/+&&.'+0%1/'
QHPQVKßGFECUGUINQDCNN[

$4+%5
QHPQVKßGFECUGU
globally)

*+)*$74&'0%17064+'5
':%.7&+0)$4+%5
QHPQVKßGFECUGU
globally)

African

Benin, Burkina Faso,
Burundi, Central
#HTKECP4GRWDNKE
Chad, Comoros,
&4%QPIQ'TKVTGC
Ethiopia, Gambia,
Guinea, GuineaBissau, Kenya, Liberia,
Madagascar, Malawi,
/CNK/Q\CODKSWG
0KIGT4YCPFC
Sierra Leone, Togo,
7ICPFC746CP\CPKC
 500 μL is
proportional to F (it was assumed that it was higher by a
factor of 2.52). For each 100 μL CD4 decline in the remaining categories (350–499, 250–349, 200–249, 100–199,



GLOBAL TUBERCULOSIS REPORT 2013

50–99 CD4 cells/μL, and CD4 count less than 50 cells μL),
the risk of infection is represented as:
F(c<500) = F(c>500)∙p(1)∙p(2)dc,
where p(1) is a parameter that is used to recognize that
people living with HIV who have high CD4 counts could
be at higher risk of TB infection relative to those who are
HIV-negative, and p(2) controls the exponential increase in
RR that occurs with CD4 decline. dc is the number of 100μL
CD4 decline associated with the midpoint of each CD4 category relative to 500: dc= (3.0, 4.4, 8.6, 12.9, 19.2, 28.6, 37.3)
for the six CD4 categories.
A reduction in RR is applied for those who have been on
ART for more than one year.

Parameter assumptions
To match total TB incidence and estimates of the number of HIV-positive TB cases from HIV testing data where
available, it was assumed that p(1)=2.5 and p(2) was fitted
accordingly.
In the RR-approach, the ‘biological meaning’ that should
be attached to the parameters and a more straightforward
interpretation of these parameters as regression coefficients need to be balanced. Both parameters can be fitted
or both can be fixed. Varying at least p(2) captures the variation among countries that is expected due to variation
in the baseline (HIV-negative) CD4 count, and it strikes a
balance between the biological and regression mechanisms.
The RR model approach to estimation of TB incidence
was used for people on ART. Although an estimate of TB
incidence among people on ART could be obtained from
surveillance data reported to WHO (such that it is arguably
not necessary to use the RR model), limitations of the ART
data (in particular that some countries appear to report
cumulative totals of people on ART) meant that the RR
approach needed to be used.
Hazard ratios (HR) of 0.35 were assumed for all CD4 at
ART initiation categories. Suthar et al have reported HRs
of 0.16, 0.35 and 0.43 for those on ART with CD4 count
< 200, 200–350 and > 350,3 and these values could in principle be used. However, Spectrum tracks only CD4 at initiation, thus limiting the use of CD4-specific HRs for people
on ART.
It was further assumed that the HR of 0.35 applies only
to patients on ART for more than six months. Spectrum’s
ART-mortality estimates, derived mostly from ART cohorts
in Sub-Saharan Africa, suggest that mortality remains very
1

2

3

Williams B. The impact of ART for HIV on TB. http://www.who.int/
hiv/topics/artforprevention/williams.pdf (accessed July 2013).
Sonnenberg P, et al. How Soon after Infection with HIV Does the
Risk of Tuberculosis Start to Increase? A Retrospective Cohort
Study in South African Gold Miners. Journal of Infectious Diseases. 2005 Jan 15;191(2):150–8.
Suthar AB, Lawn SD, del Amo J, Getahun H, Dye C, et al. (2012)
Antiretroviral Therapy for Prevention of Tuberculosis in Adults
with HIV: A Systematic Review and Meta-Analysis. PLoS Med 9(7):
e1001270. doi:10.1371/journal.pmed.1001270

high in the first six months of ART. Since TB is a leading
contributor to mortality among HIV-positive people, it was
judged that the HR for patients on ART for 0‒6 months is
likely to remain high; therefore, a reduction factor due to
ART was not applied for this subset of patients.

TABLE A1.5

Sources of data on HIV prevalence among
incident TB cases
&+4'%6/'#574'/'061(6*'24'8#.'0%'1(*+8+06$2#6+'065

National surveysa

A simple least squares approach was used to fit the model to
total TB incidence, and to all available estimates of TB incidence among people living with HIV. These estimates of TB
incidence among people living with HIV were obtained by
three sampling methods: population surveys of the prevalence of HIV among TB cases (least biased, but scarce due
to logistical constraints), sentinel HIV data (biases include
more testing of people with advanced HIV-related disease)
and routine HIV testing of reported TB patients (variable
coverage). To increase the influence of survey data, replicas
of the survey data were included in the likelihood function.
In other words, for years for which data from HIV testing
were available, identical copies of the HIV-test data were
added to the likelihood function. The estimate of total TB
incidence was based on much more data, evenly spread out
in the estimation period 1990–2015.
Model testing showed that using two replicates of the
HIV survey data (i.e. duplicating the survey data) and
two replicates of the routine testing data with coverage
greater than 90% was the best approach to disaggregating
TB incidence: the fit passed close to the survey or highcoverage routine testing data points that were available.
For each of a) HIV sentinel and b) routine testing with coverage between 50–90%, data were not used.
A prototype Bayesian importance sampling (IMIS)
algorithm was developed to handle complex data weighing possibilities, but it was based on subjective priors and
likelihood functions and is more time-consuming to run
than simple least squares. For the purposes of producing
estimates for all countries automatically, the least squares
method was used. In future, least squares and IMIS fitting
could be made available to the end user.
For countries with no data, a range for p(2) was estimated from countries with survey or testing data, which
suggest that p(2) = 1.96 [1.8–2.1]. The RR-model was then
fitted to total TB incidence only. There is no satisfactory
way to verify results for TB incidence among people living
with HIV when no HIV-testing data are available. However,
comparison of the global estimate for TB incidence among
people living with HIV produced by Spectrum and estimates previously published by WHO (based on a different
method using HIV prevalence instead of CD4 distributions
and using HIV-test data in a different way) suggests that
the RR-model works reasonably well.
Provider-initiated testing and counselling with at least
50% HIV testing coverage is the most widely available
source of information on the prevalence of HIV in TB
patients. However, this source of data is affected by biases,
particularly when coverage is closer to 50% than to 100%.
In all countries with repeat data from testing, the relation-

124

HIV sentinel surveillance

Likelihood function

a

07/$'41(%17064;;'#45

24

Provider-initiated testing and counselling with at
least 50% coverage of testing

1297

Total, at least one data source available

1322

the reported survey number is over-stated as a number of country reports confused
survey and routine testing with near 100% coverage

ship between the prevalence of HIV in TB patients and the
coverage of HIV testing was examined graphically. In some
countries, the prevalence of HIV in TB patients was found
to decrease with increasing HIV testing coverage while in
others it increased with increasing HIV testing coverage;
in most countries, the prevalence of HIV followed highly
inconsistent patterns (with repeat changes in direction) as
HIV testing coverage increased. Therefore, it was not possible to adjust for the effect of incomplete coverage of HIV
testing on estimates of the prevalence of HIV among TB
patients. The assumption was thus made that TB patients
with an HIV test result were statistically representative
of all TB cases. As coverage of HIV testing continues to
increase globally, biases will decrease.
For the 1003 country-year data points corresponding to
countries for which no surveillance data were available, the
prevalence of HIV was estimated indirectly according to
the following equation:
t=

hl
l + h(l – l)

In this equation, t is HIV prevalence among incident TB
cases, h is HIV prevalence among the general population
(from the latest time-series provided by UNAIDS) and ρ is
the incidence rate ratio (IRR) (defined as the incidence rate
of TB in HIV-positive people divided by the incidence rate
of TB in HIV-negative people). We then let logit(t) be log(t/
(1-t)) and logit(h) be log(h/(1-h)). Using data from countries
where HIV prevalence has been estimated by UNAIDS as an
independent variable, a linear model of logit-transformed
t was fitted using logit-transformed h according to the following equation, written in matrix notation:
T̂Xβ
where T̂ is a vector of predicted logit(t), X is an n x 2 matrix
in which the first column holds 1s, and the second column
holds logit(h). The vector β holds estimated model parameters. Models were tested with lags set for logit(h) ranging
from no lag to a lag of eight years. The best fit was obtained
with a lag of one year.
Models were run using Monte Carlo simulations in
which h was drawn randomly from a Beta distribution with
shape parameters computed as described in Section 4.1,
(low and high uncertainty bounds are provided by UNAIDS
– also see Table A1.5). The model was run 50 000 times

GLOBAL TUBERCULOSIS REPORT 2013

109

using country-specific distributions for H and T (noted in
capital letters to denote vectors or matrices) based on their
uncertainty intervals. The uncertainty bounds for β were
chosen as the 2.5th and 97.5th centiles.

5.

Estimates of TB prevalence, 1990–2012

The best way to measure the prevalence of TB is through
national population-based surveys of TB disease.1,2 Data
from such surveys are available for an increasing number
of countries (Chapter 2). It should be noted, however, that
measurements of prevalence are typically confined to the
adult population. Furthermore, prevalence surveys exclude
extrapulmonary cases and do not allow the diagnosis of
cases of culture-negative pulmonary TB.
When there is no direct measurement from a national
survey of the prevalence of TB disease, prevalence is the
most uncertain of the three TB indicators used to measure
disease burden. This is because prevalence is the product of
two uncertain quantities: (i) incidence and (ii) disease duration. The duration of disease is very difficult to quantify
because it cannot be measured during surveys of the prevalence of TB disease (surveys truncate the natural history
of disease). Duration can be assessed in self-presenting
patients, but there is no practical way to measure the duration of disease in patients who are not notified to NTPs.
Indirect estimates of prevalence were calculated according to the following equation:
P=

- Ii,j d i,j , iD{1,2}, jD{1,2}

where the index variable i denotes HIV+ and HIV–, the
index variable j denotes notified and non-notified cases, d
denotes the duration of disease in notified cases and I is
total incidence. In the absence of measurements, we did not
allow duration in notified cases to vary among countries.
Given their underlying uncertainty, prevalence estimates
should be used with great caution in the absence of direct
measurements from a prevalence survey. Unless measurements were available from national programmes (for example, Turkey), assumptions of the duration of disease were
used as shown in the last four rows of Table A1.3.

6.

Estimates of the number of cases
of and deaths from MDR-TB



2TQRQTVKQPQHPQVKßGFECUGUQH6$VJCVJCXG
MDR-TB, 2012

Global and regional estimates of the proportion of new and
retreatment cases of TB that had MDR-TB in 2012 were calculated using country-level information. If countries had
reported data on the proportion of new and retreatment
cases of TB that have MDR-TB from routine surveillance
or a survey of drug resistance the latest available information was used. For countries that have not reported such
data, estimates of the proportion of new and retreatment
cases of TB that have MDR-TB were produced using modelling (including multiple imputation) that was based on
data from countries for which data do exist. Estimates for
countries without data were based on countries that were
110

GLOBAL TUBERCULOSIS REPORT 2013

considered to be similar in terms of TB epidemiology (for
country groups see Appendix 1). The observed and imputed
estimates of the proportion of new and retreatment cases
of TB that have MDR-TB were then pooled to give a global
estimate, with countries weighted according to their share
of global notifications of new and retreatment cases.

6.2

MDR-TB mortality, 2012

The VR mortality data reported to WHO by Member States
does not differentiate between MDR-TB and non-MDR-TB
as a cause of death (there is no specific ICD-9 or ICD-10
codes for MDR-TB, although countries such as South Africa
have allocated two specific codes U51 and U52 to classify
deaths from MDR-TB and XDR-TB respectively).3 Therefore, a systematic review and meta-analysis of the published literature was undertaken to estimate the relative
risk of dying from MDR-TB compared with non MDR-TB.
The global estimate of MDR-TB deaths (Box 2.3) was then
based on the following formula:
m = M.p.r
Where:
m = global MDR-TB mortality,
M = global TB mortality,
p = overall proportion of MDR-TB among prevalent TB
cases, approximated by the weighted average of the
proportion of new and retreated cases that have MDRTB,
r = the relative risk of dying from MDR-TB versus nonMDR-TB.

6.3

Numbers of incident cases of MDR-TB, 2012

The global estimate of MDR-TB incidence was calculated as
the addition of three groups of MDR-TB incident cases:
1. incident MDR-TB among new pulmonary and extra-pulmonary incident TB cases, using the proportion of
MDR-TB among new cases from drug resistance surveillance (DRS);
2. incident MDR-TB among relapses, using the proportion
of MDR-TB among new cases from DRS and the estimated relative risk of MDR among relapse versus new
cases; and
3. incident MDR-TB among retreated cases that are not
relapses, which was assumed to follow a uniform distribution with min=0, max=upper limit of the global proportion of MDR-TB among retreated cases estimated
from DRS.
A second method to estimate global MDR-TB incidence was
also explored, in which the global estimate of mortality due
1

2

3

Glaziou P et al. Tuberculosis prevalence surveys: rationale and
cost. International Journal of Tuberculosis and Lung Disease, 2008,
12(9):1003–1008.
TB prevalence surveys: a handbook. Geneva, World Health Organization, 2011 (WHO/HTM/TB/2010.17).
Mortality and causes of death in South Africa, 2010: Findings from
death notification. http://w w w.statssa.gov.za /publications/
p03093/p030932010.pdf

to MDR-TB was divided by the estimated case fatality ratio
(CFR) among cases of MDR-TB. The CFR was calculated as
a weighted average of the case fatality ratio among patients
that are treated and those that are not, according to the following formula:
4 = pt * 4t + (1-pt)*4un
Where:
pt = proportion treated, approximated by the proportion
of enrolled MDR-TB patients on treatment out of
those estimated to exist among notified TB patients
with pulmonary TB;
4t = case fatality rate among patients treated for MDR-TB,
using treatment outcome data for MDR-TB patient
cohorts;
4un = case fatality rate among people with MDR-TB who are
not treated, which was assumed to follow a uniform
distribution with min=0.4, max=0.6.
Outputs from both methods gave similar best estimates
of MDR-TB incidence with largely overlapping confidence
intervals.

6.4

Resistance to second-line drugs among
patients with MDR-TB

Data from 75 countries were used to produce global estimates of the following proportions: (i) patients with MDRTB who had XDR-TB; (ii) patients with MDR-TB who had
fluoroquinolone resistance; (iii) patients with MDR-TB who
had resistance to second-line injectable drugs and fluoroquinolones but not XDR-TB. The latest available national
and subnational data from each country were analysed
using logistic regression models with robust standard
errors to account for the clustering effect at the level of the
country or territory. The analysis was limited to countries
in which more than 66% of MDR-TB cases received second-line DST.

7.

Projections of incidence, prevalence
and mortality up to 2015

Projections of TB incidence, prevalence and mortality
rates up to 2015 enable assessment of whether global targets set for 2015 are likely to be achieved at global, regional and country levels. Projections for the years 2013–2015
were made using exponential smoothing models fitted to
data from 2006–2012.

8.

Estimation of uncertainty

There are many potential sources of uncertainty associated
with estimates of TB incidence, prevalence and mortality,
as well as estimates of the burden of HIV-associated TB
and MDR-TB. These include uncertainties in input data, in
parameter values, in extrapolations used to impute missing
data, and in the models used.
We used fixed population values from the UNPD. We did
not account for any uncertainty in these values.
Notification data are of uneven quality. Cases may be

underreported (for example, missing quarterly reports
from remote administrative areas are not uncommon), misclassified (in particular, misclassification of recurrent cases
in the category of new cases is common), or overreported
as a result of duplicated entries in TB information systems.
The latter two issues can only be addressed efficiently in
countries with case-based nationwide TB databases that
include patient identifiers. Sudden changes in notifications
over time are often the result of errors or inconsistencies in
reporting, but may sometimes reflect abrupt changes in TB
epidemiology (for example, resulting from a rapid influx of
migrants from countries with a high burden of TB, or from
rapid improvement in case-finding efforts).
Missing national aggregates of new and recurrent cases were imputed by interpolation. Notification trajectories
were smoothed using a penalized cubic splines function
with parameters based on the data. Attempts to obtain corrections for historical data are made every year, but only
rarely do countries provide appropriate data corrections.
Mortality estimates incorporated the following sources of uncertainty: sampling uncertainty in the underlying
measurements of TB mortality rates from data sources,
uncertainty in estimates of incidence rates and rates of HIV
prevalence among both incident and notified TB cases, and
parameter uncertainty in the Bayesian model. Time series
of TB mortality were generated for each country through
Monte Carlo simulations.
Unless otherwise specified, uncertainty bounds and
ranges were defined as the 2.5th and 97.5th centiles of outcome distributions. Throughout this report, ranges with
upper and lower bounds defined by these centiles are provided for all estimates established with the use of simulations. When uncertainty was established with the use of
observed or other empirical data, 95% confidence intervals
are reported.
The model used the following sequence: (1) Overall TB
incidence estimation after review and cleaning of case
notification data; (2) cleaning and adjustment of raw mortality data from VR systems and mortality surveys, followed by imputation of missing values in countries with
VR or survey data – in some countries, step 1 was updated to account for mortality data; (3) cleaning of measurements of HIV prevalence among TB patients followed by
estimating HIV-positive TB incidence using the Spectrum
programme and HIV-positive TB mortality; (4) estimation
of HIV prevalence among incident cases of TB through
modelling in countries with no measurements; (5) estimation of HIV-negative TB mortality in countries with no VR
data followed with an update of step 1 in some countries;
(6) review of prevalence measurements, adjustments for
childhood TB and bacteriologically unconfirmed TB, and
estimation of prevalence followed with an update of step 1
in some countries; (7) estimation of incidence and mortality disaggregated by age and sex and disaggregated by drug
resistance status.
The general approach to uncertainty analyses was to
draw values from specified distributions for every param-

GLOBAL TUBERCULOSIS REPORT 2013

111

eter (except for notifications and population values) in
Monte Carlo simulations, with the number of simulation
runs set so that they were sufficient to ensure stability
in the outcome distributions. For each country, the same
random generator seed was used for every year, and errors
were assumed to be time-dependent within countries
(thus generating autocorrelation in time series). Regional
parameters were used in some instances (for example, for
CFRs). Summaries of quantities of interest were obtained
by extracting the mean, 2.5th and 97.5th centiles of posterior distributions. Wherever possible, uncertainty was
propagated analytically by approximating the moments of
functions of random variables using Taylor expansions –
such as when taking the product or the ratio of two random
variables – rather than through Monte Carlo simulations,
in order to shorten computing time.

High-income countries: Andorra, Aruba, Australia,
Austria, the Bahamas, Bahrain, Barbados, Belgium, Bermuda, Brunei Darussalam, Canada, the Cayman Islands, China, Hong Kong SAR, China Macao SAR, Croatia, Cyprus,
the Czech Republic, Denmark, Equatorial Guinea, Estonia, Finland, France, French Polynesia, Germany, Greece,
Greenland, Guam, Hungary, Iceland, Ireland, Israel, Italy,
Japan, Kuwait, Luxembourg, Malta, Monaco, the Netherlands, the Netherlands Antilles, New Caledonia, New Zealand, Northern Mariana Islands, Norway, Oman, Poland,
Portugal, Puerto Rico, Qatar, the Republic of Korea, Saint
Kitts and Nevis, San Marino, Saudi Arabia, Singapore, Slovakia, Slovenia, Spain, Sweden, Switzerland, Trinidad and
Tobago, the Turks and Caicos Islands, US Virgin Islands,
United Arab Emirates, the United Kingdom, the United
States.

Appendix 1. Epidemiological regions used
for analyses

Eastern Mediterranean: Afghanistan, Egypt, Iran (Islamic
Republic of), Iraq, Jordan, Lebanon, Libya, Morocco, Pakistan, Syrian Arab Republic, Tunisia, West Bank and the
Gaza Strip, Yemen.

Africa – countries with high HIV prevalence: Botswana, Burundi, Cameroon, the Central African Republic, the
Congo, Côte d’Ivoire, the Democratic Republic of the Congo, Ethiopia, Gabon, Kenya, Lesotho, Malawi, Mozambique,
Namibia, Nigeria, Rwanda, South Africa, South Sudan,
Swaziland, Uganda, the United Republic of Tanzania, Zambia, Zimbabwe.
Africa – countries with low HIV prevalence: Algeria, Angola, Benin, Burkina Faso, Cape Verde, Chad, the
Comoros, Djibouti, Eritrea, the Gambia, Ghana, Guinea,
Guinea-Bissau, Liberia, Madagascar, Mali, Mauritania,
Mauritius, the Niger, Sao Tome and Principe, Senegal, Seychelles, Sierra Leone, Somalia, Sudan, Togo.
Central Europe: Albania, Bosnia and Herzegovina, Montenegro, Serbia, the former Yugoslav Republic of Macedonia, Turkey.
Eastern Europe: Armenia, Azerbaijan, Belarus, Bulgaria,
Georgia, Kazakhstan, Kyrgyzstan, Latvia, Lithuania, the
Republic of Moldova, Romania, the Russian Federation,
Tajikistan, Turkmenistan, Ukraine, Uzbekistan.

112

GLOBAL TUBERCULOSIS REPORT 2013

Latin America: Anguilla, Antigua and Barbuda, Argentina, Belize, Bolivia (Plurinational State of), Bonaire,
Saint Eustatius and Saba, Brazil, British Virgin Islands,
Chile, Colombia, Costa Rica, Cuba, Curaçao, Dominica, the
Dominican Republic, Ecuador, El Salvador, Grenada, Guatemala, Guyana, Haiti, Honduras, Jamaica, Mexico, Montserrat, Nicaragua, Panama, Paraguay, Peru, Saint Kitts
and Nevis, Saint Lucia, Saint Vincent and the Grenadines,
Sint Maarten (Dutch part), Suriname, Uruguay, Venezuela
(Bolivarian Republic of).
South East Asia: Bangladesh, Bhutan, Democratic People’s Republic of Korea, India, Indonesia, Maldives, Myanmar, Nepal, Sri Lanka, Thailand, Timor-Leste.
West Pacific: American Samoa, Cambodia, China, Cook
Islands, Fiji, Kiribati, Lao People’s Democratic Republic,
Malaysia, Marshall Islands, Micronesia (Federated State
of), Mongolia, Nauru, Niue, Palau, Papua New Guinea,
the Philippines, Samoa, Solomon Islands, Tokelau, Tonga,
Tuvalu, Vanuatu, Viet Nam, Wallis and Futuna Islands.

#00':

Country proßles

AFGHANISTAN

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN
Estimates of TB burdena 2012


07/$'4(thousands)

4#6' (per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿ 

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

0.31 (0.19–0.46)

1 (0.63–1.5)

Incidence (HIV+TB only)



120
100
80
60
40
20
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

52 (44–63)

6$ECUGPQVKßECVKQPU



0'9%#5'5



5OGCTRQUKVKXG








1000

4'64'#6/'06%#5'5

 

   4GNCRUG

 

Smear-negative

4 740 (17)

Treatment after failure

160 (13)

Smear-unknown / not done

2 665

Treatment after default

37 (3)

Extrapulmonary

6 906 (24)

Other

702

Total new

(9)

Prevalence
(rate per 100 000 population)

Case detection, all forms (%)

Population 2012 30 million

Other

(2)

28 332

Total retreatment

1 246

750
500
250
0
1990

Other (history unknown)
6QVCNPGYCPFTGNCRUG



 6QVCNECUGUPQVKßGF


Incidence (rate per 100 000
population per year)

300

New cases




5/'#4215+6+8'

/(TCVKQ
#IG

5/'#40')#6+8'70-0190
016&10'



':64#27./10#4;











Laboratories

2012

Smear (per 100 000 population)

2.0

Culture (per 5 million population)

0.3

Drug susceptibility testing (per 5 million population)

200

100

0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUQWVUKFGEQWPVT[









New smear-positive and/or culture-positive

91

0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



Is rifampicin used throughout treatment for new patients?

No

TB/HIV 2012
TB patients with known HIV status

07/$'4

(%)

7 275

(25)

*+8RQUKVKXG6$RCVKGPVU





*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 









*+8RQUKVKXGRGQRNGUETGGPGFHQT6$



HIV-positive people provided with IPT

25

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

4'64'#6/'06

 ¿ 

 ¿

750 (21–2 600)

400 (93–700)

Reported cases of MDR-TB 2012

0'9

4'64'#6/'06

616#.



  



.CDQTCVQT[EQPßTOGF/&46$ECUGU







2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV







%CUGUVGUVGFHQT/&46$

60
40
20

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary



0'9

80

0
1995

2011

Retreatment

6
Number of patients

*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

4

2

0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically


3%

% Funded internationally

65%

% Unfunded

32%

Total budget (US$ millions)

16

Financing TB control

12
8
4
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

115

BANGLADESH

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012


07/$'4 6*175#0&5  4#6'(per 100 000 population)

/QTVCNKV[ GZENWFGU*+8 6$ 

 ¿ 

 ¿

/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

Incidence (HIV+TB only)

0.24 (0.2–0.29)

0.16 (0.13–0.19)

150

100

50

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

49 (41–59)

6$ECUGPQVKßECVKQPU



0'9%#5'5





5OGCTRQUKVKXG







1000

4'64'#6/'06%#5'5

 

   4GNCRUG

5OGCTPGICVKXG

 

   6TGCVOGPVCHVGTHCKNWTG

Smear-unknown / not done

0

'ZVTCRWNOQPCT[

(0)

 

Treatment after default

257 (3)

   1VJGT

Other

0

Total new

Total retreatment



6QVCNPGYCPFTGNCRUG

 

(0)

161 790

1VJGT JKUVQT[WPMPQYP 

Prevalence
(rate per 100 000 population)

Case detection, all forms (%)

Population 2012 155 million

8 001

 





 6QVCNECUGUPQVKßGF

750
500
250
0
1990





New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories

2012

Smear (per 100 000 population)

Incidence (rate per 100 000
population per year)

400

0.7

%WNVWTG RGTOKNNKQPRQRWNCVKQP 

300
200
100
0
1990

1995



&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP 

Incidence

2010

Incidence (HIV+TB)

Notifications



+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUQWVUKFGEQWPVT[









New smear-positive and/or culture-positive

92

0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

6$RCVKGPVUYKVJMPQYP*+8UVCVWU



HIV-positive TB patients

63

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 









HIV-positive people screened for TB

1999

2001

2003

2005

2007

2009

2011

Retreatment

80

0'9

4'64'#6/'06

 ¿ 

 ¿

1 900 (920–3 300)

2 300 (1 900–2 700)

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

(3)

0'9

4'64'#6/'06

616#.

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

Number of patients

/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

1997

0

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$

60

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

429

HIV-positive people provided with IPT

80

40
1995

(%)



*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

60
40
20
0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 

2013



&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU'UVKOCVGUQH6$FKUGCUGDWTFGPJCXGPQVDGGPCRRTQXGFD[
the national TB programme in Bangladesh and a joint reassessment will be undertaken following the
completion of the prevalence survey planned for 2014.
b Comprehensive data on domestic and international funding in 2013 could not be reported. Funding from
75#+&HQT1EVQDGT¿5GRVGODGTYCU75OKNNKQP

116

GLOBAL TUBERCULOSIS REPORT 2013

Total budget (US$ millions)

50

Financing TB controlb

40
30
20
10
0

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

Unfunded

BRAZIL

Estimates of TB burdena 2012
07/$'4(thousands)

4#6' (per 100 000 population)

4.9 (4.6–5.2)

2.5 (2.3–2.6)

2.5 (2.2–3)

1.3 (1.1–1.5)

Prevalence (includes HIV+TB)

120 (51–210)

59 (25–107)

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

Mortality (excludes HIV+TB)
Mortality (HIV+TB only)

6$ECUGPQVKßECVKQPU



0'9%#5'5






 

   4GNCRUG

5OGCTPGICVKXG

   6TGCVOGPVCHVGTHCKNWTG

 

   6TGCVOGPVCHVGTFGHCWNV

 

Extrapulmonary

10 297 (14)

1VJGT

 

Other

4 133 (36)

   

Total new

71 230

Other (history unknown)

25

6QVCNPGYCPFTGNCRUG



4
2
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

300

4'64'#6/'06%#5'5

5OGCTRQUKVKXG
5OGCTWPMPQYPPQVFQPG

6






8



Total retreatment



11 500

 6QVCNECUGUPQVKßGF

Prevalence
(rate per 100 000 population)



10

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN

Population 2012 199 million

200

100

0
1990



New cases




5/'#4215+6+8'

/(TCVKQ
#IG

5/'#40')#6+8'70-0190
016&10'



':64#27./10#4;











Laboratories

2012

Smear (per 100 000 population)

2.0

Culture (per 5 million population)

5.5

Drug susceptibility testing (per 5 million population)

Incidence (rate per 100 000
population per year)

150

100

50

0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.9

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









New smear-positive and/or culture-positive

76

New smear-negative/extrapulmonary

70

4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

TB patients with known HIV status

45 733

(55)

9 049

(20)

HIV-positive TB patients
*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 
*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 









Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

80
60
40
20
0
1995

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people screened for TB

2011

Retreatment

10 000

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

Number of patients

HIV-positive people provided with IPT

0'9

4'64'#6/'06

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

8000
6000
4000
2000
0
2003 2004

616#.

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



(WPFGFFQOGUVKECNN[



% Funded internationally

2%

% Unfunded

14%

Total budget (US$ millions)

100

Financing TB control

80
60
40
20
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

117

CAMBODIA

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN
Estimates of TB burdena 2012


07/$'4(thousands)

4#6'(per 100 000 population)

9.3 (4.3–16)

63 (29–110)

Mortality (excludes HIV+TB)
/QTVCNKV[ *+8 6$QPN[ 
2TGXCNGPEG KPENWFGU*+8 6$ 
Incidence (includes HIV+TB)
+PEKFGPEG *+8 6$QPN[ 

 ¿

 ¿ 

 ¿

61 (52–70)

411 (353–474)

 ¿ 

 ¿

400
300
200
100
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

66 (57–77)

6$ECUGPQVKßECVKQPU



0'9%#5'5



5OGCTRQUKVKXG








2500

4'64'#6/'06%#5'5

 

   4GNCRUG

5OGCTPGICVKXG

 

   6TGCVOGPVCHVGTHCKNWTG

Smear-unknown / not done

0

Extrapulmonary

(0)

15 290 (40)

Other

0

Total new

1 102

6QVCNPGYCPFTGNCRUG



22 (4)

Other

(0)

38 637

Other (history unknown)

 

Treatment after default

Total retreatment

519

 6QVCNECUGUPQVKßGF

Prevalence
(rate per 100 000 population)

Case detection, all forms (%)

 ¿ 

Population 2012 15 million

2000
1500
1000
500
0
1990



New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;











/(TCVKQ
#IG



Laboratories

2012

Smear (per 100 000 population)

1.4

Culture (per 5 million population)

1.0

Drug susceptibility testing (per 5 million population)

0.3

Is second-line drug susceptibility testing available?

No

Incidence (rate per 100 000
population per year)

1000
750
500
250
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications









New smear-positive and/or culture-positive

93

New smear-negative/extrapulmonary

94

4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

6$RCVKGPVUYKVJMPQYP*+8UVCVWU





HIV-positive TB patients

1 433

(4)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

80

70
1995

1997

1999

2001

2003

2005

2007

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people screened for TB

2009

2011

Retreatment

6000

1 145

Estimates of MDR-TB burden 2012a

0'9

4'64'#6/'06

QH6$ECUGUYKVJ/&46$

 ¿ 

 ¿

/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

330 (160–590)

56 (21–110)

Reported cases of MDR-TB 2012

Number of patients

HIV-positive people provided with IPT

%CUGUVGUVGFHQT/&46$

90

0'9

4'64'#6/'06

  

  













.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

4000

2000

0
2003 2004

616#.



2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically

2013


5%

% Funded internationally

34%

% Unfunded

62%

Total budget (US$ millions)

45

Financing TB control

30

15

0
Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.



GLOBAL TUBERCULOSIS REPORT 2013

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

CHINA

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

4#6' (per 100 000 population)

44 (43–46)

3.2 (3.1–3.3)

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

Mortality (excludes HIV+TB)
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

6$ECUGPQVKßECVKQPU



0'9%#5'5









 

   4GNCRUG

5OGCTPGICVKXG

   6TGCVOGPVCHVGTHCKNWTG

 

5OGCTWPMPQYPPQVFQPG

   6TGCVOGPVCHVGTFGHCWNV

'ZVTCRWNOQPCT[

   1VJGT
0

Total new
Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



 
 
 

(0)

858 861

20
15
10
5
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

300

4'64'#6/'06%#5'5

5OGCTRQUKVKXG

Other

25



Prevalence
(rate per 100 000 population)



Population 2012 1 377 million

Total retreatment

41 817

 6QVCNECUGUPQVKßGF

200

100

0
1990



New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories

2012

Smear (per 100 000 population)

0.2

Culture (per 5 million population)

3.7

Drug susceptibility testing (per 5 million population)

Incidence (rate per 100 000
population per year)

200
150
100
50
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.7

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









New smear-positive and/or culture-positive

95

New smear-negative/extrapulmonary

95

4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012
TB patients with known HIV

statusb

07/$'4

(%)









*+8RQUKVKXG6$RCVKGPVU
*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 



*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 

95
90
85
80
1995

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

2011

Retreatment





HIV-positive people screened for TB

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  



294 795

6000

Estimates of MDR-TB burden 2012a

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

4'64'#6/'06

616#.

  

  















2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

4000

2000

0
2003 2004

0'9

.CDQTCVQT[EQPßTOGF/&46$ECUGU

Number of patients

HIV-positive people provided with IPT

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



% Funded domestically

74%

% Funded internationally

11%

% Unfunded

15%

Total budget (US$ millions)

400

Financing TB control

300
200
100
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

119

DEMOCRATIC REPUBLIC OF THE CONGO

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

Mortality (excludes HIV+TB)

4#6'(per 100 000 population)

36 (16–64)

54 (24–97)

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

Incidence (HIV+TB only)

16 (14–19)

25 (22–29)

Case detection, all forms (%)

51 (44–59)

6$ECUGPQVKßECVKQPU



0'9%#5'5











4'64'#6/'06%#5'5

 

5OGCTRQUKVKXG

   4GNCRUG

5OGCTPGICVKXG

   6TGCVOGPVCHVGTHCKNWTG

5OGCTWPMPQYPPQVFQPG



Extrapulmonary

 
 

 6TGCVOGPVCHVGTFGHCWNV

20 669 (20)

 

Other

2 321 (31)

Total retreatment

7 492

Other
Total new

105 007

Prevalence
(rate per 100 000 population)



Population 2012 66 million
150

100

50

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

1500

1000

500

0
1990

Other (history unknown)
6QVCNPGYCPFTGNCRUG



 6QVCNECUGUPQVKßGF







5/'#4215+6+8'

/(TCVKQ

5/'#40')#6+8'70-0190
016&10'



#IG



':64#27./10#4;









Laboratories

2012

Smear (per 100 000 population)

2.3

Culture (per 5 million population)

0.3

Drug susceptibility testing (per 5 million population)

0.2

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPCPFQWVUKFGEQWPVT[

Incidence (rate per 100 000
population per year)

400

New cases

300
200
100
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications









0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG



0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

TB patients with known HIV status

35 097

(31)

*+8RQUKVKXG6$RCVKGPVU





*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

20

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Number of patients

0'9

0'9

4'64'#6/'06

1999

2001

2003

2005

2007

2009

2011

Retreatment

  

  

.CDQTCVQT[EQPßTOGF/&46$ECUGU







2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV







Financing TB control
0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically

6000
4000
2000
0
2003 2004

616#.



2013


1%

% Funded internationally

25%

% Unfunded

74%

2007 2008

2009

on CPT

2010 2011

2012

on ART

60

40

20

0
Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

GLOBAL TUBERCULOSIS REPORT 2013

2005 2006

HIV-positive TB patients

Total budget (US$ millions)

Reported cases of MDR-TB 2012

120

1997

8000

Estimates of MDR-TB burden 2012a

%CUGUVGUVGFHQT/&46$

40

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people provided with IPT

/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

60

0
1995

HIV-positive people screened for TB

QH6$ECUGUYKVJ/&46$

80

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

ETHIOPIA

Estimates of TB burdena 2012
07/$'4(thousands)

4#6' (per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

Incidence (HIV+TB only)

23 (17–30)

25 (19–33)

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

6$ECUGPQVKßECVKQPU



0'9%#5'5






 

   4GNCRUG

5OGCTPGICVKXG

   6TGCVOGPVCHVGTHCKNWTG

'ZVTCRWNOQPCT[



 
 

  6TGCVOGPVCHVGTFGHCWNV

 

   1VJGT

Other

0

Total new
Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



 

(0)

143 503

20
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

800

4'64'#6/'06%#5'5

5OGCTRQUKVKXG
5OGCTWPMPQYPPQVFQPG

40







60

Prevalence
(rate per 100 000 population)



80

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN

Population 2012 92 million

Total retreatment

4 089

 6QVCNECUGUPQVKßGF

600
400
200
0
1990


Incidence (rate per 100 000
population per year)

750

New cases




5/'#4215+6+8'

/(TCVKQ



#IG



5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;









Laboratories

2012

5OGCT RGTRQRWNCVKQP 



Culture (per 5 million population)

0.3

&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP 

500

250

0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications



Is second-line drug susceptibility testing available?

No
100









New smear-positive and/or culture-positive

90

0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

TB patients with known HIV status

96 245

(65)

*+8RQUKVKXG6$RCVKGPVU





*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 







HIV-positive people provided with IPT

30 395

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

0'9

4'64'#6/'06

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

60

40
1995

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary



0'9

80

2011

Retreatment

12 000
Number of patients

*+8RQUKVKXGRGQRNGUETGGPGFHQT6$

Treatment success rate (%)

6TGCVOGPVUWEEGUUTCVG  

8000

4000

0
2003 2004

616#.

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



% Funded domestically

17%

% Funded internationally

32%

% Unfunded

51%

Total budget (US$ millions)

180

Financing TB control

120

60

0
Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

121

INDIA

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012


07/$'4(thousands)

4#6'(per 100 000 population)

270 (170–390)

22 (14–32)

Mortality (excludes HIV+TB)
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

Incidence (includes HIV+TB)

2 200 (2 000–2 400)

176 (159–193)

130 (120–140)

10 (9.4–12)

Incidence (HIV+TB only)

6$ECUGPQVKßECVKQPU



0'9%#5'5






   4GNCRUG

Smear-negative

317 616 (27)

5OGCTWPMPQYPPQVFQPG



Extrapulmonary



40

20

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

600

 

 

Treatment after failure

16 400 (6)

 6TGCVOGPVCHVGTFGHCWNV

234 029 (20)

1VJGT



4'64'#6/'06%#5'5

5OGCTRQUKVKXG

 

Other

96 567 (34)

   

Total new

60

59 (54–66)

1 183 373



Total retreatment



284 212

Prevalence
(rate per 100 000 population)

Case detection, all forms (%)

Population 2012 1 237 million

400

200

0
1990

Other (history unknown)
6QVCNPGYCPFTGNCRUG



 6QVCNECUGUPQVKßGF


Incidence (rate per 100 000
population per year)

300

New cases




5/'#4215+6+8'

/(TCVKQ

5/'#40')#6+8'70-0190
016&10'



#IG

':64#27./10#4;











Laboratories

2012

Smear (per 100 000 population)

1.1

Culture (per 5 million population)

0.3

Drug susceptibility testing (per 5 million population)

200

100

0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.2

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG



New smear-negative/extrapulmonary

90

4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012
6$RCVKGPVUYKVJMPQYP*+8UVCVWU

07/$'4

(%)





HIV-positive TB patients

44 063

(5)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 









*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 
*+8RQUKVKXGRGQRNGUETGGPGFHQT6$



Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

 ¿ 

 ¿

 ¿ 

 ¿

QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

20

1997

4'64'#6/'06

616#.







.CDQTCVQT[EQPßTOGF/&46$ECUGU







2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV







2001

2003

2005

2007

2009

2011

Retreatment

40 000
30 000
20 000
10 000
0
2003 2004

0'9

1999

50 000
Number of patients

4'64'#6/'06

40

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary



0'9

60

0
1995

HIV-positive people provided with IPT

Estimates of MDR-TB burden 2012a

80

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



% Funded domestically

37%

% Funded internationally

57%

% Unfunded

6%

&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU'UVKOCVGUHQT+PFKCJCXGPQV[GVDGGPQHßEKCNN[CRRTQXGFD[VJG
/KPKUVT[QH*GCNVJ(COKN[9GNHCTG)QXGTPOGPVQH+PFKCCPFUJQWNFVJGTGHQTGDGEQPUKFGTGFRTQXKUKQPCN

122

GLOBAL TUBERCULOSIS REPORT 2013

Total budget (US$ millions)

250

Financing TB control

200
150
100
50
0

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

INDONESIA

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

/QTVCNKV[ GZENWFGU*+8 6$ 

 ¿ 

 ¿

/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

Prevalence (includes HIV+TB)

730 (350–1 200)

297 (144–506)

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

7.5 (5.6–9.7)

3.1 (2.3–3.9)

Incidence (HIV+TB only)
%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

6$ECUGPQVKßECVKQPU



0'9%#5'5










 

   4GNCRUG

5OGCTPGICVKXG

   6TGCVOGPVCHVGTHCKNWTG

 

Treatment after default

954 (11)

Extrapulmonary

15 697

(5)

 

Other

1 179 (14)

Total retreatment

8 542

Other
Total new

322 882

100

50

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

1000

4'64'#6/'06%#5'5

5OGCTRQUKVKXG
Smear-unknown / not done

150



Prevalence
(rate per 100 000 population)



Population 2012 247 million

750
500
250
0
1990

Other (history unknown)
6QVCNPGYCPFTGNCRUG



 6QVCNECUGUPQVKßGF



New cases




5/'#4215+6+8'

/(TCVKQ
#IG

5/'#40')#6+8'70-0190
016&10'



':64#27./10#4;











Laboratories

2012

Smear (per 100 000 population)

2.3

Culture (per 5 million population)

0.9

Drug susceptibility testing (per 5 million population)

Incidence (rate per 100 000
population per year)

300

200

100

0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.1

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









New smear-positive and/or culture-positive

90

0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

6$RCVKGPVUYKVJMPQYP*+8UVCVWU



*+8RQUKVKXG6$RCVKGPVU





*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 









HIV-positive people screened for TB

80

60

40
1995

(%)



*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

22 677

2011

Retreatment

3000

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012

0'9

4'64'#6/'06

616#.

  

  



.CDQTCVQT[EQPßTOGF/&46$ECUGU







2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV







%CUGUVGUVGFHQT/&46$

Number of patients

HIV-positive people provided with IPT
2000

1000

0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



% Funded domestically

14%

% Funded internationally

35%

% Unfunded

51%

Total budget (US$ millions)

125

Financing TB control

100
75
50
25
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

123

KENYA

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

Mortality (excludes HIV+TB)

9.5 (5.4–15)

22 (13–34)

/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

Prevalence (includes HIV+TB)

130 (71–210)

299 (163–475)

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

Incidence (HIV+TB only)

45 (44–47)

105 (101–109)

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

6$ECUGPQVKßECVKQPU



0'9%#5'5










 

   4GNCRUG

5OGCTPGICVKXG

   6TGCVOGPVCHVGTHCKNWTG


'ZVTCRWNOQPCT[

 
 

  6TGCVOGPVCHVGTFGHCWNV

 

   1VJGT

Other

0

Total new
Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



 

(0)

89 568

40

20

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

600

4'64'#6/'06%#5'5

5OGCTRQUKVKXG
5OGCTWPMPQYPPQVFQPG

60



Total retreatment

9 581

 6QVCNECUGUPQVKßGF

Prevalence
(rate per 100 000 population)



Population 2012 43 million

400

200

0
1990



New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories

2012

Smear (per 100 000 population)

4.2

Culture (per 5 million population)

0.2

Drug susceptibility testing (per 5 million population)

Incidence (rate per 100 000
population per year)

400
300
200
100
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.2

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPCPFQWVUKFGEQWPVT[









0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG



0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

6$RCVKGPVUYKVJMPQYP*+8UVCVWU





*+8RQUKVKXG6$RCVKGPVU





*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

80

60

40
1995

1997

1999

2001

2003

2005

2007

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people screened for TB

2009

2011

Retreatment

60 000

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012

Number of patients

HIV-positive people provided with IPT

0'9

4'64'#6/'06

616#.

  

  



.CDQTCVQT[EQPßTOGF/&46$ECUGU







2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV







%CUGUVGUVGFHQT/&46$

40 000

20 000

0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 

2013



% Funded domestically

24%

% Funded internationally

15%

% Unfunded

61%

Total budget (US$ millions)

60

Financing TB control

40

20

0
Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

124

GLOBAL TUBERCULOSIS REPORT 2013

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

MOZAMBIQUE

Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

Case detection, all forms (%)

34 (25–50)

6$ECUGPQVKßECVKQPU



0'9%#5'5







   4GNCRUG

Smear-negative

19 797 (43)


Extrapulmonary
Other

0

Total new
Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



 

Treatment after failure

243 (5)
 

Other

2 595 (57)

Total retreatment

4 537

(0)

46 290

100
0
1990

 6QVCNECUGUPQVKßGF

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

3000
 

 6TGCVOGPVCHVGTFGHCWNV

5 542 (12)

200



4'64'#6/'06%#5'5

5OGCTRQUKVKXG
5OGCTWPMPQYPPQVFQPG



300

Prevalence
(rate per 100 000 population)



400

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN

Population 2012 25 million

2000

1000

0
1990


Incidence (rate per 100 000
population per year)

1250

New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;

/(TCVKQ







#IG







Laboratories

2012

Smear (per 100 000 population)

1.2

Culture (per 5 million population)

0.6

Drug susceptibility testing (per 5 million population)

1000
750
500
250
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.4

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUQWVUKFGEQWPVT[









New smear-positive and/or culture-positive
New smear-negative/extrapulmonary
4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

TB patients with known HIV status

47 960

(94)

*+8RQUKVKXG6$RCVKGPVU





*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

80
60
40
20
0
1995

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people screened for TB

2011

Retreatment

30 000

17 317

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

0'9

4'64'#6/'06

 ¿ 

 ¿

1 400 (900–2 000)

540 (0–1 100)

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

Number of patients

HIV-positive people provided with IPT

0'9

4'64'#6/'06

616#.

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

20 000

10 000

0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



% Funded domestically

19%

% Funded internationally

51%

% Unfunded

30%

Total budget (US$ millions)

40

Financing TB control

30
20
10
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

125

MYANMAR

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

 ¿ 

 ¿

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

Incidence (includes HIV+TB)

/QTVCNKV[ *+8 6$QPN[ 

200 (170–230)

377 (322–435)

Incidence (HIV+TB only)

19 (16–21)

35 (30–41)

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

6$ECUGPQVKßECVKQPU



0'9%#5'5









 

   4GNCRUG

 

Smear-negative

73 042 (53)

Treatment after failure

1 671 (14)

0

Treatment after default

521 (5)

'ZVTCRWNOQPCT[

(0)

   1VJGT

Other

0

Total new

 

(0)

136 612

Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



Total retreatment

11 537

 6QVCNECUGUPQVKßGF




5/'#4215+6+8'

/(TCVKQ

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;



#IG



100

0
1990

1995

2000

2005

2010

1995

2000

2005

2010









Laboratories

2012

Smear (per 100 000 population)

2000

2005

0.9

Culture (per 5 million population)

1500
1000
500
0
1990

600

New cases



200

2000

4'64'#6/'06%#5'5

5OGCTRQUKVKXG
Smear-unknown / not done

300



Prevalence
(rate per 100 000 population)

/QTVCNKV[ GZENWFGU*+8 6$ 

4#6'(per 100 000 population)

Incidence (rate per 100 000
population per year)



Population 2012 53 million

400

200

0
1990

1995
Incidence

0.2

Drug susceptibility testing (per 5 million population)

2010

Incidence (HIV+TB)

Notifications

0.2

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPCPFQWVUKFGEQWPVT[









0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG



New smear-negative/extrapulmonary

90

4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

TB patients with known HIV status

19 219

(13)

5 161

(27)

HIV-positive TB patients
*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 



*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

1997

1999

2001

2003

2005

2007

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

2009

2011

Retreatment






6000

Estimates of MDR-TB burden 2012a

Number of patients

HIV-positive people provided with IPT

/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

60

40
1995

HIV-positive people screened for TB

QH6$ECUGUYKVJ/&46$

80

0'9

4'64'#6/'06

 ¿ 

 ¿

4 900 (3 600–6 500)

1 200 (790–1 600)

Reported cases of MDR-TB 2012

0'9

4'64'#6/'06







.CDQTCVQT[EQPßTOGF/&46$ECUGU







2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV







2000

0
2003 2004

616#.

%CUGUVGUVGFHQT/&46$

4000

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

Financing TB control
0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically

2013


2%

% Funded internationally

39%

% Unfunded

60%

Total budget (US$ millions)

40
30
20
10
0
Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

126

GLOBAL TUBERCULOSIS REPORT 2013

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

NIGERIA

Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
Mortality (HIV+TB only)

19 (11–25)

11 (6.7–15)

Prevalence (includes HIV+TB)

270 (43–710)

161 (25–420)

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

Case detection, all forms (%)

51 (29–110)

6$ECUGPQVKßECVKQPU



0'9%#5'5









   4GNCRUG
   6TGCVOGPVCHVGTHCKNWTG
4 432

(5)

 
 

Treatment after default

1 174 (16)

Other

3 249 (43)

Total retreatment

7 548

Other
Total new

90 305

50
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

1500
 

5OGCTPGICVKXG
Extrapulmonary

100



4'64'#6/'06%#5'5

5OGCTRQUKVKXG
Smear-unknown / not done

150

Prevalence
(rate per 100 000 population)



200

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN

Population 2012 169 million

1000

500

0
1990

Other (history unknown)
6QVCNPGYCPFTGNCRUG



 6QVCNECUGUPQVKßGF



New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;











/(TCVKQ
#IG



Laboratories

2012

5OGCT RGTRQRWNCVKQP 



Culture (per 5 million population)

0.1

&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP 

Incidence (rate per 100 000
population per year)

600
500
400
300
200
100
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications



+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUQWVUKFGEQWPVT[









0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG



0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

6$RCVKGPVUYKVJMPQYP*+8UVCVWU





HIV-positive TB patients

19 342

(23)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





HIV-positive people screened for TB

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

1997

1999

2001

2003

2005

2007

2009

2011

Retreatment

20 000

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

20

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

0'9

4'64'#6/'06

616#.

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

Number of patients

/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

40

2 257

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$

60

0
1995

140 460

HIV-positive people provided with IPT

80

15 000
10 000
5000
0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



(WPFGFFQOGUVKECNN[



% Funded internationally

24%

7PHWPFGF



Total budget (US$ millions)

180

Financing TB control

120

60

0
Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

127

PAKISTAN

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

62 (27–110)

34 (15–61)

Mortality (excludes HIV+TB)
/QTVCNKV[ *+8 6$QPN[ 
2TGXCNGPEG KPENWFGU*+8 6$ 
Incidence (includes HIV+TB)
+PEKFGPEG *+8 6$QPN[ 
%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

 ¿

 ¿ 

 ¿

410 (340–490)

231 (190–276)

 ¿ 

 ¿

 ¿ 

6$ECUGPQVKßECVKQPU



0'9%#5'5











4'64'#6/'06%#5'5

 

5OGCTRQUKVKXG

   4GNCRUG

5OGCTPGICVKXG

   6TGCVOGPVCHVGTHCKNWTG

Smear-unknown / not done

0

Extrapulmonary

(0)

41 410 (16)

Other

0

Total new
Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



 
 

Treatment after default

1 241 (11)

Other

3 534 (30)

(0)

261 380

200
150
100
50
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005



Total retreatment

11 717

 6QVCNECUGUPQVKßGF

Prevalence
(rate per 100 000 population)



Population 2012 179 million

1500

1000

500

0
1990



New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories

2012

5OGCT RGTRQRWNCVKQP 



Culture (per 5 million population)

0.2

Drug susceptibility testing (per 5 million population)

Incidence (rate per 100 000
population per year)

400
300
200
100
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.1

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









New smear-positive and/or culture-positive

92

New smear-negative/extrapulmonary

93

4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

TB patients with known HIV status

10 419

(4)

*+8RQUKVKXG6$RCVKGPVU





*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

80
60
40
20
0
1995

1997

1999

2001

2003

2005

2007

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people screened for TB

2009

2011

Retreatment

40

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

0'9

4'64'#6/'06

616#.

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

Number of patients

HIV-positive people provided with IPT
30
20
10
0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically
(WPFGFKPVGTPCVKQPCNN[
% Unfunded

2013


5%

9%

Total budget (US$ millions)

80

Financing TB control

60
40
20
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.



GLOBAL TUBERCULOSIS REPORT 2013

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

PHILIPPINES

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

23 (22–25)

24 (22–26)

0.11 (0.09–0.13)

0.11 (0.09–0.14)

450 (390–500)

461 (405–520)

Mortality (excludes HIV+TB)
Mortality (HIV+TB only)
Prevalence (includes HIV+TB)
Incidence (includes HIV+TB)
+PEKFGPEG *+8 6$QPN[ 
%CUGFGVGEVKQPCNNHQTOU  

260 (210–310)

265 (219–316)

 ¿ 

 ¿

 ¿ 

6$ECUGPQVKßECVKQPU



0'9%#5'5



5OGCTRQUKVKXG








4'64'#6/'06%#5'5

 

   4GNCRUG

Smear-negative

Treatment after failure

Extrapulmonary

591 (3)

0

(0)

Treatment after default

3 270

(2)

Other

17 575 (75)

0

(0)
Total retreatment

23 489

Other
Total new

 

115 263 (54)

Smear-unknown / not done

212 119

Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



80
60
40
20
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005



1 243 (5)

 6QVCNECUGUPQVKßGF

Prevalence
(rate per 100 000 population)



Population 2012 97 million

1500

1000

500

0
1990


Incidence (rate per 100 000
population per year)

600

New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;











/(TCVKQ
#IG



Laboratories

2012

Smear (per 100 000 population)

2.7

Culture (per 5 million population)

0.7

Drug susceptibility testing (per 5 million population)

400

200

0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.2

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









New smear-positive and/or culture-positive

90

0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

6$RCVKGPVUYKVJMPQYP*+8UVCVWU
*+8RQUKVKXG6$RCVKGPVU

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  







60
40
20
0
1995

(%)



80

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





HIV-positive people screened for TB

2011

Retreatment

10

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

0'9

4'64'#6/'06

616#.

  

  











.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

Number of patients

HIV-positive people provided with IPT

8
6
4
2
0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART



2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



% Funded domestically

16%

% Funded internationally

15%

% Unfunded

69%

Total budget (US$ millions)

160

Financing TB control

120
80
40
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

129

RUSSIAN FEDERATION

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

Prevalence (includes HIV+TB)

170 (73–320)

121 (51–221)

Incidence (includes HIV+TB)

/QTVCNKV[ GZENWFGU*+8 6$ 

130 (110–150)

91 (77–106)

Incidence (HIV+TB only)

9.3 (7.9–11)

6.5 (5.5–7.5)

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

6$ECUGPQVKßECVKQPU



0'9%#5'5










 

   4GNCRUG

 

Smear-negative

59 019 (61)

Treatment after failure

9 109 (17)

Treatment after default

2 593 (5)

1 039

Extrapulmonary

(1)

10 017 (10)

Other

0

Total new
Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



Other

32 466 (62)

Total retreatment

52 379

(0)

97 542

15
10
5
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

400

4'64'#6/'06%#5'5

5OGCTRQUKVKXG
Smear-unknown / not done

25
20



 6QVCNECUGUPQVKßGF

Prevalence
(rate per 100 000 population)



Population 2012 143 million

300
200
100
0
1990


Incidence (rate per 100 000
population per year)

200

New cases




5/'#4215+6+8'

/(TCVKQ

5/'#40')#6+8'70-0190
016&10'



#IG

':64#27./10#4;











Laboratories

2012

Smear (per 100 000 population)

0.7

Culture (per 5 million population)

4.1

&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP 



+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

150
100
50
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

;GUKPEQWPVT[









New smear-positive and/or culture-positive

54

New smear-negative/extrapulmonary

73

4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012
TB patients with known HIV

07/$'4

statusb

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

80
60
40
20
0
1995

(%)

1997

75 995

*+8RQUKVKXG6$RCVKGPVU





*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





1999

2001

2003

2005

2007

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people screened for TB

2009

2011

Retreatment

8000

Estimates of MDR-TB burden 2012a

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$
.CDQTCVQT[EQPßTOGF/&46$ECUGU

0'9

4'64'#6/'06

616#.

  

  















2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

Number of patients

HIV-positive people provided with IPT
6000
4000
2000
0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



% Funded domestically

100%

(WPFGFKPVGTPCVKQPCNN[
% Unfunded


0%

&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU
b The reported number of TB patients with known HIV status is for new TB patients in the civilian sector only.
It was not possible to calculate the percentage of all TB patients with known HIV status.

130

GLOBAL TUBERCULOSIS REPORT 2013

Total budget (US$ millions)

1800

Financing TB control

1200

600

0

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

SOUTH AFRICA

Estimates of TB burdena 2012


07/$'4(thousands)

4#6'(per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

Incidence (HIV+TB only)

330 (270–390)

631 (521–752)



0'9%#5'5











4'64'#6/'06%#5'5

 

   4GNCRUG

 

Smear-negative

63 210 (21)

5OGCTWPMPQYPPQVFQPG

   6TGCVOGPVCHVGTFGHCWNV

Extrapulmonary

42 467 (14)

Other

0

Total new

100
50
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

62 (52–75)

6$ECUGPQVKßECVKQPU
5OGCTRQUKVKXG

150

Treatment after failure

3 123 (6)
 

Other

15 007 (29)

Total retreatment

52 586

 6QVCNECUGUPQVKßGF



(0)

296 996

Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



2000

Prevalence
(rate per 100 000 population)

Case detection, all forms (%)

200

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN

Population 2012 52 million

1500
1000
500
0
1990

Incidence (rate per 100 000
population per year)

1250

New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories

2012

Smear (per 100 000 population)

0.4

Culture (per 5 million population)

1.4

Drug susceptibility testing (per 5 million population)

1000
750
500
250
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

1.4

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[
100









New smear-positive and/or culture-positive

79

New smear-negative/extrapulmonary

76

4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)





HIV-positive TB patients

190 093

(65)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





*+8RQUKVKXGRGQRNGUETGGPGFHQT6$



HIV-positive people provided with IPT

369 747

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012

60
40
20

1997

4'64'#6/'06

616#.

%CUGUVGUVGFHQT/&46$







.CDQTCVQT[EQPßTOGF/&46$ECUGU







2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV







2001

2003

2005

2007

2009

2011

Retreatment

250 000
200 000
150 000
100 000
50 000
0
2003 2004

0'9

1999

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary



0'9

80

0
1995

Number of patients

6$RCVKGPVUYKVJMPQYP*+8UVCVWU

Treatment success rate (%)

6TGCVOGPVUWEEGUUTCVG  

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically


97%

% Funded internationally

3%

% Unfunded

0%

Total budget (US$ millions)

500

Financing TB control

400
300
200
100
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

131

THAILAND

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

/QTVCNKV[ GZENWFGU*+8 6$ 

 ¿ 

 ¿

/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

Case detection, all forms (%)

76 (64–92)

6$ECUGPQVKßECVKQPU



0'9%#5'5







5OGCTRQUKVKXG

   4GNCRUG

Smear-negative

17 537 (31)

Smear-unknown / not done
'ZVTCRWNOQPCT[




 

 

Treatment after failure

327 (12)

Treatment after default

577 (21)

   1VJGT





Other
Total new

57 387

Other (history unknown)

1 030

6QVCNPGYCPFTGNCRUG



Total retreatment

2 791

 6QVCNECUGUPQVKßGF

60

40

20

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

500

4'64'#6/'06%#5'5

Prevalence
(rate per 100 000 population)



Population 2012 67 million

400
300
200
100
0
1990



New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;











/(TCVKQ
#IG



Laboratories

2012

Smear (per 100 000 population)

1.6

Culture (per 5 million population)

4.9

Drug susceptibility testing (per 5 million population)

Incidence (rate per 100 000
population per year)

250
200
150
100
50
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

1.3

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG



0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

TB patients with known HIV status

44 035

(72)

*+8RQUKVKXG6$RCVKGPVU





*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

1997

1999

2001

2003

2005

2007

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

2009

2011

Retreatment

10 000

Estimates of MDR-TB burden 2012a

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

Number of patients

HIV-positive people provided with IPT

/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

60

40
1995

HIV-positive people screened for TB

QH6$ECUGUYKVJ/&46$

80

0'9

4'64'#6/'06

616#.








.CDQTCVQT[EQPßTOGF/&46$ECUGU





2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV





8000
6000
4000
2000
0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART



0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically

2013

b
92%

% Funded internationally

2%

% Unfunded

6%

&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU
b Based on data reported for 2013 in the 2012 round of data collection. In 2013, Thailand was not able to
report funding for the sub-national level.

132

GLOBAL TUBERCULOSIS REPORT 2013

Total budget (US$ millions)

50

Financing TB control

40
30
20
10
0

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

UGANDA

Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

64 (24–120)

175 (67–334)

Incidence (includes HIV+TB)

65 (53–79)

179 (145–216)

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

Prevalence (includes HIV+TB)

6$ECUGPQVKßECVKQPU



0'9%#5'5






 

   4GNCRUG

5OGCTPGICVKXG

   6TGCVOGPVCHVGTHCKNWTG


Extrapulmonary

5 143 (12)

Other

0

Total new
Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



 
 

  6TGCVOGPVCHVGTFGHCWNV

 

Other

1 114 (29)

Total retreatment

3 882

(0)

43 329

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

2500

4'64'#6/'06%#5'5

5OGCTRQUKVKXG
5OGCTWPMPQYPPQVFQPG

100






200

 6QVCNECUGUPQVKßGF

Prevalence
(rate per 100 000 population)



300

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN

Population 2012 36 million

2000
1500
1000
500
0
1990



New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;











/(TCVKQ
#IG



Laboratories

2012

Smear (per 100 000 population)

3.2

Culture (per 5 million population)

0.6

Drug susceptibility testing (per 5 million population)

Incidence (rate per 100 000
population per year)

1250
1000
750
500
250
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.6

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









New smear-positive and/or culture-positive

77

New smear-negative/extrapulmonary

66

4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

6$RCVKGPVUYKVJMPQYP*+8UVCVWU





HIV-positive TB patients

20 376

(50)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 









*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

80
60
40
20
0
1995

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people screened for TB

2011

Retreatment

25 000

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012

Number of patients

HIV-positive people provided with IPT

0'9

4'64'#6/'06

616#.

  

  



.CDQTCVQT[EQPßTOGF/&46$ECUGU







2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV







%CUGUVGUVGFHQT/&46$

20 000
15 000
10 000
5000
0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically


7%

% Funded internationally

62%

% Unfunded

31%

Total budget (US$ millions)

40

Financing TB control

30
20
10
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

133

UNITED REPUBLIC OF TANZANIA

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

2TGXCNGPEG KPENWFGU*+8 6$ 

6$ECUGPQVKßECVKQPU



0'9%#5'5










 

   4GNCRUG

Smear-negative

21 393 (35)

Treatment after failure

154 (6)

0

Treatment after default

201 (7)

Extrapulmonary

(0)

14 595 (24)

Other

0

Total new
Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



 

Other

1 359 (49)

Total retreatment

2 766

(0)

61 126

60
40
20
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

800

4'64'#6/'06%#5'5

5OGCTRQUKVKXG
Smear-unknown / not done

80



 6QVCNECUGUPQVKßGF

Prevalence
(rate per 100 000 population)



Population 2012 48 million

600
400
200
0
1990



New cases




5/'#4215+6+8'

/(TCVKQ

5/'#40')#6+8'70-0190
016&10'



#IG

':64#27./10#4;











Laboratories

2012

Smear (per 100 000 population)

2.0

Culture (per 5 million population)

0.4

Drug susceptibility testing (per 5 million population)

Incidence (rate per 100 000
population per year)

300

200

100

0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.1

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG



0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

6$RCVKGPVUYKVJMPQYP*+8UVCVWU





HIV-positive TB patients

20 269

(39)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





HIV-positive people screened for TB

Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

 ¿ 

 ¿

500 (140–1 300)

0 (0–160)

1999

2001

2003

2005

2007

2009

2011

Retreatment

20 000
15 000
10 000
5000
0

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

1997

25 000
Number of patients

QH6$ECUGUYKVJ/&46$

4'64'#6/'06

70

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

357 400

0'9

80

60
1995

HIV-positive people provided with IPT

Estimates of MDR-TB burden 2012a

90

0'9

4'64'#6/'06

616#.

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 

2013



% Funded domestically

14%

% Funded internationally

19%

% Unfunded

67%

Total budget (US$ millions)

60

Financing TB control

40

20

0
Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

134

GLOBAL TUBERCULOSIS REPORT 2013

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

VIET NAM

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN | HIGH MDR-TB BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

4#6'(per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

Incidence (includes HIV+TB)

130 (99–170)

147 (109–192)

Incidence (HIV+TB only)

9.3 (6.9–12)

10 (7.6–13)

Case detection, all forms (%)

76 (59–100)

6$ECUGPQVKßECVKQPU



0'9%#5'5







5OGCTRQUKVKXG

   4GNCRUG

Smear-negative

21 706 (23)

Smear-unknown / not done
'ZVTCRWNOQPCT[




 

 

Treatment after failure

567 (6)

Treatment after default

494 (5)

   1VJGT

Other

3 210

Total new

 

(3)

94 853

80
60
40
20
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

1000

4'64'#6/'06%#5'5

Total retreatment

9 053

Prevalence
(rate per 100 000 population)



Population 2012 91 million

750
500
250
0
1990

Other (history unknown)
6QVCNPGYCPFTGNCRUG



 6QVCNECUGUPQVKßGF



New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;











/(TCVKQ
#IG



Laboratories

2012

Smear (per 100 000 population)

0.9

Culture (per 5 million population)

1.4

Drug susceptibility testing (per 5 million population)

Incidence (rate per 100 000
population per year)

400
300
200
100
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications

0.1

+UUGEQPFNKPGFTWIUWUEGRVKDKNKV[VGUVKPICXCKNCDNG!

;GUKPEQWPVT[









New smear-positive and/or culture-positive

93

New smear-negative/extrapulmonary

93

4GVTGCVOGPV



Is rifampicin used throughout treatment for new patients?

No

TB/HIV 2012

07/$'4

(%)

6$RCVKGPVUYKVJMPQYP*+8UVCVWU





HIV-positive TB patients

4 775

(7)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

90
80
70
60
1995

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people screened for TB

2011

Retreatment

6000

5 663

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

0'9

4'64'#6/'06





Number of patients

HIV-positive people provided with IPT

4000

2000

0
2003 2004

616#.



.CDQTCVQT[EQPßTOGF/&46$ECUGU







2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV







2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

2013

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 



(WPFGFFQOGUVKECNN[



% Funded internationally

20%

% Unfunded

72%

Total budget (US$ millions)

80

Financing TB control

60
40
20
0

Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

Data for all years can be downloaded from www.who.int/tb/data

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

135

ZIMBABWE

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

HIGH TB BURDEN | HIGH HIV BURDEN
Estimates of TB burdena 2012
07/$'4(thousands)

Mortality (excludes HIV+TB)

4#6'(per 100 000 population)

4.6 (0.16–16)

33 (1.2–117)

/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

Prevalence (includes HIV+TB)

59 (13–140)

433 (92–1 034)

Incidence (includes HIV+TB)

77 (60–97)

562 (434–706)

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

Case detection, all forms (%)

46 (37–60)

6$ECUGPQVKßECVKQPU



0'9%#5'5








5OGCTRQUKVKXG

   4GNCRUG

Smear-negative

14 354 (42)
2 962

'ZVTCRWNOQPCT[

   1VJGT
0

Total new
Other (history unknown)

0

6QVCNPGYCPFTGNCRUG



 
200 (5)

Treatment after default

176 (4)
 

(0)

34 391

Total retreatment

4 329

 6QVCNECUGUPQVKßGF

150

100

50

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

1500
 

Treatment after failure

Smear-unknown / not done
Other

(9)



4'64'#6/'06%#5'5

Prevalence
(rate per 100 000 population)



Population 2012 14 million

1000

500

0
1990



New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories

2012

Smear (per 100 000 population)

1.3

Culture (per 5 million population)

0.7

Drug susceptibility testing (per 5 million population)

0.7

Is second-line drug susceptibility testing available?

No

Incidence (rate per 100 000
population per year)

1000
750
500
250
0
1990

1995
Incidence

2010

Incidence (HIV+TB)

Notifications









0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG



0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



+UTKHCORKEKPWUGFVJTQWIJQWVVTGCVOGPVHQTPGYRCVKGPVU!

;GU

TB/HIV 2012

07/$'4

(%)

6$RCVKGPVUYKVJMPQYP*+8UVCVWU





HIV-positive TB patients

23 957

(70)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





Treatment success rate (%)

100

6TGCVOGPVUWEEGUUTCVG  

80
60
40
20
0
1995

1997

1999

2001

2003

2005

2007

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

HIV-positive people screened for TB

2009

2011

Retreatment

40 000

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

0'9

4'64'#6/'06

 ¿ 

 ¿

570 (300–960)

360 (76–970)

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

Number of patients

HIV-positive people provided with IPT

0'9

4'64'#6/'06

616#.

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

30 000
20 000
10 000
0
2003 2004

2005 2006

2007 2008

HIV-positive TB patients

2009

on CPT

2010 2011

2012

on ART

0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically

2013


4%

% Funded internationally

39%

% Unfunded

56%

Total budget (US$ millions)

45

Financing TB control

30

15

0
Data are as reported to WHO. Estimates of TB and MDR-TB burden are produced by WHO in consultation with
countries.
a Ranges represent uncertainty intervals.

136

GLOBAL TUBERCULOSIS REPORT 2013

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

#00':

Regional proßles

WHO AFRICAN REGION

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

WHO MEMBER STATES 46
Estimates of TB burdena 2012


07/$'4 thousands 

4#6' per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

Prevalence (includes HIV+TB)

2 700 (2 100–3 300)

303 (239–373)

Incidence (includes HIV+TB)

2 300 (2 100–2 500)

255 (235–275)

 ¿ 

 ¿

+PEKFGPEG *+8 6$QPN[ 

6$ECUGPQVKßECVKQPU



0'9%#5'5











4'64'#6/'06%#5'5

 

5OGCTRQUKVKXG

   4GNCRUG

Smear-negative

345 947 (27)

5OGCTWPMPQYPPQVFQPG

   6TGCVOGPVCHVGTFGHCWNV

 

'ZVTCRWNOQPCT[

   1VJGT

 

1VJGT

 

Treatment after failure

9 174 (7.2)

   

Total new

80
60
40
20
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

59 (55–64)

1 282 355

Other (history unknown)

2 017

6QVCNPGYCPFTGNCRUG





Total retreatment



128 267

 6QVCNECUGUPQVKßGF



Prevalence
(rate per 100 000 population)

Case detection, all forms (%)

Population 2012 893 million

750

500

250

0
1990




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;













Laboratories 2012

07/$'41(/'/$'456#6'5b

5OGCT RGTRQRWNCVKQP Ü

QWVQH

%WNVWTG RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

6TGCVOGPVUWEEGUUTCVG  

300
200
100
0
1990

1995
Incidence



Incidence (HIV+TB)

2010
Notifications

100

0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG



New smear-negative/extrapulmonary

76

4GVTGCVOGPV



/&46$ EQJQTV 



TB/HIV 2012
TB patients with known HIV status

07/$'4

(%)c

1 040 292

(74)





*+8RQUKVKXG6$RCVKGPVU
*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





HIV-positive people screened for TB

Treatment success rate (%)

#IG

80
60
40
20
0
1995

1997

1999

2001

2003

2005

2007

2009

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

2011

Retreatment

2 391 601

HIV-positive people provided with IPT

473 214

Estimates of MDR-TB burden 2012a
QH6$ECUGUYKVJ/&46$
/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

0'9

4'64'#6/'06

 ¿ 

 ¿

24 000 (2 100–46 000)

14 000 (5 600–22 000)

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

500

0'9

4'64'#6/'06

616#.

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

(KPCPEKPI6$EQPVTQN NQYCPFOKFFNGKPEQOGEQWPVTKGU
0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 

d

Number of patients

/(TCVKQ

400
300
200
100
0
2004

2005

2006

2007

2008

HIV-positive TB patients

2013



% Funded domestically

44

% Funded internationally

21

% Unfunded

36

&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU
b Data are not collected from all Member States.
c Calculations exclude countries with missing numerators or denominators.
d Financing indicators exclude funding for general healthcare services provided outside NTPs.

2009

2010

on CPT

2011

2012

on ART

1500
Total budget (US$ millions)




Incidence (rate per 100 000
population per year)

400

New cases

Data for all years can be downloaded from www.who.int/tb/data

1000

500

0

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

139

WHO REGION OF THE AMERICAS

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

WHO MEMBER STATES 35
OTHER COUNTRIES AND TERRITORIES 11
Estimates of TB burdena 2012


07/$'4 thousands 

4#6' per 100 000 population)

19 (16–21)

1.9 (1.7–2.2)

 ¿ 

 ¿

Prevalence (includes HIV+TB)

390 (300–490)

40 (31–51)

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

Mortality (excludes HIV+TB)
/QTVCNKV[ *+8 6$QPN[ 

Population 2012 961 million
8
6
4
2
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005









4'64'#6/'06%#5'5

 

   4GNCRUG

 

Smear-negative

35 606 (17)

5OGCTWPMPQYPPQVFQPG

   6TGCVOGPVCHVGTFGHCWNV

 

'ZVTCRWNOQPCT[

   1VJGT

 

1VJGT

Treatment after failure

1 195 (5.0)

   

Total new

208 845

Other (history unknown)

39

6QVCNPGYCPFTGNCRUG





Total retreatment

23 811

 6QVCNECUGUPQVKßGF





New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories 2012

QWVQH

%WNVWTG RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

6TGCVOGPVUWEEGUUTCVG  



New smear-negative/extrapulmonary

71

4GVTGCVOGPV



/&46$ EQJQTV 



HIV-positive TB patients
*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 
*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 
*+8RQUKVKXGRGQRNGUETGGPGFHQT6$
*+8RQUKVKXGRGQRNGRTQXKFGFYKVJ+26

.CDQTCVQT[EQPßTOGF/&46$ECUGU

129 174

(56)

20 355

(16)











 ¿ 

 ¿

 ¿ 

 ¿

0'9

4'64'#6/'06

616#.

  

  















(KPCPEKPI6$EQPVTQN NQYCPFOKFFNGKPEQOGEQWPVTKGU
0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 

1995

Incidence (HIV+TB)

2010
Notifications

d

60
40
20

1997

1999

2001

2003

2013



% Funded internationally

12

% Unfunded

19

&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU
b Data are not collected from all Member States.
c Calculations exclude countries with missing numerators or denominators.
d Financing indicators exclude funding for general healthcare services provided outside NTPs.

2005

2007

2009

2011

Retreatment

25
20
15
10
5

2005

2006

2007

2008

HIV-positive TB patients

69

GLOBAL TUBERCULOSIS REPORT 2013

80

0
2004

% Funded domestically

140

20

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary


4'64'#6/'06

2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

40

0
1995



0'9

Reported cases of MDR-TB 2012
%CUGUVGUVGFHQT/&46$

07/$'4

(%)c

Number of patients

TB/HIV 2012
TB patients with known HIV status

/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

60

100

0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG

QH6$ECUGUYKVJ/&46$

0
1990

Incidence



Estimates of MDR-TB burden 2012a

50

0
1990

07/$'41(/'/$'456#6'5b

5OGCT RGTRQRWNCVKQP Ü

100

80

Treatment success rate (%)

5OGCTRQUKVKXG



2009

2010

on CPT

2011

2012

on ART

200
Total budget (US$ millions)

0'9%#5'5



Incidence (rate per 100 000
population per year)



Prevalence
(rate per 100 000 population)

150

6$ECUGPQVKßECVKQPU

150
100
50
0
2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

WHO EASTERN MEDITERRANEAN REGION

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

WHO MEMBER STATES 22
OTHER COUNTRIES AND TERRITORIES 1
Estimates of TB burdena 2012


07/$'4 thousands 

Mortality (excludes HIV+TB)

4#6' per 100 000 population)

100 (63–150)

16 (10–24)

 ¿ 

 ¿

 ¿ 

 ¿

670 (590–750)

109 (96–122)

+PEKFGPEG *+8 6$QPN[ 

 ¿ 

 ¿

Case detection, all forms (%)

63 (56–71)

/QTVCNKV[ *+8 6$QPN[ 
2TGXCNGPEG KPENWFGU*+8 6$ 
Incidence (includes HIV+TB)

Population 2012 617 million
60

40

20

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

0'9%#5'5









4'64'#6/'06%#5'5

5OGCTRQUKVKXG

   4GNCRUG

Smear-negative

135 346 (33)

 

Treatment after failure

2 007 (9.5)

   6TGCVOGPVCHVGTFGHCWNV
90 943 (22)

1VJGT

 

Other

5 200 (24)

   

Total new

409 477

1VJGT JKUVQT[WPMPQYP 



6QVCNPGYCPFTGNCRUG



Total retreatment
 





21 228


 6QVCNECUGUPQVKßGF


5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories 2012

QWVQH

%WNVWTG RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

6TGCVOGPVUWEEGUUTCVG  



0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



/&46$ EQJQTV 



TB/HIV 2012

07/$'4

(%)c

6$RCVKGPVUYKVJMPQYP*+8UVCVWU





HIV-positive TB patients

2 020

(3.5)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 









*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 
HIV-positive people screened for TB

%CUGUVGUVGFHQT/&46$

 ¿ 

 ¿

11 000 (320–36 000)

6 900 (2 400–11 000)

0'9

4'64'#6/'06

616#.

  

  















(KPCPEKPI6$EQPVTQN NQYCPFOKFFNGKPEQOGEQWPVTKGU
0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 
% Funded domestically

d

Number of patients

4'64'#6/'06

2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

50

1995

Incidence (HIV+TB)

2010
Notifications

80
60
40
20

1997

1999

2001

2003

2005

2007

2009

2011

Retreatment

2.0

0'9

.CDQTCVQT[EQPßTOGF/&46$ECUGU

100

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

243

Reported cases of MDR-TB 2012

150

0
1995

15 012

HIV-positive people provided with IPT

/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

0
1990

100

0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG

QH6$ECUGUYKVJ/&46$

100

Incidence



Estimates of MDR-TB burden 2012a

200

0
1990

07/$'41(/'/$'456#6'5b

5OGCT RGTRQRWNCVKQP Ü

300

200

New cases



400





Treatment success rate (%)

Extrapulmonary

 

1.5
1.0
0.5
0
2004

2005

2006

2007

2008

HIV-positive TB patients

2013


32

% Funded internationally

53

% Unfunded

16

&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU
b Data are not collected from all Member States.
c Calculations exclude countries with missing numerators or denominators.
d Financing indicators exclude funding for general healthcare services provided outside NTPs.

2009

2010

on CPT

2011

2012

on ART

200
Total budget (US$ millions)

5OGCTWPMPQYPPQVFQPG



Incidence (rate per 100 000
population per year)



Prevalence
(rate per 100 000 population)

500

6$ECUGPQVKßECVKQPU

Data for all years can be downloaded from www.who.int/tb/data

150
100
50
0

2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

141

WHO EUROPEAN REGION

Estimates of TB

burdena

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

WHO MEMBER STATES 53
OTHER COUNTRIES AND TERRITORIES 1
2012



07/$'4 thousands 

4#6' per 100 000 population)

36 (35–36)

3.9 (3.9–4)

 ¿ 

 ¿

Mortality (excludes HIV+TB)
/QTVCNKV[ *+8 6$QPN[ 
2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

Incidence (HIV+TB only)

19 (17–21)

2.1 (1.9–2.3)

Case detection, all forms (%)

74 (70–79)

Population 2012 905 million
10
8
6
4
2
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

0'9%#5'5









4'64'#6/'06%#5'5

 

   4GNCRUG
   6TGCVOGPVCHVGTHCKNWTG

 

   6TGCVOGPVCHVGTFGHCWNV

 

Extrapulmonary

39 029 (16)

1VJGT

Other

51 237 (55)

   

Total new

242 266

Other (history unknown)

2 054

6QVCNPGYCPFTGNCRUG





Total retreatment

92 847

 6QVCNECUGUPQVKßGF





New cases




5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories 2012

07/$'41(/'/$'456#6'5b

5OGCT RGTRQRWNCVKQP Ü

QWVQH

&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

6TGCVOGPVUWEEGUUTCVG  
New smear-negative/extrapulmonary

79

4GVTGCVOGPV



/&46$ EQJQTV 



TB/HIV 2012
TB patients with known HIV status

07/$'4

(%)c

203 705

(60)

12 900

(6.3)

HIV-positive TB patients
*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





HIV-positive people screened for TB

23 567

*+8RQUKVKXGRGQRNGRTQXKFGFYKVJ+26



Estimates of MDR-TB burden 2012a

80
60
40
20
0
1990

1995

0'9

4'64'#6/'06

 ¿

 ¿ 

 ¿

Reported cases of MDR-TB 2012

0'9

4'64'#6/'06

616#.

  

  















2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

Incidence (HIV+TB)

2010
Notifications

(KPCPEKPI6$EQPVTQN NQYCPFOKFFNGKPEQOGEQWPVTKGU
0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 

d

60
40
20

1997

1999

2001

2003

2007


92

% Funded internationally

3.7

% Unfunded

4.3

2011

10

5

2005

2006

2007

2008

HIV-positive TB patients

2013

2009

Retreatment

15

0
2004

&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU
b Data are not collected from all Member States.
c Calculations exclude countries with missing numerators or denominators.
d Financing indicators exclude funding for general healthcare services provided outside NTPs.

2005

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary

% Funded domestically

GLOBAL TUBERCULOSIS REPORT 2013

80

0
1995



 ¿ 

QH6$ECUGUYKVJ/&46$

142

0
1990

100


65

.CDQTCVQT[EQPßTOGF/&46$ECUGU

50

Incidence

New smear-positive and/or culture-positive

%CUGUVGUVGFHQT/&46$

100

QWVQH

%WNVWTG RGTOKNNKQPRQRWNCVKQP Ü

/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

150

100

Treatment success rate (%)

5OGCTWPMPQYPPQVFQPG

Number of patients

5OGCTPGICVKXG

 

2009

2010

on CPT

2011

2012

on ART

2500
Total budget (US$ millions)

5OGCTRQUKVKXG



Incidence (rate per 100 000
population per year)



Prevalence
(rate per 100 000 population)

200

6$ECUGPQVKßECVKQPU

2000
1500
1000
500
0
2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

WHO SOUTH-EAST ASIA REGION

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

WHO MEMBER STATES 11
Estimates of TB burdena 2012
07/$'4 thousands 

4#6' per 100 000 population)

 ¿ 

 ¿

/QTVCNKV[ GZENWFGU*+8 6$ 
/QTVCNKV[ *+8 6$QPN[ 

 ¿ 

 ¿

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

 ¿ 

 ¿

+PEKFGPEG *+8 6$QPN[ 
%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

6$ECUGPQVKßECVKQPU



0'9%#5'5





5OGCTRQUKVKXG






 

 

   6TGCVOGPVCHVGTHCKNWTG

Smear-unknown / not done

0

'ZVTCRWNOQPCT[

(0)

 

Treatment after default

69 100 (21)

   1VJGT

1VJGT

 

   

Total new

1 993 614

Other (history unknown)

5 261

6QVCNPGYCPFTGNCRUG



60
40
20
0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005

600

4'64'#6/'06%#5'5

   4GNCRUG

5OGCTPGICVKXG

80





Total retreatment



332 580

 6QVCNECUGUPQVKßGF

Prevalence
(rate per 100 000 population)



Population 2012 1 833 million

400

200

0
1990


300


5/'#4215+6+8'













Laboratories 2012

07/$'41(/'/$'456#6'5b

5OGCT RGTRQRWNCVKQP Ü

QWVQH

%WNVWTG RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

6TGCVOGPVUWEEGUUTCVG  



0GYUOGCTPGICVKXGGZVTCRWNOQPCT[



4GVTGCVOGPV



/&46$ EQJQTV 



TB/HIV 2012

(%)c

07/$'4

TB patients with known HIV status

904 223

(39)

56 093

(6.2)

HIV-positive TB patients
*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





*+8RQUKVKXGRGQRNGUETGGPGFHQT6$

%CUGUVGUVGFHQT/&46$




0'9

4'64'#6/'06

 ¿

36 000 (26 000–46 000)

54 000 (37 000–70 000)

0'9

4'64'#6/'06

616#.

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

(KPCPEKPI6$EQPVTQN NQYCPFOKFFNGKPEQOGEQWPVTKGU
0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 

2010
Notifications

d

60
40
20

1997

1999

2001

2003

2007

2009

40

20

2005

2006

2007

2008

HIV-positive TB patients

2013



% Funded domestically

30

% Funded internationally

41

% Unfunded

29

2011

Retreatment

60

0
2004

&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU
b Data are not collected from all Member States.
c Calculations exclude countries with missing numerators or denominators.
d Financing indicators exclude funding for general healthcare services provided outside NTPs.

2005

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary



 ¿ 

Reported cases of MDR-TB 2012

Incidence (HIV+TB)

80

0
1995



*+8RQUKVKXGRGQRNGRTQXKFGFYKVJ+26

/&46$ECUGUCOQPIPQVKßGF
pulmonary TB cases

1995

100



QH6$ECUGUYKVJ/&46$

100

Incidence

0GYUOGCTRQUKVKXGCPFQTEWNVWTGRQUKVKXG

Estimates of MDR-TB burden 2012a

200

0
1990

Treatment success rate (%)

#IG

':64#27./10#4;

Number of patients

/(TCVKQ

5/'#40')#6+8'70-0190
016&10'

2009

2010

on CPT

2011

2012

on ART

600
Total budget (US$ millions)




Incidence (rate per 100 000
population per year)

New cases

Data for all years can be downloaded from www.who.int/tb/data

400

200

0
2009

2010

Funded domestically

2011

2012

Funded internationally

GLOBAL TUBERCULOSIS REPORT 2013

2013
Unfunded

143

WHO WESTERN PACIFIC REGION

Mortality (excludes HIV+TB) (rate
per 100 000 population per year)

WHO MEMBER STATES 27
OTHER COUNTRIES AND TERRITORIES 9
Estimates of TB burdena 2012


07/$'4 thousands 

/QTVCNKV[ GZENWFGU*+8 6$ 

4#6' per 100 000 population)

 ¿ 

 ¿

5 (4–5)

0.26 (0.23–0.29)

2TGXCNGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

+PEKFGPEG KPENWFGU*+8 6$ 

 ¿ 

 ¿

Incidence (HIV+TB only)

24 (21–27)

1.3 (1.1–1.5)

%CUGFGVGEVKQPCNNHQTOU  

 ¿ 

Mortality (HIV+TB only)

Population 2012 1 846 million
30

20

10

0
1990

1995

2000

2005

2010

1995

2000

2005

2010

2000

2005



0'9%#5'5









4'64'#6/'06%#5'5

5OGCTRQUKVKXG

   4GNCRUG

Smear-negative

691 714 (55)

 

 

Treatment after failure

3 714 (4.6)

   6TGCVOGPVCHVGTFGHCWNV

'ZVTCRWNOQPCT[

 

   1VJGT

1VJGT

 

   

Total new

1 264 217

Other (history unknown)

1 232

6QVCNPGYCPFTGNCRUG





Total retreatment



80 017

 6QVCNECUGUPQVKßGF



New cases

5/'#4215+6+8'

5/'#40')#6+8'70-0190
016&10'

':64#27./10#4;







/(TCVKQ
#IG







Laboratories 2012
5OGCT RGTRQRWNCVKQP Ü

QWVQH

%WNVWTG RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

&TWIUWUEGRVKDKNKV[VGUVKPI RGTOKNNKQPRQRWNCVKQP Ü

QWVQH

6TGCVOGPVUWEEGUUTCVG  

94

New smear-negative/extrapulmonary

93

4GVTGCVOGPV



/&46$ EQJQTV 



TB/HIV 2012
TB patients with known HIV status
HIV-positive TB patients

07/$'4

(%)c

451 302

(34)

14 119

(3.1)

*+8RQUKVKXG6$RCVKGPVUQPEQVTKOQZC\QNGRTGXGPVKXGVJGTCR[ %26 





*+8RQUKVKXG6$RCVKGPVUQPCPVKTGVTQXKTCNVJGTCR[ #46 





%CUGUVGUVGFHQT/&46$







0'9

4'64'#6/'06

 ¿ 

 ¿

 ¿ 

 ¿

0'9

4'64'#6/'06

  

  















.CDQTCVQT[EQPßTOGF/&46$ECUGU
2CVKGPVUUVCTVGFQP/&46$VTGCVOGPV

(KPCPEKPI6$EQPVTQN NQYCPFOKFFNGKPEQOGEQWPVTKGU
0CVKQPCN6$RTQITCOOGDWFIGV 75OKNNKQPU 

50

1995

Incidence (HIV+TB)

2010
Notifications

d

60
40
20

1997

1999

2001

2003

2007

2013



% Funded internationally

15

% Unfunded

36

2009

2011

Retreatment

5

2005

2006

2007

2008

HIV-positive TB patients

&CVCCTGCUTGRQTVGFVQ9*1'UVKOCVGUQH6$CPF/&46$DWTFGPCTGRTQFWEGFD[9*1KPEQPUWNVCVKQPYKVJ
countries.
a 4CPIGUTGRTGUGPVWPEGTVCKPV[KPVGTXCNU
b Data are not collected from all Member States.
c Calculations exclude countries with missing numerators or denominators.
d Financing indicators exclude funding for general healthcare services provided outside NTPs.

2005

10

0
2004

50

GLOBAL TUBERCULOSIS REPORT 2013

80

15

616#.

% Funded domestically

144

100

New smear-positive (and/or culture-positive)
New smear-negative/extrapulmonary



*+8RQUKVKXGRGQRNGRTQXKFGFYKVJ+26

Reported cases of MDR-TB 2012

150

0
1995

Number of patients

*+8RQUKVKXGRGQRNGUETGGPGFHQT6$

/&46$ECUGUCOQPIPQVKßGF
RWNOQPCT[6$ECUGU

0
1990

100

New smear-positive and/or culture-positive

QH6$ECUGUYKVJ/&46$

100

Incidence



Estimates of MDR-TB burden 2012a

200

0
1990

07/$'41(/'/$'456#6'5b

Treatment success rate (%)




300

200

2009

2010

on CPT

2011

2012

on ART

800
Total budget (US$ millions)

5OGCTWPMPQYPPQVFQPG



Incidence (rate per 100 000
population per year)



Prevalence
(rate per 100 000 population)

400

6$ECUGPQVKßECVKQPU

600
400
200
0

2009

2010

Funded domestically

Data for all years can be downloaded from www.who.int/tb/data

2011

2012

Funded internationally

2013
Unfunded

#00':

Key indicators for the
world, WHO regions
and individual countries
Summary by WHO region

147

#HTKECP4GIKQP



4GIKQPQHVJG#OGTKECU



'CUVGTP/GFKVGTTCPGCP4GIKQP



'WTQRGCP4GIKQP



5QWVJ'CUV#UKC4GIKQP



9GUVGTP2CEKßE4GIKQP



57//#4;$;9*14')+10
Table A4.1

Estimates of the burden of disease caused by TB, 1990–2012

149

6CDNG# +PEKFGPEGPQVKßECVKQPCPFECUGFGVGEVKQPTCVGUCNNHQTOU¿



6CDNG# %CUGPQVKßECVKQPU¿



Table A4.4

Treatment outcomes, new smear-positive cases, 1995–2011

152

Table A4.5

Treatment outcomes, retreatment cases, 1995–2011

152

6CDNG# *+8VGUVKPICPFRTQXKUKQPQH%26#46CPF+26¿



6CDNG# 6GUVKPIHQT/&46$CPFPWODGTQHEQPßTOGFECUGUQH/&46$¿



6CDNG# 0GYUOGCTRQUKVKXGECUGPQVKßECVKQPD[CIGCPFUGZ¿



Estimates of mortality, prevalence and incidence
Estimated values are shown as best estimates followed by lower and upper bounds. The lower and upper bounds are defined
as the 2.5th and 97.5th centiles of outcome distributions produced in simulations. See ANNEX 1 for further details.
Estimated numbers are shown rounded to two significant figures. Estimated rates are shown rounded to three significant
figures unless the value is under 100, in which case rates are shown rounded to two significant figures.
Estimates for all years are recalculated as new information becomes available and techniques are refined, so
they may differ from those published in previous reports in this series. The main updates implemented in this
report are explained in Box 2.1 of Chapter 2. Estimates published in previous global TB control reports should no
longer be used.

Data source
Data shown in this annex are taken from the WHO global TB database on 1 October 2013. Data shown in the main part of
the report were taken from the database in July 2013. As a result, data in this annex may differ slightly from those in the
main part of the report.
Data for all years can be downloaded from www.who.int/tb/data.



GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±

Global

1990
1995
2000
2005
2010
2011
2012
Africa
1990
1995
2000
2005
2010
2011
2012
The Americas 1990
1995
2000
2005
2010
2011
2012
Eastern
1990
Mediterranean 1995
2000
2005
2010
2011
2012
Europe
1990
1995
2000
2005
2010
2011
2012
South-East
1990
Asia
1995
2000
2005
2010
2011
2012
Western
1990
Pacific
1995
2000
2005
2010
2011
2012

a

POPULATION
(MILLIONS)

5 298
5 718
6 102
6 489
6 890
6 972
7 054
503
577
655
744
847
870
893
727
783
841
892
942
951
961
378
429
480
533
593
605
617
849
863
870
882
899
902
905
1 310
1 435
1 560
1 682
1 790
1 812
1 833
1 532
1 630
1 697
1 756
1 820
1 833
1 846

NUMBER
(THOUSANDS)

1 300
1 400
1 400
1 200
1 000
980
940
210
230
250
240
230
230
230
43
37
29
24
21
19
19
120
130
140
120
100
100
100
39
60
71
66
44
40
36
570
640
680
620
500
480
450
320
260
200
150
120
110
110

(1 100–1 500)
(1 100–1 600)
(1 100–1 600)
(1 000–1 400)
(850–1 200)
(820–1 100)
(790–1 100)
(120–340)
(140–350)
(130–400)
(130–390)
(160–310)
(160–310)
(160–310)
(35–52)
(32–42)
(25–33)
(21–27)
(18–24)
(17–22)
(16–21)
(57–200)
(67–210)
(70–230)
(65–190)
(61–150)
(62–150)
(63–150)
(36–43)
(58–62)
(69–73)
(64–67)
(43–46)
(39–41)
(35–36)
(410–750)
(460–840)
(500–890)
(480–780)
(370–660)
(350–620)
(330–590)
(280–350)
(230–300)
(160–230)
(140–170)
(110–130)
(100–120)
(96–120)

RATEa

25
24
22
19
15
14
13
43
41
38
32
27
26
26
5.9
4.7
3.5
2.7
2.2
2
1.9
32
30
29
23
17
17
16
4.6
6.9
8.1
7.4
4.9
4.5
3.9
43
44
43
37
28
26
25
21
16
12
8.6
6.4
6.1
5.8

(21–29)
(20–28)
(18–27)
(16–22)
(12–17)
(12–16)
(11–16)
(24–67)
(24–61)
(20–61)
(17–53)
(19–36)
(18–35)
(18–35)
(4.8–7.1)
(4.1–5.4)
(3.0–4.0)
(2.3–3.1)
(1.9–2.5)
(1.8–2.3)
(1.7–2.2)
(15–54)
(16–50)
(15–48)
(12–36)
(10–25)
(10–25)
(10–24)
(4.2–5.1)
(6.7–7.2)
(7.9–8.4)
(7.3–7.6)
(4.8–5.1)
(4.4–4.6)
(3.9–4.0)
(31–57)
(32–58)
(32–57)
(29–47)
(21–37)
(19–34)
(18–32)
(18–23)
(14–18)
(9.6–14)
(7.9–9.5)
(5.9–7.1)
(5.5–6.7)
(5.2–6.4)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

15 000
16 000
16 000
15 000
13 000
12 000
12 000
2 000
2 300
2 600
2 700
2 700
2 700
2 700
750
600
510
440
390
400
390
1 100
1 200
1 200
1 200
1 100
1 100
1 100
610
1 000
1 100
910
620
580
510
6 100
6 700
7 000
6 300
5 200
5 000
4 800
4 000
3 900
3 600
3 100
2 500
2 500
2 400

(13 000–16 000)
(14 000–17 000)
(14 000–18 000)
(13 000–16 000)
(11 000–14 000)
(11 000–14 000)
(11 000–13 000)
(1 300–3 000)
(1 600–3 200)
(1 700–3 700)
(1 800–3 800)
(2 100–3 300)
(2 100–3 300)
(2 100–3 300)
(540–990)
(470–750)
(390–640)
(340–550)
(300–490)
(300–500)
(300–490)
(600–1 600)
(720–1 700)
(740–1 800)
(740–1 700)
(710–1 500)
(720–1 600)
(730–1 600)
(500–720)
(840–1 200)
(890–1 400)
(700–1 100)
(470–790)
(440–740)
(380–650)
(5 200–7 000)
(5 800–7 700)
(6 000–8 100)
(5 300–7 400)
(4 000–6 600)
(3 900–6 400)
(3 700–6 100)
(3 600–4 400)
(3 500–4 300)
(3 200–4 000)
(2 700–3 400)
(2 300–2 800)
(2 200–2 700)
(2 100–2 600)

RATEa

274
275
263
225
182
176
169
404
405
397
364
318
310
303
103
76
60
49
41
42
40
279
272
256
216
184
182
180
71
120
129
103
68
64
56
465
469
449
375
293
278
264
261
238
210
174
139
134
128

(249–302)
(251–301)
(237–290)
(200–250)
(160–205)
(155–198)
(149–190)
(254–590)
(276–558)
(257–567)
(239–515)
(249–395)
(244–383)
(239–373)
(74–136)
(59–95)
(47–76)
(38–61)
(32–52)
(32–53)
(31–51)
(159–433)
(168–401)
(155–383)
(138–312)
(120–260)
(119–258)
(118–256)
(59–85)
(97–144)
(103–159)
(79–130)
(52–87)
(49–82)
(42–72)
(400–535)
(404–538)
(387–516)
(314–442)
(224–371)
(213–352)
(203–333)
(238–286)
(216–262)
(187–234)
(156–193)
(124–153)
(120–148)
(115–142)

INCIDENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

7 800
8 400
9 000
9 200
8 800
8 700
8 600
1 200
1 600
2 000
2 300
2 300
2 300
2 300
430
380
340
310
280
280
280
460
530
560
600
650
660
670
370
560
640
570
420
400
360
2 900
3 100
3 400
3 600
3 500
3 500
3 400
2 500
2 300
2 000
1 800
1 700
1 600
1 600

(7 200–8 500)
(7 900–9 000)
(8 500–9 500)
(8 700–9 700)
(8 400–9 100)
(8 400–9 100)
(8 300–9 000)
(950–1 600)
(1 300–1 900)
(1 700–2 400)
(2 000–2 700)
(2 100–2 500)
(2 100–2 500)
(2 100–2 500)
(370–490)
(360–410)
(320–370)
(290–330)
(260–300)
(260–300)
(260–300)
(360–580)
(470–590)
(500–630)
(530–670)
(570–720)
(580–740)
(590–750)
(350–380)
(530–590)
(600–680)
(530–600)
(400–450)
(380–430)
(340–390)
(2 500–3 200)
(2 800–3 400)
(3 200–3 700)
(3 300–3 900)
(3 200–3 700)
(3 200–3 700)
(3 200–3 700)
(2 100–2 900)
(2 000–2 600)
(1 800–2 300)
(1 700–2 000)
(1 500–1 800)
(1 500–1 800)
(1 500–1 800)

RATEa

147
148
148
142
128
125
122
245
275
310
310
271
262
255
59
49
41
34
30
30
29
122
123
118
112
109
109
109
43
65
73
64
47
44
40
218
218
220
213
194
191
187
161
138
119
105
92
90
87

(136–160)
(139–157)
(139–156)
(134–150)
(123–133)
(120–130)
(117–127)
(189–309)
(226–329)
(255–370)
(263–361)
(249–293)
(242–284)
(235–275)
(51–68)
(46–52)
(38–43)
(32–36)
(28–32)
(28–32)
(27–31)
(94–153)
(109–137)
(104–132)
(99–126)
(96–122)
(97–122)
(96–122)
(41–45)
(62–69)
(69–78)
(60–68)
(44–50)
(42–47)
(38–43)
(192–246)
(198–239)
(203–237)
(197–229)
(181–208)
(177–204)
(174–200)
(135–189)
(120–158)
(106–133)
(95–115)
(84–100)
(82–98)
(80–95)

SUMMARY BY WHO REGION

MORTALITY (EXCLUDING HIV)
YEAR

Rates are per 100 000 population.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

149

7$%/($,QFLGHQFHQRWLILFDWLRQDQGFDVHGHWHFWLRQUDWHVDOOIRUPV±
INCIDENCE (INCLUDING HIV)

Global

Africa

The Americas

Eastern
Mediterranean

Europe

South-East
Asia

Western
Pacific

a
b

YEAR

POPULATION
(MILLIONS)

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

5 298
5 718
6 102
6 489
6 890
6 972
7 054
503
577
655
744
847
870
893
727
783
841
892
942
951
961
378
429
480
533
593
605
617
849
863
870
882
899
902
905
1 310
1 435
1 560
1 682
1 790
1 812
1 833
1 532
1 630
1 697
1 756
1 820
1 833
1 846

NUMBER
(THOUSANDS)

7 800
8 400
9 000
9 200
8 800
8 700
8 600
1 200
1 600
2 000
2 300
2 300
2 300
2 300
430
380
340
310
280
280
280
460
530
560
600
650
660
670
370
560
640
570
420
400
360
2 900
3 100
3 400
3 600
3 500
3 500
3 400
2 500
2 300
2 000
1 800
1 700
1 600
1 600

(7 200–8 500)
(7 900–9 000)
(8 500–9 500)
(8 700–9 700)
(8 400–9 100)
(8 400–9 100)
(8 300–9 000)
(950–1 600)
(1 300–1 900)
(1 700–2 400)
(2 000–2 700)
(2 100–2 500)
(2 100–2 500)
(2 100–2 500)
(370–490)
(360–410)
(320–370)
(290–330)
(260–300)
(260–300)
(260–300)
(360–580)
(470–590)
(500–630)
(530–670)
(570–720)
(580–740)
(590–750)
(350–380)
(530–590)
(600–680)
(530–600)
(400–450)
(380–430)
(340–390)
(2 500–3 200)
(2 800–3 400)
(3 200–3 700)
(3 300–3 900)
(3 200–3 700)
(3 200–3 700)
(3 200–3 700)
(2 100–2 900)
(2 000–2 600)
(1 800–2 300)
(1 700–2 000)
(1 500–1 800)
(1 500–1 800)
(1 500–1 800)

INCIDENCE HIV-POSITIVE
NUMBER
(THOUSANDS)

a

RATE

147
148
148
142
128
125
122
245
275
310
310
271
262
255
59
49
41
34
30
30
29
122
123
118
112
109
109
109
43
65
73
64
47
44
40
218
218
220
213
194
191
187
161
138
119
105
92
90
87

(136–160)
(139–157)
(139–156)
(134–150)
(123–133)
(120–130)
(117–127)
(189–309)
(226–329)
(255–370)
(263–361)
(249–293)
(242–284)
(235–275)
(51–68)
(46–52)
(38–43)
(32–36)
(28–32)
(28–32)
(27–31)
(94–153)
(109–137)
(104–132)
(99–126)
(96–122)
(97–122)
(96–122)
(41–45)
(62–69)
(69–78)
(60–68)
(44–50)
(42–47)
(38–43)
(192–246)
(198–239)
(203–237)
(197–229)
(181–208)
(177–204)
(174–200)
(135–189)
(120–158)
(106–133)
(95–115)
(84–100)
(82–98)
(80–95)

280
620
1 100
1 300
1 100
1 100
1 100
230
460
780
960
880
850
830
17
31
32
34
33
33
31
0.91
2.8
5.9
8.6
11
11
11
1.8
3.4
6.7
17
20
19
19
22
110
210
220
180
170
170
1.8
8.6
17
24
24
24
24

a

RATE

(230–320)
5.2 (4.4–6.1)
(560–680)
11 (9.8–12)
(960–1 200)
17 (16–19)
(1 200–1 400) 20 (18–21)
(1 100–1 200) 17 (15–18)
(1 000–1 200) 16 (15–17)
(1 000–1 200) 15 (14–16)
(190–280)
46 (38–56)
(410–520)
80 (71–91)
(690–880)
119 (105–134)
(850–1 100)
130 (115–145)
(800–950)
103 (94–113)
(780–930)
98 (89–107)
(760–910)
93 (85–102)
(14–20)
2.3 (2.0–2.7)
(28–33)
3.9 (3.6–4.3)
(30–35)
3.8 (3.5–4.2)
(31–37)
3.8 (3.5–4.1)
(30–36)
3.5 (3.1–3.8)
(30–36)
3.5 (3.1–3.8)
(28–34)
3.3 (3.0–3.6)
(0.77–1.1)
0.2 (0.20–0.28)
(2.5–3.2)
0.7 (0.59–0.74)
(5.3–6.6)
1.2 (1.1–1.4)
(7.6–9.6)
1.6 (1.4–1.8)
(9.9–12)
1.9 (1.7–2.1)
(9.7–12)
1.8 (1.6–1.9)
(10–12)
1.8 (1.6–2.0)
(1.8–1.9)
0.2 (0.21–0.23)
(3.3–3.6)
0.4 (0.38–0.42)
(6.2–7.1)
0.8 (0.71–0.82)
(15–18)
1.9 (1.7–2.0)
(18–21)
2.2 (2.0–2.4)
(18–21)
2.1 (2.0–2.3)
(17–21)
2.1 (1.9–2.3)
(19–26)
1.7 (1.5–2.0)
(96–120)
7.5 (6.7–8.4)
(190–230)
13 (12–15)
(200–240)
13 (12–14)
(160–190)
9.9 (9.1–11)
(160–180)
9.4 (8.7–10)
(160–180)
9.2 (8.5–10)
(1.5–2.1)
0.1 (0.10–0.14)
(7.4–9.9)
0.5 (0.45–0.61)
(15–19)
1 (0.90–1.1)
(21–27)
1.4 (1.2–1.5)
(22–27)
1.3 (1.2–1.5)
(22–27)
1.3 (1.2–1.5)
(21–27)
1.3 (1.1–1.5)

NOTIFIED NEW AND RELAPSE
NUMBER

3 740 222
3 400 278
3 748 455
5 148 342
5 792 075
5 833 253
5 776 838
418 520
504 377
794 464
1 188 876
1 380 530
1 386 327
1 344 122
231 215
258 232
238 636
230 124
214 930
221 625
219 349
234 620
121 745
141 748
287 178
412 913
415 719
420 769
242 429
289 874
373 094
368 624
328 254
312 588
286 765
1 719 365
1 401 096
1 414 228
1 789 388
2 124 237
2 142 573
2 130 120
894 073
824 954
786 285
1 284 152
1 331 211
1 354 421
1 375 713

b

CASE DETECTION

a

RATE

PERCENT

71
59
61
79
84
84
82
83
87
121
160
163
159
151
32
33
28
26
23
23
23
62
28
30
54
70
69
68
29
34
43
42
37
35
32
131
98
91
106
119
118
116
58
51
46
73
73
74
75

48
40
42
56
66
67
67
34
32
39
52
60
61
59
54
67
70
75
76
78
79
51
23
25
48
64
63
63
66
51
59
65
77
78
79
60
45
41
50
61
62
62
36
37
39
70
80
83
85

Rates are per 100 000 population.
NOTIFIED NEW AND RELAPSE includes cases for which the treatment history is unknown.

150

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

(44–52)
(38–43)
(39–44)
(53–59)
(63–69)
(64–70)
(64–70)
(27–44)
(27–39)
(33–48)
(44–61)
(56–65)
(56–66)
(55–64)
(47–63)
(63–72)
(65–75)
(71–81)
(71–82)
(73–84)
(74–85)
(40–66)
(21–26)
(22–28)
(43–54)
(57–72)
(56–71)
(56–71)
(63–69)
(49–54)
(55–62)
(61–70)
(73–83)
(73–83)
(74–84)
(53–68)
(41–49)
(38–45)
(46–54)
(57–66)
(58–67)
(58–67)
(31–43)
(32–42)
(35–44)
(63–77)
(73–87)
(76–90)
(78–93)

7$%/($&DVHQRWLILFDWLRQV±

YEAR

Global

• 71

82 •

• 83

151 •

• 32

23 •

• 62

68 •

Africa

The Americas

Eastern
Mediterranean

Europe

• 29

32 •

• 131

116 •

• 58

75 •

South-East
Asia

Western
Pacific

a
b

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

NEW AND
RELAPSEb
3 740 222
3 400 278
3 748 455
5 148 342
5 792 075
5 833 253
5 776 838
418 520
504 377
794 464
1 188 876
1 380 530
1 386 327
1 344 122
231 215
258 232
238 636
230 124
214 930
221 625
219 349
234 620
121 745
141 748
287 178
412 913
415 719
420 769
242 429
289 874
373 094
368 624
328 254
312 588
286 765
1 719 365
1 401 096
1 414 228
1 789 388
2 124 237
2 142 573
2 130 120
894 073
824 954
786 285
1 284 152
1 331 211
1 354 421
1 375 713

NEW CASES
% SMEARRE-TREAT EXCL. TOTAL
SMEAR- SMEAR-NEGATIVE/
EXTRAHISTORY POS AMONG
OTHER RELAPSE
POSITIVE
UNKNOWN
PULMONARY
RELAPSE
RETREAT UNKNOWN NEW PULM
30 046
1 175 290
1 541 607
2 413 708
2 655 557
2 630 564
2 563 744
24 064
212 910
368 750
550 004
601 149
606 085
600 355
1 542
138 932
131 294
124 840
116 994
122 010
122 730
1 587
46 851
60 959
113 765
168 627
170 748
173 963
0
104 444
94 442
96 121
91 324
85 551
80 453
2 769
357 882
510 053
857 371
1 047 013
1 067 367
1 065 852
84
314 271
376 109
671 607
630 450
578 803
520 391

22 393
1 811 850
1 615 263
1 722 281
2 002 463
2 037 926
2 084 246
6 137
191 477
222 230
364 785
477 516
467 022
446 213
516
72 312
60 392
56 056
52 265
51 165
50 338
12 394
51 823
34 289
102 274
137 301
135 388
143 869
0
146 592
208 147
157 237
145 140
136 456
129 293
3 241
939 945
741 471
594 185
615 463
598 800
586 455
105
409 701
348 734
447 744
574 778
649 095
728 078

4 237
262 728
399 677
686 525
806 373
817 668
813 960
2 067
72 689
141 255
208 979
247 020
240 839
234 707
723
32 991
32 037
33 285
32 240
34 048
34 496
754
33 382
40 754
64 612
92 070
93 605
90 943
0
29 866
35 081
49 747
40 951
46 012
43 134
656
76 865
120 708
242 332
328 421
333 993
338 303
37
16 935
29 842
87 570
65 671
69 171
72 377

0
5
37
8 111
12 870
12 164
9 689
0
0
0
2 941
561
1 073
977
0
5
37
3 685
2 133
1 502
1 636
0
0
0
12
633
623
702
0
0
0
0
8 008
3 381
83
0
0
0
1 439
1 508
2 878
3 004
0
0
0
34
27
2 707
3 287

734
59 240
115 334
259 937
285 966
284 815
288 119
554
15 133
19 173
60 092
53 967
52 357
60 085
180
1 723
10 834
10 152
10 413
10 087
10 100
0
2 407
5 568
6 495
11 203
11 223
11 208
0
7 927
21 607
22 248
24 304
24 628
25 133
0
5 546
27 095
93 859
130 714
135 650
131 245
0
26 504
31 057
67 091
55 365
50 870
50 348

49
0
236 107
406 355
418 071
413 363
393 437
49
0
68 118
66 449
94 506
74 545
67 960
0
0
14 344
12 481
12 133
11 856
13 879
0
0
0
5 334
8 713
10 102
10 020
0
0
19 127
64 831
60 736
67 986
65 121
0
0
80 444
158 215
208 542
215 554
201 335
0
0
54 074
99 045
33 441
33 320
35 122

783
59 240
351 441
666 292
704 037
698 178
681 556
603
15 133
87 291
126 541
148 473
126 902
128 045
180
1 723
25 178
22 633
22 546
21 943
23 979
0
2 407
5 568
11 829
19 916
21 325
21 228
0
7 927
40 734
87 079
85 040
92 614
90 254
0
5 546
107 539
252 074
339 256
351 204
332 580
0
26 504
85 131
166 136
88 806
84 190
85 470

29
44
229
18 172
28 846
50 116
17 080
0
0
0
2 075
317
18 951
1 785
29
44
56
2 106
885
2 813
49
0
0
0
20
3 079
4 132
84
0
0
173
3 663
18 527
16 560
8 669
0
0
0
202
1 118
3 885
5 261
0
0
0
10 106
4 920
3 775
1 232

57
39
49
58
57
56
55
80
53
62
60
56
56
57
75
66
68
69
69
70
71
11
47
64
53
55
56
55

SUMMARY BY WHO REGION

NEW AND RELAPSE
NOTIFICATION RATEa
1990–2012

42
31
38
39
39
38
46
28
41
59
63
64
65
44
43
52
60
52
47
42

Rates are per 100 000 population.
NEW AND RELAPSE includes cases for which the treatment history is unknown.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

151

7$%/($7UHDWPHQWRXWFRPHVQHZVPHDUSRVLWLYHFDVHV±
% OF COHORT
TREATMENT SUCCESS (%)a
1995–2011

Global

• 57

87 •

• 60

82 •

• 50

78 •

• 79

88 •

• 67

66 •

• 33

89 •

• 80

94 •

Africa

The Americas

Eastern
Mediterranean

Europe

South-East
Asia

Western
Pacific

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

1 175 290
1 541 607
2 413 708
2 662 588
2 655 557
2 630 564
212 910
368 750
550 004
607 254
601 149
606 085
138 932
131 294
124 840
110 614
116 994
122 010
46 851
60 959
113 765
168 013
168 627
170 748
104 444
94 442
96 121
100 493
91 324
85 551
357 882
510 053
857 371
1 028 656
1 047 013
1 067 367
314 271
376 109
671 607
647 558
630 450
578 803

SIZE OF
COHORT

1 000 581
1 452 991
2 396 387
2 664 704
2 661 653
2 610 821
177 567
364 804
563 750
605 932
598 985
578 920
128 531
110 642
118 840
122 534
126 450
126 859
46 318
63 749
113 742
167 317
169 872
170 903
33 823
41 480
81 410
105 441
98 689
106 626
318 410
512 286
855 962
1 022 380
1 045 179
1 064 879
295 932
360 030
662 683
641 100
622 478
562 634

COHORT AS
% NOTIFIED

CURED

COMPLETED

85
94
99
100
100
99
83
99
102
100
100
96
93
84
95
111
108
104
99
105
100
100
101
100
32
44
85
105
108
125
89
100
100
99
100
100
94
96
99
99
99
97

40
60
77
80
80
80
46
59
62
70
72
72
37
60
55
53
53
54
60
69
72
74
74
74
58
47
59
56
54
51
9
44
83
85
85
85
67
85
89
90
90
91

17
9
7
7
7
7
14
12
13
10
9
10
14
17
24
23
22
23
19
12
11
14
14
14
10
28
13
13
13
15
23
6
4
3
4
4
13
5
3
3
3
3

DIED

3
4
4
4
4
4
6
7
7
5
5
5
3
5
5
5
5
5
2
4
3
3
2
2
6
5
8
8
8
8
1
2
4
4
4
4
2
2
2
2
2
2

FAILED

DEFAULTED

NOT
EVALUATED

1
1
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
2
3
2
1
1
1
1
6
6
7
12
12
8
0
1
2
2
2
2
1
1
1
1
1
1

5
7
5
4
4
4
12
11
9
6
6
6
6
8
7
8
8
7
13
8
8
5
5
5
4
6
7
6
6
6
2
7
6
5
5
5
4
2
1
1
1
1

34
19
4
4
3
4
20
10
7
7
6
6
39
11
9
11
11
9
4
6
5
3
3
4
16
7
5
5
7
12
64
40
1
1
1
1
13
4
3
3
3
2

7$%/($7UHDWPHQWRXWFRPHVUHWUHDWPHQWFDVHV±
% OF COHORT
TREATMENT SUCCESS (%)a
1995–2011

Global

• 86

72 •

• 69

68 •

• 72

51 •

• 75

74 •

• 40

47 •

• 68

75 •

• 90

86 •

Africa

The Americas

Eastern
Mediterranean

Europe

South-East
Asia

Western
Pacific

a

YEAR

NUMBER
NOTIFIED

SIZE OF
COHORT

COHORT AS
% NOTIFIED

CURED

COMPLETED

DIED

FAILED

DEFAULTED

NOT
EVALUATED

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

59 240
351 441
666 292
673 854
704 037
698 178
15 133
87 291
126 541
144 320
148 473
126 902
1 723
25 178
22 633
21 492
22 546
21 943
2 407
5 568
11 829
17 964
19 916
21 325
7 927
40 734
87 079
67 190
85 040
92 614
5 546
107 539
252 074
331 424
339 256
351 204
26 504
85 131
166 136
91 464
88 806
84 190

71 395
188 509
546 182
594 019
613 895
601 904
5 756
44 147
114 838
94 342
113 405
85 278
1 104
15 302
18 603
19 158
17 499
20 228
1 860
4 217
12 860
16 332
18 326
22 191
480
10 739
39 497
58 966
58 698
58 831
3 271
59 337
254 378
332 286
338 748
350 251
58 924
54 767
106 006
72 935
67 219
65 125

121
54
82
88
87
86
38
51
91
65
76
67
64
61
82
89
78
92
77
76
109
91
92
104
6
26
45
88
69
64
59
55
101
100
100
100
222
64
64
80
76
77

82
60
51
49
47
48
57
47
35
50
41
53
61
47
38
29
26
27
61
51
60
56
54
52
20
39
32
27
25
24
62
57
49
48
47
45
88
83
81
79
79
80

4
10
19
23
22
24
12
11
27
20
13
15
11
8
16
22
23
24
14
11
15
21
21
22
20
19
18
22
25
23
6
14
22
27
28
30
2
3
6
7
7
6

3
6
7
7
7
7
9
9
11
9
6
7
6
5
6
8
7
8
3
6
5
4
4
4
11
9
11
11
11
10
4
6
7
7
7
7
3
2
3
3
3
3

3
4
4
6
5
5
3
3
3
3
3
3
4
3
2
3
2
3
4
7
4
3
3
3
8
14
13
22
16
15
5
5
5
4
4
4
3
2
3
2
2
3

3
11
12
10
10
10
12
16
13
9
7
9
11
12
15
19
20
20
12
15
10
10
10
10
32
11
14
11
10
10
15
15
15
12
12
11
1
1
2
2
2
2

4
10
6
5
10
7
6
14
12
10
31
12
8
25
21
21
21
18
5
11
6
6
8
8
8
8
10
7
13
18
8
3
2
2
2
3
3
9
6
7
7
6

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

152

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($+,9WHVWLQJDQGSURYLVLRQRI&37$57DQG,37–

Global

•8

46 •

• 11

74 •

• 35

57 •

•1

14 •

• 40

60 •

•2

39 •

•2

32 •

Africa

The Americas

Eastern
Mediterranean

Europe

South-East
Asia

Western
Pacific

% OF TB
NUMBER OF TB
PATIENTS WITH PATIENTS WITH
KNOWN HIV
KNOWN HIV
STATUS
STATUS

2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

8.3
34
40
46
11
60
69
74
35
53
56
57
0.88
11
11
14
40
55
57
60
1.6
23
33
39
2.4
20
25
32

463 027
2 080 846
2 526 072
2 808 221
140 713
888 765
1 013 342
1 040 262
84 032
121 421
129 613
132 943
2 582
44 596
48 271
58 498
171 248
212 727
215 256
212 880
31 847
546 350
767 813
909 026
32 605
266 987
351 777
454 612

PATIENTS
NOTIFIED
(NEW AND
RETREAT)
5 554 697
6 210 146
6 246 616
6 170 275
1 255 325
1 475 036
1 460 872
1 412 082
242 605
227 063
233 481
233 228
292 512
421 626
425 821
430 789
433 455
388 990
380 574
351 886
1 947 603
2 332 779
2 358 127
2 331 455
1 383 197
1 364 652
1 387 741
1 410 835

NUMBER OF
HIV-POSITIVE
TB PATIENTS

% OF TESTED
TB PATIENTS
HIV-POSITIVE

103 683
493 186
569 074
549 769
73 332
394 332
465 647
443 558
14 232
19 615
20 497
20 798
330
1 360
1 738
2 036
6 543
12 858
11 790
13 103
7 025
52 519
55 608
56 093
2 221
12 502
13 794
14 181

22
24
23
20
52
44
46
43
17
16
16
16
13
3
3.6
3.5
2.8
5.9
5.3
6.2
22
9.6
7.2
6.2
6.8
4.6
3.9
3.1

% OF HIV% OF HIVNUMBER OF
POSITIVE TB POSITIVE TB HIV-POSITIVE
PATIENTS ON PATIENTS ON
PEOPLE
CPT
ART
PROVIDED IPT
76
81
82
79
78
81
82
79
10
50
41
63
18
50
60
69
25
58
63
71
50
86
88
89
31
55
71
79

35
46
49
57
29
44
47
55
81
63
69
77
16
44
31
49
16
61
58
62
31
56
58
61
33
41
48
56

25 938
204 802
446 598
518 670
22 211
182 524
438 121
473 214
3 727
12 906
1 705
18 710
0
253
52
243
0
6 575
4 565
17 938
0
581
368
8
0
1 963
1 787
8 557

SUMMARY BY WHO REGION

% OF TB PATIENTS WITH
YEAR
KNOWN HIV STATUS
2005–2012

7$%/($7HVWLQJIRU0'57%DQGQXPEHURIFRQILUPHGFDVHVRI0'57%±

YEAR

TOTAL
CONFIRMED
CASES OF
a

MDR-TB
Global

Africa

The Americas

Eastern
Mediterranean

Europe

South-East
Asia

Western
Pacific

a

b

2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

11988
54887
61907
85085
2445
9340
12384
18146
4427
2661
3474
2967
350
873
841
2249
4347
33776
34199
36772
68
3942
6615
19202
351
4295
4394
5749

NEW PULMONARY CASES
ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

310 000 (230 000–380 000) 170 000 (98 000–240 000)

38 000 (14 000–62 000)

24 000 (2 100–46 000)

7 100 (4 600–9 600)

3 800 (2 400–5 200)

18 000 (0–42 000)

11 000 (320–36 000)

74 000 (60 000–88 000)

33 000 (20 000–46 000)

90 000 (71 000–110 000)

36 000 (26 000–46 000)

78 000 (60 000–95 000)

59 000 (41 000–76 000)

NUMBER OF
b

BACT+VE
TESTED FOR
MDR-TB
72870
118835
133064
153626
1826
2732
1311
2565
14568
11309
13334
29869
1442
2397
2264
1990
34527
89005
89438
92580
661
1073
1204
1352
19846
12319
25513
25270

PREVIOUSLY TREATED CASES
% OF

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

b

BACT+VE
TESTED FOR
MDR-TB
2.9
4
4.6
5.7
0.32
0.36
0.19
0.39
11
8.6
10
23
1.3
1.4
1.2
1.1
27
68
67
76
<0.1
0.1
0.1
0.13
2.9
1.7
4.2
4.6

140 000 (91 000–190 000)

14 000 (5 600–22 000)

3 200 (1 100–5 300)

6 900 (2 400–11 000)

41 000 (35 000–46 000)

54 000 (37 000–70 000)

19 000 (15 000–23 000)

NUMBER OF
% OF NOTIFIED
NOTIFIED
TESTED FOR
TESTED FOR
MDR-TB
MDR-TB
24002
3.6
47315
6.7
48124
6.9
60589
8.9
3922
3.1
4294
2.9
3707
2.9
4118
3.2
11003
49
4234
19
4234
19
5565
23
94
0.79
1257
6.3
1466
6.9
1617
7.6
7024
8.1
34212
40
31646
34
38268
42
420
0.17
1264
0.37
1935
0.55
2292
0.69
1539
0.93
2054
2.3
5136
6.1
8729
10

TOTAL CONFIRMED CASES OF MDR-TB includes cases with unknown previous treatment history (i.e. not included under NEW CASES or PREVIOUSLY TREATED
CASES).
BACT+VE = bacteriologically positive cases.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

153

7$%/($1HZVPHDUSRVLWLYHFDVHQRWLILFDWLRQE\DJHDQGVH[±
MALE

Global

Africa

The Americas

Eastern
Mediterranean

Europe

South-East
Asia

Western
Pacific

154

FEMALE

YEAR

0–14

15–24

25–34

35–44

45–54

55–64

65+

UNKNOWN

0–14

15–24

25–34

35–44

45–54

55–64

65+

UNKNOWN

1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012

7 491
12 387
18 415
20 239
19 701
17 046
2 910
3 625
7 635
8 393
8 551
6 032
437
3 464
1 520
1 050
1 103
935
2 010
1 339
1 546
2 316
1 924
1 999
553
201
299
156
164
138
165
2 453
5 064
6 737
6 490
6 581
1 416
1 305
2 351
1 587
1 469
1 361

48 816
115 250
242 356
268 884
265 503
246 030
16 754
29 522
54 066
57 146
59 072
51 158
2 888
18 564
16 410
11 461
12 436
12 125
6 796
8 135
13 558
19 526
19 630
20 119
3 588
4 636
6 170
7 319
6 536
5 997
3 179
30 093
94 638
114 806
114 254
111 501
15 611
24 300
57 514
58 626
53 575
45 130

76 799
172 896
329 720
345 937
349 803
330 650
28 172
47 654
94 388
98 636
105 549
96 915
3 443
21 869
16 671
14 267
15 023
14 784
8 673
9 002
14 609
19 993
20 303
20 411
7 046
8 322
9 151
13 259
13 704
13 038
6 467
45 720
120 560
136 683
136 142
133 040
22 998
40 329
74 341
63 099
59 082
52 462

65 678
156 274
312 526
336 981
333 792
321 408
20 240
34 435
71 072
78 660
81 247
79 312
3 157
19 787
14 369
11 332
11 704
11 278
5 475
6 525
10 798
14 908
14 984
15 178
10 157
9 862
9 150
12 447
13 498
13 394
6 508
47 107
122 256
142 080
141 636
140 542
20 141
38 558
84 881
77 554
70 723
61 704

49 514
121 277
261 233
298 715
300 666
290 214
12 017
17 923
40 974
48 543
49 967
46 870
2 448
15 138
12 340
10 627
11 234
10 716
3 731
4 409
8 729
13 086
13 857
14 006
7 625
8 065
8 704
12 270
12 966
12 301
5 241
38 058
107 228
132 411
135 592
136 569
18 452
37 684
83 258
81 778
77 050
69 752

41 756
82 844
184 836
227 530
229 756
225 684
7 008
8 970
18 931
24 094
24 393
23 665
1 866
9 899
7 801
7 433
7 709
7 596
3 732
2 990
6 581
10 596
11 049
11 333
5 716
4 313
4 443
6 916
7 569
7 624
4 682
25 080
74 084
101 728
106 420
108 866
18 752
31 592
72 996
76 763
72 616
66 600

34 776
75 156
166 858
186 815
183 782
177 736
4 104
5 751
12 143
14 478
14 732
14 186
2 251
9 717
7 951
7 084
7 198
6 989
2 604
3 036
5 595
9 521
9 871
10 059
4 842
3 321
4 089
4 125
4 329
4 113
3 523
16 208
45 533
67 131
72 264
72 554
17 452
37 123
91 547
84 476
75 388
69 835

0
0
42
7 502
579
268
0
0
0
17
516
31
0
0
0
59
56
67
0
0
0
0
0
160
0
0
42
7 423
7
5
0
0
0
0
0
0
0
0
0
3
0
5

7 730
14 749
26 178
28 825
28 133
24 834
3 167
4 315
10 023
10 287
10 632
8 003
431
3 535
1 718
1 137
1 241
1 044
1 881
1 711
2 766
4 377
3 839
3 642
548
290
422
301
257
224
250
3 222
8 591
10 923
10 654
10 535
1 453
1 676
2 658
1 800
1 510
1 386

41 378
94 641
199 700
210 729
209 821
197 407
15 873
29 530
57 115
55 537
57 027
48 828
2 293
15 305
12 405
8 405
8 517
8 615
5 035
6 710
13 529
21 108
21 322
22 258
2 906
3 506
4 667
4 958
4 734
4 258
2 187
21 518
71 923
84 006
85 376
85 726
13 084
18 072
40 061
36 715
32 845
27 722

50 102
110 306
220 530
225 986
224 552
210 454
19 005
35 386
75 056
76 051
76 968
67 255
2 434
14 961
11 563
8 496
8 766
8 561
5 797
5 780
12 098
17 151
17 214
17 341
3 636
4 405
5 101
6 559
6 767
6 336
2 834
25 653
76 779
84 704
84 383
82 947
16 396
24 121
39 933
33 025
30 454
28 014

32 741
74 705
153 503
163 260
162 884
153 967
11 339
20 037
43 213
47 070
47 873
43 481
1 654
10 323
7 891
5 818
5 875
5 710
3 679
3 922
8 386
12 183
12 380
12 564
2 594
2 945
3 161
4 218
4 507
4 387
2 404
19 241
54 000
63 272
64 868
64 170
11 071
18 237
36 852
30 699
27 381
23 655

22 688
49 823
106 029
118 565
119 644
115 659
6 643
9 402
22 855
26 299
26 401
23 378
1 109
7 294
5 933
4 880
4 973
5 023
3 047
2 851
6 245
9 776
10 060
10 187
1 549
1 798
2 242
3 051
3 195
2 986
2 003
13 019
37 709
48 470
50 920
52 118
8 337
15 459
31 045
26 089
24 095
21 967

17 816
33 696
72 022
86 264
87 668
86 968
3 655
4 581
11 047
13 522
13 543
12 683
912
5 038
3 788
3 467
3 690
3 760
2 742
2 039
4 383
7 532
7 770
8 082
1 560
1 243
1 336
2 033
2 292
2 125
1 866
8 142
24 289
34 052
36 755
38 516
7 081
12 653
27 179
25 658
23 618
21 802

16 686
33 829
65 717
75 368
74 004
74 189
1 734
2 578
7 163
8 685
8 843
8 642
1 311
5 894
4 751
4 068
4 243
4 157
1 902
1 893
3 399
7 032
6 432
6 784
3 289
2 490
3 176
3 398
3 693
3 528
1 480
5 468
12 975
20 004
21 593
22 187
6 970
15 506
34 253
32 181
29 200
28 891

0
0
15
2 601
313
172
0
0
0
9
301
37
0
0
0
22
9
30
0
0
0
0
0
20
0
0
15
2 567
3
3
0
0
0
0
0
0
0
0
0
3
0
82

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

MALE:FEMALE
RATIO
1.7
1.8
1.8
1.9
1.9
1.9
1.5
1.4
1.3
1.4
1.4
1.5
1.6
1.6
1.6
1.7
1.8
1.7
1.4
1.4
1.2
1.1
1.2
1.2
2.5
2.3
2.1
2.4
2.3
2.4
2.3
2.1
2.0
2.0
2.0
2.0
1.8
2.0
2.2
2.4
2.4
2.4

#(4+%#04')+10
Table A4.1

Estimates of the burden of disease caused by TB, 1990–2012

157

6CDNG# +PEKFGPEGPQVKßECVKQPCPFECUGFGVGEVKQPTCVGUCNNHQTOU¿



6CDNG# %CUGPQVKßECVKQPU¿



Table A4.4

Treatment outcomes, new smear-positive cases, 1995–2011

166

Table A4.5

Treatment outcomes, retreatment cases, 1995–2011

169

6CDNG# *+8VGUVKPICPFRTQXKUKQPQH%26#46CPF+26¿



6CDNG# 6GUVKPIHQT/&46$CPFPWODGTQHEQPßTOGFECUGUQH/&46$¿



6CDNG# 0GYUOGCTRQUKVKXGECUGPQVKßECVKQPD[CIGCPFUGZ¿



Table A4.9

Laboratories, NTP services, drug management and infection control, 2012

179

6CDNG# /GCUWTGFRGTEGPVCIGQH6$ECUGUYKVJ/&46$OQUVTGEGPV[GCTCXCKNCDNG



Estimates of mortality, prevalence and incidence
Estimated values are shown as best estimates followed by lower and upper bounds. The lower and upper bounds are defined
as the 2.5th and 97.5th centiles of outcome distributions produced in simulations. See ANNEX 1 for further details.
Estimated numbers are shown rounded to two significant figures. Estimated rates are shown rounded to three significant
figures unless the value is under 100, in which case rates are shown rounded to two significant figures.
Estimates for all years are recalculated as new information becomes available and techniques are refined, so
they may differ from those published in previous reports in this series. The main updates implemented in this
report are explained in Box 2.1 of Chapter 2. Estimates published in previous global TB control reports should no
longer be used.

Data source
Data shown in this annex are taken from the WHO global TB database on 1 October 2013. Data shown in the main part of
the report were taken from the database in July 2013. As a result, data in this annex may differ slightly from those in the
main part of the report.
Data for all years can be downloaded from www.who.int/tb/data.

156

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±

Algeria

Angola

Benin

Botswana

Burkina Faso

Burundi

Cameroon

Cape Verde

Central African
Republic

Chad

Comoros

Congo

Côte d'Ivoire

Democratic
Republic
of the Congo

Equatorial
Guinea

Eritrea

a

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

26
29
32
34
37
38
38
10
12
14
17
20
20
21
5
6
7
8
10
10
10
1
2
2
2
2
2
2
9
10
12
13
16
16
16
6
6
7
8
9
10
10
12
14
16
18
21
21
22
<1
<1
<1
<1
<1
<1
<1
3
3
4
4
4
4
5
6
7
8
10
12
12
12
<1
<1
<1
<1
<1
<1
<1
2
3
3
4
4
4
4
12
14
16
17
19
19
20
35
42
47
54
62
64
66
<1
<1
<1
<1
<1
<1
<1
3
3
4
5
6
6
6

NUMBER
(THOUSANDS)

2.8
2.9
4.4
5
5.3
5.4
5.6
4
6.1
5.8
4.4
6.6
7.6
8.7
0.97
0.95
0.95
0.87
0.88
0.91
0.94
1.3
1.3
0.88
0.66
0.48
0.45
0.42
1.2
1.4
1.5
1.5
1.4
1.4
1.4
1.3
3
2.6
2.2
1.8
1.8
1.8
2.3
5.8
8.1
7.3
6.6
6.3
6.4
0.13
0.14
0.15
0.15
0.13
0.12
0.11
3.6
5.1
5.2
3.9
2.6
2.4
2.2
0.86
1.5
2
2.3
2.3
2.2
2.3
0.043
0.038
0.037
0.045
0.045
0.046
0.045
0.7
0.83
1.1
1.7
1.8
1.8
1.8
4.8
8.2
9
6.6
4.7
4.7
4.4
26
28
29
29
33
35
36
0
0
0
0
0
0
0
0.39
0.33
0.3
0.29
0.28
0.28
0.28

(0.970–5.5)
(0.980–5.9)
(1.5–8.8)
(1.7–9.9)
(1.8–11)
(1.9–11)
(1.9–11)
(1.0–8.9)
(2.3–12)
(2.4–11)
(1.7–8.1)
(3.0–12)
(3.5–13)
(3.9–15)
(0.390–1.8)
(0.390–1.7)
(0.400–1.7)
(0.380–1.6)
(0.390–1.6)
(0.400–1.6)
(0.420–1.7)
(0.095–4.2)
(0.076–4.4)
(0.046–2.9)
(0.190–1.4)
(0.120–1.1)
(0.120–1.0)
(0.110–0.920)
(0.470–2.3)
(0.540–2.6)
(0.580–2.8)
(0.610–2.7)
(0.630–2.5)
(0.620–2.5)
(0.600–2.5)
(0.570–2.3)
(1.2–5.6)
(1.1–4.9)
(0.960–4.0)
(0.840–3.2)
(0.840–3.2)
(0.790–3.2)
(0.980–4.1)
(2.2–11)
(3.1–16)
(3.0–14)
(2.8–12)
(2.7–11)
(2.7–12)
(0.034–0.290)
(0.055–0.270)
(0.057–0.290)
(0.057–0.280)
(0.051–0.240)
(0.049–0.220)
(0.047–0.210)
(1.3–6.9)
(1.9–9.9)
(1.9–10)
(1.5–7.5)
(1.0–4.8)
(0.980–4.4)
(0.840–4.3)
(0.370–1.5)
(0.610–2.9)
(0.800–3.7)
(0.940–4.2)
(1.0–4.1)
(0.960–3.9)
(0.980–4.1)
(0.018–0.077)
(0.017–0.069)
(0.016–0.065)
(0.019–0.083)
(0.019–0.082)
(0.019–0.083)
(0.019–0.084)
(0.220–1.4)
(0.340–1.5)
(0.500–2.0)
(0.730–3.0)
(0.790–3.3)
(0.800–3.3)
(0.780–3.4)
(1.9–9.0)
(3.2–16)
(3.6–17)
(2.8–12)
(2.1–8.2)
(2.2–8.3)
(1.8–8.0)
(9.9–49)
(11–53)
(12–53)
(13–52)
(15–59)
(15–62)
(16–64)
(0–0.063)
(0–0.087)
(0–0.086)
(0–0.058)
(0–0.058)
(0–0.053)
(0–0.054)
(0.260–0.540)
(0.220–0.460)
(0.200–0.420)
(0.190–0.400)
(0.190–0.390)
(0.190–0.390)
(0.190–0.400)

a

RATE

11
9.9
14
15
14
14
15
39
50
42
26
34
38
42
19
16
14
11
9.3
9.3
9.4
97
85
50
35
24
23
21
14
14
13
11
9.2
8.8
8.5
23
48
40
28
20
19
18
19
42
51
40
32
30
29
37
36
34
31
26
25
23
122
156
143
99
59
54
50
14
22
24
23
20
18
18
10
8.3
6.9
7.6
6.6
6.5
6.3
29
31
36
47
44
44
42
40
58
56
38
25
24
22
74
67
61
54
54
54
54
0
0
0
0
0
0
0
12
9.7
7.7
5.9
4.9
4.7
4.6

(3.7–21)
(3.4–20)
(4.9–28)
(5.1–29)
(5.0–28)
(5.0–29)
(5.1–29)
(9.9–87)
(19–96)
(17–77)
(11–49)
(16–60)
(17–66)
(19–73)
(7.9–36)
(6.6–29)
(5.8–25)
(4.7–19)
(4.1–16)
(4.1–17)
(4.2–17)
(6.9–302)
(4.8–276)
(2.6–165)
(10–76)
(6.0–56)
(5.9–51)
(5.5–46)
(5.3–26)
(5.3–26)
(5.0–24)
(4.5–20)
(4.0–16)
(3.9–16)
(3.7–15)
(10–40)
(19–90)
(16–73)
(12–51)
(9.1–35)
(8.8–33)
(8.0–32)
(8.1–34)
(16–80)
(19–98)
(16–75)
(14–58)
(13–54)
(12–54)
(9.8–81)
(14–68)
(13–65)
(12–59)
(11–49)
(10–46)
(9.5–42)
(45–236)
(57–303)
(53–277)
(37–190)
(24–110)
(22–99)
(19–95)
(6.2–26)
(8.8–41)
(9.7–45)
(9.4–42)
(8.5–35)
(8.0–33)
(7.9–33)
(4.4–19)
(3.6–15)
(3.0–12)
(3.2–14)
(2.8–12)
(2.8–12)
(2.6–12)
(9.4–61)
(13–56)
(16–63)
(21–85)
(19–80)
(19–78)
(18–77)
(16–74)
(23–109)
(22–105)
(16–69)
(11–43)
(11–43)
(9.1–41)
(28–140)
(27–126)
(25–112)
(24–97)
(24–96)
(24–97)
(24–97)
(0–17)
(0–20)
(0–17)
(0–9.7)
(0–8.3)
(0–7.4)
(0–7.4)
(7.9–17)
(6.4–14)
(5.1–11)
(3.9–8.3)
(3.2–6.9)
(3.1–6.6)
(3.0–6.5)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

29
32
47
53
56
57
59
39
55
59
57
80
90
99
9.7
8.9
9.3
9.2
10
11
11
13
15
13
11
8.1
7.5
6.9
12
12
13
13
14
14
14
15
32
27
22
20
20
20
24
56
80
78
76
68
69
1.2
1.3
1.4
1.4
1.3
1.2
1.2
40
55
54
40
28
26
24
9.4
16
21
24
28
28
28
0.38
0.35
0.34
0.4
0.42
0.45
0.44
7.7
9.6
14
21
23
23
23
48
78
83
64
49
51
45
240
270
290
300
350
360
380
0.38
0.42
0.67
0.81
1.2
1.2
1.2
16
12
7.6
9.1
9.6
9.5
9.3

(13–53)
(13–59)
(20–85)
(23–95)
(24–100)
(25–100)
(25–110)
(14–76)
(27–93)
(29–99)
(22–110)
(35–140)
(42–160)
(48–170)
(4.7–17)
(4.3–15)
(4.6–16)
(4.6–15)
(5.0–17)
(5.3–18)
(5.6–18)
(1.9–33)
(2.6–37)
(3.4–28)
(5.2–19)
(3.6–14)
(3.4–13)
(3.1–12)
(5.4–20)
(5.7–21)
(6.0–22)
(6.6–22)
(7.1–23)
(7.2–23)
(6.9–22)
(7.8–24)
(16–53)
(14–45)
(12–37)
(11–33)
(11–33)
(10–32)
(12–39)
(26–98)
(36–140)
(36–140)
(36–130)
(32–120)
(33–120)
(0.440–2.3)
(0.640–2.2)
(0.670–2.3)
(0.680–2.3)
(0.630–2.1)
(0.610–2.0)
(0.590–2.0)
(17–72)
(23–100)
(23–99)
(17–71)
(13–47)
(12–44)
(11–40)
(4.7–16)
(7.7–27)
(10–36)
(12–41)
(14–47)
(14–46)
(14–46)
(0.180–0.660)
(0.170–0.600)
(0.160–0.580)
(0.200–0.680)
(0.210–0.710)
(0.230–0.740)
(0.220–0.740)
(2.6–16)
(4.6–16)
(6.9–24)
(9.8–35)
(11–39)
(11–40)
(11–40)
(23–80)
(38–130)
(40–140)
(33–100)
(25–80)
(26–83)
(23–75)
(110–420)
(130–470)
(140–480)
(150–500)
(180–560)
(190–590)
(200–620)
(0.150–0.720)
(0.160–0.820)
(0.300–1.2)
(0.350–1.5)
(0.520–2.0)
(0.560–2.2)
(0.510–2.2)
(6.5–29)
(4.1–25)
(1.9–17)
(3.2–18)
(3.6–18)
(3.6–18)
(3.5–18)

INCIDENCE (INCLUDING HIV)
a

RATE

112
110
148
156
151
152
152
378
458
421
347
411
447
474
195
149
134
113
107
109
110
915
925
720
579
411
380
343
132
121
108
97
89
88
82
263
510
408
289
219
214
199
195
404
504
432
366
320
319
340
326
311
288
257
248
237
1 360
1 680
1 500
1 000
637
579
520
157
228
252
243
237
229
221
93
75
64
67
62
64
62
323
352
455
580
557
548
530
394
551
513
366
258
262
228
695
654
611
558
555
568
576
101
96
130
135
166
174
164
484
362
194
187
167
160
152

(49–202)
(46–203)
(64–267)
(67–281)
(65–273)
(65–274)
(66–274)
(137–738)
(225–772)
(207–709)
(132–663)
(181–731)
(209–772)
(230–804)
(93–333)
(72–253)
(66–225)
(56–189)
(53–179)
(54–182)
(55–184)
(135–2 410)
(166–2 310)
(194–1 580)
(276–991)
(185–727)
(172–668)
(157–600)
(61–230)
(57–209)
(52–186)
(49–161)
(46–147)
(45–145)
(42–136)
(140–425)
(251–858)
(207–675)
(151–471)
(116–354)
(114–345)
(106–322)
(98–325)
(186–704)
(227–889)
(201–750)
(174–629)
(152–549)
(153–544)
(125–660)
(161–549)
(152–526)
(142–485)
(129–427)
(124–414)
(119–395)
(583–2 460)
(704–3 070)
(631–2 720)
(438–1 790)
(304–1 090)
(279–987)
(251–884)
(78–264)
(111–388)
(122–429)
(119–412)
(118–397)
(114–383)
(109–372)
(45–159)
(36–129)
(30–111)
(33–114)
(31–103)
(32–105)
(31–103)
(108–654)
(168–601)
(222–770)
(276–994)
(265–955)
(262–938)
(250–913)
(193–664)
(265–940)
(249–870)
(187–604)
(133–424)
(135–430)
(115–380)
(327–1 200)
(318–1 110)
(308–1 020)
(285–920)
(288–908)
(297–923)
(301–938)
(39–193)
(35–187)
(58–231)
(58–243)
(75–294)
(79–305)
(69–299)
(198–894)
(121–731)
(49–436)
(67–368)
(63–319)
(60–307)
(56–294)

NUMBER
(THOUSANDS)

17
20
28
31
33
34
34
21
27
35
46
59
62
66
6.4
6
6
6
6.5
6.8
7
7.4
14
16
14
9.9
9
8.2
7.6
8.3
8.2
8.4
9
9.1
9
9.1
20
19
15
13
13
13
14
29
49
57
56
51
52
0.62
0.67
0.71
0.73
0.71
0.71
0.71
25
39
39
27
19
18
17
5.6
9
13
15
18
18
19
0.22
0.21
0.21
0.22
0.23
0.24
0.25
4
6.7
11
15
16
16
17
29
54
60
46
36
37
34
110
140
150
180
200
210
210
0.3
0.35
0.52
0.66
0.94
1
1
8
6.7
6.2
5.9
5.8
5.7
5.7

(13–22)
(15–26)
(20–36)
(23–41)
(24–44)
(25–44)
(25–45)
(13–31)
(22–33)
(28–42)
(37–54)
(50–69)
(53–73)
(55–77)
(5.3–7.6)
(4.9–7.1)
(4.9–7.1)
(5.0–7.2)
(5.4–7.8)
(5.6–8.1)
(5.8–8.3)
(2.9–14)
(8.8–19)
(13–20)
(13–15)
(8.8–11)
(8.1–10)
(7.3–9.1)
(6.5–8.9)
(7.0–9.6)
(7.0–9.6)
(7.1–9.8)
(7.6–10)
(7.7–11)
(7.6–10)
(8.0–10)
(18–23)
(17–22)
(14–17)
(12–15)
(12–15)
(11–14)
(11–16)
(24–34)
(41–59)
(47–68)
(47–67)
(42–61)
(43–61)
(0.380–0.910)
(0.550–0.800)
(0.580–0.850)
(0.600–0.880)
(0.590–0.850)
(0.590–0.850)
(0.590–0.850)
(21–30)
(32–47)
(32–46)
(23–33)
(16–22)
(15–21)
(14–20)
(4.7–6.7)
(7.4–11)
(10–15)
(12–18)
(15–21)
(15–22)
(16–22)
(0.180–0.270)
(0.180–0.250)
(0.170–0.250)
(0.180–0.260)
(0.190–0.270)
(0.200–0.290)
(0.200–0.290)
(2.5–5.9)
(5.4–8.0)
(9.3–13)
(12–18)
(13–19)
(13–20)
(14–20)
(25–33)
(47–62)
(52–68)
(40–53)
(31–41)
(32–42)
(30–39)
(92–140)
(110–160)
(130–180)
(150–200)
(180–230)
(180–240)
(190–250)
(0.260–0.340)
(0.310–0.400)
(0.460–0.590)
(0.580–0.750)
(0.830–1.1)
(0.890–1.1)
(0.900–1.2)
(5.3–11)
(4.5–9.5)
(4.1–8.7)
(3.9–8.2)
(3.8–8.1)
(3.8–8.1)
(3.8–8.0)

RATEa

66
68
87
93
90
90
89
205
226
250
276
304
310
316
128
100
86
74
69
70
70
533
855
918
733
503
455
408
87
82
71
62
58
57
54
162
321
288
198
144
139
130
112
206
310
312
274
243
238
175
168
160
153
147
145
144
861
1 200
1 070
690
433
400
367
95
128
151
150
151
151
151
54
46
39
36
33
34
34
169
245
353
425
391
387
381
238
379
369
267
190
191
172
327
327
327
327
327
327
327
80
80
101
110
135
142
139
243
198
157
121
100
97
93

(48–86)
(50–89)
(64–114)
(68–121)
(66–118)
(66–117)
(65–117)
(127–303)
(185–272)
(204–300)
(227–329)
(256–355)
(261–362)
(266–369)
(106–152)
(82–118)
(71–102)
(61–88)
(57–82)
(58–83)
(58–83)
(212–997)
(553–1 220)
(736–1 120)
(667–802)
(449–560)
(406–507)
(364–454)
(73–101)
(70–95)
(60–83)
(53–73)
(49–67)
(48–66)
(46–63)
(143–183)
(283–362)
(254–325)
(174–223)
(127–163)
(122–157)
(114–147)
(92–133)
(170–246)
(255–369)
(258–372)
(226–327)
(200–290)
(197–283)
(108–259)
(137–201)
(131–193)
(125–184)
(121–175)
(120–173)
(119–172)
(710–1 030)
(988–1 430)
(884–1 280)
(569–822)
(357–515)
(330–477)
(302–438)
(78–112)
(106–153)
(125–180)
(124–178)
(125–179)
(125–179)
(125–180)
(44–64)
(38–55)
(32–46)
(30–43)
(28–40)
(28–41)
(28–41)
(104–250)
(200–294)
(298–412)
(347–510)
(320–470)
(317–465)
(311–458)
(206–272)
(329–433)
(320–422)
(232–306)
(165–217)
(165–218)
(149–198)
(262–398)
(268–392)
(273–385)
(279–379)
(282–375)
(282–375)
(282–375)
(70–91)
(70–90)
(88–114)
(96–124)
(119–153)
(124–161)
(122–158)
(162–341)
(132–278)
(104–220)
(80–169)
(67–140)
(64–136)
(62–131)

AFRICAN REGION

MORTALITY (EXCLUDING HIV)
YEAR

Rates are per 100 000 population.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

157

7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±
MORTALITY (EXCLUDING HIV)
YEAR

Ethiopia

Gabon

Gambia

Ghana

Guinea

Guinea-Bissau

Kenya

Lesotho

Liberia

Madagascar

Malawi

Mali

Mauritania

Mauritius

Mozambique

Namibia

a



1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

48
57
66
76
87
89
92
<1
1
1
1
2
2
2
<1
1
1
1
2
2
2
15
17
19
21
24
25
25
6
8
9
10
11
11
11
1
1
1
1
2
2
2
23
27
31
36
41
42
43
2
2
2
2
2
2
2
2
2
3
3
4
4
4
12
13
16
18
21
22
22
9
10
11
13
15
15
16
8
9
10
12
14
14
15
2
2
3
3
4
4
4
1
1
1
1
1
1
1
14
16
18
21
24
25
25
1
2
2
2
2
2
2

NUMBER
(THOUSANDS)

23
27
27
22
17
16
16
0.39
0.62
0.99
1.1
0.8
0.73
0.72
0.33
0.4
0.44
0.57
0.78
0.84
0.91
5.3
5.4
5.1
4
2.5
2.1
1.7
3.7
4.2
3.9
3.3
2.8
2.6
2.6
0.21
0.26
0.36
0.32
0.43
0.46
0.49
7.1
4.5
5.9
8.1
8.2
8.9
9.5
0.35
0.34
0.29
0.2
0.27
0.34
0.34
0.62
1.1
1.6
1.6
1.9
1.9
1.9
13
11
11
10
10
10
10
3.8
3.7
3.2
2.3
1.8
1.5
1.4
1.2
1.2
1.2
1.3
1.3
1.3
1.3
0.38
0.92
1.5
2.3
3.2
3.4
3.5
0.027
0.013
<0.01
0.013
0.012
0.019
0.012
13
16
14
12
12
13
13
0.074
0.15
0.46
0.46
0.34
0.32
0.32

(14–35)
(16–41)
(16–41)
(13–33)
(12–23)
(12–21)
(12–21)
(0.160–0.710)
(0.250–1.2)
(0.390–1.9)
(0.430–2.0)
(0.340–1.4)
(0.320–1.3)
(0.300–1.3)
(0.087–0.730)
(0.160–0.740)
(0.180–0.810)
(0.230–1.1)
(0.300–1.5)
(0.330–1.6)
(0.360–1.7)
(0.880–14)
(1.1–13)
(1.2–12)
(1.3–8.3)
(1.2–4.4)
(1.0–3.6)
(0.880–2.9)
(1.4–7.2)
(1.6–8.1)
(1.5–7.3)
(1.4–6.1)
(1.2–5.0)
(1.2–4.7)
(1.1–4.8)
(0.051–0.480)
(0.100–0.470)
(0.130–0.690)
(0.110–0.660)
(0.150–0.860)
(0.150–0.920)
(0.160–0.990)
(2.8–13)
(2.0–7.9)
(2.8–10)
(4.3–13)
(5.1–12)
(5.3–14)
(5.4–15)
(0.100–0.730)
(0.110–0.680)
(<0.01–1.1)
(0–1.6)
(<0.01–1.3)
(<0.01–1.4)
(<0.01–1.4)
(0.130–1.5)
(0.400–2.0)
(0.580–3.0)
(0.630–3.1)
(0.790–3.5)
(0.810–3.5)
(0.830–3.5)
(4.9–25)
(4.4–21)
(4.4–20)
(4.3–19)
(4.3–18)
(4.4–18)
(4.3–19)
(0.700–9.5)
(0.760–8.9)
(0.360–9.0)
(0.130–7.4)
(0.680–3.5)
(0.560–3.0)
(0.570–2.7)
(0.510–2.1)
(0.540–2.2)
(0.560–2.2)
(0.600–2.2)
(0.620–2.2)
(0.630–2.2)
(0.630–2.3)
(0.015–1.3)
(0.390–1.7)
(0.610–2.9)
(0.880–4.4)
(1.2–6.1)
(1.2–6.5)
(1.3–6.9)
(0.026–0.028)
(0.012–0.013)
(<0.01–<0.01)
(0.013–0.014)
(0.011–0.012)
(0.019–0.019)
(0.012–0.012)
(0.360–48)
(1.0–52)
(0.430–49)
(0.360–44)
(0.890–38)
(0.890–40)
(0.980–41)
(0.058–0.091)
(0.110–0.180)
(0.360–0.580)
(0.350–0.580)
(0.270–0.410)
(0.250–0.390)
(0.260–0.400)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

RATEa

49
48
41
29
20
18
18
41
57
81
78
51
46
44
36
38
36
39
46
49
51
36
32
27
19
10
8.6
6.9
62
54
44
34
25
24
23
21
22
28
23
27
28
29
30
16
19
23
20
21
22
22
19
16
10
14
17
17
29
51
54
50
48
47
46
114
82
69
56
48
47
46
40
37
28
18
12
9.9
9
15
13
12
11
9.3
9.1
9
19
39
57
73
88
91
93
2.5
1.1
0.68
1.1
0.94
1.5
0.97
98
101
75
58
51
51
53
5.2
8.8
24
23
15
14
14

(29–73)
(28–72)
(25–63)
(17–44)
(14–26)
(14–24)
(13–23)
(17–74)
(23–107)
(32–152)
(32–145)
(22–93)
(20–83)
(18–81)
(9.4–80)
(15–70)
(15–66)
(16–74)
(18–87)
(19–92)
(20–96)
(6.0–93)
(6.3–79)
(6.3–62)
(5.9–39)
(5.0–18)
(4.2–15)
(3.5–11)
(23–119)
(21–103)
(17–83)
(14–63)
(11–46)
(10–42)
(9.8–42)
(5.0–47)
(9.2–41)
(11–54)
(7.5–46)
(9.4–54)
(9.5–57)
(9.8–59)
(12–57)
(7.4–29)
(9.0–32)
(12–36)
(12–30)
(13–32)
(13–34)
(6.5–46)
(6.5–39)
(0.38–58)
(0–82)
(<0.1–66)
(0.20–67)
(0.18–68)
(6.0–71)
(19–97)
(20–104)
(19–94)
(20–88)
(20–86)
(20–84)
(43–220)
(33–154)
(28–127)
(24–103)
(21–88)
(20–85)
(19–84)
(7.4–101)
(7.6–90)
(3.2–80)
(1.0–57)
(4.5–23)
(3.6–19)
(3.6–17)
(6.4–26)
(6.0–24)
(5.5–21)
(5.0–19)
(4.4–16)
(4.4–16)
(4.3–15)
(0.76–65)
(17–71)
(23–106)
(28–140)
(33–170)
(34–175)
(34–181)
(2.4–2.6)
(1.1–1.2)
(0.67–0.70)
(1.1–1.1)
(0.93–0.95)
(1.5–1.6)
(0.96–0.98)
(2.6–357)
(6.4–323)
(2.3–270)
(1.7–208)
(3.7–160)
(3.6–161)
(3.9–163)
(4.1–6.4)
(6.9–11)
(19–31)
(17–28)
(12–19)
(11–18)
(11–18)

200
270
280
250
220
210
210
4
6.4
11
13
10
9.8
9.2
3.2
4
4.6
5.8
7.7
8.2
8.8
47
50
48
40
29
26
23
33
40
38
33
33
32
31
2.4
2.9
3.7
3.8
4.8
5
5.2
64
54
85
120
130
130
130
4.3
5.7
7.2
7.9
8.5
8.9
8.7
6.7
9.4
14
16
20
20
21
110
98
96
95
97
98
99
39
43
41
34
27
24
22
11
12
12
12
13
13
14
5.7
9.7
15
20
27
29
30
0.58
0.57
0.54
0.52
0.5
0.49
0.48
120
140
130
120
130
130
140
11
13
27
23
18
15
16

(140–290)
(200–370)
(210–370)
(190–320)
(170–270)
(170–260)
(170–250)
(2.0–6.6)
(3.1–11)
(5.2–19)
(6.0–21)
(5.0–17)
(4.7–17)
(4.3–16)
(1.2–6.2)
(2.0–6.6)
(2.3–7.7)
(2.9–9.7)
(3.8–13)
(4.1–14)
(4.4–15)
(12–110)
(15–110)
(17–96)
(17–72)
(15–48)
(13–44)
(11–41)
(15–58)
(19–68)
(18–64)
(16–57)
(16–54)
(16–54)
(16–53)
(0.860–4.8)
(1.4–5.0)
(1.8–6.2)
(1.7–6.6)
(2.3–8.1)
(2.4–8.5)
(2.5–8.9)
(32–110)
(29–85)
(46–140)
(65–200)
(65–200)
(68–210)
(71–210)
(1.6–8.2)
(2.4–10)
(2.4–15)
(1.3–20)
(2.5–18)
(2.8–18)
(2.7–18)
(2.2–14)
(4.6–16)
(6.7–24)
(7.7–26)
(9.8–33)
(10–34)
(10–35)
(50–190)
(48–170)
(47–160)
(48–160)
(49–160)
(50–160)
(50–160)
(12–80)
(16–81)
(13–85)
(10–72)
(14–45)
(12–40)
(11–36)
(6.0–18)
(6.5–18)
(6.7–19)
(7.0–20)
(7.3–21)
(7.4–21)
(7.6–22)
(1.1–14)
(4.7–17)
(7.3–24)
(9.9–35)
(13–47)
(13–50)
(14–52)
(0.220–1.1)
(0.290–0.950)
(0.270–0.910)
(0.260–0.870)
(0.250–0.830)
(0.250–0.820)
(0.240–0.810)
(7.5–370)
(17–400)
(10–390)
(12–350)
(25–320)
(26–330)
(28–340)
(5.1–18)
(5.7–23)
(9.8–53)
(6.5–51)
(6.3–36)
(5.3–31)
(6.1–29)

RATEa

426
480
429
331
250
237
224
419
592
898
908
663
612
563
350
372
373
404
455
472
490
320
301
257
188
121
106
92
556
505
429
350
299
287
274
237
256
290
264
300
306
312
272
196
273
345
306
305
299
267
323
387
409
425
439
424
321
453
482
475
493
494
495
946
729
609
522
461
452
442
412
427
365
262
182
156
140
138
131
117
105
94
94
92
283
417
536
651
756
775
794
55
51
46
43
41
40
39
863
897
701
576
541
544
553
751
770
1 430
1 160
834
699
688

(285–594)
(342–642)
(318–556)
(250–422)
(199–307)
(191–288)
(180–272)
(210–699)
(289–1 000)
(426–1 540)
(434–1 550)
(323–1 120)
(295–1 040)
(265–971)
(129–679)
(186–622)
(184–628)
(200–677)
(227–762)
(236–788)
(245–819)
(81–722)
(91–634)
(89–510)
(81–338)
(62–199)
(52–179)
(41–162)
(257–968)
(237–873)
(205–734)
(171–590)
(149–500)
(143–481)
(136–459)
(84–469)
(120–442)
(142–490)
(121–462)
(144–513)
(145–525)
(148–537)
(138–452)
(108–311)
(147–437)
(183–559)
(159–500)
(163–491)
(164–475)
(99–515)
(134–593)
(129–784)
(65–1 060)
(126–903)
(139–905)
(130–888)
(102–661)
(220–769)
(231–822)
(234–798)
(247–822)
(245–827)
(244–832)
(434–1 650)
(356–1 230)
(300–1 020)
(261–870)
(233–767)
(228–749)
(222–735)
(131–849)
(165–810)
(118–749)
(77–556)
(95–298)
(80–256)
(72–229)
(75–221)
(73–206)
(65–184)
(58–164)
(52–149)
(52–148)
(51–146)
(53–703)
(202–707)
(268–895)
(315–1 110)
(357–1 300)
(364–1 340)
(373–1 370)
(21–105)
(25–85)
(23–76)
(22–72)
(20–68)
(20–66)
(20–65)
(56–2 730)
(104–2 520)
(56–2 130)
(59–1 660)
(105–1 320)
(106–1 330)
(111–1 340)
(358–1 280)
(344–1 360)
(517–2 790)
(321–2 510)
(291–1 660)
(241–1 390)
(271–1 300)

INCIDENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

180
240
280
260
230
230
230
2.1
3.4
6.5
8.1
7.4
7.2
7
1.7
2.2
2.8
3.6
4.6
4.8
5.1
23
28
29
25
21
20
18
15
20
20
20
20
20
20
1.6
2
2.4
3
3.7
3.9
4
33
46
89
130
120
120
120
2.9
5.7
10
12
13
13
13
4.2
4.6
7
8.7
12
12
13
45
45
46
48
51
52
52
31
46
53
46
33
30
26
6
7.2
7.9
8.3
8.8
8.9
9
4.6
5.9
7.5
9.6
12
13
13
0.29
0.29
0.29
0.28
0.27
0.26
0.26
54
76
94
110
130
130
140
5.4
9.5
27
28
19
16
15

(100–270)
(140–360)
(170–420)
(150–390)
(170–310)
(170–300)
(170–290)
(1.7–2.5)
(2.8–4.1)
(5.3–7.7)
(6.7–9.6)
(6.1–8.8)
(5.9–8.6)
(5.8–8.3)
(1.0–2.5)
(1.8–2.6)
(2.3–3.3)
(2.9–4.3)
(3.8–5.5)
(4.0–5.7)
(4.2–6.0)
(10–40)
(16–44)
(18–41)
(19–33)
(18–24)
(17–22)
(16–21)
(12–18)
(16–23)
(17–24)
(17–24)
(17–24)
(17–24)
(17–24)
(1.1–2.2)
(1.6–2.4)
(2.0–2.9)
(2.5–3.6)
(3.0–4.4)
(3.2–4.6)
(3.3–4.8)
(28–37)
(43–50)
(84–95)
(120–140)
(120–130)
(120–130)
(110–120)
(2.2–3.8)
(5.0–6.4)
(9.0–12)
(10–14)
(11–14)
(11–15)
(11–15)
(2.6–6.2)
(3.7–5.5)
(5.7–8.4)
(7.1–10)
(9.6–14)
(10–15)
(11–15)
(37–54)
(37–54)
(38–55)
(39–57)
(42–61)
(43–62)
(43–62)
(22–41)
(38–55)
(44–63)
(38–54)
(31–35)
(27–32)
(24–28)
(5.8–6.3)
(6.9–7.6)
(7.6–8.3)
(7.9–8.7)
(8.4–9.2)
(8.5–9.3)
(8.5–9.4)
(2.8–6.8)
(4.8–7.0)
(6.1–9.0)
(7.9–12)
(10–15)
(10–15)
(11–16)
(0.180–0.430)
(0.240–0.350)
(0.240–0.350)
(0.230–0.330)
(0.220–0.320)
(0.220–0.310)
(0.210–0.310)
(8.5–140)
(24–160)
(41–170)
(63–170)
(90–180)
(93–180)
(96–190)
(4.3–6.6)
(7.5–12)
(21–33)
(22–35)
(15–23)
(13–20)
(12–18)

RATEa

367
419
421
342
269
258
247
221
315
527
586
475
450
428
185
204
225
248
273
279
284
155
167
152
119
86
79
72
248
249
234
211
188
183
178
158
174
192
211
233
238
242
139
169
286
359
298
288
272
184
323
553
639
633
632
630
199
219
242
266
293
299
304
391
335
293
262
242
238
234
326
462
467
354
219
191
163
76
80
77
69
63
62
60
228
251
277
305
337
344
350
28
26
24
23
22
21
21
401
478
513
524
544
548
552
379
575
1 410
1 390
867
723
655

Rates are per 100 000 population.

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

(218–553)
(249–633)
(251–636)
(203–516)
(191–359)
(191–335)
(183–321)
(182–263)
(260–375)
(435–627)
(484–698)
(392–566)
(372–536)
(354–510)
(114–273)
(167–245)
(184–271)
(203–298)
(226–325)
(230–331)
(234–337)
(69–275)
(93–263)
(97–220)
(88–154)
(75–97)
(69–89)
(63–82)
(204–295)
(205–297)
(193–279)
(173–251)
(155–224)
(151–219)
(146–213)
(108–217)
(142–209)
(157–230)
(173–254)
(192–278)
(196–283)
(200–289)
(121–159)
(155–184)
(267–305)
(339–380)
(286–311)
(276–300)
(261–283)
(135–240)
(283–367)
(484–626)
(535–752)
(553–719)
(551–717)
(550–716)
(123–293)
(179–263)
(197–290)
(218–320)
(242–349)
(247–356)
(251–362)
(322–466)
(276–400)
(241–349)
(216–313)
(199–288)
(196–284)
(193–280)
(230–438)
(383–548)
(387–554)
(292–421)
(203–236)
(177–206)
(151–176)
(72–80)
(76–84)
(74–81)
(66–73)
(60–66)
(59–65)
(57–63)
(140–336)
(205–302)
(226–333)
(250–367)
(277–402)
(283–410)
(288–418)
(17–41)
(21–31)
(20–29)
(19–28)
(18–26)
(18–25)
(17–25)
(62–1 050)
(153–985)
(227–914)
(298–811)
(377–741)
(380–747)
(383–753)
(300–468)
(456–709)
(1 110–1 730)
(1 100–1 720)
(686–1 070)
(573–891)
(524–800)

7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±

Niger

Nigeria

Rwanda

Sao Tome and
Principe

Senegal

Seychelles

Sierra Leone

South Africa

Swaziland

Togo

Uganda

United Republic
of Tanzania

Zambia

Zimbabwe

a

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

8
9
11
13
16
17
17
96
108
123
140
160
164
169
7
6
8
9
11
11
11
<1
<1
<1
<1
<1
<1
<1
8
9
10
11
13
13
14
<1
<1
<1
<1
<1
<1
<1
4
4
4
5
6
6
6
37
41
45
48
51
52
52
<1
<1
1
1
1
1
1
4
4
5
6
6
6
7
18
21
24
29
34
35
36
25
30
34
39
45
46
48
8
9
10
11
13
14
14
10
12
13
13
13
13
14

NUMBER
(THOUSANDS)

7.7
6.8
5
3.7
2.9
2.8
2.8
34
40
47
46
34
30
27
2.7
4.4
4.1
2
1.3
1.2
1.2
0.031
0.034
0.018
0.012
0.024
0.027
0.03
1.8
2.2
2.6
2.5
2.5
2.6
2.7
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
2.4
2
2.4
5.9
8.2
8.3
8.5
16
15
20
25
26
28
31
0.31
0.27
0.37
0.32
0.46
0.67
0.78
0.23
0.37
0.59
0.58
0.54
0.56
0.58
8.7
8.3
8.5
7.6
5.5
5.1
4.7
9.9
6.4
5.8
5.7
6.2
6.1
6.1
4.9
3.9
3.1
2.2
3.2
3.4
3.9
3.5
1.9
2.1
3.6
4
4.6
4.6

(2.9–15)
(2.5–13)
(2.0–9.5)
(1.5–6.8)
(1.3–5.2)
(1.2–5.0)
(1.2–5.1)
(0.019–180)
(0.250–170)
(0.077–230)
(0.084–220)
(3.1–100)
(2.0–93)
(1.6–86)
(1.1–5.1)
(1.7–8.4)
(1.6–7.7)
(0.880–3.7)
(0.610–2.3)
(0.580–2.1)
(0.530–2.1)
(<0.01–0.070)
(0.013–0.064)
(<0.01–0.032)
(<0.01–0.023)
(0.010–0.045)
(0.011–0.050)
(0.012–0.055)
(0.800–3.3)
(0.980–4.0)
(1.1–4.7)
(1.1–4.4)
(1.1–4.5)
(1.2–4.7)
(1.2–4.8)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.730–5.2)
(0.730–3.9)
(0.860–4.8)
(2.2–11)
(3.1–16)
(3.1–16)
(3.2–16)
(4.2–34)
(5.6–28)
(4.0–48)
(2.0–75)
(2.2–80)
(2.9–83)
(3.7–86)
(0.051–0.800)
(0.065–0.620)
(<0.01–1.4)
(<0.01–2.0)
(<0.01–2.3)
(0.015–2.5)
(0.031–2.7)
(0.100–0.410)
(0.160–0.670)
(0.250–1.1)
(0.250–1.0)
(0.230–0.970)
(0.240–1.0)
(0.250–1.0)
(<0.01–48)
(<0.01–46)
(0.055–37)
(0.660–23)
(1.0–14)
(0.960–13)
(0.820–12)
(3.8–19)
(2.2–13)
(1.9–12)
(2.7–9.8)
(3.3–10)
(3.3–9.8)
(3.2–9.9)
(1.5–10)
(1.1–8.3)
(0.940–6.5)
(0.450–5.4)
(0.970–6.8)
(1.1–7.0)
(1.4–7.7)
(0.068–13)
(0–15)
(0–16)
(<0.01–18)
(0.037–17)
(0.140–17)
(0.160–16)

RATEa

99
74
46
28
18
17
16
35
37
38
33
22
18
16
37
78
49
22
12
11
10
27
26
13
7.6
14
15
16
24
26
26
22
20
20
20
2
2
2
2.5
1.8
1.8
1.8
61
51
59
116
142
142
143
42
35
44
51
51
55
59
36
28
34
29
39
56
63
6.1
8.7
12
10
8.5
8.6
8.7
50
40
35
26
16
15
13
39
21
17
15
14
13
13
63
44
31
19
24
25
28
33
16
17
28
31
35
33

(37–191)
(28–143)
(18–86)
(12–51)
(8.0–33)
(7.4–30)
(6.8–30)
(<0.1–183)
(0.23–161)
(<0.1–185)
(<0.1–159)
(2.0–64)
(1.2–57)
(0.92–51)
(15–70)
(30–149)
(19–91)
(9.3–39)
(5.7–21)
(5.2–19)
(4.6–18)
(7.1–59)
(10–49)
(5.3–23)
(2.8–15)
(5.7–25)
(6.1–27)
(6.4–29)
(11–44)
(11–46)
(12–48)
(9.6–39)
(8.7–35)
(8.7–35)
(8.8–35)
(1.9–2.0)
(1.9–2.0)
(1.9–2.0)
(2.4–2.7)
(1.8–1.9)
(1.8–1.9)
(1.8–1.9)
(18–128)
(18–99)
(21–116)
(43–223)
(54–273)
(53–274)
(53–275)
(11–93)
(14–68)
(8.9–107)
(4.1–156)
(4.3–155)
(5.6–159)
(7.0–164)
(5.9–93)
(6.8–64)
(0.74–129)
(0–177)
(<0.1–196)
(1.3–208)
(2.5–219)
(2.7–11)
(3.8–16)
(5.0–22)
(4.5–19)
(3.7–15)
(3.8–15)
(3.8–15)
(<0.1–273)
(<0.1–223)
(0.23–151)
(2.3–79)
(3.0–40)
(2.7–36)
(2.3–33)
(15–74)
(7.3–43)
(5.6–35)
(6.9–25)
(7.4–22)
(7.1–21)
(6.8–21)
(19–132)
(13–93)
(9.4–64)
(3.9–47)
(7.4–51)
(8.0–52)
(9.8–55)
(0.65–128)
(0–125)
(0–129)
(<0.1–146)
(0.28–129)
(1.1–125)
(1.2–117)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

65
57
44
34
30
29
28
290
340
400
420
330
300
270
26
37
35
21
15
14
13
0.3
0.32
0.22
0.2
0.26
0.28
0.3
19
23
27
26
28
29
30
0.035
0.059
0.045
0.053
0.048
0.039
0.036
21
18
22
53
74
76
78
170
180
250
360
410
430
450
3.4
3.4
6.1
7.4
9
11
11
2.7
4
5.6
5.9
6.2
6.6
6.9
86
89
92
88
70
68
64
94
76
80
82
86
85
84
52
53
53
47
51
52
55
34
34
49
60
57
61
59

(30–110)
(26–99)
(21–75)
(17–57)
(15–50)
(14–49)
(14–48)
(0.550–1 400)
(4.9–1 300)
(2.6–1 700)
(4.2–1 700)
(62–830)
(49–760)
(43–710)
(13–44)
(17–64)
(17–59)
(11–35)
(7.9–24)
(7.2–22)
(7.0–21)
(0.110–0.590)
(0.160–0.530)
(0.093–0.410)
(0.070–0.390)
(0.130–0.450)
(0.140–0.470)
(0.150–0.500)
(9.4–31)
(12–39)
(14–45)
(13–44)
(14–47)
(14–49)
(15–50)
(<0.01–0.091)
(0.028–0.100)
(0.021–0.080)
(0.026–0.091)
(0.023–0.082)
(0.016–0.071)
(0.013–0.072)
(7.8–39)
(8.3–31)
(10–39)
(25–90)
(36–130)
(37–130)
(37–130)
(64–340)
(81–310)
(100–480)
(110–750)
(140–840)
(150–860)
(160–880)
(1.0–7.3)
(1.4–6.3)
(1.5–14)
(1.1–19)
(1.5–23)
(2.6–24)
(2.9–25)
(1.3–4.6)
(2.0–6.6)
(2.7–9.4)
(2.9–10)
(3.0–11)
(3.2–11)
(3.4–12)
(0.490–370)
(0.760–370)
(6.1–290)
(22–200)
(27–130)
(26–130)
(24–120)
(47–160)
(37–130)
(38–140)
(43–130)
(46–140)
(45–140)
(45–140)
(24–91)
(26–90)
(26–89)
(20–83)
(25–87)
(25–87)
(28–90)
(2.4–110)
(0.860–130)
(3.9–150)
(7.0–170)
(9.1–150)
(12–150)
(13–140)

RATEa

839
620
396
261
187
176
166
302
311
326
298
210
181
161
356
655
417
228
136
121
114
258
244
159
128
149
154
159
249
269
273
234
217
217
219
50
79
57
61
52
42
39
507
454
537
1 030
1 290
1 290
1 300
475
427
568
748
803
831
857
397
357
573
666
751
870
907
71
92
114
107
99
102
104
492
429
380
305
207
192
175
368
254
234
211
190
183
176
665
605
524
406
387
379
388
323
295
389
473
438
458
433

(388–1 460)
(283–1 080)
(189–678)
(130–436)
(94–312)
(88–294)
(83–277)
(0.58–1 440)
(4.5–1 230)
(2.1–1 400)
(3.0–1 220)
(39–521)
(30–464)
(25–420)
(173–603)
(305–1 130)
(205–701)
(120–370)
(73–219)
(65–196)
(61–183)
(96–499)
(122–408)
(67–291)
(46–253)
(72–252)
(76–258)
(80–264)
(125–414)
(135–448)
(137–453)
(116–393)
(106–366)
(106–366)
(108–368)
(7.7–131)
(37–135)
(26–100)
(29–104)
(25–90)
(17–78)
(14–78)
(194–968)
(211–788)
(245–940)
(491–1 750)
(624–2 180)
(625–2 200)
(626–2 220)
(173–925)
(195–747)
(225–1 070)
(234–1 560)
(266–1 630)
(289–1 650)
(305–1 680)
(116–847)
(149–653)
(145–1 290)
(104–1 730)
(130–1 900)
(213–1 970)
(232–2 030)
(34–122)
(46–155)
(56–193)
(52–181)
(47–169)
(49–174)
(51–176)
(2.8–2 140)
(3.6–1 800)
(25–1 200)
(76–689)
(80–392)
(74–366)
(67–334)
(185–611)
(123–430)
(113–399)
(111–341)
(102–306)
(97–295)
(95–283)
(308–1 160)
(299–1 020)
(256–885)
(177–727)
(186–659)
(185–640)
(197–642)
(23–1 000)
(7.4–1 090)
(31–1 180)
(55–1 320)
(70–1 140)
(93–1 110)
(92–1 030)

INCIDENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

28
25
21
19
18
18
18
120
150
210
240
210
190
180
21
29
27
17
11
11
9.8
0.16
0.16
0.16
0.16
0.17
0.17
0.17
10
13
15
16
18
18
19
0.03
0.03
0.029
0.029
0.028
0.028
0.027
8.4
8.3
11
26
38
39
40
110
130
260
450
500
520
530
2.3
3.2
8.5
13
15
16
17
1.8
2.5
3.5
4.2
4.6
4.7
4.9
110
110
100
87
71
68
65
58
68
80
83
80
78
79
56
70
72
65
61
61
60
31
56
91
100
83
81
77

(23–33)
(20–29)
(17–25)
(15–22)
(15–21)
(15–21)
(15–21)
(1.3–500)
(8.0–490)
(15–660)
(33–660)
(100–360)
(91–340)
(85–310)
(19–23)
(26–32)
(24–30)
(15–19)
(10–13)
(9.4–12)
(8.8–11)
(0.098–0.230)
(0.130–0.190)
(0.130–0.190)
(0.140–0.190)
(0.140–0.200)
(0.140–0.210)
(0.140–0.210)
(8.5–12)
(11–16)
(13–18)
(13–19)
(15–21)
(15–22)
(16–22)
(0.019–0.044)
(0.025–0.036)
(0.024–0.035)
(0.024–0.035)
(0.023–0.033)
(0.023–0.033)
(0.023–0.033)
(5.2–12)
(6.4–11)
(8.1–14)
(21–31)
(31–45)
(32–47)
(32–49)
(76–150)
(110–160)
(210–310)
(360–540)
(420–600)
(430–610)
(430–630)
(1.4–3.4)
(2.7–3.9)
(7.0–10)
(10–15)
(13–18)
(13–19)
(14–20)
(1.5–2.1)
(2.0–3.0)
(2.9–4.2)
(3.5–5.1)
(3.8–5.5)
(3.9–5.6)
(4.0–5.8)
(57–180)
(62–180)
(63–150)
(63–120)
(57–86)
(55–82)
(53–79)
(49–67)
(58–78)
(70–91)
(76–89)
(75–85)
(74–83)
(74–84)
(49–63)
(64–76)
(67–77)
(59–71)
(55–67)
(55–67)
(54–66)
(17–50)
(39–77)
(72–110)
(81–130)
(64–100)
(62–100)
(60–97)

RATEa

358
270
191
142
113
108
104
128
139
172
175
133
118
108
290
513
325
181
106
94
86
135
124
114
105
96
94
93
138
153
155
142
137
136
137
43
40
37
33
31
30
30
207
212
264
503
660
668
674
301
317
576
925
981
993
1 000
267
337
803
1 150
1 290
1 320
1 350
47
58
72
77
73
73
73
624
542
427
304
209
193
179
226
226
236
213
177
169
165
710
788
713
566
462
444
427
296
483
726
799
633
603
562

(295–426)
(223–321)
(157–227)
(118–170)
(94–135)
(90–129)
(86–124)
(1.3–526)
(7.4–456)
(12–536)
(23–476)
(64–225)
(55–204)
(50–186)
(259–323)
(458–571)
(290–362)
(162–202)
(94–118)
(84–105)
(77–96)
(83–199)
(102–149)
(93–137)
(88–123)
(79–115)
(78–113)
(76–111)
(114–164)
(126–183)
(128–184)
(117–169)
(113–163)
(112–162)
(113–163)
(27–64)
(33–48)
(30–44)
(27–40)
(25–37)
(25–36)
(24–35)
(128–305)
(162–269)
(196–341)
(410–605)
(540–791)
(542–807)
(540–821)
(206–413)
(259–381)
(471–691)
(756–1 110)
(809–1 170)
(819–1 180)
(827–1 190)
(165–394)
(275–405)
(657–964)
(938–1 380)
(1 060–1 530)
(1 090–1 570)
(1 110–1 610)
(39–56)
(48–69)
(59–86)
(63–91)
(60–87)
(60–87)
(60–87)
(328–1 010)
(297–860)
(259–636)
(220–402)
(169–253)
(156–234)
(145–216)
(193–261)
(193–261)
(207–268)
(197–229)
(166–189)
(159–180)
(154–175)
(624–801)
(719–861)
(661–767)
(519–615)
(418–509)
(401–489)
(385–470)
(159–476)
(335–658)
(573–897)
(634–984)
(489–795)
(466–757)
(434–706)

AFRICAN REGION

MORTALITY (EXCLUDING HIV)
YEAR

Rates are per 100 000 population.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

159

7$%/($,QFLGHQFHQRWLILFDWLRQDQGFDVHGHWHFWLRQUDWHVDOOIRUPV±
INCIDENCE (INCLUDING HIV)
YEAR

Algeria

Angola

Benin

Botswana

Burkina Faso

Burundi

Cameroon

Cape Verde

Central African
Republic

Chad

Comoros

Congo

Côte d'Ivoire

Democratic
Republic
of the Congo

Equatorial
Guinea

Eritrea

a
b

160

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

26
29
32
34
37
38
38
10
12
14
17
20
20
21
5
6
7
8
10
10
10
1
2
2
2
2
2
2
9
10
12
13
16
16
16
6
6
7
8
9
10
10
12
14
16
18
21
21
22
<1
<1
<1
<1
<1
<1
<1
3
3
4
4
4
4
5
6
7
8
10
12
12
12
<1
<1
<1
<1
<1
<1
<1
2
3
3
4
4
4
4
12
14
16
17
19
19
20
35
42
47
54
62
64
66
<1
<1
<1
<1
<1
<1
<1
3
3
4
5
6
6
6

NUMBER
(THOUSANDS)

17
20
28
31
33
34
34
21
27
35
46
59
62
66
6.4
6
6
6
6.5
6.8
7
7.4
14
16
14
9.9
9
8.2
7.6
8.3
8.2
8.4
9
9.1
9
9.1
20
19
15
13
13
13
14
29
49
57
56
51
52
0.62
0.67
0.71
0.73
0.71
0.71
0.71
25
39
39
27
19
18
17
5.6
9
13
15
18
18
19
0.22
0.21
0.21
0.22
0.23
0.24
0.25
4
6.7
11
15
16
16
17
29
54
60
46
36
37
34
110
140
150
180
200
210
210
0.3
0.35
0.52
0.66
0.94
1
1
8
6.7
6.2
5.9
5.8
5.7
5.7

(13–22)
(15–26)
(20–36)
(23–41)
(24–44)
(25–44)
(25–45)
(13–31)
(22–33)
(28–42)
(37–54)
(50–69)
(53–73)
(55–77)
(5.3–7.6)
(4.9–7.1)
(4.9–7.1)
(5.0–7.2)
(5.4–7.8)
(5.6–8.1)
(5.8–8.3)
(2.9–14)
(8.8–19)
(13–20)
(13–15)
(8.8–11)
(8.1–10)
(7.3–9.1)
(6.5–8.9)
(7.0–9.6)
(7.0–9.6)
(7.1–9.8)
(7.6–10)
(7.7–11)
(7.6–10)
(8.0–10)
(18–23)
(17–22)
(14–17)
(12–15)
(12–15)
(11–14)
(11–16)
(24–34)
(41–59)
(47–68)
(47–67)
(42–61)
(43–61)
(0.380–0.910)
(0.550–0.800)
(0.580–0.850)
(0.600–0.880)
(0.590–0.850)
(0.590–0.850)
(0.590–0.850)
(21–30)
(32–47)
(32–46)
(23–33)
(16–22)
(15–21)
(14–20)
(4.7–6.7)
(7.4–11)
(10–15)
(12–18)
(15–21)
(15–22)
(16–22)
(0.180–0.270)
(0.180–0.250)
(0.170–0.250)
(0.180–0.260)
(0.190–0.270)
(0.200–0.290)
(0.200–0.290)
(2.5–5.9)
(5.4–8.0)
(9.3–13)
(12–18)
(13–19)
(13–20)
(14–20)
(25–33)
(47–62)
(52–68)
(40–53)
(31–41)
(32–42)
(30–39)
(92–140)
(110–160)
(130–180)
(150–200)
(180–230)
(180–240)
(190–250)
(0.260–0.340)
(0.310–0.400)
(0.460–0.590)
(0.580–0.750)
(0.830–1.1)
(0.890–1.1)
(0.900–1.2)
(5.3–11)
(4.5–9.5)
(4.1–8.7)
(3.9–8.2)
(3.8–8.1)
(3.8–8.1)
(3.8–8.0)

RATEa

66
68
87
93
90
90
89
205
226
250
276
304
310
316
128
100
86
74
69
70
70
533
855
918
733
503
455
408
87
82
71
62
58
57
54
162
321
288
198
144
139
130
112
206
310
312
274
243
238
175
168
160
153
147
145
144
861
1 200
1 070
690
433
400
367
95
128
151
150
151
151
151
54
46
39
36
33
34
34
169
245
353
425
391
387
381
238
379
369
267
190
191
172
327
327
327
327
327
327
327
80
80
101
110
135
142
139
243
198
157
121
100
97
93

(48–86)
(50–89)
(64–114)
(68–121)
(66–118)
(66–117)
(65–117)
(127–303)
(185–272)
(204–300)
(227–329)
(256–355)
(261–362)
(266–369)
(106–152)
(82–118)
(71–102)
(61–88)
(57–82)
(58–83)
(58–83)
(212–997)
(553–1 220)
(736–1 120)
(667–802)
(449–560)
(406–507)
(364–454)
(73–101)
(70–95)
(60–83)
(53–73)
(49–67)
(48–66)
(46–63)
(143–183)
(283–362)
(254–325)
(174–223)
(127–163)
(122–157)
(114–147)
(92–133)
(170–246)
(255–369)
(258–372)
(226–327)
(200–290)
(197–283)
(108–259)
(137–201)
(131–193)
(125–184)
(121–175)
(120–173)
(119–172)
(710–1 030)
(988–1 430)
(884–1 280)
(569–822)
(357–515)
(330–477)
(302–438)
(78–112)
(106–153)
(125–180)
(124–178)
(125–179)
(125–179)
(125–180)
(44–64)
(38–55)
(32–46)
(30–43)
(28–40)
(28–41)
(28–41)
(104–250)
(200–294)
(298–412)
(347–510)
(320–470)
(317–465)
(311–458)
(206–272)
(329–433)
(320–422)
(232–306)
(165–217)
(165–218)
(149–198)
(262–398)
(268–392)
(273–385)
(279–379)
(282–375)
(282–375)
(282–375)
(70–91)
(70–90)
(88–114)
(96–124)
(119–153)
(124–161)
(122–158)
(162–341)
(132–278)
(104–220)
(80–169)
(67–140)
(64–136)
(62–131)

INCIDENCE HIV-POSITIVE
NUMBER
(THOUSANDS)

RATEa

<0.01
<0.01
0.025
0.057
0.08
0.085
0.086
0.51
1.3
2.5
4
5.3
5.3
5.5
2.1
1.9
1.5
1.2
0.99
1
1
1.5
7.2
11
9.3
6.3
5.7
5.1
2.9
3.3
2.8
2.3
1.8
1.7
1.6
1.6
6.7
7.4
4.8
3
2.8
2.5
0.71
5.5
17
22
21
19
19
0.039
0.057
0.071
0.074
0.067
0.068
0.071
9.8
18
18
11
6.3
5.8
5.3
0.69
1.8
3.1
3.7
3.6
3.8
4.1

(<0.01–<0.01)
(<0.01–<0.01)
(0.018–0.032)
(0.042–0.074)
(0.059–0.10)
(0.062–0.11)
(0.063–0.11)
(0.31–0.75)
(1.1–1.5)
(2.0–3.0)
(3.3–4.8)
(4.5–6.2)
(4.5–6.2)
(4.7–6.5)
(1.7–2.4)
(1.5–2.2)
(1.3–1.8)
(1.0–1.5)
(0.82–1.2)
(0.84–1.2)
(0.84–1.2)
(0.58–2.7)
(4.7–10)
(9.0–14)
(8.4–10)
(5.6–7.0)
(5.1–6.3)
(4.5–5.6)
(2.5–3.4)
(2.8–3.8)
(2.4–3.3)
(2.0–2.7)
(1.5–2.1)
(1.4–1.9)
(1.3–1.8)
(1.4–1.8)
(5.9–7.5)
(6.5–8.3)
(4.3–5.5)
(2.7–3.4)
(2.4–3.1)
(2.2–2.8)
(0.58–0.84)
(4.6–6.6)
(14–20)
(18–26)
(18–25)
(16–23)
(16–23)
(0.024–0.058)
(0.046–0.069)
(0.057–0.085)
(0.060–0.089)
(0.055–0.081)
(0.055–0.081)
(0.058–0.086)
(8.1–12)
(15–21)
(15–21)
(9.4–14)
(5.2–7.5)
(4.8–6.9)
(4.4–6.4)
(0.57–0.83)
(1.5–2.2)
(2.5–3.6)
(3.1–4.4)
(2.9–4.2)
(3.2–4.6)
(3.4–4.8)

<0.1
<0.1
<0.1
0.2
0.2
0.2
0.2
4.9
11
18
24
27
26
27
41
31
22
15
10
10
10
105
456
638
494
321
285
253
33
32
25
17
11
10
9.5
28
107
110
62
33
29
25
5.8
40
105
121
103
91
88
11
14
16
15
14
14
14
336
549
492
287
145
131
118
12
26
37
37
30
32
33

(0–<0.1)
(<0.1–<0.1)
(<0.1–0.10)
(0.12–0.22)
(0.16–0.28)
(0.16–0.29)
(0.16–0.29)
(3.0–7.2)
(8.7–13)
(14–21)
(20–29)
(23–32)
(22–31)
(22–31)
(34–49)
(26–37)
(18–26)
(12–18)
(8.6–12)
(8.6–12)
(8.3–12)
(42–196)
(295–651)
(511–777)
(449–541)
(286–357)
(254–317)
(226–281)
(28–38)
(27–37)
(21–29)
(15–20)
(9.7–13)
(8.9–12)
(8.0–11)
(25–31)
(94–121)
(97–124)
(55–70)
(29–37)
(26–33)
(22–28)
(4.8–7.0)
(33–47)
(87–126)
(100–145)
(85–123)
(75–109)
(73–104)
(6.8–16)
(12–17)
(13–19)
(12–19)
(11–17)
(11–17)
(12–17)
(277–400)
(453–654)
(406–587)
(237–342)
(119–172)
(108–156)
(97–141)
(9.7–14)
(22–31)
(31–44)
(31–44)
(25–36)
(26–38)
(27–39)

<0.01
<0.01
0.01
0.94
2.1
3.2
3.8
3.4
3.5
3.6
8.3
21
25
17
9.4
9.5
8.8
8.1
12
14
16
16
17
16
0.014
0.028
0.062
0.11
0.18
0.2
0.2
0.15
0.4
0.97
1.1
0.8
0.79
0.73

(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.012)
(0.58–1.4)
(1.7–2.5)
(2.7–3.7)
(3.1–4.6)
(2.8–4.1)
(2.8–4.2)
(2.9–4.3)
(7.2–9.5)
(19–24)
(22–28)
(15–19)
(8.2–11)
(8.3–11)
(7.6–10)
(6.5–9.9)
(9.7–14)
(12–17)
(14–19)
(14–19)
(14–19)
(14–19)
(0.012–0.016)
(0.024–0.032)
(0.054–0.071)
(0.095–0.12)
(0.16–0.21)
(0.18–0.23)
(0.17–0.23)
(0.098–0.21)
(0.27–0.56)
(0.64–1.4)
(0.72–1.5)
(0.53–1.1)
(0.53–1.1)
(0.49–1.0)

0.1
0.5
1.4
40
76
102
108
83
82
83
68
151
154
98
50
49
44
23
28
30
30
26
26
25
3.7
6.3
12
18
26
29
27
4.5
12
25
22
14
13
12

(<0.1–0.13)
(0.45–0.65)
(1.2–1.7)
(24–58)
(62–91)
(86–119)
(88–130)
(68–100)
(67–98)
(68–100)
(59–78)
(131–172)
(134–177)
(85–112)
(43–57)
(43–56)
(38–51)
(19–28)
(23–34)
(25–35)
(25–34)
(23–30)
(22–30)
(22–29)
(3.2–4.2)
(5.5–7.1)
(11–14)
(16–20)
(23–30)
(25–32)
(24–31)
(3.0–6.3)
(7.8–16)
(16–34)
(15–31)
(9.3–20)
(8.9–19)
(7.9–17)

NOTIFIED NEW AND RELAPSEb

CASE DETECTION

NUMBER

RATEa

PERCENT

11 607
13 507
18 572
21 336
22 336
21 429
21 880
10 271
5 143
16 062
37 175
44 655
47 240
51 819
2 074
2 400
2 697
3 270
3 756
4 212
3 966
2 938
5 665
9 292
10 058
7 013
6 603
6 161
1 497
2 572
2 331
3 478
4 800
5 286
5 210
4 575
3 326
6 421
6 585
7 611
6 742
6 921
5 892
3 292
5 251
21 499
24 073
24 533
24 802
221
303

44
46
59
63
60
57
57
99
42
115
225
228
234
249
41
40
39
40
39
43
39
212
358
529
536
356
332
307
17
25
20
26
31
33
32
82
54
96
85
82
71
70
49
24
33
119
117
116
114
63
76

67
68
67
68
67
63
64
48
19
46
82
75
76
79
32
40
45
54
57
62
57
40
42
58
73
71
73
75
20
31
28
41
54
58
58
50
17
33
43
57
51
54
44
11
11
38
43
48
48
36
45

(52–92)
(52–92)
(52–92)
(52–92)
(51–91)
(48–87)
(49–87)
(33–78)
(16–23)
(38–56)
(68–99)
(64–89)
(65–90)
(67–94)
(27–39)
(34–49)
(38–55)
(46–66)
(48–69)
(52–75)
(48–68)
(21–100)
(29–65)
(47–72)
(67–80)
(64–79)
(66–82)
(68–84)
(17–23)
(27–37)
(24–33)
(36–49)
(46–63)
(50–68)
(50–69)
(45–57)
(15–19)
(30–38)
(38–49)
(51–65)
(45–58)
(48–62)
(37–53)
(9.6–14)
(8.9–13)
(32–46)
(36–52)
(40–58)
(40–58)
(24–58)
(38–55)

292
356
380
420
2 124
3 339

61
73
77
85
73
102

40
50
53
59
8.5
8.5

(33–49)
(42–60)
(45–65)
(49–72)
(7.1–10)
(7.1–10)

3 210
6 643
5 611
8 084
2 591
3 186

81
153
126
179
44
46

12
35
32
49
46
36

(9.9–14)
(30–43)
(27–38)
(41–59)
(39–56)
(30–43)

6 311
9 452
10 505
10 585
140
123
120
111

63
81
87
85
34
26
23
18

42
53
58
56
63
58
58
51

(35–51)
(45–65)
(48–70)
(47–68)
(53–76)
(48–70)
(49–71)
(43–62)

117
120
591
3 615
9 239
9 853
10 150
10 975
11 303
7 841
11 988
15 094
19 681
22 708
22 476
23 762
21 131
42 819
61 024
97 075
114 170
110 132
108 984
260
306

17
17
25
133
296
278
247
260
261
65
84
94
113
120
116
120
61
102
130
180
184
172
166
70
69

49
49
15
54
84
66
63
67
68
27
22
25
42
63
61
69
19
31
40
55
56
53
51
87
87

(41–59)
(41–59)
(9.9–24)
(45–66)
(72–99)
(55–80)
(53–77)
(56–82)
(57–84)
(24–31)
(19–26)
(22–29)
(37–49)
(55–73)
(53–70)
(61–81)
(15–23)
(26–38)
(34–48)
(47–64)
(49–65)
(46–61)
(44–59)
(77–99)
(77–99)

820
883

118
123

87 (77–99)
87 (77–99)

3 699
21 453
6 652
3 585
2 870
3 049
3 143

113
630
169
74
50
51
51

46
320
110
61
50
53
55

Rates are per 100 000 population.
NOTIFIED NEW AND RELAPSE includes cases for which the treatment history is unknown.

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

(33–70)
(230–480)
(77–160)
(44–92)
(36–75)
(38–80)
(39–83)

7$%/($,QFLGHQFHQRWLILFDWLRQDQGFDVHGHWHFWLRQUDWHVDOOIRUPV±

Ethiopia

Gabon

Gambia

Ghana

Guinea

Guinea-Bissau

Kenya

Lesotho

Liberia

Madagascar

Malawi

Mali

Mauritania

Mauritius

Mozambique

Namibia

a
b

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

48
57
66
76
87
89
92
<1
1
1
1
2
2
2
<1
1
1
1
2
2
2
15
17
19
21
24
25
25
6
8
9
10
11
11
11
1
1
1
1
2
2
2
23
27
31
36
41
42
43
2
2
2
2
2
2
2
2
2
3
3
4
4
4
12
13
16
18
21
22
22
9
10
11
13
15
15
16
8
9
10
12
14
14
15
2
2
3
3
4
4
4
1
1
1
1
1
1
1
14
16
18
21
24
25
25
1
2
2
2
2
2
2

NUMBER
(THOUSANDS)

180
240
280
260
230
230
230
2.1
3.4
6.5
8.1
7.4
7.2
7
1.7
2.2
2.8
3.6
4.6
4.8
5.1
23
28
29
25
21
20
18
15
20
20
20
20
20
20
1.6
2
2.4
3
3.7
3.9
4
33
46
89
130
120
120
120
2.9
5.7
10
12
13
13
13
4.2
4.6
7
8.7
12
12
13
45
45
46
48
51
52
52
31
46
53
46
33
30
26
6
7.2
7.9
8.3
8.8
8.9
9
4.6
5.9
7.5
9.6
12
13
13
0.29
0.29
0.29
0.28
0.27
0.26
0.26
54
76
94
110
130
130
140
5.4
9.5
27
28
19
16
15

(100–270)
(140–360)
(170–420)
(150–390)
(170–310)
(170–300)
(170–290)
(1.7–2.5)
(2.8–4.1)
(5.3–7.7)
(6.7–9.6)
(6.1–8.8)
(5.9–8.6)
(5.8–8.3)
(1.0–2.5)
(1.8–2.6)
(2.3–3.3)
(2.9–4.3)
(3.8–5.5)
(4.0–5.7)
(4.2–6.0)
(10–40)
(16–44)
(18–41)
(19–33)
(18–24)
(17–22)
(16–21)
(12–18)
(16–23)
(17–24)
(17–24)
(17–24)
(17–24)
(17–24)
(1.1–2.2)
(1.6–2.4)
(2.0–2.9)
(2.5–3.6)
(3.0–4.4)
(3.2–4.6)
(3.3–4.8)
(28–37)
(43–50)
(84–95)
(120–140)
(120–130)
(120–130)
(110–120)
(2.2–3.8)
(5.0–6.4)
(9.0–12)
(10–14)
(11–14)
(11–15)
(11–15)
(2.6–6.2)
(3.7–5.5)
(5.7–8.4)
(7.1–10)
(9.6–14)
(10–15)
(11–15)
(37–54)
(37–54)
(38–55)
(39–57)
(42–61)
(43–62)
(43–62)
(22–41)
(38–55)
(44–63)
(38–54)
(31–35)
(27–32)
(24–28)
(5.8–6.3)
(6.9–7.6)
(7.6–8.3)
(7.9–8.7)
(8.4–9.2)
(8.5–9.3)
(8.5–9.4)
(2.8–6.8)
(4.8–7.0)
(6.1–9.0)
(7.9–12)
(10–15)
(10–15)
(11–16)
(0.180–0.430)
(0.240–0.350)
(0.240–0.350)
(0.230–0.330)
(0.220–0.320)
(0.220–0.310)
(0.210–0.310)
(8.5–140)
(24–160)
(41–170)
(63–170)
(90–180)
(93–180)
(96–190)
(4.3–6.6)
(7.5–12)
(21–33)
(22–35)
(15–23)
(13–20)
(12–18)

a

RATE

367
419
421
342
269
258
247
221
315
527
586
475
450
428
185
204
225
248
273
279
284
155
167
152
119
86
79
72
248
249
234
211
188
183
178
158
174
192
211
233
238
242
139
169
286
359
298
288
272
184
323
553
639
633
632
630
199
219
242
266
293
299
304
391
335
293
262
242
238
234
326
462
467
354
219
191
163
76
80
77
69
63
62
60
228
251
277
305
337
344
350
28
26
24
23
22
21
21
401
478
513
524
544
548
552
379
575
1 410
1 390
867
723
655

(218–553)
(249–633)
(251–636)
(203–516)
(191–359)
(191–335)
(183–321)
(182–263)
(260–375)
(435–627)
(484–698)
(392–566)
(372–536)
(354–510)
(114–273)
(167–245)
(184–271)
(203–298)
(226–325)
(230–331)
(234–337)
(69–275)
(93–263)
(97–220)
(88–154)
(75–97)
(69–89)
(63–82)
(204–295)
(205–297)
(193–279)
(173–251)
(155–224)
(151–219)
(146–213)
(108–217)
(142–209)
(157–230)
(173–254)
(192–278)
(196–283)
(200–289)
(121–159)
(155–184)
(267–305)
(339–380)
(286–311)
(276–300)
(261–283)
(135–240)
(283–367)
(484–626)
(535–752)
(553–719)
(551–717)
(550–716)
(123–293)
(179–263)
(197–290)
(218–320)
(242–349)
(247–356)
(251–362)
(322–466)
(276–400)
(241–349)
(216–313)
(199–288)
(196–284)
(193–280)
(230–438)
(383–548)
(387–554)
(292–421)
(203–236)
(177–206)
(151–176)
(72–80)
(76–84)
(74–81)
(66–73)
(60–66)
(59–65)
(57–63)
(140–336)
(205–302)
(226–333)
(250–367)
(277–402)
(283–410)
(288–418)
(17–41)
(21–31)
(20–29)
(19–28)
(18–26)
(18–25)
(17–25)
(62–1 050)
(153–985)
(227–914)
(298–811)
(377–741)
(380–747)
(383–753)
(300–468)
(456–709)
(1 110–1 730)
(1 100–1 720)
(686–1 070)
(573–891)
(524–800)

INCIDENCE HIV-POSITIVE
NUMBER
(THOUSANDS)

11
36
61
54
30
27
23
0.12
0.47
1.6
2.5
2.1
2
1.9
0.023
0.071
0.2
0.47
0.78
0.77
0.76
1.7
4.2
5.9
5.4
3.7
3.3
2.8
1.1
2.8
4.1
4.5
3.8
3.7
3.7
0.08
0.23
0.55
1
1.3
1.4
1.6
3.6
19
47
64
51
49
45
0.083
2.2
7.6
10
9.7
9.5
9.9
0.095
0.31
0.8
1
0.91
0.83
0.76
0.34
0.55
0.73
0.77
0.7
0.67
0.64
13
29
37
33
21
19
16
0.59
1.2
1.6
1.6
1.3
1.3
1.2
0.05
0.1
0.17
0.27
0.44
0.5
0.57
<0.01
<0.01
0.011
0.017
0.016
0.015
0.014
0.84
15
41
61
78
81
83
0.48
2.8
15
19
11
8.7
7.3

(6.3–16)
(22–55)
(36–92)
(32–81)
(21–40)
(20–35)
(17–30)
(0.096–0.14)
(0.39–0.56)
(1.3–1.9)
(2.0–2.9)
(1.7–2.5)
(1.6–2.4)
(1.5–2.2)
(0.014–0.033)
(0.058–0.085)
(0.16–0.24)
(0.38–0.56)
(0.65–0.93)
(0.64–0.91)
(0.63–0.90)
(0.74–2.9)
(2.3–6.6)
(3.8–8.6)
(4.0–7.0)
(3.2–4.2)
(2.9–3.7)
(2.4–3.1)
(0.90–1.3)
(2.3–3.3)
(3.3–4.8)
(3.7–5.4)
(3.2–4.6)
(3.1–4.5)
(3.0–4.4)
(0.054–0.11)
(0.19–0.27)
(0.45–0.66)
(0.84–1.2)
(1.1–1.5)
(1.2–1.7)
(1.3–1.9)
(3.1–4.1)
(18–21)
(44–50)
(60–67)
(49–53)
(47–51)
(44–47)
(0.061–0.11)
(1.9–2.5)
(6.6–8.6)
(8.3–12)
(8.5–11)
(8.3–11)
(8.7–11)
(0.058–0.14)
(0.25–0.38)
(0.65–0.98)
(0.83–1.3)
(0.73–1.1)
(0.67–1.0)
(0.61–0.93)
(0.28–0.40)
(0.46–0.66)
(0.60–0.87)
(0.64–0.92)
(0.57–0.83)
(0.55–0.80)
(0.53–0.77)
(9.5–18)
(24–34)
(31–44)
(27–39)
(20–23)
(18–21)
(15–17)
(0.56–0.62)
(1.2–1.3)
(1.6–1.7)
(1.5–1.7)
(1.3–1.4)
(1.2–1.4)
(1.2–1.3)
(0.031–0.074)
(0.083–0.12)
(0.14–0.20)
(0.22–0.32)
(0.36–0.53)
(0.41–0.60)
(0.47–0.68)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.013)
(0.014–0.021)
(0.013–0.020)
(0.013–0.018)
(0.011–0.017)
(0.13–2.2)
(4.8–31)
(18–74)
(35–94)
(54–110)
(56–110)
(58–110)
(0.38–0.59)
(2.2–3.4)
(12–19)
(15–23)
(8.3–13)
(6.9–11)
(5.8–8.9)

a

RATE

22
64
93
71
35
30
25
12
44
132
178
136
125
115
2.5
6.7
16
33
47
44
42
11
25
31
25
15
13
11
18
35
46
47
35
33
32
7.8
20
43
73
81
88
94
15
70
151
177
124
116
105
5.2
125
408
517
483
467
485
4.5
15
28
32
23
20
18
2.9
4.1
4.6
4.2
3.3
3.1
2.9
143
291
329
256
142
125
100
7.4
14
16
13
9.4
8.9
8.2
2.5
4.4
6.3
8.4
12
14
15
<0.1
0.3
0.9
1.4
1.3
1.2
1.1
6.2
94
227
290
327
331
330
34
168
798
932
483
391
323

(13–33)
(38–97)
(55–140)
(42–107)
(25–46)
(22–39)
(19–33)
(10–15)
(36–52)
(108–157)
(146–212)
(112–162)
(103–149)
(95–137)
(1.5–3.6)
(5.5–8.0)
(13–19)
(27–39)
(39–56)
(37–53)
(35–50)
(5.0–20)
(14–39)
(20–46)
(19–33)
(13–17)
(12–15)
(9.6–12)
(15–22)
(29–42)
(38–55)
(39–56)
(29–42)
(28–40)
(27–39)
(5.3–11)
(16–24)
(35–52)
(59–87)
(67–97)
(73–105)
(77–112)
(13–17)
(64–76)
(141–161)
(168–188)
(119–129)
(111–121)
(101–109)
(3.8–6.8)
(109–142)
(357–462)
(433–608)
(422–549)
(408–531)
(423–550)
(2.8–6.7)
(12–18)
(22–34)
(25–38)
(18–28)
(16–25)
(15–22)
(2.4–3.5)
(3.4–4.9)
(3.8–5.5)
(3.5–5.0)
(2.7–3.9)
(2.6–3.7)
(2.4–3.4)
(101–192)
(241–345)
(273–391)
(211–305)
(132–153)
(116–135)
(93–108)
(7.0–7.8)
(13–14)
(15–17)
(13–14)
(9.0–9.9)
(8.5–9.4)
(7.8–8.6)
(1.5–3.7)
(3.6–5.2)
(5.1–7.5)
(6.9–10)
(10–15)
(11–16)
(12–18)
(<0.1–<0.1)
(0.24–0.35)
(0.74–1.1)
(1.2–1.7)
(1.1–1.6)
(1.0–1.5)
(0.92–1.3)
(0.97–16)
(30–194)
(100–404)
(165–449)
(227–446)
(229–451)
(228–450)
(27–41)
(133–207)
(631–983)
(738–1 150)
(383–596)
(310–482)
(258–394)

NOTIFIED NEW AND RELAPSE
NUMBER

a

b

CASE DETECTION

RATE

PERCENT

88 634
26 034
91 101
124 262
154 694
156 539
145 323
917
1 115

184
46
138
163
178
175
158
97
103

50
11
33
48
66
68
64
44
33

(33–85)
(7.2–18)
(22–55)
(32–80)
(49–93)
(52–91)
(49–87)
(37–53)
(28–40)

2 512
3 790
4 404
4 929

182
244
276
302

31
51
61
71

(26–38)
(43–62)
(52–74)
(59–85)

1 023
1 553
2 031
1 989
2 302
2 333
6 407
8 636
10 933
12 124
14 607
15 389
14 753
1 988
3 523
5 440
6 863
11 038
11 359
11 407
1 163
1 613
1 273
1 774
2 183
2 063
1 939
11 788
28 142
64 159
102 680
99 272
97 320
92 987
2 525
5 181
9 746
10 802
11 674
11 561
10 776

96
126
141
118
133
130
44
52
58
57
60
62
58
33
45
62
72
101
102
100
114
142
100
125
138
127
117
50
103
205
287
243
232
215
158
295
525
561
581
570
525

47
56
57
43
48
46
28
31
38
48
70
79
81
13
18
27
34
54
55
56
73
81
52
59
59
53
48
36
61
72
80
81
80
79
86
91
95
88
92
90
83

(39–57)
(47–69)
(47–70)
(36–52)
(40–58)
(39–56)
(16–63)
(20–55)
(26–60)
(37–64)
(62–80)
(70–90)
(71–92)
(11–16)
(15–22)
(22–32)
(29–41)
(45–66)
(47–67)
(47–68)
(53–110)
(68–100)
(43–64)
(49–72)
(50–72)
(45–65)
(40–58)
(32–41)
(56–66)
(67–77)
(76–85)
(78–85)
(77–84)
(76–83)
(66–120)
(81–100)
(84–110)
(75–100)
(81–110)
(79–100)
(73–95)

1 393
1 500
3 432
6 597
7 906
8 093
6 261
21 616

67
52
105
167
194
193
54
161

31
21
39
57
65
64
14
48

(25–37)
(18–26)
(33–48)
(48–69)
(54–79)
(53–77)
(12–17)
(40–58)

18 993
24 432
26 019
25 782
12 395
19 155
23 604
25 491
21 092
19 361
20 335
2 933
3 087
4 216
4 704
5 291
5 428
5 446
5 284
3 849
3 067
2 162
2 461
1 804
2 616
119
131
160
125
122
114
128
15 899
17 882
21 158
33 231
43 558
44 627
47 741
2 671
1 540
10 799
14 920
11 281
10 806
10 003

104
116
120
116
131
192
208
197
140
125
128
37
34
41
39
38
38
37
261
165
113
69
68
49
69
11
12
14
10
9.9
9.2
10
117
112
116
158
182
182
189
189
93
569
736
518
487
443

40
48
50
49
40
42
45
56
64
66
78
49
43
53
57
60
61
61
110
66
41
22
20
14
20
41
45
55
45
46
43
49
29
23
23
30
33
33
34
50
16
40
53
60
67
68

(33–48)
(40–58)
(42–61)
(41–60)
(30–57)
(35–50)
(38–54)
(47–68)
(59–69)
(61–71)
(73–85)
(46–51)
(41–45)
(51–56)
(54–60)
(57–63)
(58–64)
(58–64)
(78–190)
(55–80)
(34–50)
(19–28)
(17–25)
(12–17)
(16–24)
(28–66)
(37–55)
(46–68)
(37–55)
(39–56)
(36–53)
(41–60)
(11–190)
(11–73)
(13–51)
(20–53)
(25–48)
(24–48)
(25–50)
(40–63)
(13–20)
(33–51)
(43–67)
(48–75)
(55–85)
(55–84)

AFRICAN REGION

INCIDENCE (INCLUDING HIV)
YEAR

Rates are per 100 000 population.
NOTIFIED NEW AND RELAPSE includes cases for which the treatment history is unknown.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

161

7$%/($,QFLGHQFHQRWLILFDWLRQDQGFDVHGHWHFWLRQUDWHVDOOIRUPV±
INCIDENCE (INCLUDING HIV)
YEAR

Niger

Nigeria

Rwanda

Sao Tome and
Principe

Senegal

Seychelles

Sierra Leone

South Africa

Swaziland

Togo

Uganda

United Republic
of Tanzania

Zambia

Zimbabwe

162

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

NUMBER
(THOUSANDS)

POPULATION
(MILLIONS)

8
9
11
13
16
17
17
96
108
123
140
160
164
169
7
6
8
9
11
11
11
<1
<1
<1
<1
<1
<1
<1
8
9
10
11
13
13
14
<1
<1
<1
<1
<1
<1
<1
4
4
4
5
6
6
6
37
41
45
48
51
52
52
<1
<1
1
1
1
1
1
4
4
5
6
6
6
7
18
21
24
29
34
35
36
25
30
34
39
45
46
48
8
9
10
11
13
14
14
10
12
13
13
13
13
14

28
25
21
19
18
18
18
120
150
210
240
210
190
180
21
29
27
17
11
11
9.8
0.16
0.16
0.16
0.16
0.17
0.17
0.17
10
13
15
16
18
18
19
0.03
0.03
0.029
0.029
0.028
0.028
0.027
8.4
8.3
11
26
38
39
40
110
130
260
450
500
520
530
2.3
3.2
8.5
13
15
16
17
1.8
2.5
3.5
4.2
4.6
4.7
4.9
110
110
100
87
71
68
65
58
68
80
83
80
78
79
56
70
72
65
61
61
60
31
56
91
100
83
81
77

(23–33)
(20–29)
(17–25)
(15–22)
(15–21)
(15–21)
(15–21)
(1.3–500)
(8.0–490)
(15–660)
(33–660)
(100–360)
(91–340)
(85–310)
(19–23)
(26–32)
(24–30)
(15–19)
(10–13)
(9.4–12)
(8.8–11)
(0.098–0.230)
(0.130–0.190)
(0.130–0.190)
(0.140–0.190)
(0.140–0.200)
(0.140–0.210)
(0.140–0.210)
(8.5–12)
(11–16)
(13–18)
(13–19)
(15–21)
(15–22)
(16–22)
(0.019–0.044)
(0.025–0.036)
(0.024–0.035)
(0.024–0.035)
(0.023–0.033)
(0.023–0.033)
(0.023–0.033)
(5.2–12)
(6.4–11)
(8.1–14)
(21–31)
(31–45)
(32–47)
(32–49)
(76–150)
(110–160)
(210–310)
(360–540)
(420–600)
(430–610)
(430–630)
(1.4–3.4)
(2.7–3.9)
(7.0–10)
(10–15)
(13–18)
(13–19)
(14–20)
(1.5–2.1)
(2.0–3.0)
(2.9–4.2)
(3.5–5.1)
(3.8–5.5)
(3.9–5.6)
(4.0–5.8)
(57–180)
(62–180)
(63–150)
(63–120)
(57–86)
(55–82)
(53–79)
(49–67)
(58–78)
(70–91)
(76–89)
(75–85)
(74–83)
(74–84)
(49–63)
(64–76)
(67–77)
(59–71)
(55–67)
(55–67)
(54–66)
(17–50)
(39–77)
(72–110)
(81–130)
(64–100)
(62–100)
(60–97)

INCIDENCE HIV-POSITIVE
NUMBER
(THOUSANDS)

a

RATE

358
270
191
142
113
108
104
128
139
172
175
133
118
108
290
513
325
181
106
94
86
135
124
114
105
96
94
93
138
153
155
142
137
136
137
43
40
37
33
31
30
30
207
212
264
503
660
668
674
301
317
576
925
981
993
1 000
267
337
803
1 150
1 290
1 320
1 350
47
58
72
77
73
73
73
624
542
427
304
209
193
179
226
226
236
213
177
169
165
710
788
713
566
462
444
427
296
483
726
799
633
603
562

(295–426)
(223–321)
(157–227)
(118–170)
(94–135)
(90–129)
(86–124)
(1.3–526)
(7.4–456)
(12–536)
(23–476)
(64–225)
(55–204)
(50–186)
(259–323)
(458–571)
(290–362)
(162–202)
(94–118)
(84–105)
(77–96)
(83–199)
(102–149)
(93–137)
(88–123)
(79–115)
(78–113)
(76–111)
(114–164)
(126–183)
(128–184)
(117–169)
(113–163)
(112–162)
(113–163)
(27–64)
(33–48)
(30–44)
(27–40)
(25–37)
(25–36)
(24–35)
(128–305)
(162–269)
(196–341)
(410–605)
(540–791)
(542–807)
(540–821)
(206–413)
(259–381)
(471–691)
(756–1 110)
(809–1 170)
(819–1 180)
(827–1 190)
(165–394)
(275–405)
(657–964)
(938–1 380)
(1 060–1 530)
(1 090–1 570)
(1 110–1 610)
(39–56)
(48–69)
(59–86)
(63–91)
(60–87)
(60–87)
(60–87)
(328–1 010)
(297–860)
(259–636)
(220–402)
(169–253)
(156–234)
(145–216)
(193–261)
(193–261)
(207–268)
(197–229)
(166–189)
(159–180)
(154–175)
(624–801)
(719–861)
(661–767)
(519–615)
(418–509)
(401–489)
(385–470)
(159–476)
(335–658)
(573–897)
(634–984)
(489–795)
(466–757)
(434–706)

RATE

1.1
1.7
2.1
2.2
1.9
1.9
1.9
2.2
16
46
64
53
49
46
11
15
13
7.5
3.7
3.3
2.9
<0.01
<0.01
<0.01
0.015
0.018
0.018
0.017
0.17
0.4
0.8
1.2
1.5
1.6
1.7

(0.91–1.3)
14 (12–17)
(1.4–2.1)
19 (16–22)
(1.7–2.5)
19 (16–23)
(1.8–2.6)
16 (14–20)
(1.6–2.3)
12 (9.8–14)
(1.6–2.3)
11 (9.5–14)
(1.5–2.2)
11 (8.9–13)
(0.023–9.1)
2.3 (<0.1–9.5)
(0.84–52)
15 (0.78–48)
(3.3–140)
38 (2.7–118)
(8.6–170)
46 (6.2–125)
(26–91)
33 (16–57)
(23–85)
30 (14–52)
(21–80)
27 (13–47)
(9.5–12)
148 (132–165)
(13–16)
260 (232–290)
(12–15)
157 (140–175)
(6.7–8.3)
79 (71–88)
(3.3–4.1)
34 (31–38)
(3.0–3.7)
30 (26–33)
(2.6–3.2)
25 (22–28)
(<0.01–<0.01)
2 (1.2–2.9)
(<0.01–<0.01) 3.8 (3.1–4.6)
(<0.01–0.010) 6.2 (5.0–7.4)
(0.012–0.017) 9.6 (8.0–11)
(0.015–0.021) 9.9 (8.1–12)
(0.014–0.021) 9.6 (7.9–11)
(0.014–0.021) 9.2 (7.5–11)
(0.14–0.20)
2.2 (1.8–2.6)
(0.33–0.48)
4.6 (3.8–5.5)
(0.66–0.96)
8.1 (6.7–9.7)
(1.0–1.4)
11 (8.9–13)
(1.3–1.8)
12 (9.7–14)
(1.3–1.9)
12 (9.6–14)
(1.4–2.0)
12 (9.9–14)

<0.01
<0.01
<0.01
0.011
0.087
0.45
2.3
4.2
4.3
3.9
2.5
25
140
300
330
330
330
0.38
1.6
6.3
11
13
12
13
0.18
0.44
0.89
1.2
1.2
1.2
1.2
79
81
68
50
38
36
35
14
31
41
40
33
31
32
35
49
52
47
39
38
35
18
46
79
83
63
58
55

(<0.01–<0.01) 1.8
(<0.01–0.011) 5.8
(<0.01–<0.01) 2.7
(<0.01–0.016) 0.3
(0.067–0.11)
2.2
(0.33–0.58)
11
(1.9–2.7)
44
(3.4–5.0)
73
(3.5–5.2)
73
(3.2–4.8)
66
(1.7–3.4)
6.7
(21–30)
61
(110–170)
311
(250–360)
622
(270–390)
640
(270–390)
635
(270–390)
631
(0.23–0.56)
44
(1.3–1.9)
161
(5.2–7.6)
595
(8.7–13)
962
(11–15)
1 070
(10–15)
1 020
(11–15)
1 040
(0.15–0.21)
4.7
(0.37–0.53)
10
(0.73–1.1)
18
(1.0–1.5)
22
(0.99–1.4)
19
(0.97–1.4)
18
(0.98–1.4)
18
(41–130)
449
(44–130)
390
(41–100)
280
(36–66)
173
(31–46)
113
(29–44)
102
(28–42)
95
(12–16)
56
(26–36)
103
(36–46)
121
(37–43)
104
(31–35)
72
(29–33)
68
(30–34)
68
(31–40)
449
(45–54)
559
(48–56)
513
(43–51)
409
(35–43)
292
(34–42)
277
(32–39)
251
(9.5–29)
170
(32–62)
392
(62–97)
629
(66–100)
657
(48–79)
480
(45–73)
433
(42–69)
399

a

Rates are per 100 000 population.

b

NOTIFIED NEW AND RELAPSE includes cases for which the treatment history is unknown.

GLOBAL TUBERCULOSIS REPORT 2013

a

(<0.1–8.0)
(1.6–12)
(<0.1–10)
(0.17–0.40)
(1.7–2.8)
(8.0–14)
(36–53)
(60–87)
(59–88)
(53–81)
(4.6–9.2)
(50–73)
(254–374)
(508–746)
(528–763)
(524–756)
(521–752)
(27–64)
(132–194)
(486–714)
(787–1 150)
(882–1 270)
(844–1 220)
(856–1 240)
(3.8–5.6)
(8.5–12)
(15–22)
(18–26)
(16–23)
(15–22)
(15–21)
(236–729)
(214–619)
(170–417)
(125–228)
(91–137)
(83–124)
(77–115)
(47–64)
(88–119)
(106–137)
(96–112)
(68–77)
(63–72)
(64–72)
(395–507)
(510–611)
(475–551)
(375–445)
(264–322)
(250–305)
(226–276)
(91–273)
(272–535)
(496–777)
(521–809)
(371–603)
(335–543)
(308–501)

NOTIFIED NEW AND RELAPSE
NUMBER

a

RATE

b

CASE DETECTION
PERCENT

5 200
1 980
4 701
7 873
10 130
10 510
10 989
20 122
13 423
25 821
63 990
84 121
86 778
92 818
6 387
3 054
6 093
7 220
6 703
6 623
6 091
17

67
22
43
60
64
64
64
21
12
21
46
53
53
55
89
54
73
77
62
59
53
14

19
8
22
42
56
59
62
16
8.9
12
26
40
45
51
30
11
22
42
59
63
62
11

(16–23)
(6.7–9.7)
(19–27)
(35–51)
(47–68)
(49–71)
(52–75)
(4.0–1 600)
(2.7–170)
(3.9–170)
(9.6–200)
(23–82)
(26–95)
(29–110)
(27–34)
(9.4–12)
(20–25)
(38–47)
(53–66)
(57–71)
(56–69)
(7.3–17)

97
136
121
136
115
4 977
7 561
8 508
9 765
11 061
11 022
12 265
41
8
20
14
17
21
20
632
1 955
3 760
6 737
12 859
12 734
13 074
80 400
73 917
151 239
270 178
354 786
362 453
323 664

70
88
68
74
61
66
87
86
87
85
83
89
59
11
25
16
19
23
22
16
50
91
132
224
217
219
219
178
337
560
690
698
618

61
84
71
79
66
48
57
56
61
63
61
65
140
27
69
48
61
76
73
7.5
23
34
26
34
32
32
73
56
59
61
70
70
62

(51–75)
(72–100)
(59–86)
(66–96)
(55–80)
(40–58)
(47–69)
(47–68)
(51–74)
(52–76)
(51–74)
(55–79)
(92–220)
(22–33)
(57–84)
(40–59)
(51–74)
(64–92)
(61–88)
(5.1–12)
(19–31)
(27–46)
(22–32)
(28–41)
(27–40)
(27–40)
(53–110)
(47–69)
(49–72)
(50–74)
(59–85)
(59–85)
(52–75)

2 050
5 877
8 705
10 101
8 337
7 165
1 324
1 520
1 409
2 541
2 791
2 888
2 843
14 740
25 316
30 372
41 040
42 885
46 306
44 663
22 249
39 847
54 442
61 022
61 098
59 357
62 178
16 863
35 958
49 806
49 576
44 154
43 583
40 726
9 132
30 831
50 855
50 454
44 209
38 404
35 760

213
552
788
847
688
582
35
35
29
46
44
45
43
84
122
125
143
126
132
123
87
133
160
157
136
128
130
215
407
493
432
334
320
289
87
265
407
397
338
287
261

63
69
69
66
52
43
74
61
40
60
61
61
59
13
23
29
47
60
68
69
39
59
68
74
77
76
79
30
52
69
76
72
72
68
29
55
56
50
53
48
46

(53–77)
(57–84)
(57–84)
(55–80)
(44–63)
(36–52)
(62–90)
(51–74)
(34–49)
(50–73)
(51–74)
(51–74)
(49–71)
(8.3–26)
(14–41)
(20–48)
(36–65)
(50–75)
(56–84)
(57–85)
(33–45)
(51–69)
(60–77)
(69–80)
(72–82)
(71–81)
(74–84)
(27–34)
(47–57)
(64–75)
(70–83)
(66–80)
(65–80)
(62–75)
(18–55)
(40–79)
(45–71)
(40–63)
(43–69)
(38–62)
(37–60)

Data for all years can be downloaded from www.who.int/tb/data

7$%/($&DVHQRWLILFDWLRQV±

YEAR

Algeria

• 44

57 •

Angola

• 99

249 •

Benin

• 41

39 •

Botswana

• 212

307 •

Burkina Faso

• 17

32 •

Burundi

• 82

70 •

Cameroon

• 49

114 •

Cape Verde

• 63

85 •

Central African
Republic

• 73

179 •

Chad

• 44

85 •

Comoros

• 34

17 •

Congo

• 25

261 •

Côte d'Ivoire

• 65

120 •

Democratic
Republic
of the Congo

• 61

166 •

Equatorial
Guinea

• 70

a
b

0•

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

NEW AND
b

RELAPSE
11 607
13 507
18 572
21 336
22 336
21 429
21 880
10 271
5 143
16 062
37 175
44 655
47 240
51 819
2 074
2 400
2 697
3 270
3 756
4 212
3 966
2 938
5 665
9 292
10 058
7 013
6 603
6 161
1 497
2 572
2 331
3 478
4 800
5 286
5 210
4 575
3 326
6 421
6 585
7 611
6 742
6 921
5 892
3 292
5 251
21 499
24 073
24 533
24 802
221
303
292
356
380
420
2 124
3 339

NEW CASES
% SMEARSMEAR- SMEAR-NEGATIVE/
EXTRARE-TREAT EXCL. TOTAL
HISTORY POS AMONG
OTHER RELAPSE
NEW
PULM
POSITIVE
UNKNOWN
PULMONARY
RELAPSE
RETREAT UNKNOWN
5 735
8 328
8 654
8 299
7 790
7 510

2 256
2 019
1 651
1 770
1 753
1 702

5 065
7 758
10 216
11 770
11 444
12 294

3 804
9 053
20 410
21 146
21 703
21 124
1 410
1 839
2 277
2 739
2 973
3 331
3 171

1 631
5 367
12 467
17 285
18 380
23 056
310
281
130
96
296
329
305

266
1 102
2 569
3 780
4 399
4 776
182
212
199
285
367
398
316

1 903
3 091
3 170
3 295
2 669
2 426

2 885
4 789
5 166
2 055
1 983
2 208

1 028
1 545
2 290
3 041
3 450
3 583

267
0
0
0

451
467
548
497
442
374

0
0
0

134
540
1 729
2 444
2 758
2 863
172
68
91
150
120
154
174

720
1 231
1 220
1 210
1 213
1 151

195
196
367
736
692
662

1 121
3 159
3 262
4 590
4 060
4 075

80
165
194
168
202

451
547
713
691
610
576

0
0
0

189
187
85
108
109

134
540
2 871
7 776
4 444
4 470
221
68
280
337
205
262
283

0
0
0

147
181
502
453
738
376

1 058
46
619
130
62

147
1 239
548
1 072
868
438

0
0
0

195
502
571
729
742
617

90
77
175
154

45
88
160
217
227
194

90
167
335
257
195

45
178
327
552
484
389

0
0
0
0
0

908
1 489
1 160
963
799
746

1 116
1 568
2 089
1 826
1 649
1 887

0
0
8
5
3

181
205
74
224
229
210

20
42
108
86
95

181
225
116
332
315
305

0
0
0
0
0

2 896
3 960
13 001
14 464
14 927
15 016

142
625
5 021
5 437
4 941
5 204

18
415
2 461
3 157
3 597
3 524

0
0
0
0

236
251
1 016
1 015
1 068
1 058

574
479
593
558

236
251
1 590
1 494
1 661
1 616

0
0
0
0

111

150

12

135
186
182
189

93
98
127
151

43
54
54
66

13
9
10
5

34
27
27
19

0
0

1 142
5 332
1 686
1 607
49

30
0

21
18
17
14

0
0

0

0
0
0

30

0
0

1 794

964

393

3 210
6 643
5 611
8 084
2 591
3 186

2 153
3 638
3 479
4 641

608
1 598
964
1 752

286
1 079
876
1 356

2 002

518

463

203

6 311
9 452
10 505
10 585
140
123
120
111

2 516
3 833
4 434
3 849

2 419
3 746
4 211
4 809

1 055
1 217
1 033
1 113

193
249
180

321
463
578
634

194
245
269
215

515
708
847
849

0
0
0

103
87
79

10
14
14

7
15
16

0

7
4
2

1
1

7
5
3

0

117
120
591
3 615
9 239
9 853
10 150
10 975
11 303
7 841
11 988
15 094
19 681
22 708
22 476
23 762
21 131
42 819
61 024
97 075
114 170
110 132
108 984
260
306

62
71

13
24

28
23

9
2

2
2

11
4

2 013
4 218
3 640
3 568
3 716
3 984

849
2 016
3 249
3 545
3 930
3 937

675
2 810
2 665
2 692
2 990
3 110

0
0

78
169
299
345
339
272

650
108
171
168
209

78
819
407
516
507
481

0
0

8 254
10 276
12 496
14 131
14 416
14 660

1 508
1 616
2 315
2 381
2 316
2 818

1 577
2 756
4 235
5 179
4 729
5 344

0
0
0
0
0

649
446
635
1 017
1 015
940

447
345
502
444
460

649
893
980
1 519
1 459
1 400

0
0
0
0
0

20 914
36 513
65 040
73 653
71 321
71 124

7 953
8 089
9 959
14 039
13 471
13 214

9 112
13 785
18 494
22 340
21 579
20 669

2 891
2 637
3 582
4 138
3 761
3 977

2 483
4 466
4 158
3 515

2 891
2 637
6 065
8 604
7 919
7 492

219

45

41

579
611

98
118

109
131

820
883

188

0

0
24
60

163
304
232
335

5

0

188
128
117
113
199

34
23

0
0
0

203

1

0
0

291
421
345
534

0

0

1

33
30

67
53

0
0

–
72
80
84
82
82
82
–
70
63
62
55
54
48
82
87
95
97
91
91
91
–
40
39
38
62
57
52
–
84
89
86
81
83
84
–
55
68
74
83
84
85
–
95
86
72
73
75
74
–
43
–
59
65
59
56
–
65
–
78
69
78
73
–
79
–
51
51
51
44
–
91
86
85
–
83
75
–
70
68
53
50
49
50
–
85
86
84
86
86
84
–
72
82
87
84
84
84
–
83
–
–
86
84
–

AFRICAN REGION

NEW AND RELAPSE
NOTIFICATION RATEa
1990–2012

Rates are per 100 000 population.
NEW AND RELAPSE includes cases for which the treatment history is unknown.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

163

7$%/($&DVHQRWLILFDWLRQV±

NEW AND RELAPSE
NOTIFICATION RATEa
1990–2012

YEAR

Eritrea

• 113

51 •

Ethiopia

• 184

158 •

Gabon

• 97

302 •

Gambia

•0

130 •

Ghana

• 44

58 •

Guinea

• 33

100 •

Guinea-Bissau

• 114

117 •

Kenya

• 50

215 •

Lesotho

• 158

525 •

Liberia

•0

193 •

Madagascar

• 54

116 •

Malawi

• 131

128 •

Mali

• 37

37 •

Mauritania

• 261

69 •

Mauritius

• 11

164

10 •

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

NEW AND
b

RELAPSE
3 699
21 453
6 652
3 585
2 870
3 049
3 143
88 634
26 034
91 101
124 262
154 694
156 539
145 323
917
1 115

NEW CASES
% SMEARRE-TREAT EXCL. TOTAL
SMEAR- SMEAR-NEGATIVE/
EXTRAHISTORY POS AMONG
OTHER RELAPSE
NEW
PULM
POSITIVE
UNKNOWN
PULMONARY
RELAPSE
RETREAT UNKNOWN

590
687
832
835
779

18 205
5 332
1 764
1 115
1 163
1 154

3 248
683
1 001
836
888
1 093

9 040
30 510
38 525
46 634
49 594
47 236

8 888
30 565
39 816
54 979
55 497
49 413

7 763
28 907
43 675
50 417
49 305
46 854

0
60
0

47
97
87
103
117

20
27
121
44
111

67
124
208
147
228

36
0
0
0

0
0
0

343
1 119
2 246
2 664
2 143
1 820

1 658
873
2 234
2 478
2 269

343
2 777
3 119
4 898
4 621
4 089

0
0

486

517

68

44

2 512
3 790
4 404
4 929

1 042
1 560
1 740
1 745

1 071
1 366
1 959
2 353

241
379
384
414

0
0
0

158
168
321
175

99
390
512
486

257
558
833
661

1 023
1 553
2 031
1 989
2 302
2 333
6 407
8 636
10 933
12 124
14 607
15 389
14 753
1 988
3 523
5 440
6 863
11 038
11 359
11 407
1 163
1 613
1 273
1 774
2 183
2 063
1 939
11 788
28 142
64 159
102 680
99 272
97 320
92 987
2 525
5 181
9 746
10 802
11 674
11 561
10 776

778
919
1 127
1 344
1 375
1 429

171
515
749
462
673
643

68
99
78
143
199
169

0
0
4
0

6
20
77
40
51
92

33
89
41
31
54

6
53
166
81
82
146

2 638
7 316
7 505
7 656
7 616
7 097

1 225
2 500
3 068
5 068
5 875
5 979

109
615
1 019
1 400
1 471
1 301

159
502
532
483
427
376

538
451
454

159
502
532
1 021
878
830

2 263
3 920
5 479
7 041
6 934
6 653

527
430
524
1 472
1 446
1 510

620
938
629
2 077
2 284
2 434

86
273
321

55
152
231
362
422
489

294
227
286
247
234

55
446
458
648
669
723

0

956
526
1 132
1 409
1 230
1 324
6 800
13 934
28 773
40 389
36 260
37 085
36 937

714
600
522
636
644
521

19
57
24
22
63
43

0
0
0
0

59
90
96
116
126
51

42
76
7
11

59
90
138
192
133
62

0
0
0
0

9 676
24 143
43 772
41 962
39 810
36 697

3 468
9 118
15 265
17 382
17 069
15 934

0
0
0

1 064
1 773
3 254
3 668
3 356
3 419

704
5 721
6 811
6 661
6 162

1 064
2 477
8 975
10 479
10 017
9 581

0
0
0

1 361
3 041
4 280
3 600
3 666
3 298

2 685
2 838
4 063
5 331
5 296
5 142

653
2 520
2 020
2 222
2 095
1 877

147
385
439
521
504
459

1 096
602
1 464
1 224
1 195

147
1 481
1 041
1 985
1 728
1 654

1 393
1 500
3 432
6 597
7 906
8 093
6 261
21 616

1 154
1 021
2 167
3 750
4 261
4 342

119
285
575
1 385
1 967
1 946

120
187
657
1 363
1 612
1 749

7
33
99
66
56

25
24
71
59
39

32
57
170
125
95

8 026

987

2 219

18 993
24 432
26 019
25 782
12 395
19 155
23 604
25 491
21 092
19 361
20 335
2 933
3 087
4 216
4 704
5 291
5 428
5 446
5 284
3 849
3 067
2 162
2 461
1 804
2 616
119
131
160
125
122
114
128

13 056
16 795
17 927
17 206
4 301
6 285
8 260
8 443
7 240
7 003
6 951

1 287
1 657
1 726
1 804
5 827
7 054
8 846
10 132
8 245
6 612
6 550

3 634
4 545
4 851
4 964
1 885
5 257
5 734
5 823
4 857
5 076
4 886

482
674
703
427

0
2 119
1 444
1 493
128

1 498
2 109
2 218
1 946
382
551
764
3 212
2 194
2 163
822

1 866
2 527
3 530
3 686
3 777
3 724

609
797
482
481
491
487

459
653
492
926
984
1 081

180
157
145
156

153
239
380
355
321
310

2 074
1 583
1 155
1 422
1 009
1 522

800
687
454
390
222
354

455
580
403
524
458
628

28
0

113
115
110
105
100
118

8
14
4
5
3
3

12
23
8
6
8
5

0
0
0

a

Rates are per 100 000 population.

b

NEW AND RELAPSE includes cases for which the treatment history is unknown.

GLOBAL TUBERCULOSIS REPORT 2013

0

0
0
0

44

596
0
0
0

0
0

1 016
1 435
1 515
1 519
382
551
764
1 093
750
670
694

0
0
0

0

0

0
0
0

596

0

153
239
200
198
176
154

0
0
0
0

520
580
150
125
87
112

358
56
28
16
20

520
938
206
153
103
132

0
0
0

2
8
3
6
3
2

4
2
1
2
2

2
12
5
7
5
4

0

317
0
242

0
0
289

1 254

Data for all years can be downloaded from www.who.int/tb/data

0
0
0

0

–
–
10
28
43
42
40
–
50
50
49
46
47
49
–
48
–
49
53
47
43
–
82
64
60
74
67
69
–
68
75
71
60
56
54
–
81
90
91
83
83
82
–
57
47
68
69
66
72
100
59
54
48
46
48
50
–
34
52
51
40
41
39
–
91
78
79
73
68
69
–
89
–
91
91
91
91
42
47
48
45
47
51
51
–
75
76
88
88
88
88
–
72
70
72
78
82
81
–
93
89
96
95
97
98

7$%/($&DVHQRWLILFDWLRQV±

a

YEAR

Mozambique

• 117

189 •

Namibia

• 189

443 •

Niger

• 67

64 •

Nigeria

• 21

55 •

Rwanda

• 89

53 •

Sao Tome and
Principe

• 14

61 •

Senegal

• 66

89 •

Seychelles

• 59

22 •

Sierra Leone

• 16

219 •

South Africa

• 219

618 •

Swaziland

•0

582 •

Togo

• 35

43 •

Uganda

• 84

123 •

United Republic
of Tanzania

• 87

130 •

Zambia

• 215

289 •

Zimbabwe

• 87

a
b

261 •

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

NEW AND
b

RELAPSE
15 899
17 882
21 158
33 231
43 558
44 627
47 741
2 671
1 540
10 799
14 920
11 281
10 806
10 003
5 200
1 980
4 701
7 873
10 130
10 510
10 989
20 122
13 423
25 821
63 990
84 121
86 778
92 818
6 387
3 054
6 093
7 220
6 703
6 623
6 091
17
97
136
121
136
115
4 977
7 561
8 508
9 765
11 061
11 022
12 265
41
8
20
14
17
21
20
632
1 955
3 760
6 737
12 859
12 734
13 074
80 400
73 917
151 239
270 178
354 786
362 453
323 664
2 050
5 877
8 705
10 101
8 337
7 165
1 324
1 520
1 409
2 541
2 791
2 888
2 843
14 740
25 316
30 372
41 040
42 885
46 306
44 663
22 249
39 847
54 442
61 022
61 098
59 357
62 178
16 863
35 958
49 806
49 576
44 154
43 583
40 726
9 132
30 831
50 855
50 454
44 209
38 404
35 760

NEW CASES
% SMEARRE-TREAT EXCL. TOTAL
SMEAR- SMEAR-NEGATIVE/
EXTRAHISTORY POS AMONG
OTHER RELAPSE
NEW
PULM
POSITIVE
UNKNOWN
PULMONARY
RELAPSE
RETREAT UNKNOWN
10 566
13 257
17 877
20 097
19 537
20 951

5 054
4 037
9 184
16 408
18 159
19 797

1 363
2 262
4 771
5 621
5 504
5 542

697
4 012
5 222
4 464
4 503
4 333

507
4 724
4 455
3 309
3 034
2 473

248
1 459
1 907
2 330
2 039
2 063

1 492
3 045
5 050
6 283
6 604
6 848

116
699
1 193
1 730
1 856
1 989

372
702
1 227
1 492
1 489
1 689

9 476
17 423
35 048
45 416
47 436
52 901

3 364
6 613
22 705
32 616
33 034
32 972

280
1 069
2 836
3 422
3 793
4 432

1 840
3 681
4 166
3 785
3 811
3 571

676
845
859
1 072
1 017
858

338
1 289
1 727
1 577
1 300
1 247

30
49
47
53
59

56
75
63
49
37

7
1
10
28
16

5 421
5 823
6 722
7 688
7 765
8 448

1 073
1 370
1 557
1 470
1 389
1 755

504
800
921
1 404
1 315
1 524

6
11
8
9
2
9

2
7
3
8
13
8

1
2
1
0
6
2

1 454
2 472
4 370
6 898
7 435
8 031

339
821
1 679
4 919
4 358
4 241

121
400
551
831
775
570

23 112
75 967
125 460
132 107
129 770
119 898

74 399
16 392
76 680
151 772
148 266
134 631

10 636
17 486
39 739
52 095
47 285
42 467

660
1 823
2 187
3 011
2 408
2 548

687
3 198
4 106
5 064
4 228
3 111

219
583
1 458
1 631
1 395
1 209

887
984
1 798
2 096
2 087
2 112

304
91
170
164
205
168

236
287
484
397
475
444

13 631
17 246
20 559
23 456
25 614
24 916
11 553
19 955
24 049
25 264
24 769
24 115
25 138

5 912
9 003
15 040
13 567
14 389
13 270

2 070
2 618
3 780
4 571
5 001
5 143

12 362
17 624
20 810
21 184
20 438
21 393

6 195
10 997
13 094
13 715
13 725
14 595

10 038
12 927
14 857
12 639
12 046
12 645

3 268
25 222
24 327
20 412
20 004
17 050

656
10 202
8 587
9 255
9 908
9 174

8 965
14 392
13 155
11 654
12 596
12 163

10 934
27 626
29 074
25 157
19 172
17 316

5 040
8 837
6 721
6 061
5 192
4 912

899
917
1 399
1 432
1 427
1 451

546
487
2 616
2 825
3 086

899
1 463
1 886
4 048
4 252
4 537

88
604
849
1 178
1 230
1 134

930
974
1 344
1 132
1 142

88
1 534
1 823
2 522
2 362
2 276

255
403
452
376
347

351
215
204
218

255
754
667
580
565

303
716
2 009
2 667
2 515
2 513

1 640
2 858
6 326
6 272
5 035

303
2 356
4 867
8 993
8 787
7 548

242
203

200
278
371
269
253
212

96
460
362
161
117

200
374
831
631
414
329

0
0

0
0
0
0

4
11
1
6
3

16
1
10
12

4
27
2
16
15

0
0
0

0
0
0

563
515
565
499
553
538

541
355
530
566
554

563
1 056
920
1 029
1 119
1 092

0
0
0

0
0
0
0

0
0
2
0
0
1

0
0
0
1

0
0
2
0
0
2

0
0
0

41
67
137
211
166
232

374
193
336
209
280

41
441
330
547
375
512

0
0
0

2 487
0

173
116

0
0
0

97

0

0
0
0
0

28 299
18 812
18 394
26 668

179
56 202
32 289
41 768
27 521
25 918

179
56 202
60 588
60 580
45 915
52 586

0
0

489
273
311
395
306
297

976
159
1 045
843
574

489
1 249
470
1 440
1 149
871

0
0
0

93
47
85
134
121
119

86
94
106
92
69

93
133
179
240
213
188

0

955
1 505
1 661
1 291
1 302
1 334

0
769
2 661
2 712
2 548

955
1 505
2 430
3 952
4 014
3 882

0
0

1 335
1 772
1 854
1 430
1 079
1 052

3 178
2 355
1 791
1 714

1 335
1 772
5 032
3 785
2 870
2 766

243
1 455
1 805
1 848
1 625
1 857

3 691
4 462
5 011
4 551

243
1 455
5 496
6 310
6 636
6 408

4 437
3 348
2 901
2 960

5 941
4 685
4 345
4 329

0
0

0

737
0
0
0
0

1 504
1 337
1 444
1 369

0
0
0

0

0
0
185
0

1 392
0
0

0
0
18 738
0

643
0
0

4
0
0
0

0
0

0
0

0

737

0
0
0

–
68
77
66
55
52
51
–
58
46
54
57
60
64
–
93
81
81
78
78
77
–
74
72
61
58
59
62
–
73
81
83
78
79
81
–
–
35
40
43
52
61
–
83
81
81
84
85
83
–
75
61
73
53
13
53
–
81
75
72
58
63
65
–
24
82
62
47
47
47
–
49
36
35
37
36
45
–
74
92
91
93
91
93
–
70
66
58
63
64
65
100
62
58
55
54
54
54
–
75
34
38
38
38
43
–
45
34
31
32
40
41

AFRICAN REGION

NEW AND RELAPSE
NOTIFICATION RATE
1990–2012

Rates are per 100 000 population.
NEW AND RELAPSE includes cases for which the treatment history is unknown.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

165

7$%/($7UHDWPHQWRXWFRPHVQHZVPHDUSRVLWLYHFDVHV±
% OF COHORT
a

TREATMENT SUCCESS (%)
1995–2011

Algeria

•0

92 •

Angola

•0

55 •

• 71

90 •

• 67

81 •

• 25

78 •

• 45

92 •

• 53

80 •

Benin

Botswana

Burkina Faso

Burundi

Cameroon

Cape Verde

•0

77 •

Central African
Republic

• 37

68 •

Chad

• 47

68 •

• 90

25 •

Comoros

Congo

•0

71 •

• 68

78 •

• 74

87 •

• 89

0•

Côte d'Ivoire

Democratic
Republic
of the Congo

Equatorial
Guinea

Eritrea

•0

87 •

• 61

90 •

Ethiopia

Gabon

• 86
a

166

51 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

5 735
8 328
8 654
8 402
8 299
7 790
3 804
9 053
20 410
22 488
21 146
21 703
1 839
2 277
2 739
2 960
2 973
3 331
1 903
3 091
3 170
3 144
3 295
2 669
1 028
1 545
2 290
3 061
3 041
3 450
1 121
3 159
3 262
3 974
4 590
4 060
2 896
3 960
13 001
14 635
14 464
14 927
111
135
172
186
182
1 794
2 153
5 132
3 638
3 479
2 002
2 516
3 820
3 833
4 434
103
87
79
76
62
2 013
4 218
3 640
3 433
3 568
3 716
8 254
10 276
12 496
14 300
14 131
14 416
20 914
36 513
65 040
73 078
73 653
71 321
219

SIZE OF
COHORT

8 328
8 379
8 438
7 894
7 364
6 392
20 113
21 627
21 145
21 703
1 839
2 277
2 766
2 963
2 987
3 324
2 060
3 991
3 335
3 492
3 314
3 107
1 200
1 574
2 290
3 061
3 057
3 442
1 798
3 465
3 424
3 974
4 590
4 060
2 740
3 164
13 169
14 428
14 464
14 927
14
135

182
692
1 366
3 217
5 132
3 569
3 205
529

3 820
3 780
4 430
113
85
70
87
4
3 114
4 121
3 634
3 447
3 716
7 221
10 631
12 496
14 300
14 131
14 416
16 247
36 123
65 066
72 367
73 448
71 321
219

490
579
611

490
590

590
687
802
832
835
9 040
30 510
38 525
44 396
46 634
49 594
486

765
688
804
804
835
5 087
29 662
39 430
44 807
46 634
41 351
249

1 042
1 244
1 560
1 740

1 165
1 163
1 671
1 654

COHORT AS
% NOTIFIED

–
100
97
100
95
95
–
71
99
96
100
100
100
100
101
100
100
100
108
129
105
111
101
116
117
102
100
100
101
100
160
110
105
100
100
100
95
80
101
99
100
100
–
–
100
–
–
100
39
–
149
100
98
92
26
–
–
100
99
100
110
98
89
–
–
6
–
74
113
106
97
100
87
103
100
100
100
100
78
99
100
99
100
100
100
–
–
100
102
–
–
130
100
100
97
100
56
97
102
101
100
83
51
–
112
93
107
95

DIED

FAILED

DEFAULTED

COMPLETED

80
74
81
79
81

7
13
10
10
11

1
2
2
2
2

2
0
1
1
0

5
3
3
4
4

5
8
3
4
2

68
45
47
30
36
50
57
74
82
84
84
13
22
37
57
50
36
22
53
66
72
74
74
25
42
52
83
87
88
45
67
66
65
64
67

28
25
18
19
21
20
13
9
7
6
54
55
33
22
32
46
2
7
5
4
3
4
20
39
27
7
4
4
8
10
7
13
14
13

3
3
4
8
7
6
6
7
5
5
6
5
6
7
5
5
6
5
13
14
10
9
9
3
4
4
3
4
4
7
7
6
6
6
6

2
3
2
1
2
1
2
2
2
2
3
1
0
1
3
2
2
1
2
7
9
7
6
0
0
0
1
1
1
1
2
1
1
1
1

26
19
18
8
13
17
11
3
1
1
1
12
7
8
4
3
3
3
16
6
4
6
6
14
13
17
5
3
3
35
13
14
10
10
9

2
3
5
35
23
5
3
1
0
1
0
15
10
15
9
8
9
67
9
1
2
1
1
38
1
1
0
0
0
4
1
5
5
5
4

64
56

0
8

7
3

0
2

0
19

29
12

55
16
36
38
33
45
44
17

23
21
21
28
20
23
23
30

4
7
0
6
3
6
4
6

0
0
3
2
1
1
1
1

9
53
34
8
13
19
18
43

10
3
5
19
30
7
10
3

55
39
45
90
91
91

22
28
23
0
2
0

4
4
4
4
4
3

2
2
1
0
4
4

15
21
19
6
0
0

3
5
8
0
0
1

91
25

0

3
75

2

1

2
0

57
24
66
63
59
63
47
62
69
66
69
55
69
80
85
86
82
89

12
4
12
13
12
6
10
11
10
12
9
20
8
5
3
4
5
0

4
0
1
2
2
4
5
8
8
7
7
5
6
6
4
4
4
3

0
1
0
1
2
1
2
2
3
2
2
1
1
1
1
1
1
0

22
13
13
12
11
17
16
10
7
8
9
10
8
4
3
3
4
8

5
58
7
8
14
9
20
6
4
5
3
9
7
4
4
3
5
0

47
50

19
20

3
5

1
1

16
17

14
7

64
83
83
81
83
56
63
64
65
66
70
63

12
5
2
4
4
5
17
14
19
17
19
22

8
7
5
7
4
5
6
5
3
3
3
1

1
1
3
3
4
2
1
1
1
1
1
2

9
2
2
1
1
13
9
4
3
3
2
9

6
1
5
5
5
19
4
12
10
10
4
2

35
37
34
26

12
18
29
25

10
1
2
2

1
1
3
1

42
25
26
36

1
18
6
11

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

GLOBAL TUBERCULOSIS REPORT 2013

NOT
EVALUATED

CURED

Data for all years can be downloaded from www.who.int/tb/data

7$%/($7UHDWPHQWRXWFRPHVQHZVPHDUSRVLWLYHFDVHV±
% OF COHORT

Gambia

• 76

88 •

• 54

86 •

• 78

82 •

Ghana

Guinea

Guinea-Bissau

• 65

73 •

• 75

88 •

Kenya

Lesotho

• 47

74 •

Liberia

• 79

86 •

Madagascar

• 55

83 •

• 71

85 •

Malawi

Mali

• 59

68 •

Mauritania

•0

73 •

Mauritius

•0

90 •

• 39

0•

Mozambique

Namibia

•0

84 •

Niger

•0

80 •

• 49

85 •

Nigeria

Rwanda

•0

89 •

Sao Tome and
Principe

•0
a

72 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

778
919
1 127
1 313
1 344
1 375
2 638
7 316
7 505
8 255
7 656
7 616
2 263
3 920
5 479
5 377
7 041
6 934
956
526
1 132
1 310
1 409
1 230
13 934
28 773
40 389
37 402
36 260
37 085
1 361
3 041
4 280
3 976
3 600
3 666
1 154
1 021
2 167
3 796
3 750
4 261
8 026
13 056
15 729
16 795
17 927
6 285
8 260
8 443
7 623
7 240
7 003
1 866
2 527
3 530
5 163
3 686
3 777
2 074
1 583
1 155
1 555
1 422
1 009
113
115
110
98
105
100
10 566
13 257
17 877
19 579
20 097
19 537
697
4 012
5 222
4 608
4 464
4 503
1 492
3 045
5 050
6 347
6 283
6 604
9 476
17 423
35 048
44 863
45 416
47 436
1 840
3 681
4 166
4 184
3 785
3 811
30
49
52
47
53

SIZE OF
COHORT

COHORT AS
% NOTIFIED

686

88
–
100
99
100
100
14
100
101
100
100
100
100
100
106
104
103
74
100
–
103
114
90
106
46
99
100
100
100
99
131
–
129
102
107
100
138
90
100
100
–
90
113
–
117
100
100
98
100
100
100
100
100
100
69
–
100
86
102
100
–
–
152
101
100
144
–
139
100
100
100
100
100
100
100
100
100
–
–
100
100
102
102
100
–
105
100
99
100
100
100
94
100
100
100
100
–
103
100
100
101
100
–
323
100
96
96
100

1 127
1 296
1 344
1 375
361
7 316
7 584
8 255
7 656
7 623
2 263
3 920
5 811
5 597
7 250
5 152
959
1 167
1 498
1 271
1 308
6 470
28 376
40 436
37 402
36 260
36 717
1 788
5 542
4 070
3 852
3 666
1 595
924
2 167
3 796
3 853
9 101
10 506
15 298
15 709
16 789
17 602
6 293
8 296
8 443
7 624
7 240
7 012
1 290
3 530
4 454
3 778
3 777

1 761
1 563
1 422
1 450
160
110
98
105
100
10 566
13 296
17 877
19 579
20 097

4 012
5 222
4 702
4 538
4 502
3 193
5 050
6 313
6 266
6 604
9 476
16 372
35 080
44 863
45 416
47 436
3 776
4 175
4 165
3 806
3 811
97
49
50
45
53

CURED

COMPLETED

DIED

FAILED

DEFAULTED

NOT
EVALUATED

69

7

5

1

13

5

81
88
86
86
41
45
68
79
76
75
62
59
65
72
76
76
42

6
1
2
2
13
5
5
8
10
11
17
9
7
6
4
6
23

7
6
5
6
11
6
9
7
7
8
6
7
6
5
4
4
6

1
1
1
2
2
3
2
1
1
1
2
1
2
2
2
2
0

3
2
3
2
11
14
11
3
3
3
9
15
10
7
6
7
23

2
1
3
2
22
27
5
3
3
2
5
9
10
8
9
5
6

51
51
54
60
60
66
71
78
81
83
32

18
17
18
14
14
14
11
8
6
5
14

12
6
6
6
9
5
5
4
3
3
7

1
1
0
0
1
0
0
1
1
1
0

11
21
14
13
9
9
8
6
5
4
9

7
5
7
7
7
6
5
4
4
3
36

73
11
10
11

1
2
2
2
5
6
0
1

4
5
8
6
12
10
12
9

14
12
12
7
0
3
8
3

59
58
63
79
71
60
57

9
16
26

8
11
10
11
5
2
3
5

64
47
61
67
78
78
79
65
70
72
87
86
81
41

22
8
9
7
3
4
4
6
3
2
2
2
4
18

4
6
7
6
4
4
4
19
19
15
7
7
7
5

1
2
1
1
1
1
1
1
1
1
1
1
2
0

6
16
17
13
9
9
8
0
4
3
2
2
2
22

4
20
5
5
5
4
4
10
3
7
1
2
4
14

69
66
76
55

6
12
0
13

11
10
8
7

4
4
3
3

7
7
9
7

3
2
4
15

44
51
55
57

11
12
14
16

2
3
2
2

1
1
1
0

19
10
13
16

24
23
15
9

0
86
88
90
90
34
73
78
84
83

92

2
3
4
4
5
3
10
12
9
8

2

0
0
0
5
2
1
1
2

0
1
0
1
1
1
1
1

3
6
4
5
5
9
11
5
3
4

0
5
4
0
0
48
3
2
2
1

41
59
74
74
74

15
16
11
11
10

6
7
5
5
5

2
2
4
4
5

15
10
4
3
5

21
7
2
2
0

42
49
66
69
66
34
65
50
73
73
77

22
25
13
13
15
15
14
25
10
10
9

8
5
7
7
5
5
6
9
5
5
5

4
2
2
2
3
2
2
4
1
1
1

12
14
7
6
9
9
11
11
8
8
7

11
5
5
3
3
35
2
1
4
2
2

52
73
77
80
84

9
10
8
8
5

6
6
5
5
5

1
2
4
4
4

4
3
3
2
2

28
6
3
1
1

52
98
98
20
45

27
0
0
58
26

9
2
0
9
4

5
0
2
0
19

7
0
0
13
6

0
0
0
0
0

AFRICAN REGION

TREATMENT SUCCESS (%)a
1995–2011

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

167

7$%/($7UHDWPHQWRXWFRPHVQHZVPHDUSRVLWLYHFDVHV±
% OF COHORT
TREATMENT SUCCESS (%)a
1995–2011

Senegal

• 44

85 •

• 89

67 •

• 69

88 •

• 58

79 •

Seychelles

Sierra Leone

South Africa

Swaziland

•0

73 •

Togo

• 60

85 •

• 44

77 •

• 73

88 •

• 70

88 •

• 53

81 •

Uganda

United Republic
of Tanzania

Zambia

Zimbabwe

a

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

5 421
5 823
6 722
7 883
7 688
7 765
6
11
8
11
9
2
1 454
2 472
4 370
6 092
6 898
7 435
23 112
75 967
125 460
139 468
132 107
129 770
660
1 823
2 187
3 498
3 011
2 408
887
984
1 798
2 267
2 096
2 087
13 631
17 246
20 559
23 113
23 456
25 614
19 955
24 049
25 264
24 895
24 769
24 115
10 038
12 927
14 857
12 995
12 639
12 046
8 965
14 392
13 155
10 195
11 654
12 596

SIZE OF
COHORT

COHORT AS
% NOTIFIED

5 421
5 823
6 722
7 883
7 855
7 898
9
11

100
100
100
100
102
102
150
100
–
100
78
450
90
93
100
100
100
99
122
114
107
100
102
102
–
–
100
100
100
104
97
–
100
100
100
99
112
80
100
100
100
100
100
99
100
100
98
100
59
54
100
100
100
106
108
100
98
100
100
100

11
7
9
1 315
2 296
4 370
6 083
6 897
7 351
28 209
86 276
134 782
139 458
134 250
132 867

2 187
3 498
3 011
2 499
856
1 796
2 267
2 096
2 075
15 301
13 874
20 559
23 113
23 456
25 614
19 955
23 923
25 324
24 895
24 373
24 218
5 957
7 014
14 857
12 995
12 639
12 711
9 702
14 392
12 860
10 195
11 654
12 596

CURED

COMPLETED

DIED

FAILED

DEFAULTED

NOT
EVALUATED

35
43
70
81
81
82
89
82

9
9
6
3
4
3
0
0

4
3
4
4
4
3
11
0

6
1
2
2
2
2
0
0

16
21
11
5
6
7
0
9

31
22
8
5
4
3
0
9

55
100
56
55
70
77
68
77
79
40
54
58
67
73
74

9
0
11
15
7
8
10
9
9
18
9
13
6
6
5

18
0
0
5
6
6
6
4
3
4
6
7
7
6
6

0
0
0
7
2
1
1
1
1
4
1
2
2
2
2

0
0
11
16
13
6
11
6
6
15
13
10
7
7
6

18
0
22
2
2
2
4
3
2
19
17
10
12
6
7

22
51
51
48
42

20
19
22
25
18

6
10
11
8
9

2
7
9
8
3

5
7
6
5
17

45
7
2
5
11

66
77
81
81
26
33
32
30
35
39
69
72
79
82
84
80
47
48
76
85
83
82
32
61
59
70
72
73

5
4
3
3
18
30
41
38
36
38
5
6
4
6
6
7
23
19
8
6
6
5
21
8
9
9
10
8

12
10
8
7
7
7
6
5
5
5
9
10
9
5
5
4
7
7
8
6
6
4
10
12
12
8
8
8

4
4
3
2
1
0
0
1
1
1
1
0
0
0
0
0
2
6
1
1
1
1
0
0
2
1
1
1

11
3
4
5
13
17
16
12
11
12
6
6
4
2
2
2
14
6
2
3
3
3
10
7
7
7
5
4

2
2
1
1
36
12
5
16
13
5
11
5
4
5
3
6
8
14
5
0
1
4
26
13
12
6
5
6

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.



GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($7UHDWPHQWRXWFRPHVUHWUHDWPHQWFDVHV±

Algeria

•0

80 •

Angola

•0

0•

Benin

• 67

84 •

Botswana

•0

70 •

• 77

75 •

• 46

85 •

Burkina Faso

Burundi

Cameroon

•0

70 •

Cape Verde

•0

37 •

Central African
Republic

•0

55 •

Chad

• 48

60 •

• 43

0•

Comoros

Congo

•0

51 •

Côte d'Ivoire

•0

67 •

Democratic
Republic
of the Congo

• 72

74 •

• 83

0•

Equatorial
Guinea

Eritrea

•0

69 •

• 79

78 •

Ethiopia

Gabon

•0
a

40 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

451
547
713
612
691
610
134
540
2 871
3 863
7 776
4 444
68
280
337
271
205
262
147
1 239
548
1 122
1 072
868
45
178
327
608
552
484
181
225
116
238
332
315
236
251
1 590
1 569
1 494
1 661
30
34
33
27
27
188
291
629
421
345
203
515
676
708
847
7
5
3
6

SIZE OF
COHORT

512
713
553
598
588

1 613
3 044
2 272
4 444
139
282
341
270
203
262
395
219
1 126
1 027
998
26
166
272
509
475
481
265
92
238
332
315
347
1 611
1 516
1 489
1 661

34

27
353
291
629
284
275
92

676
704
847
7
5
5
5

11
78
819
407
451
516
507
649
893
980
1 436
1 519
1 459
2 891
2 637
6 065
8 666
8 604
7 919
1

44
67
53
67
124
207
208
147
343
2 777
3 119
3 544
4 898
4 621
44
257
655
558
833

187
477
418
235
528
507
980
1 436
1 519
1 459
1 202
5 448
7 193
5 583
4 572
6

44
41

157
120
147
193
1 556
3 116
2 942
3 934
1 796

150
611
147
200

COHORT AS
% NOTIFIED

–
94
100
90
87
96
–
–
56
79
29
100
204
101
101
100
99
100
–
32
40
100
96
115
58
93
83
84
86
99
146
41
–
100
100
100
–
138
101
97
100
100
–
–
100
–
–
100
–
–
100
100
67
80
45
–
–
100
99
100
100
100
167
–
–
–
–
23
117
93
46
104
–
57
100
100
100
100
42
–
90
83
65
58
600
–
–
100
61
–
–
–
–
76
58
100
56
56
100
83
80
39
–
–
58
93
26
24

DEFAULTED

NOT
EVALUATED

4
1
2
2
4

5
6
5
5
11

10
19
5
6
3

5
5
8
0
9
5
10
11
6
8

17
4
4
0
4
1
3
6
6
5

26
21
16
0
19
11
6
1
1
1

4
3
7
100
1
0
1
1
1
1

54
28
43
46
55
12
4
4
5
4
4
21
13

8
11
13
14
11
8
13
6
9
9
10
6
15

1
5
4
3
3
12
5
10
8
8
8
2
3

11
12
8
7
6
0
15
6
5
6
6
28
17

6
11
10
10
10
4
7
4
3
1
1
18
1

81
78
80

3
4
4

6
7
6

3
5
5

4
6
4

2
0
0

50
49
51
55
54

10
7
18
16
16

9
6
9
9
9

5
3
2
3
3

26
16
13
12
12

2
19
7
6
6

41

15

0

0

24

21

CURED

COMPLETED

DIED

61
48
72
69
65

16
24
12
14
15

5
2
4
4
3

23
45
42
48
61
60
70
76
80

24
21
23
0
19
21
21
11
9
4

21
33
22
20
15
65
57
71
70
72
70
25
50

FAILED

22

15

4

4

11

44

33
53
19
35
33
29

16
30
12
24
21
18

1
9
5
7
11
5

4
0
2
4
4
2

39
8
8
25
20
40

8
1
53
6
11
4

49
38
29
43
100
100

21
35
31
0
0
0

4
4
4
29
0
0

3
2
1
0
0
0

15
18
27
29
0
0

8
3
7
0
0
0

80

0

0

20

0

0

49
12
59
40
51

13
2
22
17
0

3
0
2
3
5

3
0
1
2
4

28
3
14
21
10

4
83
2
18
31

45
43
50
51
56
56

10
14
14
14
11
16

8
8
13
12
10
8

9
7
11
8
8
2

21
13
9
11
12
12

7
15
3
3
3
6

71
54
72
68
83

4
23
5
5
0

10
8
7
8
0

4
2
3
2
17

6
4
6
5
0

5
8
8
12
0

36
32

14
15

14
22

2
0

16
27

18
5

70
81
67
71
60
41
47
56
57

12
8
3
8
11
15
21
27
21

7
9
7
3
10
9
5
4
4

6
2
10
5
4
2
2
3
0

2
1
1
8
8
5
3
5
3

3
0
13
5
7
28
23
6
15

18
12
32
18

12
67
33
21

5
2
3
2

3
1
3
2

60
17
26
30

3
1
2
26

AFRICAN REGION

% OF COHORT
a

TREATMENT SUCCESS (%)
1995–2011

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

169

7$%/($7UHDWPHQWRXWFRPHVUHWUHDWPHQWFDVHV±
% OF COHORT
TREATMENT SUCCESS (%)a
1995–2011

Gambia

• 69

78 •

Ghana

• 74

77 •

• 67

64 •

Guinea

Guinea-Bissau

•0

68 •

• 72

82 •

Kenya

Lesotho

•0

58 •

Liberia

•0

82 •

Madagascar

•0

80 •

• 69

82 •

Malawi

Mali

•0

69 •

•0

53 •

Mauritania

Mauritius

•0

80 •

Mozambique

•0

0•

Namibia

•0

80 •

Niger

•0

76 •

Nigeria

•0

82 •

Rwanda

•0

80 •

Sao Tome and
Principe

•0
a

170

31 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

6
53
166
99
81
82
159
502
532
860
1 021
878
55
446
458
589
648
669
59
90
138
76
192
133
1 064
2 477
8 975
10 711
10 479
10 017
147
1 481
1 041
1 970
1 985
1 728
32
57
123
170
125
596
1 498
2 089
2 109
2 218
551
764
3 212
2 470
2 194
2 163
153
239
380
425
355
321
520
938
206
182
153
103
2
12
5
5
7
5
899
1 463
1 886
3 630
4 048
4 252
88
1 534
1 823
2 558
2 522
2 362
255
754
690
667
580
303
2 356
4 867
8 151
8 993
8 787
200
374
831
475
631
414
4
27
3
2
16

SIZE OF
COHORT

45

100
81
86
47
540
717
1 021
878
112
299
458
111
121

146
89
140
47
879
1 964
3 794
4 859
4 333
7 235

597
1 931
2 091
1 728
41
57
123
125

1 825
2 073
1 800
1 843
492
797
1 093
788
750
670

379
390
345
321

182
153
133
2
5
5
7
5
1 594
1 855

604
2 009
1 546
2 548
2 361

667
661
580
1 848
3 662
8 151
8 993
8 787
296
506
448
446
415

0
3
12
16

COHORT AS
% NOTIFIED

750
–
–
101
100
105
30
–
102
83
100
100
204
67
100
–
17
18
–
–
106
117
73
35
83
79
42
45
41
72
–
–
57
98
105
100
–
128
100
100
–
100
–
–
122
99
85
83
89
104
34
32
34
31
–
–
100
92
97
100
–
–
–
100
100
129
–
17
100
100
100
100
–
109
98
–
–
–
–
39
110
60
101
100
–
–
–
97
99
100
–
78
75
100
100
100
–
79
61
94
71
100
–
–
0
100
600
100

CURED

COMPLETED

DIED

FAILED

DEFAULTED

69

0

11

2

11

7

67
30
74
68

5
6
3
6

17
6
13
6

2
1
3
9

7
0
3
9

2
57
2
2

40
50
38
40
44
63
45

8
26
39
38
23
8
16

6
10
12
12
3
5
10

3
2
2
3
9
3
7

11
3
2
4
13
8
13

32
10
7
5
8
13
11

55
56

14
7

8
8

5
3

13
16

6
9

44
30
23
47
61
65
68
70
73
77

34
34
31
21
11
11
9
8
6
5

8
2
10
13
9
2
10
8
6
4

0
0
0
2
1
8
1
4
3
4

8
29
27
9
10
10
7
7
8
7

7
4
9
9
8
4
5
4
4
3

20
16
17

71
42
42
41

11
17
16
18

2
2
2
2

2
4
8
10

14
15
16
12

39
75
70

22
9
15

12
2
8

7
4

20
9
2

0
5
0

72

10

4

12

2

0

65
62
71
75
65
61
74
83
77
79

7
11
3
4
4
5
1
2
1
3

7
7
8
7
22
23
19
9
10
10

2
2
2
1
2
1
1
2
3
1

12
8
9
8
1
6
3
2
1
3

6
10
8
4
6
3
3
1
9
5

67
67
87
64

6
8
12
5

10
9
1
7

5
6
0
4

10
7
0
4

3
3
0
15

48
46
43

13
13
10

3
5
10

1
2
2

20
15
17

14
20
19

0
60
60
86
80

0
20
0
0
0

50

50

20
0
0

0
0
0

0
20
20
14
20

0
0
0
0
0

69
69

3
1

11
15

4
2

11
10

2
3

41
24
58
63
67

14
29
15
15
13

8
11
9
6
5

6
3
9
10
9

13
13
6
5
5

17
22
3
2
0

64
64
62

12
11
14

9
10
6

4
3
5

5
5
10

6
7
4

58
48
48
43
42

13
18
33
39
40

7
2
6
4
4

7
11
2
4
4

11
20
7
7
6

4
1
4
3
4

49
56
62
65
72

5
9
10
9
8

14
15
11
9
10

1
3
7
6
7

5
4
4
4
2

25
13
6
6
1

33
0
0

33
50
31

0
8
6

33
17
38

0
8
25

0
17
0

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

GLOBAL TUBERCULOSIS REPORT 2013

NOT
EVALUATED

Data for all years can be downloaded from www.who.int/tb/data

7$%/($7UHDWPHQWRXWFRPHVUHWUHDWPHQWFDVHV±

Senegal

• 56

68 •

•0

0•

Seychelles

Sierra Leone

• 87

70 •

South Africa

•0

66 •

Swaziland

•0

59 •

Togo

• 33

78 •

Uganda

•0

71 •

• 76

82 •

United Republic
of Tanzania

Zambia

•0

0•

Zimbabwe

•0

a

78 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

SIZE OF
COHORT

COHORT AS
% NOTIFIED

563
1 056
920
1 112
1 029
1 119
0
0
2
0
0
0
41
441
330
467
547
375
179
56 202
60 588
65 916
60 580
45 915
489
1 249
470
1 474
1 440
1 149
93
133
179
214
240
213
955
1 505
2 430
4 014
3 952
4 014
1 335
1 772
5 032
4 217
3 785
2 870
243
1 455
5 496
2 485
6 310
6 636
737

634
931
920
889
1 029
914

113
88
100
80
100
82
–
–
–
–
–
–
168
–
99
100
99
97
–
44
107
52
100
68
–
–
237
100
31
100
100
–
72
111
100
99
–
80
–
71
70
70
109
189
101
100
98
102
–
61
100
219
–
–
–
–
79
26
35
41

5 941
4 685
4 685
4 345

0
0
0
69
328
466
543
362
24 847
64 923
34 122
60 580
31 168

1 113
1 474
446
1 151
93
128
237
240
210
1 209
2 856
2 764
2 814
1 455
3 356
5 067
4 217
3 714
2 936
894
5 496
5 444

1 063
4 667
1 203
1 629
1 772

CURED

COMPLETED

45
40
58
67
56
64

11
8
5
4
4
4

DIED

5
4
8
7
6
5

FAILED

DEFAULTED

NOT
EVALUATED

10
3
5
5
3
3

25
23
13
10
7
14

4
23
11
8
24
9

72

14

3

4

4

1

68
56
65
63

7
13
11
7

6
10
5
6

3
3
2
3

15
15
15
15

1
4
2
5

43
29
53
31
59

8
29
8
4
7

8
11
10
5
9

3
2
3
2
3

19
16
12
7
12

19
13
15
52
10

7
14
32
12
16

21
41
18
46
17

11
17
17
15
5

3
9
21
8
4

5
10
7
5
19

54
8
6
13
38

73
68
78
75

2
3
4
3

14
18
6
8

4
3
4
4

7
4
8
8

0
5
1
1

34

30

13

0

13

10

31
31
38
66
49
37
34
37
38

39
34
33
10
24
39
49
47
43

7
8
8
11
14
13
8
9
7

1
1
2
1
1
1
1
1
1

15
12
14
8
6
4
3
3
3

7
13
5
4
6
6
5
4
7

52
24
33

15
60
53

11
9
9

4
1
1

5
3
4

12
4
0

51
13
72
63
63

14
46
8
11
15

17
16
11
13
11

1
0
0
3
4

8
13
5
5
4

9
11
4
5
3

AFRICAN REGION

% OF COHORT
TREATMENT SUCCESS (%)a
1995–2011

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

171

7$%/($+,9WHVWLQJDQGSURYLVLRQRI&37$57DQG,37–

% OF TB PATIENTS WITH
KNOWN HIV STATUS
YEAR
2005–2012
Algeria

–

–

Angola

–

23 •

Benin

• 15

98 •

Botswana

• 23

95 •

• 33

84 •

Burkina Faso

Burundi

–

82 •

Cameroon

•0

82 •

• 98

89 •

Cape Verde

Central African
Republic
–

46 •

–

44 •

Chad

Comoros

• 100

3•

Congo

–

17 •

• 20

85 •

•2

31 •

Côte d'Ivoire

Democratic
Republic
of the Congo
Equatorial
Guinea
–

–

Eritrea

–

59 •

Ethiopia

•3

65 •

•7

100 •

Gabon

Gambia

–

78 •

•7

78 •

–

65 •

Ghana

Guinea

Guinea-Bissau

• 11

68 •

• 14

94 •

•1

88 •

Kenya

Lesotho

Liberia

•3

70 •

•9

54 •

Madagascar

172

2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

% OF TB
NUMBER OF TB
PATIENTS WITH PATIENTS WITH
KNOWN HIV
KNOWN HIV
STATUS
STATUS

4.9
10
23
15
98
99
98
23
81
97
95
33
93
89
84

2 434
5 107
12 022
503
3 774
4 259
4 006
2 291
6 147
6 545
5 940
1 213
4 761
4 944
4 567

71
71
82
0
78
81
82
98

5 511
4 817
5 734
0
19 117
20 280
20 810
298

90
89

352
378

39
33
46

2 638
1 890
3 839

39
38
44
100
3.4
3.3

3 801
4 124
4 766
112
119
4
4

40
20
17
20
73
80
85
1.9
24
27
31
92
100

21 501
22 530
21 597
22 082
38 317
49 987
48 926
53 426
3 457
3 841
4 320
4 075
10 104
7 632
6 733
6 223
3 645
5 135
5 543
5 405
6 627
7 719
6 828
7 016
22 073
24 552
25 126
25 360
305
365
390
425
3 338
6 760
5 724
8 283
6 505
9 697
10 774
10 800
112

NUMBER OF
HIV-POSITIVE
TB PATIENTS

% OF TESTED
TB PATIENTS
HIV-POSITIVE

NUMBER OF
% OF HIV% OF HIVPOSITIVE TB POSITIVE TB HIV-POSITIVE
PEOPLE
PATIENTS ON PATIENTS ON
PROVIDED IPT
ART
CPT

1 620
789
1 149
57
592
727
637
1 829
4 018
4 129
3 759
559
839
829
671

67
15
9.6
11
16
17
16
80
65
63
63
46
18
17
15

43
100
100

43
100
100

97
98

57
74

79
62
90
68
98
97
96

43
53
65
32
60
70
75

1 260
1 036
1 076
0
8 314
7 731
7 747
14

23
22
19

95
95
94

40
48
55

43
38
37
4.7

81
87
83

51
62
55
100

47
45

13
12

44

98

862
733
1 483

33
39
39

0
12
28

62
9.3
20

17
23
20
1.8
0
100
100

53
39
100

45
43
65
100

100
100

100
100

4 106
2 247
1 979
4 079
16 991
18 297
20 663
1 885
28 997
30 636
35 097

119
122
9 961
10 321
11 143
11 512
20 026
23 210
22 920
24 222
99 558
118 636
114 290
112 499

663
959
960
2
0
4
4
757
687
653
1 551
4 112
4 820
5 482
386
5 273
4 942
5 748

18
31
33
38
24
26
27
20
18
16
16

2.9
24
20
38
80
80
75
74
24
54
61

2.9
26
23
14
27
36
44
0.78
9.3
23
40

786
911

853
913

225
234

29
26

85

31
21

164
1 321
9 809
5 442
9 819
185
667
578
852

8.6
41
15
8.4
10
100
59
26
16

88
69
62
37
100
52

29
39
39
82

224

11

93

46

302
340
2 676
2 907
2 812

16
40
26
23
24

97
100
77
72
72

48
37
18
28
37

1 483
1 670
1 859
110
396
431
517
8 954
40 069
38 175
35 837
127
8 459
8 519
7 878
14
283
454
772
16
39
40
19

26
26
25
55
38
42
39
57
41
39
39
81
77
75
75
12
8
10
14
0.91
0.24
0.26
0.13

87
72
83
100

41
49
49
30

0
0
44
100
97
98
79
96
95
97
0
8.5
26
90

0
0
17
48
64
74

59
2.6
43
41
65
7.1
27
46
100

1 913
3 211
66 955
65 140
96 245
185
1 130
2 252
5 415

97
74
78
7
67
79
78

1 962
1 726
1 859
844
10 147
12 587
11 825

51
56
65
11
46
50
68
14
91
93
94
1.4
84
89
88
3.3
53
55
70
9
65
58
54

5 776
6 548
7 575
200
1 046
1 037
1 322
15 658
96 930
97 136
92 890
156
11 005
11 413
10 476
114
3 533
4 355
5 661
1 759
16 439
15 532
14 146

GLOBAL TUBERCULOSIS REPORT 2013

PATIENTS
NOTIFIED
(NEW AND
RETREAT)

3 612
2 991
3 093
3 254
125 135
156 928
159 017
147 592
2 611
4 180
4 916
5 415
2 120
2 030
2 333
2 387
12 124
15 145
15 840
15 207
7 090
11 324
11 606
11 641
1 816
2 259
2 070
1 950
108 401
106 083
103 981
99 149
11 404
13 138
12 785
11 971
3 456
6 668
7 965
8 132
19 475
25 106
26 722
26 209

1 100

339
18 762
738

0
0
0
1 373

123

0
2

0
1 983
6 636
30 816
30 395
0

52
66

27
68
53
0
9.3
15
36
95

Data for all years can be downloaded from www.who.int/tb/data

0

0

16 403

7$%/($+,9WHVWLQJDQGSURYLVLRQRI&37$57DQG,37–

Malawi

• 44

93 •

Mali

–

28 •

Mauritania

•0

–

Mauritius

• 91

96 •

–

94 •

Mozambique

Namibia

• 16

89 •

–

46 •

• 10

84 •

• 65

99 •

Niger

Nigeria

Rwanda

Sao Tome and
Principe
• 100

99 •

–

78 •

Senegal

Seychelles

–

100 •

–

87 •

• 22

84 •

–

95 •

Sierra Leone

South Africa

Swaziland

Togo

•0

91 •

• 25

86 •

•3

82 •

•2

100 •

•0

88 •

Uganda

United Republic
of Tanzania

Zambia

Zimbabwe

2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

NUMBER OF TB
% OF TB
PATIENTS WITH PATIENTS WITH
KNOWN HIV
KNOWN HIV
STATUS
STATUS
44
88
83
93

12 243
19 855
17 334
19 009

42
35
28
0.45
24
0.66

2 303
1 963
1 544
10
608
12

91
95
93
96

115
117
108
125

88
91
94
16
76
84
89

40 554
43 096
47 960
2 547
9 534
10 042
9 927

48
44
46
10
79
81
84
65
98
97
99
100
92
100
99

4 925
4 710
5 166
6 897
71 844
75 772
82 641
5 003
6 914
6 560
6 131
152
112
146
126

69
76
78

8 018
8 757
10 048

100
100
100

17
21
21

74
78
87
22
54
83
84

9 718
10 159
11 655
67 988
213 006
322 732
294 196

86
92
95
0
77
84
91
25
81
80
86
2.5
90
88
82
2
84
100
100
0
86
90
88

9 536
8 419
7 363
0
2 242
2 513
2 657
10 555
36 742
39 394
40 581
1 613
56 849
53 842
52 499
1 082
40 704
48 594
45 269
0
41 062
37 029
34 212

PATIENTS
NOTIFIED
(NEW AND
RETREAT)
27 610
22 536
20 854
20 463
4 884
5 448
5 573
5 602
2 218
2 489
1 820
2 636
127
123
116
130
33 718
46 174
47 452
50 827
15 894
12 625
11 938
11 145
8 224
10 345
10 714
11 207
66 848
90 447
93 050
97 853
7 680
7 065
6 784
6 208
152
122
146
127
10 120
11 591
11 588
12 819
14
17
21
21
6 930
13 195
12 943
13 354
302 467
396 554
389 974
349 582
8 864
11 146
9 180
7 739
2 635
2 897
2 980
2 912
41 809
45 546
49 018
47 211
64 200
63 453
61 148
63 892
53 267
48 616
48 594
45 277
54 891
47 557
41 305
38 720

NUMBER OF
HIV-POSITIVE
TB PATIENTS

% OF TESTED
TB PATIENTS
HIV-POSITIVE

% OF HIV% OF HIVNUMBER OF
POSITIVE TB POSITIVE TB HIV-POSITIVE
PATIENTS ON PATIENTS ON
PEOPLE
CPT
ART
PROVIDED IPT

8 447
12 476
10 341
11 296

69
63
60
59

92
94
89
88

49
46
60
81

416
404
425
0
90
12

18
21
28
0
15
100

75
72
42

52
69
100

0

61
100

0

2
8
8
10

1.7
6.8
7.4
8

100
100
100
100

50
75
62
90

24 574
26 538
27 979
1 465
5 227
4 990
4 688
152
405
334
431
1 241
17 736
19 553
19 342
2 276
2 199
1 855
1 601
5
13
15
18

61
62
58
58
55
50
47

97
91
98

25
29
55

13 164
17 064
17 317

93
98
99
43
37
6.6
31

44
54
72
34
0
4.8
16

13 989
14 428
11 906

59
68
80
15
97
97
99
0
92
100
100

33
43
56
13
72
75

1 750
1 107
2 257

0
54
100
100
37
48
64
100
100
100
100

8.2
7.1
8.3
18
25
26
23
45
32
28
26
3.3
12
10
14

776
877
882
2
1
4
3

9.7
10
8.8
5.9
19
14

85
85
90
100
100
75
67

976
902
1 343
35 299
128 457
211 128
190 093

10
8.9
12
52
60
65
65

6.4
25
26
100
74
77
74

19
28
69
33
54
46
54

7 788
6 480
5 666
0
632
667
625
7 523
19 836
20 725
20 376
841
21 662
20 632
20 269
614
26 571
26 737
24 309
0
31 849
27 562
23 957

82
77
77

93
95
98

35
51
66

28
27
24
71
54
53
50
52
38
38
39
57
65
55
54

72
77
87
25
90
93
94
61
92
95
96
75
87
93

49
67
76
10
24
32
49
22
35
38
54
68
48
53
60

78
74
70

88
94
26

45
60
18

Data for all years can be downloaded from www.who.int/tb/data

20 542

AFRICAN REGION

% OF TB PATIENTS WITH
KNOWN HIV STATUS
YEAR
2005–2012

0
0
0

426
0
0

1 062
1 466
146 247
372 994
369 747

1 934
0

0

GLOBAL TUBERCULOSIS REPORT 2013

173

7$%/($7HVWLQJIRU0'57%DQGQXPEHURIFRQILUPHGFDVHVRI0'57%±

YEAR

TOTAL
CONFIRMED
CASES OF
a

MDR-TB
Algeria

Angola

Benin

Botswana

Burkina Faso

Burundi

Cameroon

Cape Verde

Central African
Republic

Chad

Comoros

Congo

Côte d'Ivoire

Democratic
Republic
of the Congo
Equatorial
Guinea

Eritrea

Ethiopia

Gabon

Gambia

Ghana

Guinea

Guinea-Bissau

Kenya

Lesotho

Liberia

Madagascar

174

2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

NEW PULMONARY CASES
ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

74
56
180 (69–290)
3
40
45
28
15
20
25
106
46
53
3
31
42
38
24
6
24
35
63
153
0
0
0

NUMBER OF
b

BACT+VE
TESTED FOR
MDR-TB
809

130 (56–250)

29
1 700 (780–2 500)

800 (44–1 500)

54 (26–83)

17 (2.1–70)

31
103
0
26

140 (94–190)

120 (70–160)

488
151
349

150 (71–240)

150 (27–280)

79 (4.4–150)

1
1
7

120 (0.48–240)

22
0
1
0

670 (140–1 200)

510 (2.0–1 000)

0

9.8 (4.0–16)

6.1 (0.34–12)

0
0

9
15
28

9
0
130 (36–220)

3
0
0

320 (150–490)

160 (8.8–300)

0
0

2.5 (0.92–4.0)

1.7 (0.10–3.2)

250 (43–450)

200 (0.79–400)

28 (0.72–160)
0
0
0

47
50
30
221

580 (270–890)

440 (190–850)

0
0
1
0

87
121
81

2 900 (670–5 100)

2 100 (8.4–4 200)

22
12

0
3

0
–

11
0
140
212
284

79 (38–120)

2 000 (1 200–2 900)

–

35 (1.9–66)

1 600 (830–2 700)

42
73
469

0
0
0
0
0
1
4
7
20
20
31
78
69

170 (57–280)

100 (0.41–200)

9.9 (0–29)

9.9 (0.25–54)

390 (170–620)

240 (13–440)

250 (130–380)

47 (9.8–140)

45 (15–75)

33 (1.8–63)

2
6
44
112
166
225

2 800 (840–4 800)

1 800 (7.4–3 700)

117
64
46

170 (36–300)

77 (16–220)

3
9
10

0
0
215
5
8

0

0
6

0
50

92
78

5
0

130 (32–230)

170 (32–310)

110 (6.3–210)

94 (26–240)

60
9
7

PREVIOUSLY TREATED CASES
% OF
b

BACT+VE
TESTED FOR
MDR-TB
9.1
–
–
–
–
–
0.13
–
1.1
3.5
0
0.78
–
11
4.5
14
–
<0.1
<0.1
0.20
–
0.48
0
<0.1
–
0
–
0
–
–
0
0
–
0.25
0
–
–
0
0
0
–
–
–
–
–
–
–
–
0
0
<0.1
0
–
–
<0.1
<0.1
–
0
–
–
–
–
–
–
–
<0.1
0.15
0.99
–
–
–
–
–
–
–
0
0.62
–
0
0
3.9
<0.1
0.12
–
–
–
–
–
0
–
0.25
0.21
–
–
–
0.15
–
0
–
–
–
0.36
<0.1
<0.1

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

52 (6.5–170)

860 (330–1 400)

37 (23–55)

29 (11–47)

75 (29–120)

31 (11–52)

160 (57–270)

3.6 (1.4–5.9)

97 (37–190)

160 (63–260)

0.77 (0.30–1.2)

49 (17–81)

140 (49–240)

760 (260–1 300)

–

44 (17–71)

480 (230–870)

67 (23–110)

0 (0–26)

160 (61–260)

200 (100–340)

12 (4.6–19)

980 (340–1 600)

94 (20–260)

18 (7.0–29)

76 (9.3–260)

NUMBER OF
% OF NOTIFIED
NOTIFIED
TESTED FOR
TESTED FOR
MDR-TB
MDR-TB
164
23
–
–
–
–
–
–
45
1.0
107
32
6
2.9
152
58
110
39
–
286
27
90
10
149
34
126
39
117
21
68
14
72
19
–
2
0.60
6
1.9
23
7.5
–
35
2.3
–
80
5.0
–
–
0
0
0
0
–
0
0
56
16
–
–
0
0
0
0
0
0
–
–
–
–
–
–
–
–
0
0
72
4.7
29
2.0
365
26
–
100
1.2
160
2.0
95
1.3
–
0
0
–
–
–
–
–
–
–
510
10
139
3.0
180
4.4
–
–
–
–
–
–
–
0
0
2
0.38
21
2.1
61
6.9
44
5.3
34
7.4
26
4.0
26
3.9
–
–
–
–
–
1829
20
706
6.7
1195
12
1183
12
–
–
–
28
1.7
–
0
0
–
–
–
24
1.1
64
2.9
63
3.2

a

TOTAL CONFIRMED CASES OF MDR-TB includes cases with unknown previous treatment history (i.e. not included under NEW CASES or PREVIOUSLY TREATED CASES).

b

BACT+VE = bacteriologically positive cases.

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($7HVWLQJIRU0'57%DQGQXPEHURIFRQILUPHGFDVHVRI0'57%±

a

MDR-TB
Malawi

Mali

Mauritania

Mauritius

Mozambique

Namibia

Niger

Nigeria

Rwanda

Sao Tome and
Principe

Senegal

Seychelles

Sierra Leone

South Africa

Swaziland

Togo

Uganda

United Republic
of Tanzania

Zambia

Zimbabwe

a
b

2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

9
40
26
27
2
12
10
12
11
35
8
1
0
2
1
0
115
165
283
266
214
192
210
39
18
35
21
95
107
35
90
76
58
0
4
8
38
50
27
0
0
0

NEW PULMONARY CASES
ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

96 (45–150)

56 (18–130)

140 (60–210)

76 (4.2–140)

59 (26–92)

34 (1.9–64)

0 (0–0)

0 (0–3.6)

2 000 (1 300–2 700)

630 (510–750)

270 (110–420)

3 600 (2 700–4 500)

1 400 (900–2 000)

NUMBER OF
b

BACT+VE
TESTED FOR
MDR-TB
871
102
0
0
0
23
161
3
1
114
105
100
121
113
80
206
205

260 (190–350)

160 (9.0–300)

2 500 (1 800–3 400)

0
1
0
27
12
11
57
171

240 (170–310)

180 (120–270)

15 (11–19)

1.7 (0.10–3.3)

2
16

220 (70–500)

41
14
25

0 (0–0)

0 (0–3.9)

0
14

220 (0–460)

100 (2.7–570)

400 (170–620)

8
2000
7386
10085
15419
326
332
280
2
4
2
46
93
71
89
10
34
68
42

80
17
118
149

8 100 (6 900–9 400)

4 600 (3 700–5 800)
148

730 (560–890)

430 (270–590)

77 (35–120)

41 (2.3–78)

1 000 (660–1 300)

500 (13–1 000)

620 (290–940)

930 (430–1 400)

540 (230–860)

500 (140–1 300)

86
0
358
316
196
276
201
83
639

98 (12–350)

570 (300–960)

0
360

PREVIOUSLY TREATED CASES
% OF
b

BACT+VE
TESTED FOR
MDR-TB
–
10
1.5
0
0
0
–
0.62
12
–
0.30
<0.1
100
100
100
100
0.63
0.39
1.1
0.98
–
–
–
–
–
0
<0.1
0
–
<0.1
<0.1
<0.1
1.4
4.0
–
–
–
–
1.9
27
–
0.53
0.18
0.30
–
–
0
82
–
–
–
–
–
–
–
–
–
2.9
–
–
–
–
4.1
0
–
1.5
1.2
0.79
0.60
0.44
0.34
2.5
–
–
–
–
–
–
0
3.0

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

40 (27–57)

60 (23–96)

25 (9.8–41)

0 (0–2.4)

540 (0–1 100)

370 (290–470)

110 (42–180)

1 100 (770–1 500)

63 (51–76)

13 (7.1–15)

180 (76–340)

0 (0–1.7)

120 (26–280)

3 500 (2 800–4 300)

290 (250–340)

36 (14–58)

470 (260–750)

0 (0–160)

520 (260–900)

360 (76–970)

NUMBER OF
% OF NOTIFIED
NOTIFIED
TESTED FOR
TESTED FOR
MDR-TB
MDR-TB
917
29
449
20
552
26
27
3.3
0
0
12
3.4
–
39
13
30
15
–
4
3.9
–
3
60
7
100
5
100
4
100
305
16
251
6.2
443
10
243
5.4
–
–
–
–
–
47
7.0
21
3.6
35
6.2
–
19
0.21
76
0.86
94
1.2
0
0
431
68
–
–
–
–
2
12
8
53
–
66
6.4
97
8.7
113
10
–
–
1
–
2
100
–
–
–
–
–
–
–
–
–
505
35
–
–
–
–
83
39
2
1.1
–
356
9.0
360
9.0
748
19
405
8.0
246
6.5
17
0.59
108
3.9
–
–
–
–
–
–
0
0
258
6.0

AFRICAN REGION

YEAR

TOTAL
CONFIRMED
CASES OF

TOTAL CONFIRMED CASES OF MDR-TB includes cases with unknown previous treatment history (i.e. not included under NEW CASES or PREVIOUSLY TREATED CASES).
BACT+VE = bacteriologically positive cases.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

175

7$%/($1HZVPHDUSRVLWLYHFDVHQRWLILFDWLRQE\DJHDQGVH[±
MALE
YEAR

Algeria

Angola

Benin

Botswana

Burkina Faso

Burundi

Cameroon

Cape Verde

Central African
Republic

Chad

Comoros

Congo

Côte d'Ivoire

Democratic
Republic
of the Congo

Equatorial
Guinea

Eritrea

Ethiopia

Gabon

Gambia

176

1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012

FEMALE

0–14

15–24

25–34

35–44

45–54

55–64

65+

59
53
52
42
29
386
186
520
448
501
390
14
19
21
18
21
23

927
1 309
1 203
1 147
1 102
724
999
2 549
2 900
3 000
2 804
186
277
306
314
320
314

1 516
1 841
1 669
1 513
1 467
562
1 003
2 797
3 584
3 792
3 627
352
428
595
631
650
595

610
919
825
881
857
346
912
1 918
2 415
2 386
2 529
306
327
396
443
497
524

491
473
513
483
464
224
482
1 255
1 424
1 395
1 427
176
213
270
267
353
329

234
314
392
345
354
155
312
665
691
680
732
101
103
135
164
210
179

299
426
397
347
349
14
194
461
355
455
424
92
74
87
85
107
121

25
27
45
36
40
4
12
18
20
22
25
5

185
260
256
220
207
67
91
181
231
265
277
128

605
563
590
464
394
133
274
430
620
708
769
238

488
506
477
354
333
124
252
370
493
582
631
224

267
272
239
206
190
62
133
273
328
375
423
73

135
135
137
110
79
48
68
144
224
262
250
32

96
97
107
94
75
29
65
113
173
196
198
19

34
56
37
45
20
41
134
106
114
108

352
481
484
447
208
518
1 472
1 497
1 580
1 597

591
773
743
801
569
842
2 482
2 750
2 931
2 900

525
651
620
667
323
584
1 766
1 996
2 139
2 182

372
570
504
461
287
284
1 035
1 314
1 283
1 304

111
270
235
233
204
130
463
559
625
658

55
157
98
103
164
75
289
329
361
375

0

22

23

26

9

2

8

0
0
38

17
29
162

43
36
356

35
34
206

31
24
120

3
8
40

3
2
18

29
78
70
73

40
379
362
502

1 136
633
576
799

160
468
467
660

26
251
269
360

35
135
119
158

15
63
59
92

25
76
92
68
0
0
0

194
382
469
405
18
18
12

535
850
951
842
13
7
9

409
666
764
634
9
14
6

229
379
418
376
7
9
4

123
173
184
210
8
3
2

82
99
121
88
4
4
4

0
16

10
9
265

13
15
409

9
8
221

5
4
73

2
6
44

5
6
15

41
58
46
41

435
453
563
989

672
705
716
2 092

424
462
519
1 344

203
222
276
759

77
80
113
283

55
76
72
130

128
159
189
163
373
485
1 321
1 707
1 579
1 439
8

1 346
1 751
1 743
1 743
1 572
4 048
6 675
6 859
6 640
6 612
15

2 449
2 858
3 043
3 087
2 382
5 833
9 808
10 412
9 872
10 274
45

1 606
1 882
1 852
2 017
1 890
4 151
7 577
9 134
8 932
9 361
37

888
1 010
1 072
1 032
1 184
2 549
5 022
6 464
6 415
6 612
15

422
505
601
552
634
1 295
2 637
3 641
3 584
3 698
11

385
375
348
430
289
602
1 499
1 907
1 911
1 941
7

10
11

71
77

80
90

59
89

35
59

16
22

10
12

9
9
10
0
2
247
915
1 109
1 582
1 847

70
68
93

75
73
109

57
50
81

32
45
51

25
51
37

20
39
60

84
1 221
5 095
6 726
7 400
7 835

105
1 017
5 187
6 181
7 785
9 246

90
541
3 082
3 454
4 451
3 881

62
276
1 495
1 985
2 746
2 771

39
142
610
1 027
1 473
1 218

51
51
397
475
822
771

UNKNOWN

0

0

0
0
0

0
0
0

0
0
0

0
0
0

0–14

15–24

25–34

35–44

45–54

55–64

65+

36
102
79
58
60
371
247
704
558
708
592
26
36
25
29
41
39

1 005
1 044
1 086
1 050
917
707
1 142
2 926
2 763
2 731
2 501
148
239
249
265
288
264

1 293
820
826
787
773
443
1 091
2 682
2 594
2 563
2 540
197
275
331
382
385
346

746
389
417
383
382
264
844
1 797
1 688
1 683
1 617
118
149
145
200
246
221

314
270
251
211
198
248
417
1 138
958
1 006
1 028
69
76
89
98
119
105

208
229
222
202
229
130
200
581
482
457
529
32
45
51
42
42
65

312
465
367
341
329
18
120
417
286
346
384
22
25
39
35
52
46

37
45
68
65
63
7
7
15
33
31
27
19

335
321
338
286
267
76
59
125
158
163
160
109

469
491
509
421
402
53
128
248
259
277
288
124

262
253
301
211
193
39
101
174
198
221
191
89

98
97
119
105
109
26
45
109
124
146
156
33

57
55
56
48
43
11
38
54
97
110
106
12

36
48
53
49
31
10
14
40
83
92
82
4

46
78
56
74
9
63
226
172
178
184

298
390
345
338
185
368
1 467
1 474
1 461
1 417

399
421
374
367
313
530
1 788
2 031
2 022
2 053

288
332
263
283
223
293
1 028
1 121
1 177
1 177

122
225
180
162
153
139
503
642
581
579

36
99
81
64
106
60
205
290
281
295

33
87
40
30
93
33
143
183
194
187

0

0

0
0
0

0
0
0

0
0
0

0
0
0

2

9

16

4

5

3

6

4
0
39

14
19
233

15
13
350

4
9
145

6
8
57

3
3
21

4
4
9

30
88
96
101

32
367
382
511

420
576
530
689

145
319
289
370

30
155
162
191

40
73
62
96

15
44
26
39

28
59
84
51
1
1
2

148
274
296
273
13
9
10

298
413
438
403
9
6
7

211
263
298
227
8
12
4

148
158
166
135
6
1
8

59
79
109
91
5
2
3

27
44
44
46
2
1
8

2
1
17

8
5
296

4
7
353

2
5
167

1
1
61

0
1
38

1
3
11

49
72
63
99

409
408
438
810

510
463
482
813

296
332
349
497

152
200
171
273

70
88
68
105

56
97
108
19

193
246
244
204
331
718
1 695
1 987
1 800
1 699
2

1 280
1 431
1 358
1 306
1 223
4 422
7 570
7 199
6 802
6 598
18

1 756
1 819
1 838
1 870
1 532
5 146
8 501
9 120
8 742
8 406
28

989
1 051
1 044
1 120
1 232
3 309
5 832
6 721
6 541
6 471
20

528
531
560
536
863
1 724
3 898
4 579
4 537
4 131
4

232
304
301
337
427
855
2 054
2 612
2 671
2 625
7

201
209
223
263
137
351
951
1 311
1 295
1 257
1

0
0

13
15

80
76

57
81

45
46

26
21

9
9

6
3

0
0

0

10
8
3

100
67
88

87
127
111

71
72
79

21
39
43

12
21
31

8
18
36

0

4
283
1 037
1 326
1 608
1 983

86
908
4 699
5 885
5 708
6 570

98
781
4 424
5 663
6 480
7 917

74
382
2 105
2 730
3 439
3 069

45
152
976
1 296
1 950
1 564

19
64
366
513
855
719

20
15
122
155
335
303

0
0

1
4

0
0
0

0

0

0

0

3

45

74

80

54

30

15

9

47

54

28

25

19

3

13
15
34
42
3

123
145
240
236
68

199
223
269
286
181

140
208
229
228
88

70
130
144
166
72

38
89
86
101
29

25
91
66
41
24

19
13
25
29
4

128
110
177
185
39

123
164
188
165
61

88
122
125
109
44

29
100
74
78
25

29
86
44
45
12

18
64
39
34
8

13
9
14
7

133
194
183
210

292
314
271
331

206
184
181
191

62
141
136
107

53
68
87
80

44
39
56
54

2
6
16
16

84
104
103
123

87
121
112
106

64
71
88
89

38
35
63
41

22
40
32
32

27
18
33
42

GLOBAL TUBERCULOSIS REPORT 2013

UNKNOWN

0
0
0

0
0
0

Data for all years can be downloaded from www.who.int/tb/data

0
0

8
6

0
0
0

0

0

0

0

0
0
0

0
0
0

MALE:FEMALE
RATIO
–
1.1
1.6
1.6
1.6
1.6
1.1
1.0
0.99
1.3
1.3
1.3
2.0
1.7
1.9
1.8
1.8
1.9
–
1.4
1.4
1.3
1.3
1.2
2.1
2.3
2.0
2.2
2.3
2.5
1.8
–
1.7
1.8
2.0
2.1
1.6
1.7
1.4
1.4
1.5
1.5
–
–
2.0
–
2.6
2.4
1.1
–
2.0
1.2
1.2
1.3
–
–
1.7
2.0
2.1
2.1
1.3
1.7
0.88
–
2.4
2.1
1.1
–
–
1.2
1.2
1.4
2.2
–
1.4
1.5
1.6
1.6
1.4
1.1
1.1
1.2
1.2
1.3
1.7
–
–
1.2
1.4
–
–
0.93
0.95
1.1
–
1.3
1.4
1.2
1.2
1.3
1.2
–
1.6
–
1.4
1.4
1.6
1.7
2.4
–
2.5
2.4
2.1
2.2

7$%/($1HZVPHDUSRVLWLYHFDVHQRWLILFDWLRQE\DJHDQGVH[±

Ghana

Guinea

Guinea-Bissau

Kenya

Lesotho

Liberia

Madagascar

Malawi

Mali

Mauritania

Mauritius

Mozambique

Namibia

Niger

Nigeria

Rwanda

Sao Tome and
Principe

Senegal

Seychelles

FEMALE

0–14

15–24

25–34

35–44

45–54

55–64

65+

1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012

42
73
49
63
50
30
18
39
51
61
45
28

223
550
592
570
550
559
244
551
749
679
1 051
761

397
1 266
1 201
1 146
1 127
1 051
538
860
1 165
877
1 537
1 104

398
1 115
1 311
1 301
1 328
1 271
357
570
778
982
955
791

302
811
944
1 030
955
921
189
282
463
876
541
383

190
495
462
540
491
512
98
203
195
565
293
190

112
426
414
447
456
462
61
103
130
289
197
120

2
14
18
6
7
154
264
359
357
356
393
9
8
32
16
19
15

52
116
164
140
145
2 072
3 739
4 790
4 698
4 773
4 893
108
165
395
222
179
204

92
167
219
230
262
3 073
6 653
8 832
7 945
8 376
8 149
214
458
695
607
584
580

80
153
183
181
183
1 675
3 548
5 069
5 077
5 201
5 302
256
517
397
497
493
427

64
130
141
104
115
920
1 630
2 521
2 509
2 660
2 493
189
395
148
364
329
295

39
72
80
65
63
485
630
1 031
994
1 045
1 099
96
198
82
244
245
196

19
42
43
36
38
296
414
590
658
665
669
88
76
37
133
121
114

12
26
90
67
65
79

133
240
338
382
382
791

196
352
621
595
627
1 289

127
333
510
727
667
1 173

52
155
295
440
406
630

17
74
114
194
129
423

26
65
21
87
83
242

98
204
146
177
25
50
58
50
70
52
27
23
26
94
25
25

1 159
1 721
1 807
1 725
493
653
622
565
519
495
72
206
350
381
370
405

1 867
1 621
2 764
2 474
1 195
1 476
1 653
1 509
1 486
1 537
357
430
628
707
772
731

1 732
2 525
2 495
2 460
833
1 113
1 031
985
1 050
1 051
294
396
539
526
515
547

1 349
1 782
1 938
1 927
519
585
549
485
440
471
181
297
365
354
352
377

582
960
1 044
1 059
215
245
279
275
238
292
138
235
263
227
267
257

333
485
522
490
89
114
157
187
201
204
102
144
193
207
230
211

17
36
22
2
2
0
0
2
187

192
165
204
17
6
10
9
10
11
1 136

295
185
302
13
9
15
9
13
14
1 475

206
131
195
22
18
21
13
9
16
1 338

137
106
139
27
19
20
23
17
17
1 022

99
58
114
13
14
10
15
10
11
664

76
55
114
8
8
6
7
8
7
320

0
18
98
36
48
61

68
269
355
359
337
358

235
874
1 027
852
844
810

113
665
874
680
660
686

55
300
365
287
361
292

21
147
146
146
152
157

29
35
44
50
40
450
157
325
521
529
538

270
557
669
709
702
845
2 173
3 824
4 457
4 549
5 026

174
1 204
1 587
1 673
1 752
921
3 164
6 758
9 186
9 520
10 382

441
819
988
1 025
1 133
937
1 836
4 544
6 218
6 550
7 684

252
497
615
646
747
557
1 091
2 863
3 804
4 230
4 589

155
45
48
42
22

466
494
430
423
375

974
713
741
795
768

824
592
526
500
519

1
2
0
0
1
94
60
71
81
75
84
0

5
5
10
5
6
717
772
1 050
1 351
1 264
1 454
2

0
0
0
0

2
0
0
0

11
7
14
9
11
1 219
1 297
1 561
1 793
1 835
2 036
0
2
1
0
1
1

4
6
7
8
8
813
857
904
972
981
1 121
1
4
2
6
0
2

UNKNOWN

0–14

15–24

25–34

35–44

45–54

55–64

65+

40
74
68
64
52
51
28
66
65
51
85
49

199
456
450
446
470
418
202
314
594
549
709
505

272
791
693
667
699
563
255
446
583
739
688
509

205
566
527
560
614
468
153
245
354
751
432
323

122
338
366
369
390
332
64
114
203
405
219
134

88
179
207
204
174
188
37
82
94
145
109
61

48
176
221
249
260
271
19
45
55
72
73
57

4
13
30
12
7
187
416
577
549
629
603
14
11
19
27
23
30

30
78
100
119
121
1 802
3 916
5 144
4 044
4 183
4 097
106
222
226
283
311
309

46
110
161
122
157
1 759
4 363
6 521
5 112
4 917
4 975
125
336
721
597
572
571

47
92
133
90
98
741
1 874
2 781
2 372
2 434
2 363
71
195
616
329
307
296

24
82
80
56
56
411
831
1 266
1 056
1 025
993
49
83
494
169
185
143

15
44
38
44
33
242
347
593
544
477
529
17
36
297
64
84
71

12
19
19
25
25
117
148
315
345
344
379
19
29
121
48
58
47

21
37
254
67
61
100

140
232
339
329
354
799

149
297
488
433
535
1 108

88
171
259
517
605
744

28
108
171
285
292
340

16
52
151
88
79
230

16
25
99
50
57
78

150
323
252
242
65
66
84
103
79
71
31
14
33
31
42
34

1 012
1 621
1 726
1 720
802
1 038
913
610
601
538
132
174
208
265
255
253

1 451
1 943
2 031
1 848
1 028
1 481
1 598
1 196
1 119
1 057
184
232
348
337
393
344

1 047
1 376
1 503
1 420
573
831
859
661
660
609
128
152
245
247
223
239

614
946
978
914
294
401
386
314
283
298
107
106
152
144
147
137

248
397
462
474
108
148
180
198
161
156
61
75
101
96
118
89

129
192
188
199
45
64
74
102
96
120
52
43
72
70
68
77

14
28
25
2
1
0
0
0
226

90
68
112
4
5
4
7
7
11
994

104
72
81
12
8
5
9
12
7
1 314

82
47
88
10
8
5
4
2
8
1 016

52
36
73
8
6
11
4
3
2
551

29
19
46
4
7
2
3
6
8
234

29
20
28
4
4
1
2
3
4
89

6
81
120
126
138
137

5
16
105
67
78
81

49
352
399
429
427
394

78
654
809
685
653
582

50
348
525
382
410
396

16
161
213
206
185
198

1
76
95
122
100
84

0
52
91
87
110
97

151
350
415
436
444
611
566
1 464
1 974
2 248
2 449

78
198
342
347
360
515
463
950
1 363
1 443
1 686

31
34
39
50
48
404
239
482
595
578
649

123
214
272
285
260
842
2 934
3 996
4 182
4 198
4 652

206
388
418
449
485
795
2 434
4 884
6 117
6 168
6 762

168
330
347
323
302
770
1 110
2 448
3 431
3 574
4 084

151
223
238
278
237
724
676
1 350
1 846
2 014
2 243

63
131
174
189
214
654
344
745
1 040
1 112
1 290

9
70
135
147
124
451
231
415
682
724
867

393
408
325
376
341

129
142
202
210
214

56
71
126
124
123

105
73
48
50
40

396
483
399
358
327

473
442
448
398
393

309
262
261
235
208

109
157
128
146
116

52
60
65
87
66

14
29
38
67
59

7
4
1
7
8
408
470
533
590
582
597
1
1
1
0
0
2

3
5
0
1
2
300
279
274
329
335
365
2
1
0
0
0
0

10
2
1
4
0
213
189
236
221
214
224
1

3
1
0
2
0
84
77
83
81
88
125
0

7
4
5
2
6
428
521
709
835
807
836
0
0
2
1
0

5
3
3
4
6
283
376
351
332
362
383
0
0
1
0
0
1

7
2
2
1
0
203
217
185
217
208
263
0
1
0
0
0
1

4
3
0
0
0
126
107
116
136
144
155
0
1
0
0
0
0

15
0
0
0
1
72
61
81
105
74
90
1

0
0
0
0

15
5
4
10
10
461
540
568
643
664
715
1
1
1
0
0
1

0
1
0
0

0

0
0
10

0

0

0
0
0

0
0
0

0
0

0

0
0
0

0
0

0
0
0

0

0
0
0

0
89
0

0
0
0

Data for all years can be downloaded from www.who.int/tb/data

0
0
0
1

UNKNOWN

0

0
0
4

0

0

0
0
0

0
0
0

0
0

0

0
0
0

0
0

0
0
0

0

0
0
0

0
43
0

0
0
0

MALE:FEMALE
RATIO
1.7
1.8
2.0
2.0
1.9
2.1
2.0
2.0
1.8
1.6
2.0
2.1
–
2.0
1.6
1.5
1.6
1.6
1.6
1.4
1.3
1.6
1.6
1.6
2.4
2.0
0.72
1.4
1.3
1.2
–
1.2
1.4
1.1
1.4
1.2
1.4
–
1.5
1.4
1.5
1.5
1.2
1.1
1.1
1.3
1.3
1.4
1.7
2.2
2.0
2.1
2.0
2.2
–
–
–
2.6
2.5
2.4
2.3
1.9
2.9
2.6
2.0
2.0
1.4
–
–
–
–
–
2.5
1.4
1.3
1.3
1.3
1.4
–
1.9
2.6
2.9
2.8
3.1
1.0
1.2
1.4
1.5
1.6
1.6
–
2.1
1.6
1.7
1.8
2.0
–
0.73
1.7
2.4
1.8
1.6
2.3
2.1
2.2
2.3
2.2
2.3
3.5
2.7
3.0
3.5
1.0
1.2

GLOBAL TUBERCULOSIS REPORT 2013

AFRICAN REGION

MALE
YEAR

177

7$%/($1HZVPHDUSRVLWLYHFDVHQRWLILFDWLRQE\DJHDQGVH[±
MALE

Sierra Leone

South Africa

Swaziland

Togo

Uganda

United Republic
of Tanzania

Zambia

Zimbabwe



FEMALE

YEAR

0–14

15–24

25–34

35–44

45–54

55–64

65+

1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012

10
18
45
64
75
70

184
287
490
718
825
858

305
486
792
1 176
1 224
1 324

201
361
651
1 076
1 099
1 213

99
190
397
663
781
841

47
113
226
320
334
416

22
47
124
254
287
274

116
2 035
1 496
1 472
1 132
4
11
9
30
16
18
7
4
11
21
15
9
370
283
257
268
295
272
183
200
190
232
190
208
91
349
135

723
10 422
9 925
9 772
9 074
59
130
162
207
161
163
95
101
177
150
169
171
1 193
1 511
1 598
2 055
2 075
2 174
2 108
2 357
2 062
1 975
1 975
2 086
659
2 175
1 240

1 999
20 576
20 855
20 487
19 894
117
352
406
537
459
479
151
168
320
350
340
338
2 491
3 497
4 075
4 735
5 044
5 029
4 091
4 836
4 939
4 493
4 405
4 707
1 668
2 610
3 166

2 135
19 465
19 842
19 360
18 510
130
249
285
369
318
332
123
144
283
358
350
341
1 797
2 479
3 209
4 133
4 613
4 493
2 916
3 430
4 025
4 141
4 073
4 397
1 124
3 045
2 160

1 146
11 143
12 386
12 111
11 331
98
138
139
192
158
168
82
109
125
217
234
237
1 115
1 279
1 576
2 214
2 466
2 479
1 754
2 022
2 310
2 427
2 402
2 435
487
435
917

435
4 124
5 155
5 220
5 054
40
37
57
109
69
84
64
48
79
116
123
121
602
607
725
905
994
1 015
1 007
1 202
1 279
1 309
1 211
1 293
231
261
358

212
1 705
2 211
2 164
2 085
16
17
27
50
46
38
49
39
69
80
85
87
323
395
539
613
604
633
640
834
1 054
1 161
1 127
1 114
130
174
321

105
141

1 033
1 003

2 897
3 088

2 194
2 412

810
846

280
319

207
220

210
150
152
120

837
710
784
783

2 264
2 208
2 467
2 421

1 855
1 682
2 071
2 086

762
761
780
796

295
350
377
360

656
252
278
271

GLOBAL TUBERCULOSIS REPORT 2013

UNKNOWN

0

0
0
0

0
0

0

16
423
21

0

0
0
0

0–14

15–24

25–34

35–44

45–54

55–64

65+

18
27
54
77
115
80

165
249
393
648
678
703

193
298
518
742
796
861

110
225
312
556
543
667

65
92
207
293
343
391

24
49
114
180
219
201

11
30
47
131
116
132

122
2 561
1 933
1 932
1 545
5
10
14
51
35
39
9
13
23
39
11
17
402
400
371
401
400
364
201
257
271
248
221
282
129
150
168

1 283
13 632
13 023
12 751
11 547
52
198
318
354
281
284
80
107
157
163
167
165
1 376
1 649
1 811
1 964
2 092
2 194
1 904
2 106
1 852
1 689
1 660
1 651
1 125
932
1 507

1 716
19 343
20 205
19 250
17 452
57
298
453
662
495
535
96
124
236
285
277
287
1 845
2 782
3 099
2 923
2 853
2 912
2 532
3 426
3 521
2 988
2 896
2 906
1 779
1 118
2 463

933
11 338
12 910
12 807
11 430
39
62
207
276
220
242
45
50
146
148
146
154
1 104
1 510
1 800
1 691
1 809
1 733
1 324
1 738
1 892
2 013
2 140
2 108
717
1 305
1 433

423
5 416
6 873
6 955
5 939
29
62
73
104
86
88
38
36
67
78
89
109
635
671
818
924
973
864
735
868
968
1 044
944
1 022
257
186
569

167
2 352
3 165
3 266
2 846
8
24
21
54
40
51
23
24
41
62
50
48
312
316
389
365
409
419
380
494
547
578
490
507
117
112
235

80
1 348
2 128
2 223
2 059
6
5
8
16
24
27
15
15
32
29
38
28
113
163
257
248
313
281
179
269
354
471
381
422
63
75
185

151
180

940
1 024

1 683
1 646

1 063
1 077

422
376

162
189

99
124

269
173
174
173

1 136
974
1 084
939

2 242
2 185
2 161
2 053

1 255
1 283
1 386
1 286

578
490
448
483

193
265
274
231

603
171
160
161

UNKNOWN

Data for all years can be downloaded from www.who.int/tb/data

0

0
0
0

0
0

0

1
252
33

0

0
0
0

MALE:FEMALE
RATIO
1.5
1.5
1.7
1.6
1.6
1.6
–
1.4
1.2
1.2
1.2
1.3
2.4
1.4
0.99
0.98
1.0
1.0
1.9
1.7
1.5
1.6
1.7
1.6
1.4
1.3
1.4
1.8
1.8
1.8
1.8
1.6
1.7
1.7
1.8
1.8
1.0
2.3
1.3
–
1.7
1.7
–
–
1.1
1.1
1.2
1.3

7$%/($/DERUDWRULHV173VHUYLFHVGUXJPDQDJHPHQWDQGLQIHFWLRQFRQWURO
LABORATORIES

FREE THROUGH NTP

SECONDNUMBER OF
SMEAR LABS % OF SMEAR
CULTURE
DST b LABS
LPAc LABS
LABS USING LABS PER 5M
LINE DST
LABS USING
PER 100K
PER 5M
PER 5M
a
POPULATION
POPULATION POPULATION POPULATION XPERT MTB/RIF AVAILABLE
LED

Algeria
Angola

0.6
0.6

0
–

3.8
0.5

0.3
0.5

0.1

1

Benin

0.8

9

0.5

0.5

0.5

1

Botswana

2.6

21

2.5

2.5

2.5

5

Burkina Faso

0.7

0

0.3

0.3

0.9

0

Burundi

1.7

9

0.5

0

0

0

Cameroon

1.1

4

0.9

0.5

0.5

1

Cape Verde

3.2

0

0

0

0

1

Central African Republic
Chad
Comoros

1.6
0.6

0
0
–

1.1
0

1.1
0

0
0

1
0

Congo

0.8

3

Côte d'Ivoire
Democratic Republic
of the Congo
Equatorial Guinea

0.6

0

0.5

0.5

0

0

2.3

0

0.3

0.2

<0.1

26

NRLd

In country Yes
Yes
In and out
Yes
of country
Out of
Yes
country
Out of
Yes
country
Out of
country
In country
Out of
country
No
No

TB NOTIF.
RIFAMPICIN
RATE PER
USED
100 000
THROUGHOUT
HEALTH-CARE
TREATMENT
WORKERS

Yes (all suspects)
Yes (all suspects)
Yes (if TB is
confirmed)

Yes
Yes

Yes
No

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

No

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes
Yes
Yes

Yes (all suspects)
Yes (all suspects)
Yes (all suspects)
Yes (if TB is
confirmed)
Yes (all suspects)
Yes (if TB is
confirmed)

Yes
Yes
Yes

Yes
Yes
Yes

No Yes
No Yes
In and out
Yes
of country

Yes

Yes

Yes

Yes

Yes

Yes

1.3

0

0

0

0

0

No Yes

2.8
0.9
1.8
1.1

0
0
31
1

0.3
3.1
2.8
0.6

<0.1
3.1
2.8
0.6

0.3
0
0
0.6

7
0
0
0

No
No
No
No

Guinea

0.5

6

0.4

0.4

0

1

Guinea-Bissau

1.3

0

3.0

0

0

1

Kenya

4.2

8

0.2

0.2

0.2

15

Lesotho

0.9

17

2.4

2.4

2.4

5

Liberia

3.9

0

0

0

0

0

Madagascar
Malawi
Mali
Mauritania

1.0
1.4
0.4
1.4

6
19
0
–

0.2
1.3
1.0
1.3

0.2
0.6
0.3
1.3

0.2
0.3
0.3

5
19
0

Mauritius

–

Yes
Yes
Yes
Yes

No Yes
Out of
country
In and out
of country
Out of
country
Out of
country
No
No
No
No
Out of
country
Out of
country
Out of
country
Out of
country
Out of
country

Yes

Yes

Yes

Yes

Yes

Yes

Yes

Yes

Yes (if TB is
confirmed)
Yes (all suspects)
Yes (all suspects)
Yes (all suspects)
Yes (all suspects)

Yes

Yes

Yes
Yes
Yes
Yes

Yes
Yes
Yes
Yes

Yes
Yes
Yes
Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes (all suspects)
Yes (all suspects)
Yes (if TB is
confirmed)

Yes
Yes

Yes
Yes

Yes

Yes

No

0.4

0

12

Namibia

1.4

100

2.2

2.2

2.2

1

Niger

1.1

1

0.3

0.3

0

0

Nigeria

0.8

2

0.1

<0.1

0.1

32

Rwanda
Sao Tome and Principe

1.7
4.3

13
0

0.9
0

0.9
0

0.9
0

6
0

Yes
No Yes

Senegal

0.8

0

1.1

0.7

0.7

3

In country Yes

0
1.4
4.1

0
1.4
4.1

0
1.4
4.1

0
100
19

Out of
Yes
country
No Yes
In country Yes
Yes

Yes (all suspects)

Yes

Yes

Yes
Yes
Yes

Yes
Yes
Yes

Togo

1.7

0

0.8

0.8

0

1

No Yes

Uganda

3.2

8

0.6

0.6

0.6

25

Yes

Yes (all suspects)
Yes (all suspects)
Yes (all suspects)
Yes (if TB is
confirmed)
Yes (all suspects)

United Republic of Tanzania

2.0

17

0.4

0.1

0.3

13

Yes

Yes (all suspects)

Yes

Yes

Zambia
Zimbabwe

1.5
1.3

1
1

1.1
0.7

17

In country Yes
No Yes

Yes (all suspects)
Yes (all suspects)

Yes
Yes

Yes
Yes

c
d

0
97
21

Yes

Yes (all suspects)
Yes (all suspects)

0.6

–

Yes
Yes
Yes
Yes
Yes

Yes (all suspects)

9

2.7
0.4
1.5

Yes
Yes
Yes
Yes
Yes

Yes

1.2

Seychelles

Yes (for smearpositive TB)
Yes (all suspects)
No
Yes (all suspects)
Yes (all suspects)
Yes (if TB is
confirmed)

Yes

Mozambique

b

815

0.7

0

Yes

Yes

Yes

Yes

AFRICAN REGION

Eritrea

a

1 870

–

Ethiopia
Gabon
Gambia
Ghana

Sierra Leone
South Africa
Swaziland

TB DIAGNOSIS

FIRSTLINE
DRUGS

0

199

28

104

LED = Light emitting diode microscopes
DST = Drug susceptibility testing
LPA = Line probe assay
NRL = National Reference Laboratory

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

179

7$%/($0HDVXUHGSHUFHQWDJHRI7%FDVHVZLWK0'57%DPRVWUHFHQW\HDUDYDLODEOH
New TB cases
Algeria
Angola
Benin
Botswana
Burkina Faso
Burundi
Cameroon
Cape Verde
Central African Republic
Chad
Comoros
Congo
Côte d'Ivoire
Democratic Republic
of the Congo
Equatorial Guinea
Eritrea
Ethiopia
Gabon
Gambia
Ghana
Guinea
Guinea-Bissau
Kenya
Lesotho
Liberia
Madagascar
Malawi
Mali
Mauritania
Mauritius
Mozambique
Namibia
Niger
Nigeria
Rwanda
Sao Tome and Principe
Senegal
Seychelles
Sierra Leone
South Africa
Swaziland
Togo
Uganda

Previously treated TB cases

Year

Source

Coverage

Percentage

Year

Source

2002

Survey

National

Coverage

Percentage

1.4 (0.60–2.7)

2002

Survey

National

9.1 (1.1–29)

2010
2008

Survey
Survey

National
National

0.5 (<0.1–2.0)
2.5 (1.5–3.5)

2011
2008

Surveillance
Survey

National
National

13 (8.2–20)
6.6 (2.4–11)

2009

Survey

Sub-national

0.44 (<0.1–2.5)

1998

Survey

Sub-national

18 (7.0–35)

2006

Survey

National

2005

Survey

National

2000

Survey

National

1.6 (0.86–2.8)

2005

Survey

National

12 (5.6–21)

0.48 (<0.1–2.6)

2000

Survey

National

0 (0–18)

1998

Survey

Sub-national

0.56 (0.11–1.6)

1998

Survey

Sub-national

2.5 (1.1–4.9)

28 (14–47)

1995

Survey

National

0.91 (0.19–2.6)

1995

Survey

National

5.7 (1.2–16)

2007
2011

Survey
Survey

National
National

0.49 (0.13–1.3)
0.42 (0.14–0.97)

2007
2011

Survey
Survey

National
National

3.9 (0.48–13)
4.8 (3.2–6.9)

2012
2007
2008

Surveillance
Survey
Survey

National
National
National

0 (0–3.0)
3.5 (2.2–4.8)
3.8 (2.7–5.1)

2012
2007
2008

Surveillance
Survey
Survey

National
National
National

0 (0–60)
12 (0–25)
16 (13–21)

2010
2005

Survey
Survey

National
National

2.9 (2.1–4.0)
3.9 (2.5–5.8)

2006
2012
1997
2002
2009

Survey
Surveillance
Survey
Survey
Survey

National
National
National
National
National

(0.69–4.9)
(0–23)
(<0.1–4.7)
(1.4–2.3)
(4.8–11)

2010
2010
2012
2006
2012
1997
2002
2009

Survey
Surveillance
Surveillance
Survey
Surveillance
Survey
Survey
Survey

National
National
National
National
National
National
National
National

14
19
88
17
0
23
6.7
34

12 (6.8–19)

2.1
0
0.85
1.8
7.7

(10–19)
(15–23)
(47–100)
(7.0–31)
(0–84)
(5.0–54)
(5.4–8.2)
(28–39)

2011

Survey

National

1.4 (0.60–2.2)

2011

Survey

National

United Republic of Tanzania 2007

Survey

National

1.1 (0.30–2.8)

2007

Survey

National

0 (0–5.9)

Zambia
Zimbabwe

Survey
Survey

National
National

0.33 (<0.1–1.2)
1.9 (1.0–3.3)

2008
1995

Survey
Survey

National
National

8.1 (4.1–14)
8.3 (1.8–22)

a

2008
1995

Empty rows indicate an absence of high-quality survey or surveillance data. In the absence of high-quality national data, high-quality sub-national data are used.



GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

4')+101(6*'#/'4+%#5
6CDNG# 'UVKOCVGUQHVJGDWTFGPQHFKUGCUGECWUGFD[6$¿



6CDNG# +PEKFGPEGPQVKßECVKQPCPFECUGFGVGEVKQPTCVGUCNNHQTOU¿



6CDNG# %CUGPQVKßECVKQPU¿



Table A4.4

Treatment outcomes, new smear-positive cases, 1995–2011

192

Table A4.5

Treatment outcomes, retreatment cases, 1995–2011

195

6CDNG# *+8VGUVKPICPFRTQXKUKQPQH%26#46CPF+26¿



6CDNG# 6GUVKPIHQT/&46$CPFPWODGTQHEQPßTOGFECUGUQH/&46$¿



6CDNG# 0GYUOGCTRQUKVKXGECUGPQVKßECVKQPD[CIGCPFUGZ¿



Table A4.9

Laboratories, NTP services, drug management and infection control, 2012

205

6CDNG# /GCUWTGFRGTEGPVCIGQH6$ECUGUYKVJ/&46$OQUVTGEGPV[GCTCXCKNCDNG



Estimates of mortality, prevalence and incidence
Estimated values are shown as best estimates followed by lower and upper bounds. The lower and upper bounds are defined
as the 2.5th and 97.5th centiles of outcome distributions produced in simulations. See ANNEX 1 for further details.
Estimated numbers are shown rounded to two significant figures. Estimated rates are shown rounded to three significant
figures unless the value is under 100, in which case rates are shown rounded to two significant figures.
Estimates for all years are recalculated as new information becomes available and techniques are refined, so
they may differ from those published in previous reports in this series. The main updates implemented in this
report are explained in Box 2.1 of Chapter 2. Estimates published in previous global TB control reports should no
longer be used.

Data source
Data shown in this annex are taken from the WHO global TB database on 1 October 2013. Data shown in the main part of
the report were taken from the database in July 2013. As a result, data in this annex may differ slightly from those in the
main part of the report.
Data for all years can be downloaded from www.who.int/tb/data.

Country notes
Caribbean Islands
Data collection from Caribbean Islands that are not Member States of WHO was resumed in 2011 after a break of a few
years. This includes Aruba, Curaçao, Puerto Rico and Sint Maarten, which are Associate Members of the Pan American
Health Organization, plus the territories of Anguilla, Bermuda, Bonaire, Saint Eustatius and Saba, British Virgin Islands,
Cayman Islands, Montserrat and Turks and Caicos Islands. Data are not currently independently collected from the US
Virgin Islands

USA
In addition to the 51 reporting areas, the USA includes territories that report separately to WHO. The data for these territories are not included in the data reported by the USA. Definitions of case types and outcomes do not exactly match those
used by WHO.



GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±

Anguilla

1990
1995
2000
2005
2010
2011
2012
Antigua and
1990
Barbuda
1995
2000
2005
2010
2011
2012
Argentina
1990
1995
2000
2005
2010
2011
2012
Aruba
1990
1995
2000
2005
2010
2011
2012
Bahamas
1990
1995
2000
2005
2010
2011
2012
Barbados
1990
1995
2000
2005
2010
2011
2012
Belize
1990
1995
2000
2005
2010
2011
2012
Bermuda
1990
1995
2000
2005
2010
2011
2012
Bolivia
1990
(Plurinational
1995
State of)
2000
2005
2010
2011
2012
Bonaire, Saint
2010
Eustatius and Saba 2011
2012
Brazil
1990
1995
2000
2005
2010
2011
2012
British Virgin
1990
Islands
1995
2000
2005
2010
2011
2012
Canada
1990
1995
2000
2005
2010
2011
2012
Cayman Islands
1990
1995
2000
2005
2010
2011
2012
Chile
1990
1995
2000
2005
2010
2011
2012
Colombia
1990
1995
2000
2005
2010
2011
2012

a

POPULATION
(MILLIONS)

<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
33
35
37
39
40
41
41
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
7
8
8
9
10
10
10
<1
<1
<1
150
162
175
186
195
197
199
<1
<1
<1
<1
<1
<1
<1
28
29
31
32
34
34
35
<1
<1
<1
<1
<1
<1
<1
13
14
15
16
17
17
17
33
37
40
43
46
47
48

NUMBER
(THOUSANDS)

0
0
0
0
0
0
0
<0.01
0
<0.01
<0.01
<0.01
<0.01
<0.01
1.4
1.2
0.84
0.73
0.54
0.55
0.55
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0.043
0.012
<0.01
<0.01
<0.01
<0.01
<0.01
0
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0.014
<0.01
<0.01
0.013
0.014
0.014
0
0
0
0
<0.01
<0.01
<0.01
2.7
2.5
2.4
2.3
2.2
2.2
2.2
0
0
0
10
8.6
7.7
5.8
5.4
5.1
4.9
0
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0.12
0.12
0.082
0.086
0.074
0.071
0.067
<0.01
0
0
0
0
0
0
0.76
0.5
0.3
0.24
0.23
0.22
0.21
1.7
2
1.3
1
0.9
0.84
0.77

(0–0)
(0–0)
(0–0)
(0–0)
(0–0)
(0–14)
(0–0)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(1.3–1.4)
(1.1–1.2)
(0.810–0.870)
(0.700–0.760)
(0.520–0.570)
(0.520–0.570)
(0.530–0.580)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.043–0.043)
(0.012–0.012)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.013–0.016)
(<0.01–<0.01)
(<0.01–<0.01)
(0.013–0.013)
(0.014–0.014)
(0.014–0.014)
(0–0)
(0–0)
(0–0)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.710–6.0)
(1.2–4.4)
(1.0–4.3)
(0.950–4.1)
(0.940–4.0)
(0.930–4.0)
(0.930–3.9)
(0–0)
(0–0)
(0–0)
(7.8–13)
(6.8–11)
(6.3–9.2)
(5.2–6.5)
(5.0–5.8)
(4.8–5.4)
(4.6–5.2)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.110–0.120)
(0.120–0.120)
(0.081–0.082)
(0.086–0.086)
(0.074–0.074)
(0.070–0.071)
(0.067–0.068)
(<0.01–<0.01)
(0–0)
(0–0)
(0–0)
(0–0)
(0–0)
(0–0)
(0.710–0.820)
(0.460–0.540)
(0.290–0.310)
(0.240–0.240)
(0.220–0.230)
(0.220–0.230)
(0.210–0.220)
(1.4–2.0)
(1.8–2.2)
(1.2–1.4)
(1.0–1.0)
(0.890–0.910)
(0.830–0.850)
(0.760–0.790)

RATEa

0
0
0
0
0
0
0
3.9
0
1.8
1.4
1.4
1.4
1.4
4.2
3.3
2.3
1.9
1.3
1.3
1.3
0.78
0.78
0.78
0.78
0.78
0.78
0.78
17
4.3
2.2
1.1
0.51
0.43
0.37
0
0.63
0.71
0.62
0.69
0.69
0.69
2.5
7
3.3
2.2
4.3
4.3
4.3
0
0
0
0
0.18
0.18
0.18
40
33
28
24
22
21
21
0
0
0
7
5.3
4.4
3.1
2.7
2.6
2.5
0
5.5
5.3
4.6
4.1
4.1
4.1
0.42
0.4
0.27
0.27
0.22
0.21
0.19
4
0
0
0
0
0
0
5.8
3.5
1.9
1.5
1.3
1.3
1.2
5
5.3
3.2
2.4
1.9
1.8
1.6

(0–0)
(0–0)
(0–0)
(0–0)
(0–0)
(0–100 000)
(0–0)
(3.5–4.3)
(0–0)
(1.5–2.2)
(1.3–1.4)
(1.2–1.5)
(1.2–1.5)
(1.2–1.5)
(4.1–4.2)
(3.3–3.4)
(2.2–2.3)
(1.8–2.0)
(1.3–1.4)
(1.3–1.4)
(1.3–1.4)
(<0.1–2.5)
(<0.1–2.5)
(<0.1–2.5)
(<0.1–2.5)
(<0.1–2.5)
(<0.1–2.5)
(<0.1–2.5)
(17–17)
(4.3–4.3)
(2.1–2.3)
(1.1–1.1)
(0.49–0.53)
(0.42–0.45)
(0.36–0.38)
(0–0)
(0.62–0.64)
(0.70–0.73)
(0.61–0.63)
(0.67–0.70)
(0.67–0.70)
(0.67–0.70)
(1.9–3.1)
(6.3–7.7)
(3.2–3.3)
(2.1–2.2)
(4.3–4.3)
(4.3–4.3)
(4.3–4.3)
(0–0)
(0–0)
(0–0)
(0–0)
(0.18–0.18)
(0.18–0.18)
(0.18–0.18)
(10–89)
(15–58)
(12–51)
(10–44)
(9.3–39)
(9.1–38)
(8.8–37)
(0–0)
(0–0)
(0–0)
(5.2–9.0)
(4.2–6.6)
(3.6–5.3)
(2.8–3.5)
(2.5–3.0)
(2.4–2.8)
(2.3–2.6)
(0–0)
(5.5–5.5)
(5.1–5.5)
(4.4–4.7)
(4.0–4.3)
(4.0–4.3)
(4.0–4.3)
(0.41–0.44)
(0.40–0.40)
(0.26–0.27)
(0.27–0.27)
(0.22–0.22)
(0.20–0.21)
(0.19–0.19)
(4.0–4.1)
(0–0)
(0–0)
(0–0)
(0–0)
(0–0)
(0–0)
(5.3–6.2)
(3.2–3.7)
(1.8–2.0)
(1.4–1.5)
(1.3–1.4)
(1.3–1.3)
(1.2–1.2)
(4.2–5.9)
(4.8–5.9)
(3.0–3.4)
(2.3–2.4)
(1.9–2.0)
(1.8–1.8)
(1.6–1.6)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
33
26
22
18
16
16
15
0.013
0.016
0.018
0.02
0.021
0.021
0.021
0.056
0.064
0.1
0.056
0.037
0.058
0.04
<0.01
<0.01
<0.01
0.016
<0.01
<0.01
<0.01
0.1
0.1
0.13
0.13
0.16
0.17
0.17
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
28
27
25
24
23
23
23

(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.011)
(<0.01–0.012)
(<0.01–0.012)
(<0.01–0.012)
(<0.01–0.012)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.012)
(<0.01–0.018)
(<0.01–0.016)
(<0.01–0.015)
(<0.01–<0.01)
(12–64)
(12–46)
(9.5–39)
(7.8–34)
(7.1–29)
(6.8–28)
(6.5–27)
(<0.01–0.024)
(<0.01–0.031)
(<0.01–0.035)
(<0.01–0.038)
(<0.01–0.039)
(<0.01–0.039)
(<0.01–0.039)
(0.024–0.100)
(0.027–0.120)
(0.050–0.170)
(0.025–0.100)
(0.015–0.068)
(0.028–0.098)
(0.016–0.076)
(<0.01–0.014)
(<0.01–<0.01)
(<0.01–0.011)
(<0.01–0.027)
(<0.01–0.013)
(<0.01–<0.01)
(<0.01–<0.01)
(0.033–0.210)
(0.037–0.200)
(0.047–0.240)
(0.055–0.230)
(0.073–0.290)
(0.073–0.290)
(0.071–0.300)
(<0.01–<0.01)
(<0.01–0.013)
(<0.01–<0.01)
(<0.01–0.014)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.012)
(11–55)
(14–44)
(12–43)
(12–41)
(11–39)
(11–38)
(11–38)

<0.01 (<0.01–<0.01)
210
170
150
120
110
120
120
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
3
3
2.6
2.4
2
2.2
2.1
<0.01
<0.01
0.012
<0.01
<0.01
<0.01
0.011
10
6.4
4.6
4
3.7
3.8
3.6
28
30
27
25
24
23
23

(73–420)
(76–290)
(65–260)
(52–220)
(47–210)
(54–220)
(51–210)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(1.3–5.6)
(1.3–5.4)
(1.1–4.8)
(1.0–4.3)
(0.770–3.7)
(0.950–3.9)
(0.900–3.8)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.020)
(<0.01–<0.01)
(<0.01–0.016)
(<0.01–0.010)
(<0.01–0.019)
(4.4–18)
(2.6–12)
(1.9–8.6)
(1.8–7.1)
(1.5–6.7)
(1.6–6.9)
(1.4–6.7)
(10–55)
(15–51)
(13–46)
(12–43)
(11–41)
(11–40)
(11–39)

RATEa

60
47
56
54
50
50
49
2.8
4.8
9.3
9.4
5.3
6.8
4.8
102
74
59
48
40
38
36
20
20
20
20
20
20
20
22
23
34
17
10
16
11
2.6
1.5
2.1
5.7
2.8
0.79
1.8
55
49
52
48
53
52
51
3.9
13
1.2
13
3.8
3
11
419
352
299
258
227
221
215

(22–118)
(23–81)
(24–102)
(23–99)
(22–89)
(22–89)
(22–88)
(0.83–6.0)
(1.4–10)
(4.6–16)
(2.2–22)
(0.24–18)
(1.1–18)
(1.6–9.9)
(38–198)
(33–131)
(26–107)
(20–87)
(18–71)
(17–68)
(16–65)
(7.9–38)
(7.9–38)
(7.9–38)
(7.9–38)
(7.9–38)
(7.9–38)
(7.9–38)
(9.5–39)
(9.7–41)
(17–57)
(7.6–30)
(4.2–19)
(7.6–27)
(4.2–21)
(0.93–5.2)
(0.56–3.0)
(0.79–4.2)
(2.7–9.9)
(1.4–4.7)
(0.30–1.5)
(0.77–3.1)
(17–113)
(18–95)
(20–101)
(20–86)
(24–93)
(23–93)
(22–92)
(1.2–8.3)
(6.6–22)
(0.35–2.5)
(6.4–22)
(0.97–8.6)
(0.78–6.7)
(5.3–19)
(156–810)
(180–580)
(145–506)
(126–436)
(113–381)
(110–370)
(107–360)

8.1 (3.2–15)
140
103
84
66
58
62
59
23
23
8.4
2.7
9.2
0.97
1
11
10
8.5
7.3
5.7
6.3
6.1
12
10
28
2.2
15
8
18
76
44
30
25
21
22
21
85
83
68
58
51
49
48

(49–278)
(47–180)
(37–149)
(28–119)
(24–106)
(27–112)
(25–107)
(9.3–43)
(9.5–43)
(2.5–18)
(0.82–5.8)
(4.3–16)
(0.29–2.0)
(0.30–2.1)
(4.6–20)
(4.3–18)
(3.5–16)
(3.1–13)
(2.2–11)
(2.7–11)
(2.6–11)
(3.5–25)
(4.4–18)
(14–48)
(1.1–3.7)
(5.5–28)
(2.2–18)
(8.2–33)
(34–136)
(18–82)
(12–55)
(11–44)
(8.9–39)
(9.5–40)
(8.3–38)
(31–165)
(41–140)
(33–116)
(28–100)
(24–87)
(23–85)
(22–83)

INCIDENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0
<0.01
<0.01
<0.01
<0.01
<0.01
19
17
15
13
11
11
10
<0.01
0.013
0.014
0.016
0.016
0.016
0.016
0.053
0.066
0.094
0.055
0.036
0.047
0.037
<0.01
<0.01
<0.01
0.014
<0.01
0
<0.01
0.075
0.083
0.095
0.11
0.12
0.13
0.13
0
<0.01
0
<0.01
<0.01
<0.01
<0.01
17
16
16
15
14
14
13
0
<0.01
0
130
120
110
95
91
95
92
<0.01
<0.01
<0.01
0
<0.01
0
0
2.3
2.3
2
1.8
1.6
1.6
1.6
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
7.1
4.8
3.5
2.9
2.7
2.8
2.8
18
18
17
17
16
16
16

(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(13–28)
(14–21)
(12–18)
(11–15)
(9.1–13)
(8.9–13)
(8.6–12)
(<0.01–0.011)
(0.011–0.014)
(0.013–0.016)
(0.014–0.018)
(0.014–0.018)
(0.014–0.018)
(0.014–0.018)
(0.046–0.060)
(0.057–0.074)
(0.083–0.110)
(0.048–0.062)
(0.031–0.040)
(0.041–0.053)
(0.032–0.042)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.012–0.016)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(0.052–0.100)
(0.068–0.099)
(0.078–0.110)
(0.094–0.120)
(0.100–0.150)
(0.100–0.150)
(0.110–0.160)
(0–0)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(11–24)
(14–19)
(13–19)
(12–18)
(11–16)
(11–16)
(11–16)
(0–0)
(<0.01–<0.01)
(0–0)
(79–180)
(94–140)
(86–130)
(80–110)
(75–110)
(78–110)
(76–110)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(0–0)
(0–0)
(2.0–2.6)
(2.0–2.6)
(1.7–2.2)
(1.6–2.0)
(1.4–1.8)
(1.4–1.9)
(1.4–1.8)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(6.2–8.0)
(4.2–5.4)
(3.0–3.9)
(2.5–3.3)
(2.4–3.1)
(2.5–3.2)
(2.4–3.1)
(12–25)
(14–21)
(14–21)
(14–20)
(13–19)
(13–19)
(13–19)

RATEa

24
23
23
22
21
21
21
1.9
0
5.9
8.4
9.2
7.8
3.9
60
49
40
33
27
26
25
16
16
16
16
16
16
16
21
23
32
17
9.9
13
9.9
2.2
1.3
1.3
5.1
2.5
0
1.6
40
40
40
40
40
40
40
0
7.5
0
8.1
1.8
1.8
5.3
251
215
184
158
135
131
127
0
6.3
0
84
71
60
51
46
48
46
17
17
5.6
0
4.2
0
0
8.3
7.7
6.5
5.5
4.6
4.8
4.6
9.2
7.3
14
1.2
8.3
4.1
12
54
33
22
18
16
16
16
54
48
43
38
34
34
33

(15–35)
(20–27)
(18–27)
(18–26)
(18–25)
(17–25)
(17–25)
(1.6–2.1)
(0–0)
(5.2–6.7)
(7.3–9.5)
(8.1–10)
(6.9–8.9)
(3.4–4.4)
(39–85)
(40–59)
(33–49)
(27–40)
(23–32)
(22–31)
(21–30)
(14–18)
(14–18)
(14–18)
(14–18)
(14–18)
(14–18)
(14–18)
(18–23)
(21–26)
(28–36)
(15–19)
(8.7–11)
(11–15)
(8.7–11)
(1.9–2.5)
(1.1–1.5)
(1.1–1.5)
(4.4–5.7)
(2.2–2.8)
(0–0)
(1.4–1.8)
(28–54)
(33–48)
(33–48)
(34–46)
(33–48)
(33–48)
(33–48)
(0–0)
(6.6–8.5)
(0–0)
(7.1–9.1)
(1.6–2.0)
(1.5–2.0)
(4.6–6.0)
(166–354)
(185–248)
(151–221)
(129–190)
(111–161)
(108–156)
(105–151)
(0–0)
(5.5–7.2)
(0–0)
(53–121)
(58–85)
(49–72)
(43–60)
(38–55)
(40–57)
(38–55)
(15–20)
(15–20)
(4.9–6.3)
(0–0)
(3.7–4.8)
(0–0)
(0–0)
(7.3–9.4)
(6.8–8.7)
(5.7–7.3)
(4.8–6.3)
(4.0–5.2)
(4.2–5.4)
(4.0–5.2)
(8.1–10)
(6.4–8.2)
(12–16)
(1.1–1.4)
(7.3–9.4)
(3.6–4.6)
(11–14)
(47–61)
(29–37)
(20–25)
(15–20)
(14–18)
(14–18)
(14–18)
(36–75)
(39–58)
(35–52)
(31–46)
(28–41)
(28–40)
(27–39)

REGION OF THE AMERICAS

MORTALITY (EXCLUDING HIV)
YEAR

Rates are per 100 000 population.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013



7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±
MORTALITY (EXCLUDING HIV)
YEAR

Costa Rica

Cuba

Curaçao

Dominica

Dominican
Republic

Ecuador

El Salvador

Grenada

Guatemala

Guyana

Haiti

Honduras

Jamaica

Mexico

Montserrat

Netherlands
Antilles

Nicaragua

a



1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

3
3
4
4
5
5
5
11
11
11
11
11
11
11
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
7
8
9
9
10
10
10
10
11
13
14
15
15
15
5
6
6
6
6
6
6
<1
<1
<1
<1
<1
<1
<1
9
10
11
13
14
15
15
<1
<1
<1
<1
<1
<1
<1
7
8
9
9
10
10
10
5
6
6
7
8
8
8
2
2
3
3
3
3
3
86
95
104
111
118
119
121
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
4
5
5
5
6
6
6

NUMBER
(THOUSANDS)

0.078
0.11
0.07
0.06
0.043
0.04
0.038
0.062
0.096
0.046
0.033
0.039
0.038
0.038
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
1
1
0.76
0.59
0.53
0.49
0.46
2
2
1.8
1.1
0.69
0.53
0.41
0.26
0.22
0.17
0.11
0.076
0.071
0.065
0
0
0
<0.01
<0.01
<0.01
<0.01
0.86
0.63
0.57
0.41
0.34
0.32
0.31
0.054
0.067
0.099
0.12
0.12
0.12
0.12
2.5
3
3.4
3.4
2.9
2.7
2.6
0.31
0.35
0.31
0.26
0.24
0.24
0.23
0.021
0.025
0.016
0.011
<0.01
<0.01
<0.01
6.7
5.3
3.5
2.7
2.6
2.2
2.2
0
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0.45
0.41
0.33
0.3
0.26
0.19
0.19

(0.072–0.083)
(0.100–0.110)
(0.067–0.072)
(0.058–0.061)
(0.038–0.047)
(0.036–0.045)
(0.034–0.043)
(0.059–0.065)
(0.095–0.098)
(0.045–0.047)
(0.033–0.034)
(0.039–0.040)
(0.038–0.038)
(0.038–0.038)
(<0.01–<0.01)
(0–<0.01)
(0–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.550–1.6)
(0.510–1.7)
(0.400–1.2)
(0.380–0.850)
(0.390–0.680)
(0.380–0.620)
(0.380–0.550)
(1.4–2.6)
(1.4–2.7)
(1.3–2.3)
(0.910–1.2)
(0.610–0.790)
(0.460–0.610)
(0.350–0.480)
(0.150–0.390)
(0.150–0.300)
(0.120–0.210)
(0.087–0.140)
(0.056–0.100)
(0.051–0.094)
(0.046–0.088)
(0–0)
(0–0)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.800–0.930)
(0.570–0.700)
(0.510–0.640)
(0.370–0.460)
(0.310–0.370)
(0.290–0.350)
(0.280–0.340)
(0.036–0.075)
(0.049–0.087)
(0.061–0.150)
(0.110–0.140)
(0.098–0.130)
(0.099–0.140)
(0.099–0.140)
(0.450–6.4)
(1.1–6.0)
(1.2–6.7)
(1.2–6.6)
(1.1–5.4)
(1.1–5.1)
(1.0–4.9)
(0.096–0.650)
(0.110–0.730)
(0.060–0.760)
(0.025–0.780)
(<0.01–0.840)
(<0.01–0.850)
(<0.01–0.850)
(0.016–0.026)
(0.020–0.031)
(0.013–0.020)
(<0.01–0.013)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(6.4–7.0)
(4.9–5.7)
(3.3–3.6)
(2.6–2.9)
(2.5–2.7)
(2.1–2.4)
(2.1–2.3)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.260–0.680)
(0.260–0.600)
(0.230–0.440)
(0.220–0.380)
(0.200–0.330)
(0.150–0.240)
(0.150–0.230)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

RATEa

2.5
3.1
1.8
1.4
0.92
0.85
0.8
0.58
0.88
0.41
0.3
0.35
0.33
0.33
0.19
<0.1
<0.1
7.6
2.4
3.4
1.3
3.2
2.1
2
14
13
8.7
6.3
5.3
4.9
4.4
19
17
14
7.7
4.6
3.5
2.7
4.8
3.8
2.8
1.8
1.2
1.1
1
0
0
0
1.6
0.76
0.99
0.99
9.7
6.3
5.1
3.3
2.3
2.2
2.1
7.5
9.1
13
16
15
15
15
36
39
40
37
29
27
25
6.4
6.2
5
3.8
3.1
3
2.9
0.87
1
0.63
0.4
0.26
0.24
0.22
7.8
5.5
3.3
2.5
2.2
1.9
1.8
0
11
21
22
21
24
24
0.59
0.57
0.59
0.59
11
8.9
6.4
5.4
4.5
3.3
3.1

(2.3–2.7)
(3.0–3.2)
(1.7–1.8)
(1.3–1.4)
(0.82–1.0)
(0.76–0.95)
(0.70–0.89)
(0.55–0.62)
(0.87–0.89)
(0.40–0.42)
(0.30–0.30)
(0.35–0.35)
(0.33–0.34)
(0.33–0.34)
(<0.1–0.63)
(0–0.19)
(0–0.18)
(7.3–7.9)
(2.2–2.5)
(3.1–3.7)
(1.3–1.3)
(3.2–3.3)
(2.1–2.1)
(2.0–2.0)
(7.6–22)
(6.4–21)
(4.6–14)
(4.0–9.1)
(3.9–6.8)
(3.8–6.1)
(3.7–5.3)
(14–26)
(12–24)
(10–19)
(6.6–9.0)
(4.0–5.2)
(3.0–4.0)
(2.3–3.1)
(2.8–7.4)
(2.6–5.2)
(2.1–3.6)
(1.4–2.3)
(0.90–1.6)
(0.81–1.5)
(0.73–1.4)
(0–0)
(0–0)
(0–0)
(1.6–1.6)
(0.75–0.76)
(0.95–1.0)
(0.95–1.0)
(9.0–10)
(5.7–7.1)
(4.6–5.7)
(2.9–3.6)
(2.1–2.6)
(2.0–2.4)
(1.9–2.2)
(5.0–10)
(6.7–12)
(8.2–20)
(14–19)
(12–17)
(12–17)
(12–17)
(6.3–90)
(14–77)
(14–78)
(13–71)
(11–55)
(11–51)
(10–48)
(2.0–13)
(1.9–13)
(0.96–12)
(0.36–11)
(0.12–11)
(<0.1–11)
(<0.1–11)
(0.68–1.1)
(0.81–1.2)
(0.51–0.77)
(0.32–0.48)
(0.21–0.31)
(0.20–0.28)
(0.18–0.26)
(7.5–8.1)
(5.2–5.9)
(3.2–3.5)
(2.4–2.6)
(2.1–2.3)
(1.8–2.0)
(1.7–1.9)
(0–0)
(10–11)
(21–22)
(21–22)
(21–22)
(24–25)
(24–25)
(0.56–0.62)
(0.54–0.60)
(0.58–0.61)
(0.57–0.61)
(6.4–16)
(5.6–13)
(4.5–8.7)
(4.1–6.9)
(3.5–5.6)
(2.6–4.1)
(2.4–3.8)

RATEa

3.6
3
2.5
1.7
0.93
0.78
0.6
6.4
3.5
2.2
1.6
1.6
1.6
1.6
<0.01
<0.01
<0.01
0.012
0.014
0.02
0.012
0.013
0.016
0.018
25
17
14
12
11
10
10
34
27
23
20
17
16
15
5.1
3.1
3.3
3.7
2.1
2.1
2.2
0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
13
14
14
15
16
16
17
1.4
1.1
1
1.1
1
1
1
27
30
34
36
32
31
30
8.7
9.5
11
7.7
6.4
6.5
6.5
0.23
0.22
0.21
0.23
0.26
0.26
0.26
130
85
53
38
40
41
40
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01

(1.7–6.3)
(1.5–5.0)
(1.3–4.0)
(0.920–2.8)
(0.460–1.6)
(0.360–1.4)
(0.220–1.2)
(2.4–12)
(1.7–5.9)
(0.940–3.9)
(0.730–2.8)
(0.730–2.8)
(0.700–2.8)
(0.670–2.8)
(<0.01–0.014)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.031)
(<0.01–0.026)
(<0.01–0.034)
(<0.01–0.024)
(<0.01–0.024)
(<0.01–0.033)
(<0.01–0.030)
(9.4–47)
(8.6–29)
(6.8–23)
(6.0–21)
(5.3–18)
(5.1–18)
(4.9–17)
(13–66)
(14–46)
(12–39)
(10–34)
(8.5–28)
(8.1–27)
(7.6–25)
(1.7–10)
(1.2–6.1)
(1.6–5.7)
(1.8–6.2)
(0.740–4.0)
(0.760–4.2)
(0.770–4.3)
(<0.01–0.020)
(<0.01–0.014)
(<0.01–0.015)
(<0.01–0.014)
(<0.01–0.013)
(<0.01–0.015)
(<0.01–0.015)
(4.8–24)
(6.8–23)
(7.1–24)
(7.4–25)
(7.9–27)
(8.0–28)
(8.2–28)
(0.520–2.7)
(0.550–1.9)
(0.490–1.8)
(0.470–1.9)
(0.430–1.9)
(0.430–1.9)
(0.430–1.9)
(8.2–56)
(14–51)
(17–58)
(17–61)
(15–55)
(15–53)
(14–52)
(3.0–18)
(3.0–19)
(3.4–22)
(2.5–16)
(2.2–13)
(2.2–13)
(2.1–13)
(0.081–0.440)
(0.100–0.380)
(0.095–0.370)
(0.110–0.400)
(0.130–0.430)
(0.130–0.440)
(0.130–0.440)
(61–210)
(43–140)
(27–87)
(19–63)
(19–67)
(20–69)
(19–69)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)

118
87
63
40
20
16
12
60
32
19
14
14
14
14
5
0.97
0.95
17
19
28
17
19
23
25
339
215
159
131
107
103
98
340
242
187
148
113
106
98
95
55
56
60
33
34
34
11
8.2
8.6
8.1
5.5
7.1
6.8
142
139
129
119
112
111
110
193
153
139
139
132
131
131
376
378
400
388
326
309
296
178
169
169
112
84
84
82
9.5
8.9
8.1
8.7
9.4
9.4
9.5
145
89
51
34
34
34
33
20
8.2
11
42
9.9
4.7

(54–205)
(44–143)
(33–101)
(21–65)
(9.8–33)
(7.6–29)
(4.7–24)
(23–115)
(15–54)
(8.4–35)
(6.4–25)
(6.4–25)
(6.2–25)
(5.9–25)
(2.0–9.4)
(0.38–1.8)
(0.37–1.8)
(2.7–43)
(7.3–36)
(13–49)
(6.3–34)
(7.9–34)
(7.2–46)
(12–42)
(130–646)
(108–360)
(78–268)
(65–220)
(53–181)
(50–173)
(48–165)
(127–655)
(121–403)
(93–313)
(74–248)
(57–187)
(53–176)
(49–163)
(32–191)
(21–105)
(27–96)
(29–103)
(12–65)
(12–67)
(12–68)
(3.9–21)
(4.1–14)
(4.1–15)
(3.9–14)
(1.3–13)
(2.2–15)
(2.1–14)
(53–274)
(69–233)
(63–217)
(59–200)
(55–189)
(55–188)
(54–187)
(72–372)
(75–258)
(66–239)
(62–248)
(55–241)
(54–241)
(54–242)
(115–787)
(180–648)
(193–681)
(187–659)
(156–556)
(148–528)
(140–509)
(60–358)
(54–348)
(54–347)
(36–228)
(29–170)
(28–169)
(27–168)
(3.4–19)
(4.1–15)
(3.7–14)
(4.1–15)
(4.6–16)
(4.6–16)
(4.7–16)
(71–246)
(46–146)
(26–84)
(17–57)
(16–57)
(16–58)
(16–57)
(10–33)
(2.5–17)
(3.3–23)
(21–69)
(2.9–21)
(1.4–10)

0.013
0.014
<0.01
0.01
7.6
6.4
5.5
4.6
2.9
3.1
3.3

(<0.01–0.024)
(<0.01–0.025)
(<0.01–0.019)
(<0.01–0.021)
(2.8–15)
(3.0–11)
(2.6–9.5)
(2.2–8.0)
(1.0–5.9)
(1.1–6.3)
(1.1–6.7)

6.7
7.2
5
5.6
183
137
108
85
50
53
55

(2.5–13)
(3.1–13)
(1.5–11)
(1.7–12)
(68–354)
(65–236)
(51–186)
(39–146)
(17–101)
(18–106)
(19–112)

INCIDENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

1.5
1.5
1.4
1
0.65
0.59
0.51
2.6
2
1.4
1
1
1
1
<0.01
<0.01
<0.01
0.01
0.01
<0.01
<0.01
<0.01
<0.01
<0.01
11
9.7
8.6
7.7
6.7
6.6
6.4
18
15
13
11
9.7
9.4
9.1
3.4
2.6
2.2
2.4
1.8
1.7
1.6
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
6.6
7.1
7.6
8.2
8.8
9
9.1
0.65
0.65
0.78
0.88
0.87
0.87
0.87
18
19
23
25
23
22
22
5.6
6.4
7.1
5
4.1
4.2
4.3
0.15
0.16
0.17
0.18
0.18
0.18
0.18
57
44
32
25
26
27
27
<0.01
<0.01
0
<0.01
0
0
0
<0.01
0.01
<0.01
<0.01
4.5
4
3.4
2.9
2.5
2.4
2.3

(1.3–1.7)
(1.3–1.7)
(1.2–1.5)
(0.880–1.1)
(0.570–0.740)
(0.510–0.660)
(0.440–0.580)
(1.6–3.9)
(1.7–2.5)
(1.1–1.8)
(0.850–1.3)
(0.840–1.3)
(0.830–1.3)
(0.840–1.3)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.015)
(<0.01–0.012)
(<0.01–0.012)
(<0.01–0.011)
(<0.01–0.011)
(<0.01–0.011)
(<0.01–0.011)
(6.6–16)
(7.9–12)
(7.1–10)
(6.3–9.2)
(5.6–8.0)
(5.4–7.8)
(5.3–7.6)
(11–26)
(13–19)
(11–16)
(9.4–14)
(8.0–12)
(7.8–11)
(7.5–11)
(2.3–4.7)
(2.3–2.9)
(1.8–2.6)
(1.9–2.9)
(1.5–2.0)
(1.4–1.9)
(1.4–1.8)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(4.1–9.7)
(5.8–8.5)
(6.2–9.1)
(6.7–9.9)
(7.3–11)
(7.4–11)
(7.5–11)
(0.400–0.960)
(0.530–0.780)
(0.630–0.930)
(0.720–1.1)
(0.720–1.0)
(0.720–1.0)
(0.710–1.0)
(11–26)
(16–23)
(19–28)
(21–30)
(19–27)
(18–27)
(18–26)
(3.6–7.9)
(4.1–9.2)
(4.6–10)
(3.2–7.2)
(2.7–5.9)
(2.7–6.0)
(2.8–6.1)
(0.110–0.210)
(0.130–0.190)
(0.140–0.200)
(0.140–0.210)
(0.150–0.210)
(0.150–0.220)
(0.150–0.220)
(49–66)
(38–51)
(27–37)
(21–28)
(23–30)
(23–31)
(23–32)
(<0.01–<0.01)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(0–0)
(0–0)
(0–0)
(<0.01–0.011)
(<0.01–0.012)
(<0.01–<0.01)
(<0.01–<0.01)
(2.9–6.3)
(3.2–4.8)
(2.8–4.1)
(2.4–3.5)
(2.1–2.8)
(2.0–2.7)
(2.0–2.7)

RATEa

48
43
35
23
14
12
11
25
19
13
9.2
9.3
9.3
9.3
3.9
0.76
0.74
15
14
14
13
13
13
13
148
121
100
82
67
65
62
174
136
107
83
65
62
59
63
45
37
39
28
27
25
4.6
4.5
4.4
4.2
4.1
4.1
4.1
74
71
68
65
62
61
60
89
89
104
115
111
110
109
247
247
271
272
230
222
213
113
115
114
73
54
54
54
6.5
6.5
6.5
6.5
6.6
6.6
6.6
67
46
31
22
22
23
23
11
4.1
0
24
0
0
0
5.3
5.3
3.2
4.7
108
85
68
53
42
40
38

Rates are per 100 000 population.

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

(42–54)
(37–48)
(31–39)
(20–26)
(12–16)
(11–14)
(9.3–12)
(15–37)
(15–23)
(10–16)
(7.5–11)
(7.4–11)
(7.4–11)
(7.4–11)
(3.4–4.4)
(0.67–0.86)
(0.65–0.84)
(9.3–21)
(12–17)
(11–17)
(11–16)
(11–16)
(11–16)
(11–15)
(91–218)
(99–146)
(82–120)
(67–98)
(55–80)
(53–77)
(51–74)
(108–257)
(111–164)
(87–128)
(68–100)
(54–77)
(51–74)
(48–70)
(43–88)
(39–50)
(30–44)
(32–47)
(24–33)
(23–31)
(22–29)
(2.9–6.8)
(3.8–5.2)
(3.6–5.2)
(3.5–5.1)
(3.4–4.9)
(3.4–4.9)
(3.4–4.9)
(47–109)
(58–85)
(55–81)
(53–78)
(51–73)
(50–73)
(50–72)
(55–132)
(73–107)
(85–125)
(94–138)
(91–132)
(91–131)
(90–130)
(153–365)
(202–297)
(221–325)
(222–326)
(190–275)
(183–265)
(176–254)
(73–162)
(74–164)
(74–163)
(47–104)
(35–77)
(35–77)
(35–77)
(4.7–8.8)
(5.4–7.9)
(5.4–7.9)
(5.4–7.9)
(5.4–7.8)
(5.4–7.8)
(5.4–7.8)
(57–77)
(40–53)
(26–36)
(19–26)
(19–26)
(19–26)
(19–26)
(9.4–12)
(3.6–4.7)
(0–0)
(21–27)
(0–0)
(0–0)
(0–0)
(4.6–6.0)
(4.6–6.0)
(2.8–3.7)
(4.1–5.3)
(71–152)
(70–102)
(55–81)
(44–64)
(36–49)
(35–46)
(33–44)

7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±

Panama

Paraguay

Peru

Puerto Rico

Saint Kitts and
Nevis

Saint Lucia

Saint Vincent and
the Grenadines

Sint Maarten
(Dutch part)
Suriname

Trinidad and
Tobago

Turks and Caicos
Islands

United States
of America

Uruguay

US Virgin Islands

Venezuela
(Bolivarian
Republic of)

a

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

2
3
3
3
4
4
4
4
5
5
6
6
7
7
22
24
26
28
29
30
30
4
4
4
4
4
4
4
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
1
1
1
1
1
1
1
<1
<1
<1
<1
<1
<1
<1
255
268
285
298
312
315
318
3
3
3
3
3
3
3
<1
<1
<1
<1
<1
<1
<1
20
22
24
27
29
30
30

NUMBER
(THOUSANDS)

0.2
0.2
0.2
0.22
0.19
0.19
0.19
0.2
0.23
0.23
0.28
0.19
0.2
0.2
7.5
6.2
3.7
2.7
1.8
1.7
1.5
0.069
0.081
0.017
0.017
0.01
<0.01
<0.01
0
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0.012
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0.027
0.016
<0.01
<0.01
0.014
0.014
0.014
0.032
0.034
0.025
0.018
0.028
0.028
0.028
0
0
<0.01
<0.01
<0.01
<0.01
<0.01
2.6
1.4
0.81
0.64
0.61
0.47
0.44
0.085
0.076
0.069
0.067
0.054
0.053
0.051
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0.85
0.81
0.67
0.63
0.71
0.72
0.73

(0.130–0.290)
(0.160–0.250)
(0.180–0.230)
(0.210–0.230)
(0.190–0.200)
(0.190–0.190)
(0.180–0.190)
(0.150–0.250)
(0.170–0.290)
(0.160–0.310)
(0.220–0.350)
(0.160–0.230)
(0.160–0.230)
(0.160–0.240)
(2.5–15)
(3.3–9.9)
(2.3–5.4)
(2.1–3.4)
(1.3–2.3)
(1.2–2.1)
(1.1–2.0)
(0.069–0.070)
(0.080–0.081)
(0.017–0.017)
(0.017–0.017)
(0.010–0.010)
(<0.01–<0.01)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.016)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0–<0.01)
(0–<0.01)
(0–<0.01)
(0.019–0.037)
(<0.01–0.027)
(<0.01–<0.01)
(<0.01–<0.01)
(0.012–0.015)
(0.012–0.015)
(0.012–0.016)
(0.031–0.033)
(0.033–0.034)
(0.024–0.025)
(0.018–0.018)
(0.028–0.028)
(0.028–0.028)
(0.028–0.028)
(0–0)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(2.5–2.6)
(1.4–1.4)
(0.790–0.820)
(0.640–0.650)
(0.590–0.630)
(0.440–0.500)
(0.390–0.480)
(0.078–0.092)
(0.073–0.078)
(0.066–0.072)
(0.064–0.070)
(0.051–0.057)
(0.050–0.056)
(0.048–0.054)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.830–0.870)
(0.790–0.830)
(0.650–0.690)
(0.630–0.630)
(0.410–1.1)
(0.410–1.1)
(0.420–1.1)

RATEa

8.1
7.4
6.6
6.6
5.2
5.1
4.9
4.6
4.8
4.3
4.7
3
3
3
34
26
14
9.7
6.1
5.6
5.1
2
2.2
0.45
0.45
0.28
0.25
0.23
0
2.1
2.4
2.2
2.5
2.5
2.5
4
8.3
0.81
3.5
1.4
1.3
1.2
1
3.7
3.3
0.86
4.8
2.6
2.6
0.4
0.26
0.13
6.7
3.6
1.2
1.7
2.6
2.6
2.6
2.6
2.7
1.9
1.4
2.1
2.1
2.1
0
0
6.1
3.9
3.5
3.5
3.5
1
0.51
0.28
0.22
0.2
0.15
0.14
2.7
2.3
2.1
2
1.6
1.6
1.5
3
2.4
2.8
0.94
0.96
0.96
0.96
4.3
3.7
2.7
2.4
2.4
2.4
2.4

(5.2–12)
(5.8–9.2)
(5.9–7.4)
(6.3–6.9)
(5.1–5.4)
(5.0–5.2)
(4.8–5.0)
(3.5–5.9)
(3.6–6.1)
(3.1–5.8)
(3.7–5.9)
(2.5–3.6)
(2.5–3.6)
(2.5–3.6)
(11–70)
(14–41)
(8.9–21)
(7.4–12)
(4.6–7.8)
(4.1–7.2)
(3.8–6.7)
(2.0–2.0)
(2.2–2.2)
(0.45–0.45)
(0.45–0.46)
(0.27–0.28)
(0.25–0.25)
(0.23–0.23)
(0–0)
(2.1–2.2)
(2.3–2.5)
(2.1–2.3)
(2.3–2.6)
(2.3–2.6)
(2.3–2.6)
(3.8–4.2)
(6.3–11)
(0.71–0.92)
(3.3–3.6)
(1.3–1.5)
(1.2–1.4)
(1.1–1.4)
(0.95–1.1)
(3.6–3.8)
(3.0–3.6)
(0.86–0.87)
(4.7–4.8)
(2.5–2.6)
(2.5–2.6)
(0–2.0)
(0–1.4)
(<0.1–0.43)
(4.6–9.2)
(1.7–6.2)
(0.98–1.5)
(1.5–1.9)
(2.3–2.9)
(2.3–2.9)
(2.3–2.9)
(2.5–2.7)
(2.7–2.7)
(1.9–2.0)
(1.4–1.4)
(2.1–2.1)
(2.1–2.1)
(2.1–2.1)
(0–0)
(0–0)
(5.7–6.6)
(3.9–4.0)
(3.4–3.7)
(3.4–3.7)
(3.4–3.7)
(0.99–1.0)
(0.50–0.52)
(0.28–0.29)
(0.21–0.22)
(0.19–0.20)
(0.14–0.16)
(0.12–0.15)
(2.5–3.0)
(2.3–2.4)
(2.0–2.2)
(1.9–2.1)
(1.5–1.7)
(1.5–1.6)
(1.4–1.6)
(3.0–3.1)
(2.4–2.4)
(2.8–2.8)
(0.94–0.95)
(0.94–0.97)
(0.94–0.97)
(0.94–0.97)
(4.2–4.4)
(3.6–3.8)
(2.7–2.8)
(2.3–2.4)
(1.4–3.8)
(1.4–3.8)
(1.4–3.8)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

RATEa

1.9
1.6
1.6
1.8
2.2
2.3
2.4
4.2
3.7
3.8
4.1
4.2
4.2
4.2
120
85
70
54
37
37
36
0.22
0.4
0.27
0.15
0.12
0.07
0.11
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0.027
0.035
0.024
0.023
0.015
0.011
<0.01
0.071
0.061
0.055
0.049
0.035
0.031
0.027
<0.01
<0.01
<0.01
0.53
0.69
0.6
0.47
0.35
0.33
0.31
0.21
0.23
0.29
0.2
0.26
0.26
0.37

(0.740–3.6)
(0.600–3.0)
(0.600–3.0)
(0.670–3.4)
(0.920–3.9)
(1.0–4.0)
(1.2–4.2)
(2.0–7.0)
(1.9–6.2)
(1.9–6.4)
(2.1–7.0)
(2.0–7.1)
(2.1–7.1)
(2.1–7.1)
(42–240)
(37–150)
(30–130)
(23–99)
(12–77)
(12–74)
(12–73)
(0.064–0.460)
(0.170–0.740)
(0.110–0.490)
(0.066–0.270)
(0.055–0.210)
(0.026–0.140)
(0.053–0.200)
(<0.01–<0.01)
(<0.01–0.014)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.051)
(0.014–0.065)
(<0.01–0.044)
(<0.01–0.044)
(<0.01–0.033)
(<0.01–0.022)
(<0.01–0.018)
(0.025–0.140)
(0.028–0.110)
(0.026–0.094)
(0.020–0.092)
(0.011–0.071)
(0.010–0.064)
(<0.01–0.061)
(<0.01–0.011)
(<0.01–<0.01)
(<0.01–<0.01)
(0.200–1.0)
(0.230–1.4)
(0.180–1.3)
(0.150–0.980)
(0.120–0.700)
(0.130–0.620)
(0.120–0.590)
(0.099–0.350)
(0.090–0.440)
(0.140–0.490)
(0.073–0.390)
(0.096–0.500)
(0.096–0.520)
(0.170–0.650)

77
57
52
53
59
61
64
98
78
72
70
65
64
63
554
355
268
195
127
124
121
6.1
11
7
4
3.2
1.9
3
0.56
17
7.3
3.7
5.6
5.1
5.1
19
24
15
14
8.6
6.1
4.8
66
57
51
45
32
29
24
11
7.4
3.3
129
157
128
94
66
62
58
17
19
23
15
20
20
28

<0.01
0.016
0.013
<0.01
0.015
0.01
38
35
24
21
17
16
15
1.5
0.91
0.96
0.89
0.96
1.2
1.1
<0.01
<0.01
0.011
0.011
0.011
0.011
0.011
11
12
12
13
15
15
15

(<0.01–0.015)
(<0.01–0.029)
(<0.01–0.021)
(<0.01–0.015)
(<0.01–0.026)
(<0.01–0.022)
(15–71)
(15–62)
(10–45)
(9.3–38)
(7.1–30)
(6.7–28)
(6.5–27)
(0.690–2.6)
(0.340–1.8)
(0.410–1.7)
(0.390–1.6)
(0.400–1.8)
(0.560–2.1)
(0.490–2.1)
(<0.01–0.011)
(<0.01–0.016)
(<0.01–0.020)
(<0.01–0.020)
(<0.01–0.020)
(<0.01–0.020)
(<0.01–0.020)
(3.9–20)
(5.4–20)
(5.5–21)
(6.2–23)
(7.3–25)
(7.3–25)
(7.6–26)

47
86
47
24
47
32
15
13
8.6
7.2
5.3
5
4.7
48
28
29
27
29
36
34
5.6
7.3
9.9
9.9
9.9
9.9
9.9
53
53
50
50
52
50
52

(30–146)
(22–110)
(20–99)
(20–101)
(25–107)
(28–108)
(30–110)
(48–165)
(39–129)
(36–120)
(35–118)
(32–110)
(32–108)
(31–106)
(191–1 100)
(156–634)
(116–481)
(82–357)
(40–263)
(42–248)
(41–243)
(1.8–13)
(4.5–20)
(2.9–13)
(1.7–7.1)
(1.5–5.6)
(0.69–3.7)
(1.4–5.3)
(0.17–1.2)
(6.2–32)
(2.2–15)
(1.1–7.9)
(1.6–12)
(1.3–12)
(1.7–10)
(7.2–37)
(9.6–44)
(5.9–28)
(5.4–26)
(2.5–18)
(2.0–13)
(1.5–9.9)
(24–129)
(26–99)
(24–87)
(18–84)
(10–65)
(9.1–59)
(5.6–56)
(3.0–25)
(1.6–17)
(1.3–6.3)
(50–245)
(52–320)
(38–273)
(30–195)
(22–133)
(24–117)
(22–110)
(8.1–29)
(7.2–35)
(11–39)
(5.7–30)
(7.2–38)
(7.2–39)
(13–48)
(14–100)
(37–156)
(24–79)
(7.5–50)
(21–82)
(9.1–68)
(5.9–28)
(5.7–23)
(3.6–16)
(3.1–13)
(2.3–9.6)
(2.1–9.0)
(2.0–8.4)
(22–83)
(11–54)
(12–53)
(12–48)
(12–53)
(17–62)
(14–61)
(2.1–11)
(2.2–15)
(3.8–19)
(3.9–19)
(3.9–19)
(3.8–19)
(3.9–19)
(20–103)
(25–92)
(22–88)
(23–87)
(25–87)
(25–85)
(25–87)

INCIDENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

1.2
1.3
1.4
1.6
1.8
1.8
1.8
2.8
2.5
2.6
2.9
3
3
3
69
58
48
39
31
30
29
0.18
0.3
0.2
0.13
0.092
0.058
0.082
0
<0.01
0
0
<0.01
<0.01
<0.01
0.021
0.027
0.018
0.018
0.012
<0.01
<0.01
0.029
0.029
0.028
0.027
0.027
0.026
0.026
<0.01
<0.01
<0.01
0.26
0.4
0.4
0.31
0.24
0.23
0.22
0.14
0.19
0.23
0.19
0.25
0.26
0.32
0
<0.01
0.012
<0.01
<0.01
0.01
<0.01
30
26
19
16
13
12
11
1
0.72
0.74
0.72
0.8
0.94
0.93
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
7
7.7
8.4
9
9.7
9.8
9.9

(0.810–1.6)
(1.1–1.6)
(1.2–1.7)
(1.3–1.9)
(1.5–2.0)
(1.6–2.0)
(1.6–2.0)
(2.6–3.0)
(2.3–2.7)
(2.4–2.8)
(2.7–3.1)
(2.7–3.2)
(2.8–3.2)
(2.8–3.2)
(43–100)
(47–70)
(39–57)
(33–46)
(27–35)
(26–34)
(25–32)
(0.160–0.210)
(0.260–0.340)
(0.180–0.230)
(0.110–0.150)
(0.081–0.100)
(0.050–0.065)
(0.072–0.092)
(0–0)
(<0.01–<0.01)
(0–0)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.019–0.024)
(0.023–0.030)
(0.016–0.021)
(0.016–0.020)
(0.011–0.014)
(<0.01–0.010)
(<0.01–<0.01)
(0.018–0.043)
(0.023–0.035)
(0.023–0.033)
(0.022–0.033)
(0.022–0.032)
(0.022–0.032)
(0.022–0.031)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.170–0.360)
(0.260–0.570)
(0.260–0.580)
(0.200–0.450)
(0.160–0.340)
(0.170–0.310)
(0.160–0.290)
(0.120–0.160)
(0.170–0.220)
(0.200–0.260)
(0.170–0.220)
(0.220–0.290)
(0.230–0.290)
(0.280–0.360)
(0–0)
(<0.01–<0.01)
(0.010–0.014)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.012)
(<0.01–0.010)
(26–33)
(23–30)
(16–21)
(14–18)
(11–15)
(11–14)
(10–13)
(0.890–1.2)
(0.630–0.810)
(0.650–0.840)
(0.630–0.810)
(0.700–0.910)
(0.820–1.1)
(0.810–1.1)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(4.9–9.4)
(6.3–9.2)
(6.8–10)
(7.4–11)
(8.0–12)
(8.1–12)
(8.2–12)

RATEa

47
47
47
47
48
48
48
66
52
49
49
46
45
45
317
242
184
140
106
101
95
5.2
8.2
5.3
3.5
2.5
1.6
2.2
0
13
0
0
4.4
2.2
4.3
15
18
12
11
6.9
5.1
3.3
27
27
26
25
24
24
24
8.1
5.3
2.6
63
92
86
63
46
44
41
11
15
18
15
19
19
24
0
36
63
29
22
33
28
12
9.8
6.6
5.4
4.1
3.8
3.6
33
22
22
22
24
28
27
4.5
4.3
7.7
7.7
7.7
7.7
7.7
35
35
34
34
33
33
33

(33–65)
(39–57)
(39–56)
(39–57)
(42–54)
(42–54)
(42–54)
(61–72)
(48–56)
(45–53)
(45–53)
(42–50)
(42–49)
(41–48)
(196–468)
(198–290)
(151–221)
(118–164)
(93–120)
(88–114)
(83–108)
(4.6–5.9)
(7.2–9.2)
(4.6–6.0)
(3.0–3.9)
(2.2–2.8)
(1.4–1.8)
(1.9–2.5)
(0–0)
(12–15)
(0–0)
(0–0)
(3.8–5.0)
(1.9–2.5)
(3.8–4.9)
(13–17)
(16–21)
(10–13)
(9.5–12)
(6.1–7.8)
(4.5–5.8)
(2.9–3.7)
(17–40)
(22–32)
(21–31)
(20–30)
(20–29)
(20–29)
(20–29)
(7.1–9.2)
(4.6–6.0)
(2.3–2.9)
(41–90)
(59–131)
(56–124)
(41–90)
(31–65)
(32–58)
(30–55)
(9.9–13)
(13–17)
(16–20)
(13–17)
(17–21)
(17–22)
(21–27)
(0–0)
(32–41)
(55–72)
(26–33)
(20–25)
(29–37)
(25–32)
(10–13)
(8.5–11)
(5.8–7.5)
(4.8–6.1)
(3.6–4.7)
(3.4–4.3)
(3.2–4.1)
(29–37)
(20–25)
(20–25)
(19–24)
(21–27)
(24–31)
(24–31)
(3.9–5.0)
(3.8–4.9)
(6.8–8.7)
(6.8–8.7)
(6.8–8.7)
(6.8–8.7)
(6.8–8.7)
(25–47)
(28–42)
(28–41)
(28–41)
(27–40)
(27–40)
(27–39)

REGION OF THE AMERICAS

MORTALITY (EXCLUDING HIV)
YEAR

Rates are per 100 000 population.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013



7$%/($,QFLGHQFHQRWLILFDWLRQDQGFDVHGHWHFWLRQUDWHVDOOIRUPV±
INCIDENCE (INCLUDING HIV)
YEAR

Anguilla

1990
1995
2000
2005
2010
2011
2012
Antigua and
1990
Barbuda
1995
2000
2005
2010
2011
2012
Argentina
1990
1995
2000
2005
2010
2011
2012
Aruba
1990
1995
2000
2005
2010
2011
2012
Bahamas
1990
1995
2000
2005
2010
2011
2012
Barbados
1990
1995
2000
2005
2010
2011
2012
Belize
1990
1995
2000
2005
2010
2011
2012
Bermuda
1990
1995
2000
2005
2010
2011
2012
Bolivia
1990
(Plurinational
1995
State of)
2000
2005
2010
2011
2012
Bonaire, Saint
2010
Eustatius and Saba 2011
2012
Brazil
1990
1995
2000
2005
2010
2011
2012
British Virgin
1990
Islands
1995
2000
2005
2010
2011
2012
Canada
1990
1995
2000
2005
2010
2011
2012
Cayman Islands
1990
1995
2000
2005
2010
2011
2012
Chile
1990
1995
2000
2005
2010
2011
2012
Colombia
1990
1995
2000
2005
2010
2011
2012
a
b

POPULATION
(MILLIONS)

<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
33
35
37
39
40
41
41
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
7
8
8
9
10
10
10
<1
<1
<1
150
162
175
186
195
197
199
<1
<1
<1
<1
<1
<1
<1
28
29
31
32
34
34
35
<1
<1
<1
<1
<1
<1
<1
13
14
15
16
17
17
17
33
37
40
43
46
47
48

NUMBER
(THOUSANDS)

<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0
<0.01
<0.01
<0.01
<0.01
<0.01
19
17
15
13
11
11
10
<0.01
0.013
0.014
0.016
0.016
0.016
0.016
0.053
0.066
0.094
0.055
0.036
0.047
0.037
<0.01
<0.01
<0.01
0.014
<0.01
0
<0.01
0.075
0.083
0.095
0.11
0.12
0.13
0.13
0
<0.01
0
<0.01
<0.01
<0.01
<0.01
17
16
16
15
14
14
13
0
<0.01
0
130
120
110
95
91
95
92
<0.01
<0.01
<0.01
0
<0.01
0
0
2.3
2.3
2
1.8
1.6
1.6
1.6
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
7.1
4.8
3.5
2.9
2.7
2.8
2.8
18
18
17
17
16
16
16

(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(13–28)
(14–21)
(12–18)
(11–15)
(9.1–13)
(8.9–13)
(8.6–12)
(<0.01–0.011)
(0.011–0.014)
(0.013–0.016)
(0.014–0.018)
(0.014–0.018)
(0.014–0.018)
(0.014–0.018)
(0.046–0.060)
(0.057–0.074)
(0.083–0.110)
(0.048–0.062)
(0.031–0.040)
(0.041–0.053)
(0.032–0.042)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.012–0.016)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(0.052–0.100)
(0.068–0.099)
(0.078–0.110)
(0.094–0.120)
(0.100–0.150)
(0.100–0.150)
(0.110–0.160)
(0–0)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(11–24)
(14–19)
(13–19)
(12–18)
(11–16)
(11–16)
(11–16)
(0–0)
(<0.01–<0.01)
(0–0)
(79–180)
(94–140)
(86–130)
(80–110)
(75–110)
(78–110)
(76–110)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(0–0)
(0–0)
(2.0–2.6)
(2.0–2.6)
(1.7–2.2)
(1.6–2.0)
(1.4–1.8)
(1.4–1.9)
(1.4–1.8)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(6.2–8.0)
(4.2–5.4)
(3.0–3.9)
(2.5–3.3)
(2.4–3.1)
(2.5–3.2)
(2.4–3.1)
(12–25)
(14–21)
(14–21)
(14–20)
(13–19)
(13–19)
(13–19)

NUMBER
(THOUSANDS)

RATEa

24
23
23
22
21
21
21
1.9
0
5.9
8.4
9.2
7.8
3.9
60
49
40
33
27
26
25
16
16
16
16
16
16
16
21
23
32
17
9.9
13
9.9
2.2
1.3
1.3
5.1
2.5
0
1.6
40
40
40
40
40
40
40
0
7.5
0
8.1
1.8
1.8
5.3
251
215
184
158
135
131
127
0
6.3
0
84
71
60
51
46
48
46
17
17
5.6
0
4.2
0
0
8.3
7.7
6.5
5.5
4.6
4.8
4.6
9.2
7.3
14
1.2
8.3
4.1
12
54
33
22
18
16
16
16
54
48
43
38
34
34
33

INCIDENCE HIV-POSITIVE

(15–35)
(20–27)
(18–27)
(18–26)
(18–25)
(17–25)
(17–25)
(1.6–2.1)
(0–0)
(5.2–6.7)
(7.3–9.5)
(8.1–10)
(6.9–8.9)
(3.4–4.4)
(39–85)
(40–59)
(33–49)
(27–40)
(23–32)
(22–31)
(21–30)
(14–18)
(14–18)
(14–18)
(14–18)
(14–18)
(14–18)
(14–18)
(18–23)
(21–26)
(28–36)
(15–19)
(8.7–11)
(11–15)
(8.7–11)
(1.9–2.5)
(1.1–1.5)
(1.1–1.5)
(4.4–5.7)
(2.2–2.8)
(0–0)
(1.4–1.8)
(28–54)
(33–48)
(33–48)
(34–46)
(33–48)
(33–48)
(33–48)
(0–0)
(6.6–8.5)
(0–0)
(7.1–9.1)
(1.6–2.0)
(1.5–2.0)
(4.6–6.0)
(166–354)
(185–248)
(151–221)
(129–190)
(111–161)
(108–156)
(105–151)
(0–0)
(5.5–7.2)
(0–0)
(53–121)
(58–85)
(49–72)
(43–60)
(38–55)
(40–57)
(38–55)
(15–20)
(15–20)
(4.9–6.3)
(0–0)
(3.7–4.8)
(0–0)
(0–0)
(7.3–9.4)
(6.8–8.7)
(5.7–7.3)
(4.8–6.3)
(4.0–5.2)
(4.2–5.4)
(4.0–5.2)
(8.1–10)
(6.4–8.2)
(12–16)
(1.1–1.4)
(7.3–9.4)
(3.6–4.6)
(11–14)
(47–61)
(29–37)
(20–25)
(15–20)
(14–18)
(14–18)
(14–18)
(36–75)
(39–58)
(35–52)
(31–46)
(28–41)
(28–40)
(27–39)

<0.01
<0.01
<0.01
<0.01
0.16
0.27
0.29
0.28
0.27
0.27
0.27

(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.11–0.23)
(0.22–0.32)
(0.24–0.35)
(0.23–0.34)
(0.23–0.32)
(0.23–0.32)
(0.22–0.32)

RATEa

4.2
7.7
4.9
1.5
0.5
0.8
0.8
0.7
0.7
0.7
0.7

(1.6–7.9)
(4.9–11)
(2.6–7.9)
(0.50–3.0)
(0.33–0.71)
(0.62–0.91)
(0.64–0.95)
(0.59–0.87)
(0.56–0.80)
(0.55–0.80)
(0.55–0.78)

0.019
0.029
0.041
0.022
0.013
0.012
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01

(0.017–0.021)
(0.026–0.033)
(0.036–0.047)
(0.020–0.025)
(0.012–0.015)
(0.011–0.014)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)

7.4
10
14
6.8
3.7
3.3
2.3
0.1
0.2
0.3
1.6
1

(6.5–8.3)
(9.1–12)
(12–16)
(5.9–7.7)
(3.2–4.2)
(2.9–3.7)
(2.0–2.6)
(0.12–0.15)
(0.14–0.18)
(0.24–0.31)
(1.4–1.8)
(0.83–1.1)

<0.01
<0.01
0.011
0.018
0.022
0.025
0.026
0.026

(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.013)
(0.015–0.022)
(0.019–0.026)
(0.021–0.030)
(0.021–0.031)
(0.021–0.032)

0.5
2.8
5.3
7.5
8.2
8.2
8.1
8.1

(0.47–0.60)
(1.9–3.8)
(4.3–6.4)
(6.2–9.1)
(7.1–9.4)
(6.7–9.8)
(6.6–9.7)
(6.6–9.7)

0.86
0.94
0.86
0.77
0.52
0.48
0.43

5.5
12
12
15
17
17
16

0.11
0.17
0.098
0.11
0.11
0.11
0.11

0.021
0.043
0.072
0.084
0.086
0.088
0.084
0.36
1.2
1.7
1.8
1.8
1.7
1.6

(0.57–1.2)
(0.80–1.1)
(0.71–1.0)
(0.63–0.92)
(0.43–0.62)
(0.40–0.57)
(0.36–0.52)

13
12
10
8.2
5.1
4.7
4.1

(8.4–18)
(11–14)
(8.3–12)
(6.7–9.8)
(4.2–6.1)
(3.8–5.5)
(3.4–4.9)

(3.5–8.0)
(9.9–15)
(9.8–14)
(12–18)
(14–20)
(14–20)
(13–19)

3.7
7.5
6.9
8
8.5
8.6
8

(2.3–5.3)
(6.1–9.0)
(5.6–8.3)
(6.7–9.4)
(7.1–10)
(7.1–10)
(6.6–9.5)

(0.095–0.12)
(0.15–0.20)
(0.086–0.11)
(0.094–0.12)
(0.095–0.12)
(0.098–0.13)
(0.096–0.12)

(0.019–0.024)
(0.038–0.049)
(0.063–0.081)
(0.074–0.095)
(0.076–0.098)
(0.077–0.099)
(0.074–0.095)
(0.24–0.50)
(0.95–1.4)
(1.4–2.0)
(1.4–2.1)
(1.5–2.1)
(1.4–2.0)
(1.3–1.9)

0.4
0.6
0.3
0.3
0.3
0.3
0.3

0.2
0.3
0.5
0.5
0.5
0.5
0.5
1.1
3.2
4.3
4.1
3.8
3.5
3.3

(0.34–0.44)
(0.52–0.67)
(0.28–0.36)
(0.29–0.38)
(0.28–0.36)
(0.28–0.37)
(0.28–0.36)

(0.14–0.18)
(0.26–0.34)
(0.41–0.53)
(0.45–0.58)
(0.44–0.57)
(0.44–0.57)
(0.42–0.54)
(0.73–1.5)
(2.6–3.8)
(3.5–5.1)
(3.3–4.9)
(3.1–4.6)
(2.9–4.2)
(2.7–4.0)

NOTIFIED NEW AND RELAPSE
NUMBER

b

RATEa

GLOBAL TUBERCULOSIS REPORT 2013

PERCENT

0
2

0
20

0
88 (75–100)

1
0
0
1
0
4
6
7
6
3
12 309
13 450
11 767
10 576
7 336
9 733
8 758

7.3
0
0
1.6
0
5.2
7.3
8
6.8
3.4
38
39
32
27
18
24
21

34 (29–41)
0
0
87 (77–99)
87
87
87
87
87
63
79
79
82
67
91
84

(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(44–97)
(65–96)
(66–96)
(68–100)
(56–80)
(76–110)
(71–100)

6
8
28
46
57
82
48
31
41
32
5
3
3

5.9
7.8
27
18
20
28
15
8.6
11
8.6
1.9
1.1
1.1

37
50
170
87
87
87
87
87
87
87
87
87
87

(33–43)
(44–57)
(150–200)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)

6
0
4
57
95
106
102
145
74
84
0
4
0

2.1
0
1.4
30
46
44
38
47
23
26
0
6.5
0

1
1
3
11 166
14 422
10 127
9 748
8 363
8 521
8 257
0
1
0
74 570
91 013
77 899
80 675
74 395
77 647
75 122

1.5
1.5
4.6
164
189
119
104
82
83
79
0
5.5
0
50
56
45
43
38
39
38

87
87
87
65
88
65
66
61
63
62

1
0
1
0
0
1 997
1 965
1 723
1 552
1 361
1 430
1 653
2
2
5

4.8
0
3.7
0
0
7.2
6.7
5.6
4.8
4
4.1
4.7
8
6.3
12

87 (77–99)

87
87
87
87
87
87
100
87
87
87

(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(91–120)
(77–99)
(77–99)
(77–99)

4
2
6
6 151
4 150
3 021
2 505
2 376
2 450
2 394
12 447
9 912
11 630
10 360
11 420
11 884
11 424

7.2
3.5
10
47
29
20
15
14
14
14
37
27
29
24
25
25
24

87
87
87
87
87
87
87
87
87
87
70
56
68
62
71
75
73

(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(50–100)
(47–69)
(56–83)
(52–76)
(60–86)
(63–91)
(61–88)

Rates are per 100 000 population.
NOTIFIED NEW AND RELAPSE includes cases for which the treatment history is unknown.



CASE DETECTION

Data for all years can be downloaded from www.who.int/tb/data

87 (77–99)
87
76
110
110
94
120
59
65

(77–99)
(56–110)
(96–140)
(93–140)
(82–110)
(98–140)
(49–72)
(54–79)

87 (77–99)

(77–99)
(77–99)
(77–99)
(46–99)
(76–100)
(54–79)
(55–81)
(51–74)
(53–76)
(52–75)

87 (77–99)
60
79
74
85
82
82
82

(41–94)
(66–97)
(62–91)
(72–100)
(69–99)
(69–99)
(69–99)

87 (77–99)

7$%/($,QFLGHQFHQRWLILFDWLRQDQGFDVHGHWHFWLRQUDWHVDOOIRUPV±

YEAR

Costa Rica

Cuba

Curaçao

Dominica

Dominican
Republic

Ecuador

El Salvador

Grenada

Guatemala

Guyana

Haiti

Honduras

Jamaica

Mexico

Montserrat

Netherlands
Antilles

Nicaragua

a
b

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
1990
1995
2000
2005
2010
2011
2012

3
3
4
4
5
5
5
11
11
11
11
11
11
11
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
7
8
9
9
10
10
10
10
11
13
14
15
15
15
5
6
6
6
6
6
6
<1
<1
<1
<1
<1
<1
<1
9
10
11
13
14
15
15
<1
<1
<1
<1
<1
<1
<1
7
8
9
9
10
10
10
5
6
6
7
8
8
8
2
2
3
3
3
3
3
86
95
104
111
118
119
121
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
4
5
5
5
6
6
6

NUMBER
(THOUSANDS)

1.5
1.5
1.4
1
0.65
0.59
0.51
2.6
2
1.4
1
1
1
1
<0.01
<0.01
<0.01
0.01
0.01
<0.01
<0.01
<0.01
<0.01
<0.01
11
9.7
8.6
7.7
6.7
6.6
6.4
18
15
13
11
9.7
9.4
9.1
3.4
2.6
2.2
2.4
1.8
1.7
1.6
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
6.6
7.1
7.6
8.2
8.8
9
9.1
0.65
0.65
0.78
0.88
0.87
0.87
0.87
18
19
23
25
23
22
22
5.6
6.4
7.1
5
4.1
4.2
4.3
0.15
0.16
0.17
0.18
0.18
0.18
0.18
57
44
32
25
26
27
27
<0.01
<0.01
0
<0.01
0
0
0
<0.01
0.01
<0.01
<0.01
4.5
4
3.4
2.9
2.5
2.4
2.3

(1.3–1.7)
(1.3–1.7)
(1.2–1.5)
(0.880–1.1)
(0.570–0.740)
(0.510–0.660)
(0.440–0.580)
(1.6–3.9)
(1.7–2.5)
(1.1–1.8)
(0.850–1.3)
(0.840–1.3)
(0.830–1.3)
(0.840–1.3)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.015)
(<0.01–0.012)
(<0.01–0.012)
(<0.01–0.011)
(<0.01–0.011)
(<0.01–0.011)
(<0.01–0.011)
(6.6–16)
(7.9–12)
(7.1–10)
(6.3–9.2)
(5.6–8.0)
(5.4–7.8)
(5.3–7.6)
(11–26)
(13–19)
(11–16)
(9.4–14)
(8.0–12)
(7.8–11)
(7.5–11)
(2.3–4.7)
(2.3–2.9)
(1.8–2.6)
(1.9–2.9)
(1.5–2.0)
(1.4–1.9)
(1.4–1.8)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(4.1–9.7)
(5.8–8.5)
(6.2–9.1)
(6.7–9.9)
(7.3–11)
(7.4–11)
(7.5–11)
(0.400–0.960)
(0.530–0.780)
(0.630–0.930)
(0.720–1.1)
(0.720–1.0)
(0.720–1.0)
(0.710–1.0)
(11–26)
(16–23)
(19–28)
(21–30)
(19–27)
(18–27)
(18–26)
(3.6–7.9)
(4.1–9.2)
(4.6–10)
(3.2–7.2)
(2.7–5.9)
(2.7–6.0)
(2.8–6.1)
(0.110–0.210)
(0.130–0.190)
(0.140–0.200)
(0.140–0.210)
(0.150–0.210)
(0.150–0.220)
(0.150–0.220)
(49–66)
(38–51)
(27–37)
(21–28)
(23–30)
(23–31)
(23–32)
(<0.01–<0.01)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(0–0)
(0–0)
(0–0)
(<0.01–0.011)
(<0.01–0.012)
(<0.01–<0.01)
(<0.01–<0.01)
(2.9–6.3)
(3.2–4.8)
(2.8–4.1)
(2.4–3.5)
(2.1–2.8)
(2.0–2.7)
(2.0–2.7)

a

RATE

48
43
35
23
14
12
11
25
19
13
9.2
9.3
9.3
9.3
3.9
0.76
0.74
15
14
14
13
13
13
13
148
121
100
82
67
65
62
174
136
107
83
65
62
59
63
45
37
39
28
27
25
4.6
4.5
4.4
4.2
4.1
4.1
4.1
74
71
68
65
62
61
60
89
89
104
115
111
110
109
247
247
271
272
230
222
213
113
115
114
73
54
54
54
6.5
6.5
6.5
6.5
6.6
6.6
6.6
67
46
31
22
22
23
23
11
4.1
0
24
0
0
0
5.3
5.3
3.2
4.7
108
85
68
53
42
40
38

(42–54)
(37–48)
(31–39)
(20–26)
(12–16)
(11–14)
(9.3–12)
(15–37)
(15–23)
(10–16)
(7.5–11)
(7.4–11)
(7.4–11)
(7.4–11)
(3.4–4.4)
(0.67–0.86)
(0.65–0.84)
(9.3–21)
(12–17)
(11–17)
(11–16)
(11–16)
(11–16)
(11–15)
(91–218)
(99–146)
(82–120)
(67–98)
(55–80)
(53–77)
(51–74)
(108–257)
(111–164)
(87–128)
(68–100)
(54–77)
(51–74)
(48–70)
(43–88)
(39–50)
(30–44)
(32–47)
(24–33)
(23–31)
(22–29)
(2.9–6.8)
(3.8–5.2)
(3.6–5.2)
(3.5–5.1)
(3.4–4.9)
(3.4–4.9)
(3.4–4.9)
(47–109)
(58–85)
(55–81)
(53–78)
(51–73)
(50–73)
(50–72)
(55–132)
(73–107)
(85–125)
(94–138)
(91–132)
(91–131)
(90–130)
(153–365)
(202–297)
(221–325)
(222–326)
(190–275)
(183–265)
(176–254)
(73–162)
(74–164)
(74–163)
(47–104)
(35–77)
(35–77)
(35–77)
(4.7–8.8)
(5.4–7.9)
(5.4–7.9)
(5.4–7.9)
(5.4–7.8)
(5.4–7.8)
(5.4–7.8)
(57–77)
(40–53)
(26–36)
(19–26)
(19–26)
(19–26)
(19–26)
(9.4–12)
(3.6–4.7)
(0–0)
(21–27)
(0–0)
(0–0)
(0–0)
(4.6–6.0)
(4.6–6.0)
(2.8–3.7)
(4.1–5.3)
(71–152)
(70–102)
(55–81)
(44–64)
(36–49)
(35–46)
(33–44)

INCIDENCE HIV-POSITIVE
NUMBER
(THOUSANDS)

0.031
0.066
0.092
0.074
0.074
0.071
0.064
0.023
0.028
0.033
0.023
0.035
0.037
0.037

0.25
0.81
1.1
0.98
0.64
0.59
0.54
0.71
0.96
1.2
1.2
0.97
0.92
0.84
0.082
0.16
0.23
0.27
0.19
0.18
0.2

(0.027–0.035)
(0.058–0.075)
(0.080–0.10)
(0.065–0.084)
(0.065–0.084)
(0.062–0.080)
(0.056–0.072)
(0.014–0.034)
(0.023–0.034)
(0.026–0.040)
(0.019–0.028)
(0.028–0.043)
(0.030–0.045)
(0.030–0.046)

(0.15–0.37)
(0.66–0.98)
(0.90–1.3)
(0.80–1.2)
(0.53–0.76)
(0.49–0.71)
(0.44–0.64)
(0.44–1.0)
(0.78–1.2)
(0.96–1.4)
(0.99–1.5)
(0.80–1.2)
(0.76–1.1)
(0.70–1.0)
(0.055–0.11)
(0.14–0.18)
(0.19–0.28)
(0.22–0.32)
(0.16–0.21)
(0.15–0.20)
(0.17–0.23)

<0.01 (<0.01–<0.01)
<0.01
0.14
0.38
0.78
0.99
1.3
1.4
1.5
0.05
0.12
0.24
0.27
0.22
0.22
0.2
3.2
5.6
6.8
6.5
4.6
4.5
4.3
0.24
0.77
0.84
0.37
0.19
0.18
0.17
0.01
0.033
0.052
0.053
0.042
0.041
0.04
2.6
2.6
2
1.5
1.5
1.6
1.6

0.015
0.02
0.027
0.034
0.042
0.044
0.047

(0–<0.01)
(0.086–0.20)
(0.31–0.46)
(0.63–0.93)
(0.81–1.2)
(1.1–1.5)
(1.1–1.7)
(1.2–1.8)
(0.031–0.074)
(0.098–0.14)
(0.20–0.29)
(0.22–0.33)
(0.18–0.27)
(0.18–0.26)
(0.16–0.23)
(2.0–4.8)
(4.6–6.8)
(5.6–8.2)
(5.3–7.9)
(3.8–5.5)
(3.7–5.4)
(3.5–5.1)
(0.16–0.35)
(0.49–1.1)
(0.52–1.2)
(0.23–0.54)
(0.12–0.28)
(0.11–0.26)
(0.10–0.25)
(<0.01–0.013)
(0.027–0.040)
(0.042–0.062)
(0.043–0.064)
(0.034–0.050)
(0.034–0.049)
(0.033–0.048)
(2.2–3.0)
(2.2–3.0)
(1.7–2.3)
(1.3–1.7)
(1.3–1.7)
(1.3–1.8)
(1.4–1.8)

(<0.01–0.025)
(0.011–0.031)
(0.015–0.041)
(0.020–0.053)
(0.025–0.062)
(0.027–0.066)
(0.028–0.070)

NOTIFIED NEW AND RELAPSE

a

RATE

1
1.9
2.3
1.7
1.6
1.5
1.3
0.2
0.3
0.3
0.2
0.3
0.3
0.3

3.5
10
13
11
6.4
5.8
5.2
7
8.5
9.4
8.8
6.5
6
5.4
1.5
2.7
3.9
4.4
3
2.8
3.2

(0.87–1.1)
(1.7–2.2)
(2.0–2.7)
(1.5–1.9)
(1.4–1.8)
(1.3–1.7)
(1.2–1.5)
(0.13–0.32)
(0.21–0.31)
(0.23–0.36)
(0.16–0.24)
(0.25–0.38)
(0.26–0.40)
(0.26–0.41)

(2.1–5.1)
(8.3–12)
(10–15)
(8.6–13)
(5.2–7.6)
(4.8–7.0)
(4.3–6.3)
(4.3–10)
(6.9–10)
(7.7–11)
(7.2–11)
(5.3–7.7)
(5.0–7.2)
(4.5–6.5)
(1.0–2.1)
(2.4–3.1)
(3.2–4.7)
(3.6–5.2)
(2.5–3.4)
(2.4–3.2)
(2.7–3.7)

1 (<0.1–3.2)
0.5
1.5
3.8
6.9
7.8
9
9.5
10
6.9
16
33
36
28
27
25
45
72
79
71
47
45
42
4.9
14
14
5.4
2.5
2.3
2.1
0.4
1.4
2
2
1.5
1.5
1.5
3
2.7
1.9
1.3
1.3
1.3
1.3

0.4
0.4
0.5
0.6
0.7
0.8
0.8

(0–3.0)
(0.97–2.3)
(3.1–4.6)
(5.7–8.3)
(6.4–9.4)
(7.4–11)
(7.8–11)
(8.2–12)
(4.3–10)
(13–20)
(27–39)
(29–43)
(23–34)
(22–33)
(20–29)
(28–67)
(59–87)
(65–95)
(58–85)
(39–56)
(37–54)
(35–50)
(3.2–7.1)
(8.7–20)
(8.4–20)
(3.3–7.9)
(1.5–3.7)
(1.4–3.4)
(1.3–3.2)
(0.30–0.57)
(1.1–1.6)
(1.6–2.4)
(1.6–2.4)
(1.3–1.8)
(1.2–1.8)
(1.2–1.7)
(2.6–3.5)
(2.3–3.1)
(1.6–2.2)
(1.1–1.5)
(1.1–1.5)
(1.1–1.5)
(1.1–1.5)

(0.18–0.61)
(0.24–0.66)
(0.30–0.81)
(0.36–0.97)
(0.43–1.1)
(0.45–1.1)
(0.47–1.2)

a

b

CASE DETECTION

NUMBER

RATE

PERCENT

230
586
585
534
492
514
475
546
1 553
1 183
772
827
805
734
5
1
1
6
8

7.5
17
15
12
11
11
9.9
5.2
14
11
6.8
7.3
7.1
6.5
3.4
0.66
0.64
8.5
11

16
40
43
53
75
88
93
21
76
82
74
79
77
70
87
87
87
57
78

(14–18)
(35–45)
(38–49)
(47–61)
(67–86)
(78–100)
(82–110)
(14–34)
(63–94)
(67–100)
(61–91)
(65–99)
(63–97)
(57–88)
(77–99)
(77–99)
(77–99)
(40–91)
(66–95)

8
2
7
2 597
4 053
5 291
5 003
3 964
4 309
4 262
8 243
7 893
6 908
4 416
4 832
5 106
5 456
2 367
2 422
1 485
1 794
1 700
1 896
2 053
0
4
0

11
2.8
9.8
36
51
61
54
40
42
41
81
70
55
32
32
33
35
44
42
25
30
27
30
33
0
4
0

86
22
75
24
42
61
65
59
66
67
47
51
52
38
50
54
60
70
95
68
75
96
110
130
0
89
0

(72–100)
(18–26)
(63–92)
(16–39)
(35–51)
(51–75)
(54–80)
(49–71)
(55–80)
(56–81)
(32–76)
(43–63)
(43–63)
(32–47)
(42–60)
(45–66)
(50–73)
(50–100)
(84–110)
(56–83)
(63–92)
(83–110)
(98–130)
(110–150)

4
2
1
3 813
3 119
2 913
3 803
3 322
3 040
3 442
168
296
422
639
712
710
748

3.8
1.9
0.95
43
31
26
30
23
21
23
23
41
57
84
91
90
94

93
46
23
58
44
38
46
38
34
38
26
45
54
73
82
82
86

(78–110)
(39–56)
(19–28)
(39–92)
(37–54)
(32–47)
(39–57)
(32–46)
(28–41)
(32–46)
(18–42)
(38–56)
(45–67)
(61–89)
(68–99)
(68–99)
(72–100)

6 212
10 420
14 311
14 222
14 315
16 568
3 647
4 984
6 406
3 333
2 876
3 233
3 014
123
109
127
90
130
105
91
14 437
11 329
18 434
18 524
20 155
19 857
20 470
1

79
121
155
144
143
163
74
89
103
48
38
42
38
5.2
4.4
4.9
3.4
4.7
3.8
3.3
17
12
18
17
17
17
17
9.3

32
45
57
62
64
76
66
78
90
66
70
77
70
79
68
75
51
72
58
50
25
26
58
75
77
73
75
87

(27–39)
(37–55)
(47–70)
(52–76)
(54–78)
(64–93)
(46–100)
(54–120)
(63–140)
(46–100)
(49–110)
(54–120)
(49–110)
(59–110)
(56–83)
(63–92)
(43–63)
(61–88)
(49–70)
(42–61)
(22–29)
(22–30)
(50–67)
(66–87)
(66–89)
(63–86)
(64–87)
(77–99)

0
1
0
0
0

0
21
0
0
0

5

2.8

2 944
2 842
2 402
1 907
2 448
2 693
2 790

71
61
47
35
42
46
47

REGION OF THE AMERICAS

INCIDENCE (INCLUDING HIV)
POPULATION
(MILLIONS)

(77–100)

87 (77–99)

87 (77–99)
66
72
70
65
100
110
120

(47–100)
(60–88)
(58–85)
(54–80)
(86–120)
(98–130)
(110–140)

Rates are per 100 000 population.
NOTIFIED NEW AND RELAPSE includes cases for which the treatment history is unknown.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013



7$%/($,QFLGHQFHQRWLILFDWLRQDQGFDVHGHWHFWLRQUDWHVDOOIRUPV±
INCIDENCE (INCLUDING HIV)
YEAR

Panama

Paraguay

Peru

Puerto Rico

Saint Kitts and
Nevis

Saint Lucia

Saint Vincent and
the Grenadines

Sint Maarten
(Dutch part)
Suriname

Trinidad and
Tobago

Turks and Caicos
Islands

United States
of America

Uruguay

US Virgin Islands

Venezuela
(Bolivarian
Republic of)

a
b

POPULATION
(MILLIONS)

NUMBER
(THOUSANDS)

INCIDENCE HIV-POSITIVE
NUMBER
(THOUSANDS)

RATEa

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005

2
3
3
3
4
4
4
4
5
5
6
6
7
7
22
24
26
28
29
30
30
4
4
4
4
4
4
4
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1

1.2
1.3
1.4
1.6
1.8
1.8
1.8
2.8
2.5
2.6
2.9
3
3
3
69
58
48
39
31
30
29
0.18
0.3
0.2
0.13
0.092
0.058
0.082
0
<0.01
0
0
<0.01
<0.01
<0.01
0.021
0.027
0.018
0.018
0.012
<0.01
<0.01
0.029
0.029
0.028
0.027

(0.810–1.6)
(1.1–1.6)
(1.2–1.7)
(1.3–1.9)
(1.5–2.0)
(1.6–2.0)
(1.6–2.0)
(2.6–3.0)
(2.3–2.7)
(2.4–2.8)
(2.7–3.1)
(2.7–3.2)
(2.8–3.2)
(2.8–3.2)
(43–100)
(47–70)
(39–57)
(33–46)
(27–35)
(26–34)
(25–32)
(0.160–0.210)
(0.260–0.340)
(0.180–0.230)
(0.110–0.150)
(0.081–0.100)
(0.050–0.065)
(0.072–0.092)
(0–0)
(<0.01–<0.01)
(0–0)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.019–0.024)
(0.023–0.030)
(0.016–0.021)
(0.016–0.020)
(0.011–0.014)
(<0.01–0.010)
(<0.01–<0.01)
(0.018–0.043)
(0.023–0.035)
(0.023–0.033)
(0.022–0.033)

47
47
47
47
48
48
48
66
52
49
49
46
45
45
317
242
184
140
106
101
95
5.2
8.2
5.3
3.5
2.5
1.6
2.2
0
13
0
0
4.4
2.2
4.3
15
18
12
11
6.9
5.1
3.3
27
27
26
25

(33–65)
(39–57)
(39–56)
(39–57)
(42–54)
(42–54)
(42–54)
(61–72)
(48–56)
(45–53)
(45–53)
(42–50)
(42–49)
(41–48)
(196–468)
(198–290)
(151–221)
(118–164)
(93–120)
(88–114)
(83–108)
(4.6–5.9)
(7.2–9.2)
(4.6–6.0)
(3.0–3.9)
(2.2–2.8)
(1.4–1.8)
(1.9–2.5)
(0–0)
(12–15)
(0–0)
(0–0)
(3.8–5.0)
(1.9–2.5)
(3.8–4.9)
(13–17)
(16–21)
(10–13)
(9.5–12)
(6.1–7.8)
(4.5–5.8)
(2.9–3.7)
(17–40)
(22–32)
(21–31)
(20–30)

2010
2011
2012
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
<1
1
1
1
1
1
1
1
<1
<1
<1
<1
<1
<1
<1
255
268
285
298
312
315
318
3
3
3
3
3
3
3
<1
<1
<1
<1
<1
<1
<1
20
22
24
27
29
30
30

0.027
0.026
0.026
<0.01
<0.01
<0.01
0.26
0.4
0.4
0.31
0.24
0.23
0.22
0.14
0.19
0.23
0.19
0.25
0.26
0.32
0
<0.01
0.012
<0.01
<0.01
0.01
<0.01
30
26
19
16
13
12
11
1
0.72
0.74
0.72
0.8
0.94
0.93
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
7
7.7
8.4
9
9.7
9.8
9.9

(0.022–0.032)
(0.022–0.032)
(0.022–0.031)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.170–0.360)
(0.260–0.570)
(0.260–0.580)
(0.200–0.450)
(0.160–0.340)
(0.170–0.310)
(0.160–0.290)
(0.120–0.160)
(0.170–0.220)
(0.200–0.260)
(0.170–0.220)
(0.220–0.290)
(0.230–0.290)
(0.280–0.360)
(0–0)
(<0.01–<0.01)
(0.010–0.014)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.012)
(<0.01–0.010)
(26–33)
(23–30)
(16–21)
(14–18)
(11–15)
(11–14)
(10–13)
(0.890–1.2)
(0.630–0.810)
(0.650–0.840)
(0.630–0.810)
(0.700–0.910)
(0.820–1.1)
(0.810–1.1)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(4.9–9.4)
(6.3–9.2)
(6.8–10)
(7.4–11)
(8.0–12)
(8.1–12)
(8.2–12)

24
24
24
8.1
5.3
2.6
63
92
86
63
46
44
41
11
15
18
15
19
19
24
0
36
63
29
22
33
28
12
9.8
6.6
5.4
4.1
3.8
3.6
33
22
22
22
24
28
27
4.5
4.3
7.7
7.7
7.7
7.7
7.7
35
35
34
34
33
33
33

(20–29)
(20–29)
(20–29)
(7.1–9.2)
(4.6–6.0)
(2.3–2.9)
(41–90)
(59–131)
(56–124)
(41–90)
(31–65)
(32–58)
(30–55)
(9.9–13)
(13–17)
(16–20)
(13–17)
(17–21)
(17–22)
(21–27)
(0–0)
(32–41)
(55–72)
(26–33)
(20–25)
(29–37)
(25–32)
(10–13)
(8.5–11)
(5.8–7.5)
(4.8–6.1)
(3.6–4.7)
(3.4–4.3)
(3.2–4.1)
(29–37)
(20–25)
(20–25)
(19–24)
(21–27)
(24–31)
(24–31)
(3.9–5.0)
(3.8–4.9)
(6.8–8.7)
(6.8–8.7)
(6.8–8.7)
(6.8–8.7)
(6.8–8.7)
(25–47)
(28–42)
(28–41)
(28–41)
(27–40)
(27–40)
(27–39)

RATEa

0.072
0.21
0.29
0.3
0.25
0.24
0.23
0.05
0.1
0.15
0.2
0.2
0.22
0.24
0.58
1.2
1.3
0.89
0.53
0.5
0.49

(0.050–0.099)
(0.17–0.25)
(0.24–0.34)
(0.24–0.36)
(0.22–0.28)
(0.21–0.27)
(0.20–0.26)
(0.046–0.055)
(0.093–0.11)
(0.13–0.16)
(0.18–0.21)
(0.19–0.22)
(0.20–0.24)
(0.22–0.26)
(0.36–0.86)
(0.98–1.4)
(1.0–1.5)
(0.75–1.0)
(0.46–0.60)
(0.44–0.57)
(0.43–0.55)

2.9
7.5
9.5
8.8
6.7
6.5
6.1
1.2
2.1
2.7
3.3
3.2
3.4
3.5
2.7
5
4.9
3.2
1.8
1.7
1.6

(2.0–4.0)
(6.1–9.0)
(7.9–11)
(7.2–11)
(5.9–7.6)
(5.7–7.3)
(5.3–6.8)
(1.1–1.3)
(1.9–2.3)
(2.5–2.9)
(3.1–3.6)
(2.9–3.4)
(3.1–3.6)
(3.3–3.8)
(1.6–3.9)
(4.1–6.0)
(4.0–5.8)
(2.7–3.8)
(1.6–2.0)
(1.5–1.9)
(1.4–1.8)

0.039
0.017
0.012
0.013

(0.027–0.054)
(<0.01–0.027)
(<0.01–0.020)
(<0.01–0.024)

1
0.5
0.3
0.4

(0.72–1.4)
(0.25–0.72)
(0.15–0.53)
(0.14–0.65)

<0.01 (<0.01–<0.01)
<0.01 (<0.01–<0.01)

0.7 (<0.1–2.7)
0.4 (0–1.7)

<0.01 (<0.01–0.015)

3.6 (<0.1–13)

<0.01 (<0.01–0.017)
<0.01 (<0.01–0.016)
<0.01 (<0.01–0.017)

7.3 (2.0–16)
7.6 (2.9–14)
8.7 (3.9–15)

0.023
0.12
0.16
0.1
0.06
0.053
0.047
<0.01
0.018
0.049
0.048
0.07
0.069
0.083

5.7
28
34
21
12
10
8.7
0.2
1.5
3.9
3.7
5.2
5.1
6.2

(0.015–0.033)
(0.077–0.17)
(0.10–0.22)
(0.066–0.15)
(0.040–0.085)
(0.038–0.071)
(0.033–0.062)
(<0.01–<0.01)
(0.016–0.021)
(0.043–0.055)
(0.042–0.054)
(0.061–0.079)
(0.060–0.078)
(0.073–0.094)

(3.7–8.2)
(18–39)
(22–48)
(13–29)
(7.7–16)
(7.2–13)
(6.2–12)
(0.16–0.21)
(1.3–1.7)
(3.4–4.4)
(3.2–4.2)
(4.6–5.9)
(4.5–5.8)
(5.5–7.0)

<0.01 (<0.01–<0.01)

4.5 (0.21–15)

1.6
2.2
1.2
1.3
1.2
1.1
1.1
0.013
0.022
0.067
0.11
0.13
0.15
0.14

(1.4–1.8)
(1.9–2.5)
(1.1–1.4)
(1.2–1.5)
(1.0–1.4)
(1.0–1.3)
(0.96–1.2)
(0.011–0.014)
(0.019–0.025)
(0.059–0.076)
(0.093–0.12)
(0.11–0.14)
(0.13–0.17)
(0.12–0.16)

0.6
0.8
0.4
0.5
0.4
0.4
0.4
0.4
0.7
2
3.2
3.8
4.4
4.2

(0.54–0.69)
(0.71–0.91)
(0.38–0.49)
(0.39–0.50)
(0.34–0.43)
(0.32–0.41)
(0.30–0.39)
(0.35–0.46)
(0.60–0.78)
(1.8–2.3)
(2.8–3.6)
(3.3–4.3)
(3.9–5.0)
(3.7–4.8)

(0.17–0.33)
(0.30–0.56)
(0.44–0.78)
(0.56–0.98)
(0.72–1.1)
(1.0–1.5)
(0.94–1.4)

1.2
1.9
2.4
2.8
3.1
4.3
3.9

(0.88–1.7)
(1.4–2.5)
(1.8–3.2)
(2.1–3.7)
(2.5–3.7)
(3.5–5.2)
(3.1–4.7)

0.24
0.42
0.59
0.76
0.89
1.3
1.2

NOTIFIED NEW AND RELAPSE

b

CASE DETECTION

NUMBER

RATEa

846
1 300
1 169
1 637
1 496
1 571
1 520
2 167
1 745
1 950
2 075
2 352
2 372
2 416
37 905
45 310
38 661
33 747
31 073
31 241
29 760
159
262
174
113
80
50
71
0
5
0
0
2
1
2
13
11
9
14
9
7
11
2
13
16
7

34
47
38
49
41
42
40
51
36
36
35
36
36
36
174
189
149
122
106
105
99
4.5
7.1
4.6
3
2.2
1.4
1.9
0
12
0
0
3.8
1.9
3.7
9.4
7.5
5.7
8.5
5.1
3.9
6.1
1.9
12
15
6.4

72
99
81
100
85
88
84
77
70
74
71
79
79
81
55
78
81
87
100
100
100
87
87
87
87
87
87
87

87
87
87
61
41
49
78
73
76
180
6.8
45
57
26

(77–99)
(77–99)
(77–99)
(54–70)
(36–47)
(43–56)
(69–89)
(65–84)
(67–87)
(160–210)
(4.6–11)
(38–55)
(48–70)
(21–31)

15
17
30
3
2
1
82

14
16
27
7.1
4.6
2.3
20

56
64
110
87
87
87
32

(47–68)
(54–78)
(96–140)
(77–99)
(77–99)
(77–99)
(22–50)

89
117
194
125
128
120
166
198
166
219
224
274
0

19
23
37
24
24
9.8
13
16
13
16
17
20
0

22
37
79
54
58
87
87
87
87
87
87
87

(15–34)
(26–58)
(57–120)
(41–74)
(44–80)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)

6
9
8
25 701
22 728
16 310
14 080
11 181
10 521
9 945
886
625
645
622
699
817
808
4
4

19
28
25
10
8.5
5.7
4.7
3.6
3.3
3.1
28
19
19
19
21
24
24
3.9
3.7

87
87
87
87
87
87
87
87
87
87
87
87
87
87
87
87
87
87
87

(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)

5 457
5 578
6 466
6 847
6 451
6 282
6 495

28
25
26
26
22
21
22

78
73
77
76
67
64
65

(58–110)
(60–89)
(64–95)
(63–93)
(56–81)
(54–78)
(55–79)

Rates are per 100 000 population.
NOTIFIED NEW AND RELAPSE includes cases for which the treatment history is unknown.



GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

PERCENT

(52–100)
(83–120)
(68–97)
(85–130)
(76–97)
(78–100)
(75–95)
(71–84)
(65–75)
(69–81)
(66–77)
(73–86)
(73–86)
(75–88)
(37–89)
(65–96)
(67–98)
(74–100)
(88–110)
(93–120)
(92–120)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)

87 (77–99)

7$%/($&DVHQRWLILFDWLRQV±

a

YEAR

Anguilla

•0

0•

Antigua and
Barbuda

•2

3•

Argentina

• 38

21 •

•0

27 •

Aruba

Bahamas

• 18

9•

Barbados

•2

1•

Belize

• 30

26 •

Bermuda

•0

5•

Bolivia
(Plurinational
State of)

• 164

79 •

Bonaire, Saint
Eustatius and Saba
Brazil

• 50

38 •

British Virgin
Islands

•0

0•

Canada

•7

5•

Cayman Islands

•8

10 •

Chile

• 47

14 •

Colombia

• 37

24 •

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

NEW AND
b

RELAPSE
0
2

1
0
0
1
0
4
6
7
6
3
12 309
13 450
11 767
10 576
7 336
9 733
8 758

NEW CASES
% SMEARRE-TREAT EXCL. TOTAL
SMEAR- SMEAR-NEGATIVE/
EXTRAHISTORY POS AMONG
OTHER RELAPSE
NEW
PULM
POSITIVE
UNKNOWN
PULMONARY
RELAPSE
RETREAT UNKNOWN
0

2

0

0
0
0

1
0
0

0
0
0

3
6
6
6
1

1
0
0
0
1

5 698
4 749
4 709
3 973
5 150
4 661

0

0
0
0

0
0
0

0
0
0
0

0
0
0
0
0

0
0
2
1

0
0
0
2
1

3 067
1 773
1 561
854
1 426
1 291

0
159
138
143

104
143
290
314
322

1 724
666
426
758
848

1 828
809
716
1 072
1 170

2
0
20

1
1

0

1

1

2

0

38
56
30
19
23
21

11
23
8
3
12
11

8
4
7
7
5
0

1
1
0
0

1
0
2
1
1
0

0
2
1
1
0

1
0
4
2
2
0

0
0
0
0

3
3

0

0

0

0

0

6
0
4

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

36
44
59
97
64
36

34
55
29
47
0
36

1
1
3
0
0
5

0
0
0
0

4
6
11
1
10
7

0
4
0
2
0

4
6
15
1
12
7

0
0
0
0

2
0

2
0

0

0

0

0

1
0
1

0
1
1

0
0
1

0
0
0

0
0
0

0
0
0

0
0
0

7 010
6 458
6 278
5 613
5 746
5 568
0
0
0

1 408
1 565
1 250
630
643
571
0
0
0

1 133
1 288
1 673
1 694
1 721
1 672
0
0
0

63
451
547
408
411
446

1 630
225
257
226
227

63
2 081
772
665
637
673

1
0

0
0

1
0

45 650
41 186
42 093
37 932
40 294
40 152

29 291
23 622
23 990
23 030
20 961
20 770

13 814
10 457
11 037
10 017
10 067
10 297

18
15
11

2 634
3 089
3 398
3 555
3 867

8 700
6 548
7 551
6 490
7 633

11 334
9 637
10 949
10 045
11 500

466
0
2 755
25

1
0
1
0
0
1 997
1 965
1 723
1 552
1 361
1 430
1 653
2
2
5

1
0
1
0
0
549
436
492
433
358
407
478

0
0
0
0
516
656
528
446
472
456
574

0
0
0
0
723
634
482
562
444
469
519

0
0
0
0
0
0
20
4
0
0
0

0
0
0
0
180
195
145
39
48
59
58

0
0
0
0

64
24
22
33

0
0
0
0
180
195
145
103
72
81
91

0
0
0
0
29
44
56
68
39
39
24

0
5

2
0

1
0

0
0

0

0
0

4
2
6
6 151
4 150
3 021
2 505
2 376
2 450
2 394
12 447
9 912
11 630
10 360
11 420
11 884
11 424

2
1
5

2
1
1

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

1 561
1 290
1 186
1 154
1 196
1 173

1 284
879
502
502
473
538

1 017
694
631
553
594
518

0
0
0

225
158
186
167
187
165

128
96
85
66

225
158
314
263
272
231

0
0
0

7 530
8 358
6 870
7 028
6 807
6 523

1 380
1 446
1 429
1 696
2 355
2 279

1 002
1 487
1 618
1 985
2 275
2 264

311
0
0

339
443
400
447
358

469
554
405

339
443
869
1 001
763

0
0
0

6
8
28
46
57
82
48
31
41
32
5
3
3
6
0
4
57
95
106
102
145
74
84
0
4
0
1
1
3
11 166
14 422
10 127
9 748
8 363
8 521
8 257
0
1
0
74 570
91 013
77 899
80 675
74 395
77 647
75 122

0
0
0

0
0
0

0
0
0
0
1

4 668
4 110
3 357
2 011
2 705
2 341

4
7
6

0

a

Rates are per 100 000 population.

b

NEW AND RELAPSE includes cases for which the treatment history is unknown.

0
0
0
0
0

Data for all years can be downloaded from www.who.int/tb/data

0
0
0

0
1
0

806
49

0
0
0

18
0

–
0
–
–
0

–
–
75
100
100
100
50
–
55
54
58
66
66
67
–
–
–
–
67
100
23
–
78
71
79
86
66
66
–
100
100
–
100

REGION OF THE AMERICAS

NEW AND RELAPSE
NOTIFICATION RATE
1990–2012

100
–
51
44
67
67
100
50
–
50
–
100
0
50
–
83
80
83
90
90
91

0
0
–
61
64
64
62
66
66
–
–
100
100

52
40
48
49
43
47
45
–
0
100
–
50
50
83
–
55
59
70
70
72
69
–
85
85
83
81
74
74

GLOBAL TUBERCULOSIS REPORT 2013



7$%/($&DVHQRWLILFDWLRQV±

NEW AND RELAPSE
NOTIFICATION RATEa
1990–2012

YEAR

Costa Rica

•7

10 •

Cuba

•5

7•

Curaçao

Dominica

•8

10 •

Dominican
Republic

• 36

41 •

Ecuador

• 81

35 •

El Salvador

• 44

33 •

Grenada

•0

1•

Guatemala

• 43

23 •

Guyana

• 23

94 •

Haiti

•0

163 •

Honduras

• 74

38 •

Jamaica

•5

3•

Mexico

• 17

17 •

Montserrat

•9

0•

Netherlands
Antilles
•0

190

0•

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005

NEW AND
b

RELAPSE

NEW CASES
% SMEARRE-TREAT EXCL. TOTAL
SMEAR- SMEAR-NEGATIVE/
EXTRAHISTORY POS AMONG
OTHER RELAPSE
NEW
PULM
POSITIVE
UNKNOWN
PULMONARY
RELAPSE
RETREAT UNKNOWN

230
586
585
534
492
514
475
546
1 553
1 183
772
827
805
734
5
1
1
6
8

245
349
330
267
285
257

71
184
81
89
128
99

31
98
104
108
85
102

834
675
467
462
437
374
5
0
1

520
257
160
212
219
200
0
1
0

199
201
103
98
86
112
0
0
0

1
0
0

10
6
2
0
0
0

5

8
2
7
2 597
4 053
5 291
5 003
3 964
4 309
4 262
8 243
7 893
6 908
4 416
4 832
5 106
5 456
2 367
2 422
1 485
1 794
1 700
1 896
2 053
0
4
0

0
35
19
25
16
17

26
7
10
5

0
35
45
32
26
22

2
0
0

54
50
40
45
57
46

122
9
11
16
14

54
172
49
56
73
60

2
0
0
0

0
0

0
0

0
0

0
0

3

0
0
0

0
0
1

0
1
1

0
1
2

0
0
0

244
540
602
578
655
544

100
49
44

204
610
420
324
342
374

309
196
163
178

204
610
729
520
505
552

0
0
0

2 237
1 338
635
404
380
285

420
400
330
655
808
856

0
0
111

106
403
400
397
348

280
392
263
244
315

386
795
663
641
663

1 008
1 059
972
1 079
1 237

2 241
278
402
338
371
313

181
108
255
328
384
415

0
0
0

91
78
62
62
88

180
36
30
21
10

271
114
92
83
98

2
0

0

0

0

0

0

4
1
1

0
1
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

2 368
2 052
2 420
2 121
1 961
2 212

546
518
588
265
309
382

205
202
256
348
243
311

436
415
393

249
141
101
152
112
144

58
29
48
57

249
141
159
181
160
201

85
119
240
325
323
309

187
231
352
274
282
339

22
34
33
75
78
77

6
0
0
0

2
38
8
38
27
23

46
17
124
206
221

2
84
25
162
233
244

5 887
7 340
8 242
8 011
9 254

2 930
5 292
4 335
4 553
4 956

1 367
1 484
1 307
1 374
1 914

0
0
0

236
195
338
377
444

110
33
43
46
155

346
228
381
423
599

2 306
3 404
2 069
1 842
2 060
1 945

2 214
2 396
721
482
616
509

232
370
362
382
377
362

0
0
0

100
236
181
170
180
198

25
10
32

100
236
181
195
190
230

93
90
53
76
35
46

14
20
31
46
39
33

2
4
6
6
6
9

0
0
24
0

2
13
0
2
1
3

5
17
3
3

2
13
5
19
4
6

0
0
0
0

9 220
11 676
11 997
12 572
12 960
13 038

1 807
1 675
421
2 812
2 497
2 681

302
2 081
2 657
3 464
3 529
3 839

2 831
0
0
139

421
618
722
871
773

914
1 408
544
671
878

1 335
2 026
1 266
1 542
1 651

585
0
0

0
1
0
0
0

0
1
0
0
0

0
0
0
0
0

0
0
0
0
0

0
0
0
0

0
0
0
0
0

0
0
0
0
0

0
0
0
0
0

0
0

5

2

3

0

0

0

0

0

0

4
2
1
3 813
3 119
2 913
3 803
3 322
3 040
3 442
168
296
422
639
712
710
748
6 212
10 420
14 311
14 222
14 315
16 568
3 647
4 984
6 406
3 333
2 876
3 233
3 014
123
109
127
90
130
105
91
14 437
11 329
18 434
18 524
20 155
19 857
20 470
1

8
2
5

0
0
1

0
0
0

2 787
2 907
2 949
2 159
2 454
2 483

1 418
1 234
1 032
803
809
817

5 890
5 064
3 048
3 373
3 521
3 856

3

a

Rates are per 100 000 population.

b

NEW AND RELAPSE includes cases for which the treatment history is unknown.

GLOBAL TUBERCULOSIS REPORT 2013

0
0

0
0
0
0

0
0
0

438
0
0

0
0
0
0

0
0

0
0

Data for all years can be downloaded from www.who.int/tb/data

0

–
78
65
80
75
69
72
–
62
72
74
69
67
65
100
0
100
–
100
–
–
100
100
83
–
66
70
74
73
75
75
–
72
79
83
89
90
93
–
–
78
72
74
74
80
–
100
–
100
50
100
–
81
80
80
89
86
85
–
31
34
41
54
53
48
–
–
67
58
66
64
65
–
51
59
74
79
77
79
–
87
82
63
62
47
58
–
84
87
97
82
84
83
–
–
100

–
–
40
–

7$%/($&DVHQRWLILFDWLRQV±

YEAR

Nicaragua

• 71

47 •

Panama

• 34

40 •

Paraguay

• 51

36 •

Peru

• 174

99 •

Puerto Rico

•5

2•

Saint Kitts and
Nevis

•0

4•

Saint Lucia

•9

6•

Saint Vincent and
the Grenadines

•2

27 •

Sint Maarten
(Dutch part)
Suriname

• 20

24 •

Trinidad and
Tobago

• 10

20 •

•0

25 •

Turks and Caicos
Islands

United States
of America

• 10

3•

Uruguay

• 28

24 •

US Virgin Islands

•4

0•

Venezuela
(Bolivarian
Republic of)

• 28

22 •

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

NEW AND
b

RELAPSE

2 944
2 842
2 402
1 907
2 448
2 693
2 790
846
1 300
1 169
1 637
1 496
1 571
1 520
2 167
1 745
1 950
2 075
2 352
2 372
2 416
37 905
45 310
38 661
33 747
31 073
31 241
29 760
159
262
174
113
80
50
71
0
5
0
0
2
1
2
13
11
9
14
9
7
11
2
13
16
7
15
17
30
3
2
1
82

NEW CASES
% SMEARRE-TREAT EXCL. TOTAL
SMEAR- SMEAR-NEGATIVE/
EXTRAHISTORY POS AMONG
OTHER RELAPSE
NEW
PULM
POSITIVE
UNKNOWN
PULMONARY
RELAPSE
RETREAT UNKNOWN

169
127
129
144

167
159
268
286
282
294

0
0
0
0

93
191
134
124
155

108
134
247
211
179
215

0
18
0

105
127
123

516
273
109
177
207

28
530
273
214
304
330

75
0
0

809
647
712
583

4 381
3 195
2 776
2 047
1 735

1 794
1 404
1 603
1 945

4 381
4 989
4 180
3 650
3 680

23
24
16
4
8
10

0
0
0
0

0
4
0
3

0
0
0
0

0
4
0
3

0
0
0
0

0
0
0
0
0

0
0
0
0
0

0
0
0
0

0
0
0
0
0

0
2
0
0
0

0
2
0
0
0

0
0
0

11
7
11
9
7
11

1
1
0
0
0

0
0
0
0
0

0
0
0
0

1
2
0
0
0

2
0
0
0
0

3
2
0
0
0

0
0
0

5
9
6
8
8
27
3
2
0

7
4
1
7
9
3
0
0
1

0
0
0
0
0
0
0
0
0

0
0
0
0
0
0
0

4
3
0
0
0
0
0
0
0

89
117
194
125
128
120
166
198
166
219
224
274
0

37
49
130
64
83

40
54
42
34
28

12
6
14
20
13

2
2
1
2

7
115
95
136
121
167

68
61
50
58
77
81

12
17
12
20
19
19

6
9
8
25 701
22 728
16 310
14 080
11 181
10 521
9 945
886
625
645
622
699
817
808
4
4

3
8
5

1
1
2

8 093
5 883
5 111
3 695
3 742
3 563

5 457
5 578
6 466
6 847
6 451
6 282
6 495

1 568
1 471
1 253
1 440
1 552
1 484

854
541
395
575
653
817

253
231
160
274
335
339

1 066
460
860
707
830
778
993
748
900
1 260
1 318
1 371
1 391

114
589
505
425
433
434

28
74
216
287
235
248

870
791
665
499
515
494

127
170
150
269
251
221

86
108
187

32 096
22 580
18 490
17 264
17 754
17 653

7 803
6 018
5 592
5 201
5 164
4 556

5 411
5 682
5 335
5 185
5 564
5 233

128
81
60
37
29
41

111
69
37
35
13
17

4
0
0
2
1
2

0
0
0

5
0
0
0

167
159
99
159
153
150
108
41
56
77
55
60
28
14

326
0
0

0

4
3
0
2
0
4
0
0
0

0
6
6
5
2

1
2
10
6
5

1
8
16
11
7

0
0
1
0

0
0
0
0

22
5
9
5
7
7

26
13
39
42
47

22
31
22
44
49
54

0
0
0

1
0
1

0
0
0

1
0
0

1
1
0

2
1
0

0
0
0

10 795
7 204
6 030
4 990
4 556
4 261

3 835
3 211
2 939
2 134
2 189
2 100

5
12
0
362
34
21

349
348
355
368
467
432

178
165
147
218
249
269

78
77
73
72
48
59

32
0
0
0

20
39
15
41
53
48

4
0
0
7

20
39
19
41
53
55

0
0
0

2

2

0

3 056
3 525
3 653
3 252
3 224
3 446

1 517
1 616
1 853
1 758
1 649
1 617

709
948
1 094
1 077
1 196
1 143

0
0
0

272
377
247
248
213
289

103
194
195
282

272
377
350
442
408
571

116
0
0

a

Rates are per 100 000 population.

b

NEW AND RELAPSE includes cases for which the treatment history is unknown.

Data for all years can be downloaded from www.who.int/tb/data

0
0
2
0
4
0

0
0
0
0

0

–
65
73
76
71
70
64
–
90
44
63
62
66
64
100
46
53
65
73
73
74
–
80
79
77
77
77
79
–
54
54
62
51
69
71
–
100

REGION OF THE AMERICAS

NEW AND RELAPSE
NOTIFICATION RATEa
1990–2012

100
100
100
–
100
88
92
100
100
100
–
42
69
86
53
47
90
100
100
0
–
–
48
48
76
65
75
–
9
65
66
70
61
67
–
–
–
–
75
89
71
–
43
45
46
43
45
46
–
66
68
71
63
65
62
–
50
–
–
–
–
–
–
67
69
66
65
66
68

GLOBAL TUBERCULOSIS REPORT 2013

191

7$%/($7UHDWPHQWRXWFRPHVQHZVPHDUSRVLWLYHFDVHV±
% OF COHORT
TREATMENT SUCCESS (%)a
1995–2011

Anguilla

•0

0•

Antigua and
Barbuda

•0

17 •

Argentina

• 12

52 •

•0

92 •

Aruba

Bahamas

•0

70 •

Barbados

•0

0•

Belize

• 52

0•

•0

0•

• 62

86 •

Bermuda

Bolivia
(Plurinational
State of)

Bonaire, Saint
Eustatius and Saba
Brazil

• 17

76 •

British Virgin
Islands

•0

0•

Canada

•0

62 •

Cayman Islands

•0

100 •

Chile

• 79

71 •

Colombia

•0

77 •

Costa Rica

•0

88 •

• 90

88 •

Cuba

a

192

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

SIZE OF
COHORT

0

0
0

0
0
0

3
6
1
6
6
5 698
4 749
4 709
4 044
3 973
5 150

4
6
3
6
6
5 707
5 177
4 709
5 062
5 088
5 600

6
4
7
38
56
30
26
19
23
3
3
2
6
0
36
44
59
82
97
64
2
0

1
0
7 010
6 458
6 278
5 937
5 613
5 746
0
0
45 650
41 186
42 093
39 267
37 932
40 294
1
0
1
0
436
492
433
462
358
407
0
5
1
2
1
1 561
1 290
1 186
1 152
1 154
1 196
7 530
8 358
6 870
7 319
7 028
6 807
245
349
330
271
267
285
834
675
467
418
462
437

13

30
26
19
23

11
2
6
0
29
45
59
142

1
1
1
7 010
6 212
6 278
5 897
5 571
5 770
0
0
0
45 650
34 007
42 093
40 818
41 840
42 764
1
1
0
0
492
459
850
854
858
5
1
2
2
1
1 111
1 360
1 147
1 365
1 437
1 462
1 634
7 778
6 899
7 364
6 805
349
306
166
297
282
834
673
466
415
458
443

COHORT AS
% NOTIFIED

–
–
–
–
–
–
–
133
100
300
100
100
100
109
100
125
128
109
–
–
–
–
–
186
–
–
100
100
100
100
–
–
–
100
100
–
81
102
100
–
146
–
–
–
–
–
100
–
100
96
100
99
99
100
–
–
–
100
83
100
104
110
106
–
100
–
–
0
–
–
100
106
184
239
211
–
100
–
200
100
100
71
105
97
118
125
122
–
20
113
94
105
100
–
100
93
61
111
99
100
100
100
99
99
101

CURED

100
50
67
0
5
26
19
19
20
18

COMPLETED

0
0
33
17
7
20
34
26
27
33

DIED

0
33
33
33
33
1
5
5
4
4
5

92

FAILED

DEFAULTED

0

0

0
0

0
33
50
3
6
5
7
8
8

0
0
0
0
0
0

8

0
17
0
0
0
84
43
37
43
40
36

0

17
12
16
4

40
69
53
65

17
8
16
26

7
0
5
0

20
12
11
4

0
0
0
0

45
100
100

45
0
0

9
0
0

0
0

0
0

0
0
0

52
78
56

0
0
19

10
9
12

3
0
2

28
2
12

7
11
0

0
0
0
53
73
76
84
86
84

0
0
0
9
6
2
1
2
2

0
0
0
4
4
3
4
4
3

0
0
0
1
1
1
1
1
1

0
0
0
9
9
5
5
5
5

100
100
100
24
7
12
4
3
5

17
49
31
31
37
37

0
22
44
41
37
38

1
4
5
5
5
5

1
0
1
1
0
0

3
9
9
10
11
10

79
16
9
11
10
9

0

100

0

0

0

0

22
8
10
12
8

13
59
65
65
54

5
9
7
8
9

0
0
0
0

1
1
0
0
0

59
22
17
15
29

0
0
50
50
100
79
82
83
61
51
50

40
0
0
0
0

0
11
20
22

0
0
0
0
0
7
9
9
9
9
7

0
0
0
0
0
0
0
0
0
0
0

0
100
0
0
0
8
6
6
7
6
6

60
0
50
50
0
5
2
2
12
14
15

70
63
68
69
66

10
9
9
10
11

5
6
6
7
7

1
1
2
1
1

8
7
9
9
10

6
14
6
4
5

43
85
49
75
85
90
91
90
87
89
83

14
4
4
12
3
0
2
2
3
1
5

10
5
5
7
7
4
4
6
7
7
8

1
2
1
2
1
3
1
1
2
1
2

12
3
1
2
2
2
1
1
1
2
3

19
1
39
2
2
2
1
1
0
0
0

100

0

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

GLOBAL TUBERCULOSIS REPORT 2013

NOT
EVALUATED

Data for all years can be downloaded from www.who.int/tb/data

7$%/($7UHDWPHQWRXWFRPHVQHZVPHDUSRVLWLYHFDVHV±

Curaçao

Dominica

•0

100 •

• 64

83 •

Dominican
Republic

Ecuador

• 39

78 •

El Salvador

•0

93 •

Grenada

•0

100 •

Guatemala

• 61

86 •

• 44

72 •

Guyana

Haiti

• 70

84 •

• 64

88 •

• 67

47 •

• 75

86 •

Honduras

Jamaica

Mexico

Montserrat

•0

0•

Netherlands
Antilles
•0
Nicaragua

• 80

86 •

• 69

84 •

• 51

78 •

• 83

74 •

Panama

Paraguay

Peru

Puerto Rico

• 68
a

73 •

YEAR

2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

SIZE OF
COHORT

5
5
0
5

4
8
2
2 787
2 907
2 949
2 441
2 159
2 454
5 890
5 064
3 048
3 317
3 373
3 521
1 008
1 059
930
972
1 079
2
0
4
4
1
2 368
2 052
2 420
1 609
2 121
1 961
85
119
240
328
325
323
5 887
7 340
8 242
8 011
2 306
3 404
2 069
1 881
1 842
2 060
93
90
53
77
76
35
9 220
11 676
11 997
11 862
12 572
12 960

1

4
3
2
2 007
2 760
2 697
2 441
2 194
2 454
5 236
2 150
3 330
3 373
3 441
1 008
1 059
930
972
1 079

6
4
4
1
2 368
1 908
2 121
2 121
2 056
296
119
257
328
325
323
3 081
5 887
7 340
8 435
8 242
8 390
2 226
2 362
1 905
1 881
1 918
2 004
93
99
53
76
76
59
9 220
11 538
12 172
11 821
12 304
12 622

0
1
0
0

0
0

2

5

1 568
1 471
1 253
1 329
1 440
1 552
1 066
460
860
755
707
830
748
900
1 260
1 498
1 318
1 371
32 096
22 580
18 490
17 391
17 264
17 754
128
81
60
30
37
29

1 536
1 437
1 496
1 552
1 704
1 565
1 388
460
873
768
717
861
748
900
1 452
1 467
1 317
1 367
28 185
22 230
14 793
14 212
17 264
16 694
128
81
60
37
37
40

COHORT AS
% NOTIFIED

–
–
–
–
–
–
100
38
100
72
95
91
100
102
100
89
–
71
100
100
98
–
100
100
100
100
100
–
–
–
100
100
100
100
93
–
132
100
105
348
100
107
100
100
100
–
100
100
–
100
105
97
69
92
100
104
97
100
110
100
99
100
169
100
99
101
100
98
97
–
–
–
–
–
–
–
250
–
98
98
119
117
118
101
130
100
102
102
101
104
100
100
115
98
100
100
88
98
80
82
100
94
100
100
100
123
100
138

DEFAULTED

NOT
EVALUATED

0
0
0
2
2
2
2
1
2
8

0
0
0
13
19
7
7
7
8
14

0
0
0
16
4
3
2
6
3
37

3
4
3
3

3
3
3
3

6
8
7
7

5
11
8
10

1
0
1
1
0

7
4
5
4
4

1
1
4
2
1

5
2
2
2
2

8
1
0
0
0

0

33
50
25

0

0

5
11

3
5

1
1

4
7

0
0
0
0
31
1

6
6
5
34
13
57
57
41
50
70
14
8
12
10
10
25
5
7
6
6
6
65
40
53
14
34
22
6
12
6
4
4
15

6
6
5
11
12
7
8
6
7
4
5
6
5
5
4
7
6
5
6
6
5
10
23
13
14
9
7
4
6
5
6
6
5

1
1
1
1
5

9
9
8
38
24
26
19
18
16
21
13
7
8
7
6
4
5
4
6
6
5
17
11
26
11
5
5
12
9
6
5
5
4

1
1
0
6
3
9
2
4
4
3
10
6
7
5
5
25
3
3
2
2
2
5
20
4
5
38
41
6
8
11
2
1
2

CURED

COMPLETED

100
67
100
43
37
80
79
73
76

0
33
0
21
34
5
6
7
7
39

0
0
0
5
5
4
4
5
4
2

81
71
75
73

3
4
4
4

78
91
88
91
93

67
50
75
100
56
75
77
77
81
10
43
2
13
30
22
57
72
67
72
74
39
81
81
79
79
82
2
5
4
55
13
25
69
64
71
82
82
72

DIED

FAILED

1
1
1
1
1
1
1
1
1
0
1
0
1
1
0
1
0
0
0
0
0
3
1
1
1
1
1

20
66
70
73
69
66
68
10
27
68
65
64
68
8
21
46
75
69
70
75
90
91
70
57
68

75
81
78
0

14
13
12
16
18
18
60
33
12
16
16
16
43
45
33
5
9
8
9
0
11
12
6
68
64
0
0
0
72

4
5
5
4
5
3
14
7
8
7
7
5
3
5
5
7
8
7
3
2
2
3
2
3
23
31
22
16
14
25

REGION OF THE AMERICAS

% OF COHORT
a

TREATMENT SUCCESS (%)
1995–2011

80
2
1
2
1
2
2
1
2
0
1
1
1
0
0
0
0
1
2
2
2
1
5
7

0
0
3
2

10
9
6
7
6
7
13
22
10
12
12
10
17
22
8
5
5
5
6
3
4
6
5
5
8
5
3
0
5
0

4
2
3
3
3
3
3
10
1
0
0
0
29
7
7
7
8
9
6
4
1
9
20
11
2
0
0
3
0
0

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

193

7$%/($7UHDWPHQWRXWFRPHVQHZVPHDUSRVLWLYHFDVHV±
% OF COHORT
TREATMENT SUCCESS (%)a
1995–2011

Saint Kitts and
Nevis

• 60

100 •

Saint Lucia

•0

57 •

Saint Vincent and
the Grenadines

•0

56 •

Sint Maarten
(Dutch part)
Suriname

• 14

76 •

• 69

72 •

Trinidad and
Tobago

Turks and Caicos
Islands

•0

22 •

United States
of America

• 76

78 •

Uruguay

• 68

85 •

• 50

0•

US Virgin Islands

Venezuela
(Bolivarian
Republic of)

• 74

a

80 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

4
0
0
4
2
1
11
7
11
7
9
7
5
9
6
3
8
8
3
2
37
49
149
130
64
7
115
95
154
136
121

SIZE OF
COHORT

5

5
2
1
8
13
7
9
7
13
1
8
9
3
2
51
37
143
73
75
78
194
106
154
136
123
2
3

3
8
8 093
5 883
5 111
4 014
3 695
3 742
349
348
355
409
368
467
2

4
9
8 116
5 901
5 136
7 460
7 034
5 955
370
344
345
406
368
467
2

3 056
3 525
3 653
3 436
3 252
3 224

3 056
3 390
3 581
3 433
3 157
3 224

COHORT AS
% NOTIFIED

125
–
–
125
100
100
–
114
118
100
100
100
–
144
–
33
100
112
–
100
100
–
100
–
96
56
117
1 114
169
112
100
100
102
–
–
–
–
133
112
100
100
100
186
190
159
106
99
97
99
100
100
100
–
–
–
–
–
100
96
98
100
97
100

FAILED

COMPLETED

DIED

20

40

20

0

20

0

80
100
100

0
0
0

0
0
0

0
0
0

0
0
0

20
0
0

88
15
22
43

12
54
57
67
14

0
31
29
0
14

0
0
0
0
29

0
0
14
0
0

0
0
0
11
0

100

0

0

0

0

0

0
0
44

0
0
11

0
0
11

0
0
0

0
0
33

100
100
0

100
10
49

100
0
4
19

0
0
12
16

0
0

0
0
8
14

0
0
67
3

64
60
71
49
22
68
61
72
69

3
0
5
21
46
4
8
4
3

11
12
13
19
11
12
14
9
11

1
0
0
1
2
1
3
1

16
4
4
10
6
16
14
11
15

5
23
7
0
13
0
1
1
1

0
33

0
33

0
0

0
0

100
0

0
33

0

DEFAULTED

75

41
85
80
73
80
81
50

68
76
83
84
83
80

22
76
83
84
60
64
78
27
0
4
7
5
4

6
0
0
0
0

15
11
8
6
6
6
10
13
11
12
10
8
0

4
4
5
4
5
5

1
1
0
0
0
0
0

1
1
1
4
1
4
6
5
7
0

25
11
6
3
6
32
29
15
17
0
1
2
0
0
50

1
0
0
0
0
0

8
13
10
11
11
12

13
6
2
1
0
3

67
4
3
2

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

194

GLOBAL TUBERCULOSIS REPORT 2013

NOT
EVALUATED

CURED

Data for all years can be downloaded from www.who.int/tb/data

7$%/($7UHDWPHQWRXWFRPHVUHWUHDWPHQWFDVHV±
% OF COHORT

Anguilla

•0

0•

Antigua and
Barbuda

•0

50 •

Argentina

•0

41 •

•0

0•

Aruba

Bahamas

•0

100 •

Barbados

•0

0•

Belize

• 23

0•

Bermuda

•0

0•

Bolivia
(Plurinational
State of)

• 66

73 •

Bonaire, Saint
Eustatius and Saba
Brazil

•0

49 •

British Virgin
Islands

•0

0•

Canada

•0

56 •

Cayman Islands

•0

0•

Chile

•0

43 •

Colombia

•0

45 •

Costa Rica

•0

81 •

• 82

68 •

Cuba

a

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

SIZE OF
COHORT

0

0
0

0
0
0

0
0
2
0
2

1
0
2

1 828
809
827
716
1 072

1 615
893
1 114
1 492

1
0
4
5
2
2

4
5
2
2

0
0
0
0
4
6
15
12
1
12

0
0
0
13
14
1

0

1

0
0
0
462
804
772
598
589
560
0
0
1

11 334
9 637
9 818
10 949
10 045

7 859
9 479
10 664
10 721
12 083

0
0
63
2 081
772
732
665
637

0
0
0
195
145
103
94
72
81
0
0
0
0
0
225
158
314
306
263
272
339
443
616
869
1 001
0
35
45
31
32
26
54
172
49
51
56
73

0
0
0
145
106
95
94
101

0
0
0
0
150
140
219
336
281

0
920
1 001
69
49
2
35
26
55
58
48
61
55
72

COHORT AS
% NOTIFIED

–
–
–
–
–
–
–
–
–
50
–
100
–
–
200
108
156
139
–
–
–
–
–
–
–
–
100
100
100
100
–
–
–
–
–
–
325
–
93
–
100
–
–
–
–
–
–
–
733
39
100
82
89
88
–
–
100
–
69
98
109
98
120
–
–
–
–
–
–
–
100
103
101
131
125
–
–
–
–
–
–
–
95
45
72
128
103
–
–
0
–
106
100
–
197
109
6
109
100
102
34
98
120
98
99

CURED

COMPLETED

DIED

FAILED

DEFAULTED

NOT
EVALUATED

100

0

0

0

0

0

50

0

50

0

0

0

7
10
9
9

26
20
23
33

5
4
4
5

0
1
1
0

9
13
15
16

53
52
49
38

25
20
0
0

50
60
100
100

0
20
0
0

0
0
0
0

25
0
0
0

0
0
0
0

23

0

23

8

38

8

57

29

14

0

0

0

57
49
63
73
72
71

9
11
3
5
5
2

7
12
5
7
5
6

5
2
3
2
3
3

15
8
7
7
10
10

7
16
19
7
5
7

30
26
15
18
19

10
22
28
28
30

4
7
8
8
9

0
2
2
2
2

14
19
23
25
23

41
25
24
19
17

16
8
4
15
8

16
59
60
56
49

6
7
7
9
9

1
0
0
0
0

2
3
1
0
0

60
23
27
20
35

32
69
15
14
24

26
3
9
12
19

8
14
7
6
7

1
1
2
2
1

18
9
7
9
15

15
3
60
58
33

11
32

5
13

3
7

1
4

7
23

73
22

23
55
0
37
54
82
78
67
69
67
53

9
12
0
43
27
0
7

10
4
50
11
12
7
10
6
15
4
19

3
2
0
0
4
5
3
4
5
4
3

25
24
0
9
4
5
2
2
7
11
10

30
2
50
0
0
0
0
21
0
0
0

5
15
15

REGION OF THE AMERICAS

TREATMENT SUCCESS (%)a
1995–2011

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

195

7$%/($7UHDWPHQWRXWFRPHVUHWUHDWPHQWFDVHV±
% OF COHORT
a

TREATMENT SUCCESS (%)
1995–2011

Curaçao

Dominica

•0

0•

Dominican
Republic

•0

61 •

Ecuador

•0

35 •

El Salvador

•0

90 •

Grenada

•0

0•

Guatemala

• 73

64 •

Guyana

•0

49 •

Haiti

•0

72 •

Honduras

•0

68 •

Jamaica

• 67

25 •

Mexico

•0

61 •

Montserrat

•0

0•

Netherlands
Antilles
•0
Nicaragua

• 78

69 •

Panama

•0

59 •

Paraguay

•0

67 •

Peru

•0

0•

Puerto Rico

•0
a

196

0•

YEAR

2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

SIZE OF
COHORT

0
3

0

1
0
1
204
610
729
452
520
505

0
1
1
498
530
434
384
415

386
795
756
663
641

641

271
114
113
92
83

181
114
113
92
83

554
756

0
0
0
0
249
141
159
128
181
160
2
84
25
205
162
233
346
228
381
423
100
236
181
225
195
190
2
13
5
20
19
4
1 335
2 026
1 535
1 266
1 542

0
0
0
254
164
181
181
182
38
23
205
162
233
55
228
381
381
453
180
169
192
164
165
6
5
19
19
4
138
1 456
1 229
1 272
1 352

0
0
0
0

0
0

0
167
159
268
282
286
282
108
134
247
235
211
179
28
530
273
177
214
304

289
230
181
178
204
134
42
237
203
208
203
144
164
188
216
228

4 381
4 989
4 324
4 180
3 650

4 521
2 299
2 163

0
0
4
0

113
0
4
0

COHORT AS
% NOTIFIED

–
–
–
–
–
–
0
–
100
–
82
73
96
74
82
–
–
70
100
–
100
–
67
100
100
100
100
–
–
–
–
–
–
102
116
–
141
100
114
–
45
92
100
100
100
–
16
100
–
100
107
–
76
93
85
84
87
300
–
100
95
100
100
–
10
72
80
100
88
–
–
–
–
–
–
–
–
–
173
145
68
63
71
48
–
31
96
86
99
113
–
27
60
106
101
75
–
103
46
50
–
–
–
–
–
–
100
–

CURED

COMPLETED

DIED

FAILED

DEFAULTED

0
0

100
0

0
0

0
100

0
0

0
0

29
56
47
51
46

26
5
6
13
15

3
7
13
9
7

4
8
5
5
5

27
19
29
18
20

11
6
0
4
6

56
46

8
9

5
6

10
8

12
16

9
16

29

6

3

5

10

46

63
68
85
88
90

3
0
3
2
0

9
6
3
2
2

3
4
1
3
0

18
13
8
1
5

3
8
1
3
2

59
63

15
16

4
4

2
4

4
10

17
2

55
55
51

8
8
14

5
5
11

7
7
4

20
20
20

4
4
1

24
22
0
0
6

29
35
51
52
43

13
9
14
14
9

5
9
0
1
1

26
13
18
28
33

3
13
17
5
8

42
63
49
60
61

15
7
20
14
11

5
3
7
5
4

7
0
3
2
6

22
13
10
10
10

9
14
11
8
9

44
59
50
66
64
0

10
9
7
9
5
67

8
6
10
7
9
17

2
2
1
2
2
0

6
17
10
15
16
17

29
7
22
1
4
0

16
5
0

20
58
26
25

5
26
0

0
0
0

80
21
21
25

0
0
21
50

33
48
56
55
47

4
7
5
7
14

8
7
9
9
10

7
4
6
6
5

12
14
10
11
10

36
20
14
10
14

69
65
71
70
60
58

10
10
12
6
16
10

4
6
7
3
8
10

3
2
2
6
4
2

11
15
7
11
9
14

3
2
2
3
2
4

19
23
18
23
24

24
35
30
34
34

2
9
10
11
11

0
4
0
3
2

48
22
37
30
28

7
7
4
0
0

19
44
47
54
60

40
26
9
6
7

6
4
9
8
4

1
4
2
4

25
10
11
9
9

9
16
20
20
16

78
78
49

0
21

4
5
4

7
5
2

6
11
12

4
1
12

73

23

0

4

1

0

25

25

0

0

50

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

GLOBAL TUBERCULOSIS REPORT 2013

NOT
EVALUATED

Data for all years can be downloaded from www.who.int/tb/data

7$%/($7UHDWPHQWRXWFRPHVUHWUHDWPHQWFDVHV±
% OF COHORT

Saint Kitts and
Nevis

•0

0•

Saint Lucia

•0

0•

Saint Vincent and
the Grenadines

•0

0•

Sint Maarten
(Dutch part)
Suriname

•0

64 •

Trinidad and
Tobago

•0

35 •

Turks and Caicos
Islands

•0

0•

•0

0•

United States
of America

Uruguay

• 76

79 •

•0

0•

US Virgin Islands

Venezuela
(Bolivarian
Republic of)

•0

a

80 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

0
2
0
0
0

SIZE OF
COHORT

2
0
0
0

3
2
3
0
0
4
3
0
2
2
0

1
0
0

0
0

0

1
8
15
16
11
22
31
22
60
44
49

1
3
0
0
3

12
11
11
22
21
60
44
49

3
2
1

0
0

20
39
19
37
41
53

25

272
377
350
428
442
408

30
41
41
53

247
261
248
400

COHORT AS
% NOTIFIED

–
–
100
–
–
–
–
33
–
100
–
–
–
100
–
50
0
–
–
–
–
–
–
–
80
69
100
–
71
95
100
100
100
–
–
–
–
0
0
–
–
–
–
–
–
125
–
158
111
100
100
–
–
–
–
–
–
–
–
71
61
56
98

CURED

COMPLETED

DIED

FAILED

DEFAULTED

50

100

NOT
EVALUATED

50

0

0

0

0

0

33

67

0

0

0

100

0

0

0

0

0

0

0

0

0

100

0

50
45
45

0
9
18

8
27
36

0
0
0

42
0
0

0
18
0

23
19
48
43
22

45
38
20
20
12

14
29
15
14
12

9
0
0
0

9
14
17
23
51

0
0
0
0
2

33

33

33

0

0

0

56

20

16

0

8

0

57
46
56
74

17
10
20
6

13
34
15
11

3
0
0
0

7
7
5
9

3
2
5
0

80
80
83
80

0
0
0

4
4
6
9

2
2
1
0

12
13
10
10

2
2
0
0

REGION OF THE AMERICAS

TREATMENT SUCCESS (%)a
1995–2011

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

197

7$%/($+,9WHVWLQJDQGSURYLVLRQRI&37$57DQG,37–

% OF TB PATIENTS WITH
KNOWN HIV STATUS
YEAR
2005–2012
Anguilla

–

–

Antigua and
Barbuda
• 100

100 •

Argentina

–

15 •

–

3•

Aruba

Bahamas

–

100 •

–

100 •

Barbados

Belize

• 100

81 •

Bermuda

–

100 •

Bolivia
(Plurinational
State of)
•0

60 •

Bonaire, Saint
Eustatius and Saba
Brazil

• 59

55 •

British Virgin
Islands
–

–

Canada

• 26

42 •

Cayman Islands

–

100 •

–

16 •

• 53

66 •

Chile

Colombia

Costa Rica

• 67

94 •

Cuba

• 93

83 •

Curaçao

Dominica

–

75 •

Dominican
Republic
•1

61 •

•0

86 •

Ecuador

El Salvador

• 84

99 •

Grenada

–

100 •

Guatemala

• 16

85 •

• 70

94 •

•0

81 •

Guyana

Haiti



2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

NUMBER OF TB
% OF TB
PATIENTS WITH PATIENTS WITH
KNOWN HIV
KNOWN HIV
STATUS
STATUS
0

100
86
75
100

0
0
0
6
6
6
4

14
13
15

1 121
1 313
1 434

3.4

1

100
100
100

75
100
100

33
42
32
8
6
0
4
106
142
64
68
1
1
1
3
0
1 897
3 928
5 049
0
0
0
51 552
51 764
53 455
45 733
0
0
0
0
414
658
513
716
1
3
2
6

11
16
53
43
53
66
67
99
96
94
93
100
95
83
0
0
100

286
392
5 537
5 079
6 579
7 791
374
494
505
453
729
862
780
618
0
0
1

38
67
75
1.5
60
57
61
0.21
100
68
86
84
96
98
99

3
2
6
78
2 489
2 540
2 721
10
5 183
3 640
4 974
1 544
1 667
1 878
2 036
0
4
2
1
600
2 121
2 223
2 982
456
734
852
914
0
9 518
11 213
13 518

100
100
100
98
84
81
100
100
100
0
22
45
60
0
59
63
64
55
0

26
48
35
42

100
100
100
16
63
72
85
70
88
93
94
0
67
78
81

GLOBAL TUBERCULOSIS REPORT 2013

PATIENTS
NOTIFIED
(NEW AND
RETREAT)
1
0
0
6
7
8
4
11 242
7 762
10 491
9 606
6
8
29
50
32
42
32
6
0
4
106
145
76
84
1
1
3
9 973
8 620
8 747
8 484
0
1
0
87 223
81 946
84 137
82 755
0
1
0
0
1 616
1 385
1 452
1 686
4
2
6
2 633
2 472
2 535
2 460
10 360
11 889
12 438
11 829
560
499
524
480
781
838
821
748
5
1
1
8
3
8
5 312
4 160
4 472
4 440
4 808
5 095
5 350
5 771
1 830
1 730
1 917
2 063
4
2
1
3 861
3 351
3 088
3 499
656
836
916
969
14 344
14 265
14 361
16 723

NUMBER OF
HIV-POSITIVE
TB PATIENTS

% OF TESTED
TB PATIENTS
HIV-POSITIVE

% OF HIV% OF HIVNUMBER OF
POSITIVE TB POSITIVE TB HIV-POSITIVE
PATIENTS ON PATIENTS ON
PEOPLE
CPT
ART
PROVIDED IPT

0
0
0
3
5
4
2

50
83
67
50

672
735
685

60
56
48

1

100

16
12
8
2
2
0
1
25
29
24
19
0
0
0
0
0
130
333
164
0
0
0
8 249
9 338
9 088
9 049
0
0
0
0
63
53
61
57
0
0
0
0

48
29
25
25
33

31
42
38
0
0

25
24
20
38
28
0
0
0
0

0
68
100

100
68
100
100
100

6.9
8.5
3.2

0

87
36
100

16
18
17
20

0

85
92
100
100

148
140
353
1 231
1 292
1 400
50
54
36
49
0
56
62
54
0
0
1
0
1
0
0
3
547
460
557
3
427
576
669
188
180
194
214
0
1
0
0
478
255
285
293
80
209
199
284
1 797
1 892
2 320
2 705

100
40
50
50

100
100
100
100

0
0
5
1

100
75
67
62
100

409

50

0
0

674

27

15
8.1
12
8
0
0
0
0

52
36
6.4
24
20
18
13
11
7.1
11
0
6.5
7.9
8.7

0
0

35
36
34
84
0
0

0
34
81

62
89
94

33
0
0
3.8
22
18
20
30
8.2
16
13
12
11
10
11

100

100

0
7.9
58
69
0

0
3.8
93
48

20
82
85
66

38
63
77
83

25
0
0
80
12
13
9.8
18
28
23
31

0

0

100
16
0

240
100
30
95

77
94
71

59
83
59

144
119
154

20
21
20

13
11
59

9.8
6.9
46

15 283

0
1 366
1 429
1 339

100

953
5 041

100

455

0
0

Data for all years can be downloaded from www.who.int/tb/data

4 112

7$%/($+,9WHVWLQJDQGSURYLVLRQRI&37$57DQG,37–

Honduras

• 44

76 •

• 83

69 •

•7

70 •

Jamaica

Mexico

Montserrat

• 100

–

Netherlands Antilles
Nicaragua

•0

72 •

• 86

96 •

–

73 •

Panama

Paraguay

Peru

•2

18 •

• 82

86 •

Puerto Rico

Saint Kitts and
Nevis
–

100 •

•7

100 •

Saint Lucia

Saint Vincent and
the Grenadines
• 100

91 •

Sint Maarten
(Dutch part)
Suriname

• 73

91 •

Trinidad and
Tobago
• 69

97 •

Turks and Caicos
Islands
–

0•

United States
of America
• 59

84 •

Uruguay

• 92

95 •

US Virgin Islands

–

–

Venezuela
(Bolivarian
Republic of)
• 39

73 •

2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

NUMBER OF TB
% OF TB
PATIENTS WITH PATIENTS WITH
KNOWN HIV
KNOWN HIV
STATUS
STATUS
44
54
75
76
83
87
85
69
6.9
43
56
70
100

1 455
1 557
2 443
2 312
79
128
92
65
1 382
8 915
11 416
15 005
1
0
0

PATIENTS
NOTIFIED
(NEW AND
RETREAT)
3 333
2 901
3 243
3 046
95
147
108
94
19 932
20 699
20 528
21 348
1
0
0
0

NUMBER OF
HIV-POSITIVE
TB PATIENTS
200
201
261
259
28
30
17
13
217
1 645
1 520
1 233
0
0
0

14
13
11
11
35
23
18
20
16
18
13
8.2
0

2
30
60
60
105
200
240
241
224

100

144
174
154
668
853
960
979
28
14
10
11

18
11
8.1
100
8.9
14
17
30
18
22
18
0
0
0
0
0
14
9.1
14
30
38
29
0
0
0
23
34
32
30
34
23
33
26
20
20
0
13
8.5
7.6
7.5
13
16
14
17

15
9.2
13
12

0
56
55
72
86
96
95
96

2
0
1 440
1 552
2 117
1 569
1 558
1 608
1 600

33
60
73
1.9
29
21
18
82
95
92
86

817
1 533
1 906
668
9 539
7 052
5 836
93
76
46
61

100
100
100
7.1
100
100
100
100
59
76
91
100
100
100
73
85
89
91
69
98
95
97
71
10
0
59
66
83
84
92
92
94
95

2
1
2
1
9
7
11
7
10
13
31
3
2
1
87
173
117
121
124
254
252
311
5
5
1
0
8 273
7 404
8 752
8 376
574
646
769
775

7
10
8
14 080
11 181
10 521
9 945
626
699
817
815

0
0
0
0
0
1
1
1
3
5
9
0
0
0
20
58
38
36
42
58
84
82
1
1
0
0
1 035
627
668
625
74
104
110
134

39
78
64
73

2 678
5 213
4 133
4 956

6 950
6 645
6 477
6 777

392
479
519
581

2 076
2 575
2 822
2 934
1 828
1 630
1 695
1 675
2 348
2 461
2 549
2 623
35 541
32 477
32 844
31 705
113
80
50
71
2
2
1
2
14
9
7
11
7
17
17
34
3
2
1
119
204
131
133
179
258
266
321

% OF TESTED
TB PATIENTS
HIV-POSITIVE

4.2
3.9
5
13
15
15
14

Data for all years can be downloaded from www.who.int/tb/data

NUMBER OF
% OF HIV% OF HIVPOSITIVE TB POSITIVE TB HIV-POSITIVE
PATIENTS ON PATIENTS ON
PEOPLE
PROVIDED IPT
ART
CPT
0
90
50
52
43

0
90
72
74
54
100
82

100
70
70

26
25
24

0
67
67
78
63
94
89

67
67
74
10
84
93
65

0
25
60

67
56
79
1.2
68
87

43
50
82

50
50
36

100
100
0

100
100
0
100
80
67

80
67

29
19
24
28
0
100

10
38
55
69
36
34
19
29
0
100

0
0
0
0

34
31
24

10
18

0

39
33
32
89

0
27
286

465
152
230
400

REGION OF THE AMERICAS

% OF TB PATIENTS WITH
KNOWN HIV STATUS
YEAR
2005–2012

1 214
1 183
1 416

1

0
11

102

GLOBAL TUBERCULOSIS REPORT 2013

199

7$%/($7HVWLQJIRU0'57%DQGQXPEHURIFRQILUPHGFDVHVRI0'57%±

YEAR

TOTAL
CONFIRMED
CASES OF
a

MDR-TB
2005
2010
2011
2012
Antigua and
2005
Barbuda
2010
2011
2012
Argentina
2005
2010
2011
2012
Aruba
2005
2010
2011
2012
Bahamas
2005
2010
2011
2012
Barbados
2005
2010
2011
2012
Belize
2005
2010
2011
2012
Bermuda
2005
2010
2011
2012
Bolivia
2005
(Plurinational
2010
State of)
2011
2012
Bonaire, Saint
2010
Eustatius and Saba 2011
2012
Brazil
2005
2010
2011
2012
British Virgin
2005
Islands
2010
2011
2012
Canada
2005
2010
2011
2012
Cayman Islands
2005
2010
2011
2012
Chile
2005
2010
2011
2012
Colombia
2005
2010
2011
2012
Costa Rica
2005
2010
2011
2012
Cuba
2005
2010
2011
2012
Curaçao
2010
2011
2012
Dominica
2005
2010
2011
2012
Dominican
2005
Republic
2010
2011
2012
Ecuador
2005
2010
2011
2012
El Salvador
2005
2010
2011
2012
Grenada
2005
2010
2011
2012
Guatemala
2005
2010
2011
2012
Guyana
2005
2010
2011
2012

NEW PULMONARY CASES
ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

NUMBER OF
b

BACT+VE
TESTED FOR
MDR-TB

Anguilla

200

0
0
0
0
0
0
276
109
103
63

0 (0–0)

0.18 (<0.1–0.27)

0
0
0

0 (0–0)

<0.1 (<0.1–<0.1)

340 (230–440)

160 (88–260)

0.85 (0.57–1.1)

0.57 (0.36–0.81)

0

0
1
1
0
0
0
0
0
0
0
0
0
0
63
106
83
117
0
1
0
373
573
566
684
0
0
0
22
15
19
9
0
0
0
6
10
9
18
131
108
105
3
3
0
1
1
7
10
8
0
0
0
0
0
0
108
117
92
253
176
354
223
14
2
4
8
0
0
0
40
18
27
69
5
3
0

0
0
0
2369

5

1.2 (<0.1–6.1)

1.2 (<0.1–6.1)

21
31
27
0
0
0
0

<0.1 (<0.1–0.10)

<0.1 (<0.1–0.10)

2.5 (1.7–3.4)

1.6 (1.0–2.2)

0

0 (0–1.7)

1
1
2

0 (0–1.7)

150 (88–210)

0 (0–0)

1 700 (1 400–2 000)

74 (27–160)

0 (0–0)

0
98
1376
0
0

850 (620–1 100)

22
21
700

0 (0–0)

0 (0–0)

0
0
0
1130
987

7.4 (2.2–13)

6.0 (2.4–12)

1244

0 (0–3.1)

0 (0–3.1)

19 (7.5–30)

12 (4.4–26)

310 (220–400)

210 (140–320)

6.4 (0.81–12)

5.4 (1.5–14)

11 (3.4–19)

4.3 (0.52–15)

0 (0–0.98)

0 (0–0.98)

0 (0–0)

0 (0–5.9)

330 (230–430)

220 (140–330)

380 (320–450)

210 (150–280)

16 (5.9–26)

5.1 (0.61–18)

<0.1 (<0.1–<0.1)

1
1
5
49
65
71
125
1240
2620
2378
2
203
32
273
169
174
313
269
5
1
1
1
1
2
32
12
79
117
363
239
529
12
0
238
252

<0.1 (<0.1–<0.1)
20

140 (100–180)

48 (25–70)

89 (55–140)

0
37

14 (9.1–20)

0
2
3

PREVIOUSLY TREATED CASES
% OF
b

BACT+VE
TESTED FOR
MDR-TB
–
–
–
–
–
0
0
0
46
–
–
–
–
–
71
–
–
95
97
84
–
0
–
0
0
–
–
0
–
100
100
200
–
0
1.7
22
–
–
–
–
<0.1
<0.1
1.6
–
0
–
–
150
130
–
140
–
50
100
100
3.2
4.4
4.8
8.4
–
17
36
33
0.49
64
9.6
95
32
36
60
61
100
100
100
–
12
50
40
–
1.4
0.42
3.1
3.2
10
6.3
13
1.1
0
22
20
–
–
–
–
0.83
–
0
1.4
–
0
0.62
0.97

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

0 (0–0)

0.14 (<0.1–0.23)

180 (110–260)

0.27 (<0.1–0.46)

0 (0–0)

0 (0–0)

0.96 (0.32–1.6)

0 (0–0)

75 (60–94)

0 (0–0)

860 (660–1 100)

0 (0–0)

1.4 (<0.1–7.8)

0 (0–0)

6.7 (2.2–15)

98 (74–130)

1.0 (<0.1–5.0)

7.1 (2.7–14)

0 (0–0)

0 (0–2.0)

110 (71–150)

170 (150–190)

11 (4.8–20)

0 (0–0)

53 (40–69)

33 (11–56)

NUMBER OF
% OF NOTIFIED
NOTIFIED
TESTED FOR
TESTED FOR
MDR-TB
MDR-TB
–
0
–
0
–
0
–
–
0
–
0
0
0
0
1290
160
–
–
–
–
–
–
–
–
2
100
1
50
0
–
–
0
–
0
–
0
–
3
20
–
–
0
0
–
0
–
0
–
0
–
–
664
100
597
94
634
94
0
–
1
100
0
–
5917
61
643
5.9
604
6.0
198
1.7
–
0
–
0
–
0
–
–
51
71
–
63
69
–
0
–
0
–
0
–
226
72
276
100
277
100
172
74
–
495
57
568
57
391
51
1
2.2
–
16
62
22
100
19
39
31
55
76
100
51
85
–
0
–
0
–
–
1
–
1
100
1
50
–
106
20
77
15
193
35
502
63
584
88
284
44
827
120
14
12
2
2.2
69
83
73
74
–
–
–
–
40
25
18
9.9
27
17
74
37
–
0
0
55
24
1
0.41

a

TOTAL CONFIRMED CASES OF MDR-TB includes cases with unknown previous treatment history (i.e. not included under NEW CASES or PREVIOUSLY TREATED CASES).

b

BACT+VE = bacteriologically positive cases.

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($7HVWLQJIRU0'57%DQGQXPEHURIFRQILUPHGFDVHVRI0'57%±

a

MDR-TB
2005
2010
2011
2012
Honduras
2005
2010
2011
2012
Jamaica
2005
2010
2011
2012
Mexico
2005
2010
2011
2012
Montserrat
2005
2010
2011
2012
Netherlands Antilles 2005
Nicaragua
2005
2010
2011
2012
Panama
2005
2010
2011
2012
Paraguay
2005
2010
2011
2012
Peru
2005
2010
2011
2012
Puerto Rico
2005
2010
2011
2012
Saint Kitts and
2005
Nevis
2010
2011
2012
Saint Lucia
2005
2010
2011
2012
Saint Vincent and 2005
the Grenadines
2010
2011
2012
Sint Maarten
2010
(Dutch part)
2011
2012
Suriname
2005
2010
2011
2012
Trinidad and
2005
Tobago
2010
2011
2012
Turks and Caicos 2005
Islands
2010
2011
2012
United States
2005
of America
2010
2011
2012
Uruguay
2005
2010
2011
2012
US Virgin Islands 2005
2010
2011
2012
Venezuela
2005
(Bolivarian
2010
Republic of)
2011
2012

NEW PULMONARY CASES
ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

Haiti

a
b

41
86
81
3
9
5
6
0
1
1
0
394
140
140
114
1
0
0
0
50
18
13
21
5
10
7
11
13
1
6
7
2748
1048
1663
1225
0
0
3
1
0
0
0
0
0
0
6
0
0
0
0
0
0
1
0
0
0
3
0
0

390 (270–520)

b

BACT+VE
TESTED FOR
MDR-TB
53
2

310 (200–440)

71 (37–110)

43 (19–84)

2.6 (1.7–3.4)

1.7 (1.1–2.4)

480 (350–620)

380 (330–440)

0 (0–0)

NUMBER OF

3
57
30
41
11
40
28
16
314
21
6
13
0
0
0

0 (0–0)
8
50
200

46 (21–70)

56 (35–78)

55 (19–90)

2 200 (2 100–2 300)

1.0 (0–2.6)

<0.1 (<0.1–<0.1)

14 (1.7–52)

27 (17–38)

29
58
25
2

6.5 (0.16–36)

115
227
235

890 (820–960)

1199
14484

0 (0–3.8)

<0.1 (<0.1–<0.1)

0.24 (0.15–0.34)

0.24 (0.15–0.34)

1.2 (0.78–1.6)

0.66 (0.42–0.93)

69
44
52
0
0
0
0
2
0
6
2
1
2
0

<0.1 (<0.1–<0.1)

<0.1 (<0.1–<0.1)
49
1
0

3.4 (2.4–4.5)

2.5 (1.6–3.5)
0

11 (8.4–13)

4.5 (2.2–6.4)

0.13 (<0.1–0.18)

0.13 (<0.1–0.18)

6

1

124
107
119
81
1
1
1

81 (63–100)

1.3 (0–3.8)

–
28
21
25
21

100 (58–150)

81 (63–100)

0 (0–5.5)

10064
7593
6899
6790
160
422
466

–

26 (7.2–67)

163
26
565
460

PREVIOUSLY TREATED CASES
% OF
b

BACT+VE
TESTED FOR
MDR-TB
0.72
<0.1
–
–
0.13
3.1
1.5
2.1
19
31
64
28
2.1
0.16
<0.1
<0.1
0
–
–
–
–
0.64
3.5
13
–
3.3
8.2
2.3
0.26
–
8.2
15
15
–
–
6.5
79
–
100
110
98
–
0
0
0
–
0
29
0
86
22
12
7.4
–
0
–
44
0.70
0
–
0
–
–
2.4
–
–
–
–
110
110
99
100
–
36
75
88
–
–
–
–
4.3
0.78
17
13

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

82 (28–140)

28 (13–51)

0.82 (0.28–1.4)

100 (84–130)

0 (0–0)

31 (18–49)

29 (9.9–49)

48 (20–92)

1 300 (1 200–1 400)

1.0 (<0.1–2.7)

0 (0–0)

0 (0–0)

0.55 (0.18–0.92)

0 (0–0)

0.96 (0.32–1.6)

6.4 (5.0–7.9)

0 (0–0)

–

1.3 (<0.1–6.9)

–

77 (43–120)

NUMBER OF
% OF NOTIFIED
NOTIFIED
TESTED FOR
TESTED FOR
MDR-TB
MDR-TB
–
39
10
–
81
14
0
0
62
32
65
34
96
42
2
40
5
26
1
25
0
0
74
3.7
505
40
180
12
148
9.0
0
–
0
–
0
–
–
–
8
3.0
150
52
67
24
–
48
19
17
8.1
40
22
7
3.3
–
52
24
93
31
89
27
2336
47
–
598
16
1902
52
–
4
100
0
–
3
100
–
0
–
0
–
0
–
–
0
–
0
–
0
–
0
–
–
0
–
0
0
–
–
–
0
0
–
0
0
–
3
14
–
–
10
19
–
–
–
–
505
–
345
–
304
–
339
–
–
22
54
38
72
42
76
–
–
–
–
15
4.3
160
36
195
48
148
26

REGION OF THE AMERICAS

YEAR

TOTAL
CONFIRMED
CASES OF

TOTAL CONFIRMED CASES OF MDR-TB includes cases with unknown previous treatment history (i.e. not included under NEW CASES or PREVIOUSLY TREATED CASES).
BACT+VE = bacteriologically positive cases.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

201

7$%/($1HZVPHDUSRVLWLYHFDVHQRWLILFDWLRQE\DJHDQGVH[±
MALE
YEAR

Anguilla

Antigua and
Barbuda

Argentina

Aruba

Bahamas

Barbados

Belize

Bermuda

Bolivia
(Plurinational
State of)

Bonaire, Saint
Eustatius and Saba
Brazil

British Virgin
Islands

Canada

Cayman Islands

Chile

Colombia

Costa Rica

Cuba

Curaçao

Dominica

202

1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
2010
2011
2012
1995
2000
2005
2010
2011
2012

0–14

15–24

25–34

35–44

FEMALE
45–54

55–64

65+

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

1
0
0

0

0

0
2
1
0

0
1
2
3
1

1

0
0
0

0
1
0
1
0

0

0
0
0

1
1
0

97
64
56
143
59

278
621
536
664
533

594
530
491
657
484

402
358
309
434
299

419
384
302
397
180

368
340
340
358
182

3
1

3
2

5
7

2
7
9

4
3
4
4

2
3

2
2

0
0
0

2
2
1

3
3
1

5
6
6

0
2
2

2
2
0

0
1
2

0

0

0

2

0

0

0

0
0
0
1
2
0
2
0
1

0
0
0
1
5
8
9
8
2

0
0
0
2
7
8
16
14
7

1
0
0
4
2
6
22
9
5

2
0
0
0
6
8
24
16
4

0
0
0
1
3
5
11
2
3

0
0
0

0
0
0

0
0
0

1
0
0

0
0
0

166
157
95
100
99
0
0
0

1 182
1 320
1 150
1 231
1 096
0
0
0

797
725
622
685
672
0
0
0

518
439
415
372
368
0
0
0

1 894
317
298
336
277

7 268
5 074
4 405
4 877
5 027

11 568
6 119
6 381
6 755
6 811

0
0
0
1
5
3
3
2
1

0
0
0
28
34
37
30
34
33

0
0
0
0
24
6
3
2
4
4

UNKNOWN

0–14

15–24

25–34

35–44

45–54

0
0
0

65+

UNKNOWN

0
0

0
0
0

0
0
0

0
0
0

0
0
0

1

0

0

0
0
0

1
2
1
0
0

0

0
0
0

1
2
0
1
0

0

0
1
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

330
348
282
289
181

2
9
15

121
90
59
142
67

544
530
421
587
652

479
474
426
470
614

262
290
233
279
375

230
198
184
192
364

179
169
153
169
321

216
240
176
213
322

1
4
13

1
0
2

4
1
5

7
7

2
2
8

1
0
2

0
3

1
1
1
1

0
0
0

0
0
0

5
1
2

1
3
5

1
3
1

0
0
1

0
0
0

0
0
0

0

0

1

0

0

0

0

0
0
0
1
5
3
18
0
2

0
0
0

1
0
0
6
2
4
5
2
4

0
0
0
2
1
4
7
0
3

0
0
0
0
2
4
7
8
4

2
0
0
1
4
3
9
4
4

0
0
0
1
1
2
4
1
1

0
0
0
2
4
4
5
0
0

0
0
0

0

0
0
0
0
0
0
4
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
1

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

466
391
395
371
358
0
0
0

340
346
338
302
353
0
0
0

366
415
409
457
380
0
0
0

0
0

191
160
119
146
101
0
0
0

831
846
744
778
792
0
0
0

588
533
471
459
480
0
0
0

334
276
238
235
223
0
0
0

254
226
191
183
204
0
0
0

192
182
162
155
193
0
0
0

233
262
264
272
249
0
0
0

0
0

11 906
6 128
5 293
5 462
5 387

8 623
5 259
4 762
5 054
5 128

5 085
2 803
2 875
3 083
3 103

4 494
2 140
1 947
2 142
2 160

43
41
38

1 859
355
280
356
303

6 719
3 496
2 677
2 815
2 798

7 215
3 663
3 008
3 131
3 013

5 395
2 626
2 211
2 230
2 173

3 582
1 897
1 720
1 779
1 785

2 384
1 112
1 038
1 164
1 113

2 496
1 104
979
1 069
1 030

15
0
6

0
0
0
31
45
45
28
36
32

0
0
0
60
46
44
36
31
53

0
0
0
34
41
40
32
40
51

1
0
0
41
32
20
25
33
35

0
0
0
70
79
68
62
70
97

0
0
0
7
4
6
1
3
6

0
0
0
33
33
28
28
23
32

0
0
0
28
40
40
24
29
34

0
0
0
22
30
27
16
28
29

0
0
0
12
25
24
10
14
19

0
0
0
18
12
13
19
9
11

0
0
0
51
66
37
44
55
45

0

3

1

0

1

0

0
0
0
148
81
74
90
88
91

0
0
2
182
160
128
115
139
122

1
0
2
204
198
179
144
143
135

0
0
1
155
150
162
159
164
170

0
1
0
141
132
115
122
127
117

0
0
0
163
126
133
157
134
149

0
0
0
24
10
4
6
6
4

0
0
0
100
66
55
56
62
59

0
0
0
120
96
78
76
75
69

0
0
0
108
70
60
59
66
53

1
0
0
75
54
56
56
69
56

0
0
0
73
58
36
40
48
60

0
0
0
107
83
93
72
71
76

246
178
148
105
92
1
14
1
2
0
2
2
0
2
3
2
1
0
0
0

763
623
602
663
613
17
31
43
18
23
18
59
71
20
17
14
15
0
0
0

1 030
685
765
714
744
38
53
38
48
24
33
118
167
73
61
51
45
0
0
0

963
666
540
558
497
24
62
53
33
29
28
83
90
90
89
83
83
2
0
0

743
687
710
702
653
19
39
34
27
33
34
75
74
50
78
86
70
1
0
0

610
510
610
594
616
23
28
20
22
22
41
75
55
58
53
50
45
0
0
0

746
695
814
753
740
22
49
34
28
36
23
156
75
51
57
48
36
0
0
0

0

194
179
146
98
79
2
13
1
0
2
2
1
2
2
1
1
0
0
0
0

587
581
560
461
519
17
21
21
18
18
11
17
9
14
15
6
13
1
0
1

758
533
576
535
555
15
33
31
20
27
24
52
22
17
15
18
12
1
0
0

523
457
428
324
376
11
24
18
12
23
11
29
26
26
14
18
16
0
0
0

381
389
374
337
355
7
20
16
14
19
12
39
22
13
16
17
12
0
0
0

304
292
284
278
252
9
23
6
15
12
8
48
23
22
17
17
13
0
0
0

510
395
471
390
432
14
24
14
8
17
5
80
39
29
26
26
13
0
0
0

0
0
0

0
0
2

0

0
2
0

0
0
1

3
0
2

1
0
0

0
0
0

0
0
0

0
0
0

0
0
0

1
0
0

2
0
0

1
0
0

0
0
0

1

0
0
0

55–64

1

0
0
0

0
0

0
0
0

0

1

0

GLOBAL TUBERCULOSIS REPORT 2013

0
0
0

0
0
0

0
0
0

0
0
5

0
0
0

1
0
2

0
0
0
0

Data for all years can be downloaded from www.who.int/tb/data

0
0
0

0
0
0

0
0
0

0
0
3

0
0
0

1
0
3

0
0
0
0
0

0
0
0

MALE:FEMALE
RATIO
–
–
–
–
–
–
–
0.33
0.50
5.0
7.0
–
–
1.2
1.3
1.4
1.4
0.71
–
–
–
–
2.5
0.56
2.4
1.0
–
1.7
2.3
1.3
–
2.0
–
1.0
–
–
0.83
2.1
1.8
2.5
3.3
1.5
–
–
–
–
–
–
–
1.5
1.5
1.6
1.6
1.5
–
–
–
–
1.7
2.0
2.2
2.2
2.3
–
–
–
–
–
–
1.5
1.3
1.5
1.5
1.5
1.7
–
–
–
1.0
–
–
1.7
2.0
2.1
2.2
2.0
2.1
–
1.6
1.4
1.5
1.7
1.5
1.9
1.7
2.1
2.0
1.4
2.4
2.1
3.7
2.8
3.4
3.2
3.7
1.5
–
–
–
–
–
1.0
–
–

7$%/($1HZVPHDUSRVLWLYHFDVHQRWLILFDWLRQE\DJHDQGVH[±

Dominican
Republic

Ecuador

El Salvador

Grenada

Guatemala

Guyana

Haiti

Honduras

Jamaica

Mexico

Montserrat

Netherlands
Antilles
Nicaragua

Panama

Paraguay

Peru

Puerto Rico

Saint Kitts and
Nevis

Saint Lucia

1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012

FEMALE

0–14

15–24

25–34

35–44

45–54

55–64

65+

73
43
29
20
15

410
399
276
333
317

481
483
346
406
489

344
386
292
318
315

173
228
170
200
197

125
123
112
133
126

113
105
85
112
111

48
32
45
37

446
499
481
506

468
529
547
567

308
314
364
387

237
309
323
359

150
227
272
291

159
246
232
333

13
5
5
3
5

99
97
101
114
131

124
140
170
183
194

114
128
96
106
122

92
104
77
96
100

62
74
62
77
87

107
117
101
115
115

0

0

0

1
0

1
1

1
0

51
36
39
60
18

235
220
251
187
197

280
236
258
245
205

236
216
185
207
172

165
177
187
172
162

142
112
127
143
136

0
1
139
140
115
165
152

7
4
12
2
8
5

8
20
48
32
26
30

5
19
130
38
54
39

6
14
116
65
61
68

9
7
81
49
54
64

6
6
41
22
19
23

7
9
20
13
13
8

67
69
98
102
126
42
30
13
15
17
18
2
0
0
1
0
1

836
1 045
1 225
1 155
1 359
280
123
238
177
194
247
9
6
4
7
2
10

898
1 035
1 357
1 342
1 563
540
371
280
246
291
285
14
13
6
15
6
8

613
701
718
670
758
204
246
215
207
227
192
9
13
6
15
3
3

350
451
469
442
473
130
277
152
165
184
184
11
15
10
8
4
5

147
222
259
206
271
236
214
134
113
120
129
8
6
6
6
4
5

118
156
160
132
164
58
43
152
157
184
146
9
5
7
7
3
1

214
100
125
128
133

1 079
1 095
1 081
1 124
1 153

1 387
1 376
1 375
1 440
1 480

1 162
1 314
1 380
1 503
1 522

1 235
1 238
1 392
1 532
1 484

972
1 042
1 119
1 112
1 153

0
0
0

0
0
0

0
0
0

0
0
0

1
0
0
0

0
0
0

UNKNOWN

UNKNOWN

0–14

15–24

25–34

35–44

45–54

55–64

65+

65
57
43
30
26

317
339
239
242
230

325
332
207
274
260

212
209
142
159
148

115
119
102
103
119

79
72
54
66
62

75
54
62
58
68

48
52
49
59

329
298
340
333

305
308
311
337

199
178
177
184

139
158
141
164

85
113
118
146

127
110
121
153

0
0
0

28
6
6
6
5

81
85
63
61
81

76
82
65
61
73

63
59
49
44
80

63
50
58
52
90

39
42
51
69
64

47
70
68
92
90

0
0
0

0

0

0

1
0

0

0

0

0

0

51
41
38
29
25

224
199
339
194
186

255
167
245
190
192

221
175
277
179
154

146
135
176
139
154

129
87
88
108
102

94
111
95
103
106

3
1
14
2
2
4

5
11
41
22
17
17

7
8
62
25
19
10

6
7
41
19
17
17

5
5
30
20
17
12

2
5
11
10
7
7

4
3
9
6
9
5

0
0
0

96
116
158
148
160
54
25
27
28
19
15
2
1
0
0
1
1

914
1 097
1 268
1 282
1 476
208
21
219
186
181
180
7
8
1
5
3
1

857
1 099
1 223
1 250
1 415
292
269
222
163
194
157
6
8
5
4
4
5

513
633
608
595
698
134
258
125
106
138
115
5
7
4
5
0
4

275
414
358
363
416
76
270
107
103
99
88
5
2
0
1
3
2

132
170
207
196
219
136
160
81
69
98
75
2
5
1
0
1
0

71
132
134
128
156
48
38
104
107
126
114
2
1
3
2
1
0

1 126
1 288
1 303
1 299
1 284

0
0
0

176
125
112
136
134

663
771
791
776
778

828
733
763
765
743

698
710
730
698
686

832
784
852
889
840

595
637
713
734
824

709
784
836
824
824

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0

0
0
0

0
0
0

0
0
0

0
0

0
0
0

0
0
0

0

0

1

2

0

0

0

0

0

1

0

0

1

0

23
18
17
22
10
0
86
3
5
6
10
19
18
16
23
18
9
4
147
552
371

178
194
163
157
273
0
155
44
76
69
96
88
64
112
168
163
182
180
1 311
5 290
3 802

172
174
159
189
235
0
193
78
129
127
104
103
71
103
185
244
238
230
849
2 875
2 670

175
147
116
141
156
0
112
61
129
80
91
104
96
105
136
129
135
158
454
1 546
1 513

126
108
106
115
108
0
126
37
84
62
99
67
74
86
117
143
151
143
322
1 041
1 075

96
64
61
82
61
0
42
27
57
61
63
51
57
80
87
103
124
116
200
801
641

92
90
79
108
94
0
83
26
49
49
47
61
61
71
99
99
103
129
216
796
708

24
34
23
27
4
0
72
6
11
7
11
9
13
12
31
18
14
16
149
633
375

176
188
135
154
61
0
120
43
73
51
55
62
65
69
89
106
110
95
1 005
3 686
2 674

215
173
122
149
145
0
111
34
81
52
64
57
49
86
98
99
103
98
660
2 472
2 111

98
98
103
92
161
0
75
35
62
46
58
45
46
41
69
39
55
60
373
1 156
1 046

83
76
61
75
108
0
57
19
33
45
44
46
35
41
52
50
39
55
259
609
699

64
46
54
50
64
0
16
12
30
23
40
22
34
30
29
46
36
38
162
499
333

46
61
47
79
72
0
40
16
41
29
48
44
53
46
71
45
62
60
152
624
472

4
0
0
0
0
0

3
1
4
0
1
1

12
4
4
3
4
5

20
19
7
2
3
1

15
9
9
4
6
6

9
10
7
5
6
8

19
14
7
8
2
10

0
0
0

1
1
0
0
0
0

2
4
3
1
1
0

6
5
2
0
1
3

5
3
5
2
1
1

7
7
4
6
0
2

4
1
1
2
3
3

9
3
7
4
1
1

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0

1
0
0

0
1
0

0
0
1

0
0
0

0
0
0

0
0
0

0
0
1

1
0
0

0
0
0

0
0
0

0
0
0

0
0
0

0
0
0
0
0

0
0
0
0
2

0
0
1
1
0

1
0
2
1
1

0
2
0
0
4

1
1
1
3
0

2
2
2
2
2

0
0
0

0
1
0
0
0

1
1
0
0
1

0
0
0
0
0

1
1
1
0
0

0
1
0
0
0

1
0
1
0
1

0
2
1
0
0

0
0
0

0
0
0

0
0
0

11
6
7

Data for all years can be downloaded from www.who.int/tb/data

0
0
0

0
0
0

5
4
2

MALE:FEMALE
RATIO
–
1.4
1.5
1.5
1.6
1.7
–
–
1.5
1.8
1.8
1.8
–
1.5
1.7
1.7
1.8
1.6
–
–
–
3.0
–
–
1.1
1.2
0.92
1.3
1.1
–
1.5
2.0
2.2
2.1
2.7
3.3
–
1.1
1.0
1.1
1.0
1.0
1.6
1.3
1.3
1.4
1.4
1.6
2.1
1.8
2.8
3.5
1.7
2.5
–
1.6
1.6
1.6
1.7
1.7
–
–
–
–
–
–
–
1.5
–
1.2
1.2
1.3
1.3
1.5
–
1.6
1.7
1.6
1.8
1.6
1.7
1.5
1.8
1.9
2.2
2.2
2.3
1.3
1.3
1.4
–
–
–
2.4
2.4
1.7
1.5
3.1
3.1
–
–
–
1.0
–
1.0
–
1.3
0.83
2.0
–
4.5

GLOBAL TUBERCULOSIS REPORT 2013

REGION OF THE AMERICAS

MALE
YEAR

203

7$%/($1HZVPHDUSRVLWLYHFDVHQRWLILFDWLRQE\DJHDQGVH[±
MALE
YEAR

Saint Vincent and
the Grenadines

Sint Maarten
(Dutch part)
Suriname

Trinidad and
Tobago

Turks and Caicos
Islands

United States
of America

Uruguay

US Virgin Islands

Venezuela
(Bolivarian
Republic of)

204

1995
2000
2005
2010
2011
2012
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012

FEMALE

0–14

15–24

25–34

35–44

45–54

55–64

65+

0
0
0
0
0

1
0
0
0
1

0
0
1
2
5
1

4
2
0
2
1

2
1
3
2
3

0
0
0
0
5

1
2
2
0
4

0

1
0

0

0

0

0

0

1
0
0
0
0
2
0
0
0
1
0

6
7
5
4
6
6
7
10
11
14
7

6
8
21
7
7
15
18
11
21
27
31

3
12
35
15
15
10
27
13
17
13
22

2
6
19
18
14
12
17
21
32
15
28

0
3
5
3
9
7
7
10
20
16
12

4
4
10
5
7
4
7
3
8
7
11

0
0
0
19
6
14
5
12
10
4
0
1
1
0
3
0

0
2
0
355
365
383
246
235
239
28
36
42
46
58
38
0

0
3
876
602
535
360
403
322
40
48
48
70
93
98
0

1
2
2
1 417
906
666
371
374
333
35
45
39
35
55
56
1

0
0
0
1 121
904
767
505
557
502
49
41
45
46
45
52
1

0
1
0
742
577
499
403
434
455
38
30
34
33
36
39
0

0
0
0
1 099
738
624
466
486
529
50
34
36
31
37
29
0

35
22
28
23

312
320
340
379

395
376
353
405

413
333
303
353

402
391
363
375

265
253
307
319

332
288
241
273

GLOBAL TUBERCULOSIS REPORT 2013

UNKNOWN

UNKNOWN

0–14

15–24

25–34

35–44

45–54

55–64

65+

0
0
0

1
0
0
0
0

0
0
0
0
1

0
1
1
1
3

0
0
0
0
1

0
1
0
1
3
2

0
0
1
0
0

0
0
0
0
0

0
0
0

0

0

1

1
0

0

0

0

0

0

2
0
1
0
2
0
0
0
0
1
2

3
3
4
1
1
6
5
4
4
6
9

6
2
6
1
7
4
7
9
7
7
11

3
1
10
5
5
2
9
3
7
3
10

0
2
6
2
7
5
5
5
5
4
8

1
1
2
2
1
3
2
4
2
2
4

1
2
8
1
0
0
4
3
2
5
12

0
0
0

0
0
0
26
14
11
9
15
14
2
2
1
3
1
2

0
0
0
280
246
241
195
160
161
21
28
33
24
29
25

0
0
2
579
376
348
265
254
262
26
22
30
36
55
26

1
0
0
499
349
276
183
199
169
18
21
17
12
19
21

1
0
1
285
253
242
165
150
175
12
13
9
10
12
15

0
0
0
202
152
161
130
138
148
9
12
8
5
11
13

0
0
0
591
396
322
223
269
243
17
16
12
16
16
15

0
0
0

0
0

37
26
25
32

351
269
252
276

299
306
316
281

267
188
178
203

183
145
178
167

146
147
150
161

216
188
190
199

0
0

0
0
0

0
0
0

0
0
0

2
0
0

Data for all years can be downloaded from www.who.int/tb/data

0
0
2

0
0
0

0
0
0

0
1
1

MALE:FEMALE
RATIO
–
8.0
2.5
3.0
3.0
2.4
0.50
1.0
–
–
1.4
3.6
2.6
4.3
2.3
2.8
2.6
2.4
4.0
3.3
2.0
–
–
–
0.50
–
0.67
2.3
2.3
2.2
2.0
2.1
2.0
2.3
2.1
2.2
2.5
2.3
2.7
–
–
–
–
–
–
–
–
1.4
1.6
1.5
1.6

7$%/($/DERUDWRULHV173VHUYLFHVGUXJPDQDJHPHQWDQGLQIHFWLRQFRQWURO
FREE THROUGH NTP

Anguilla

–

Antigua and Barbuda

–

Argentina

1.7

0

Aruba

–

Bahamas

–

Barbados

–

Belize

0.9

Bermuda
Bolivia
(Plurinational State of)
Bonaire, Saint Eustatius
and Saba
Brazil

0

0

1.9

0

0

0

0

0

–
5.1

0

24.8

0.5

0

0

–
2.0

–

British Virgin Islands

–

Canada

–

Cayman Islands
Chile
Colombia
Costa Rica
Cuba

12.5

5.5

0.9

0.2

13

–
1.0
5.6
2.2

0
0
0
–

Curaçao

–

Dominica

–

11.2
124.6
14.6

0.3
0.4
1

0.3
0.5
0

1
4
4

Dominican Republic
Ecuador

2.0
2.3

2
0

5.8
5.8

1
0.3

0

0
5

El Salvador

3.3

0

8.7

0.8

0

1

Grenada
1.9

18

3.3

1

0

0

Guyana

2.5

100

6.3

6.3

6.3

0

Haiti

2.5

6

1.0

1

1

7

Honduras

2.1

0

3.2

0.6

0

0

Jamaica

0.1

100

0

0

0

0

Mexico

1.0

0

2.7

0.6

<0.1

6

Montserrat

–

Nicaragua

3.2

100

1.7

0.8

Panama

1.4

0

14.5

1.3

1.3

3

Paraguay
Peru

1.8
4.8

23
0

8.2
11.0

0.7
1.8

0
0.2

0
0

Puerto Rico

–

Saint Kitts and Nevis

–

Saint Lucia

–

Saint Vincent and
the Grenadines

–

Sint Maarten (Dutch part)

–
0.6

0

Trinidad and Tobago

–

Turks and Caicos Islands
United States of America

–
–

Uruguay
US Virgin Islands
Venezuela
(Bolivarian Republic of)

a
b
c
d

<0.1

100

9.4

0

0

No

No

No

No

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

No

No

Yes

Yes

Yes (other criteria)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

No

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes (all suspects)

Don't
know
Yes

Yes

0

2

1.5

1.5

1.5

0

3.5

0.2

0.2

0

Yes

Yes

Yes (all suspects)

No

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes
Yes
Yes
Yes

Yes (all suspects)
Yes (all suspects)
Yes (all suspects)
Yes (all suspects)

Yes
Yes
Yes
Yes

Yes
Yes
Yes
Yes

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes
Yes

Yes (all suspects)
Yes (all suspects)

Yes
Yes

Yes
Yes

Yes

Out of
Yes
country
In and out
Yes
of country
Yes
Out of
Yes
country
Out of
Yes
country
In and out
Yes
of country
Out of
No
country
Out of
Yes
country

Yes (all suspects)

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes (all suspects)

Yes

Yes

Yes (all suspects)

Yes

Yes

83

14

Yes (all suspects)

Yes

Yes

Yes (all suspects)

Yes

Yes

109

Yes (all suspects)

Yes

Yes

21

Yes (all suspects)

Yes

Yes

33

Yes (all suspects)

No

Yes

Yes (all suspects)

Yes

Yes

Yes

Yes

Yes
Yes

Yes (if TB is
confirmed)
Yes (all suspects)
Yes (all suspects)

Yes
Yes

Yes
Yes

Yes

Yes (all suspects)

Yes

Yes

No

Yes (all suspects)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

No Yes
In country
In country
Out of
country
No
Out of
country
Out of
country
Out of
country
Out of
country
In and out
of country

TB DIAGNOSIS

TB NOTIF.
RIFAMPICIN
RATE PER
USED
100 000
THROUGHOUT
HEALTH-CARE
TREATMENT
WORKERS

Yes

–

Guatemala

Suriname

No
Out of
country
In country
Out of
country
Out of
country
Out of
country
Out of
country
Out of
country
Out of
country
Out of
country
In country
Out of
country
In country
Out of
country
In country
In country
No
No
Out of
country
Out of
country
In country
In country
Out of
country

NRLd

FIRSTLINE
DRUGS

Yes

Yes (all suspects)

Yes

Yes

No

Yes (other criteria)

Yes

Yes

Yes

Yes (all suspects)

Yes

Yes

REGION OF THE AMERICAS

LABORATORIES
SECONDNUMBER OF
SMEAR LABS % OF SMEAR
CULTURE
DST b LABS
LPAc LABS
LABS USING LABS PER 5M
LINE DST
LABS USING
PER 100K
PER 5M
PER 5M
a
POPULATION
POPULATION POPULATION POPULATION XPERT MTB/RIF AVAILABLE
LED

7

Yes

Yes (all suspects)

Yes

Yes

In country Yes
Out of
Yes
country

Yes (all suspects)

Yes

Yes

Yes (all suspects)

Yes

Yes

31

In country Yes

Yes (all suspects)

Yes

Yes

2 242

–
0.8

0

LED = Light emitting diode microscopes
DST = Drug susceptibility testing
LPA = Line probe assay
NRL = National Reference Laboratory

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

205

7$%/($0HDVXUHGSHUFHQWDJHRI7%FDVHVZLWK0'57%DPRVWUHFHQW\HDUDYDLODEOH
New TB cases
Year

Anguilla
Antigua and Barbuda
Argentina
Aruba
Bahamas
Barbados
Belize
Bermuda
Bolivia
(Plurinational State of)
Bonaire, Saint Eustatius
and Saba
Brazil
British Virgin Islands
Canada
Cayman Islands
Chile
Colombia
Costa Rica
Cuba
Curaçao
Dominica
Dominican Republic
Ecuador
El Salvador
Grenada
Guatemala
Guyana
Haiti
Honduras
Jamaica
Mexico
Montserrat
Nicaragua
Panama
Paraguay
Peru
Puerto Rico
Saint Kitts and Nevis
Saint Lucia
Saint Vincent and
the Grenadines
Sint Maarten (Dutch part)
Suriname
Trinidad and Tobago
Turks and Caicos Islands
United States of America
Uruguay
Venezuela
(Bolivarian Republic of)

a

Source

Previously treated TB cases

Coverage

Percentage

Year

Source

Coverage

Percentage

2005

Survey

National

2.2 (1.2–3.6)

2005

Survey

National

15 (9.8–23)

2012

Surveillance

National

3.7 (<0.1–19)

2012

Surveillance

National

0 (0–98)

2012

Surveillance

National

0 (0–98)

2012

Surveillance

National

11 (8.9–14)

2012

Surveillance

National

1996

Survey

National

2011

Surveillance

National

2008

Survey

Sub-national

2012
2012
2001
2005
2006
2012
2012
2011
1995
2002
2001

Surveillance
Surveillance
Survey
Survey
Survey
Surveillance
Surveillance
Surveillance
Survey
Survey
Survey

National
National
National
National
National
National
National
National
National
National
National

2002

Survey

National

2004

Survey

2009

Survey

0 (0–84)
1.2 (0.44–2.6)
50 (1.3–99)

2011

Surveillance

National

100 (2.5–100)

1.4 (1.0–1.8)

2008

Survey

Sub-national

7.5 (5.7–9.9)

2012
2012
2012
2012
2012
2012
2012
2012
1995
2012
2012

Surveillance
Surveillance
Surveillance
Surveillance
Surveillance
Surveillance
Surveillance
Surveillance
Survey
Surveillance
Surveillance

National
National
National
National
National
National
National
National
National
National
National

1.6
0
2.9
13
4.5
12
0
0
20
26
11

3 (1.8–4.6)

2002

Survey

National

26 (20–34)

National

1.8 (0.76–3.4)

2004

Survey

National

12 (5.8–22)

National

2.4 (2.1–2.8)

2009

Survey

National

6.3 (5.1–7.8)

0.57
0
0.69
2.4
1.5
0.74
0
0
6.6
4.9
0.33

(0.23–1.2)
(0–52)
(0.25–1.5)
(1.6–3.6)
(0.42–3.9)
(<0.1–2.7)
(0–98)
(0–98)
(4.1–10)
(3.5–6.7)
(<0.1–1.2)

(<0.1–8.5)
(0–98)
(0.95–6.7)
(9.6–17)
(0.12–23)
(4.4–24)
(0–98)
(0–98)
(13–28)
(23–29)
(4.9–20)

2006

Survey

National

0.63 (<0.1–2.2)

2010

Surveillance

National

11 (6.2–17)

2008
2012
2012

Survey
Surveillance
Surveillance

National
National
National

0.31 (<0.1–1.7)
3.9 (3.6–4.2)
0 (0–6.5)

2008
2012
2012

Survey
Surveillance
Surveillance

National
National
National

15 (6.1–28)
35 (33–37)
33 (0.84–91)

2012
2012

Surveillance
Surveillance

National
National

1 (0.80–1.3)
0 (0–0.79)

2012
2012

Surveillance
Surveillance

National
National

2.9 (1.4–5.4)
2.4 (<0.1–13)

1999

Survey

National

0.52 (0.14–1.3)

1999

Survey

National

13 (7.6–22)

Empty rows indicate an absence of high-quality survey or surveillance data. In the absence of high-quality national data, high-quality sub-national data are used.

206

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

'#56'40/'&+6'44#0'#04')+10
Table A4.1

Estimates of the burden of disease caused by TB, 1990–2012

209

6CDNG# +PEKFGPEGPQVKßECVKQPCPFECUGFGVGEVKQPTCVGUCNNHQTOU¿



6CDNG# %CUGPQVKßECVKQPU¿



Table A4.4

Treatment outcomes, new smear-positive cases, 1995–2011

215

Table A4.5

Treatment outcomes, retreatment cases, 1995–2011

217

6CDNG# *+8VGUVKPICPFRTQXKUKQPQH%26#46CPF+26¿



6CDNG# 6GUVKPIHQT/&46$CPFPWODGTQHEQPßTOGFECUGUQH/&46$¿



6CDNG# 0GYUOGCTRQUKVKXGECUGPQVKßECVKQPD[CIGCPFUGZ¿



Table A4.9

Laboratories, NTP services, drug management and infection control, 2012

223

6CDNG# /GCUWTGFRGTEGPVCIGQH6$ECUGUYKVJ/&46$OQUVTGEGPV[GCTCXCKNCDNG



Estimates of mortality, prevalence and incidence
Estimated values are shown as best estimates followed by lower and upper bounds. The lower and upper bounds are defined
as the 2.5th and 97.5th centiles of outcome distributions produced in simulations. See ANNEX 1 for further details.
Estimated numbers are shown rounded to two significant figures. Estimated rates are shown rounded to three significant
figures unless the value is under 100, in which case rates are shown rounded to two significant figures.
Estimates for all years are recalculated as new information becomes available and techniques are refined, so
they may differ from those published in previous reports in this series. The main updates implemented in this
report are explained in Box 2.1 of Chapter 2. Estimates published in previous global TB control reports should no
longer be used.

Data source
Data shown in this annex are taken from the WHO global TB database on 1 October 2013. Data shown in the main part of
the report were taken from the database in July 2013. As a result, data in this annex may differ slightly from those in the
main part of the report.
Data for all years can be downloaded from www.who.int/tb/data.



GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±

YEAR

Afghanistan

Bahrain

Djibouti

Egypt

Iran (Islamic
Republic of)

Iraq

Jordan

Kuwait

Lebanon

Libyan Arab
Jamahiriya

Morocco

Oman

Pakistan

Qatar

Saudi Arabia

Somalia

a

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

12
18
21
25
28
29
30
<1
<1
<1
<1
1
1
1
<1
<1
<1
<1
<1
<1
<1
56
61
66
72
78
79
81
56
60
66
70
74
75
76
18
20
24
27
31
32
33
3
4
5
5
6
7
7
2
2
2
2
3
3
3
3
3
3
4
4
4
5
4
5
5
6
6
6
6
25
27
29
30
32
32
33
2
2
2
3
3
3
3
111
127
144
158
173
176
179
<1
<1
<1
<1
2
2
2
16
19
20
25
27
28
28
6
6
7
8
10
10
10

NUMBER
(THOUSANDS)

3.7
8.7
11
9.7
10
10
11
0.034
0.02
0.017
<0.01
<0.01
<0.01
<0.01
0.59
0.4
0.41
0.65
0.68
0.67
0.66
1.8
1.5
1.1
0.76
0.45
0.56
0.38
2.6
3.2
2.5
2.1
2.2
2.3
2.2
1.2
1.2
1.1
1.1
0.98
0.97
0.96
0.041
0.04
0.039
0.036
0.037
0.037
0.037
0.019
0.023
0.015
0.023
0.033
0.018
0.031
0.085
0.067
0.04
0.046
0.065
0.073
0.072
0.44
0.28
0.27
0.23
0.32
0.34
0.42
6.2
5.2
4.3
3.5
3.1
3
3
0.059
0.05
0.041
0.035
0.028
0.029
0.031
80
90
99
84
64
62
62
0.031
0.016
<0.01
<0.01
<0.01
<0.01
<0.01
0.63
0.71
0.79
0.95
1.1
1.1
1.1
5.7
5
5
4.8
5.7
6.1
6.5

(0.860–8.5)
(2.9–18)
(4.0–21)
(3.9–18)
(4.2–18)
(4.4–19)
(4.6–20)
(0.032–0.037)
(0.018–0.022)
(0.015–0.020)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.140–1.3)
(0.160–0.750)
(0.180–0.740)
(0.260–1.2)
(0.290–1.2)
(0.280–1.2)
(0.280–1.2)
(1.4–2.2)
(1.2–1.9)
(0.840–1.4)
(0.700–0.830)
(0.420–0.490)
(0.530–0.600)
(0.350–0.400)
(0.870–5.3)
(1.1–6.5)
(0.830–5.1)
(0.680–4.2)
(0.730–4.5)
(0.780–4.7)
(0.700–4.7)
(0.410–2.4)
(0.310–2.6)
(0.180–2.9)
(0.100–3.1)
(0.039–3.4)
(0.030–3.5)
(0.025–3.5)
(0–0.330)
(0–0.390)
(0–0.410)
(0–0.410)
(0–0.420)
(0–0.420)
(0–0.420)
(0.017–0.022)
(0.021–0.024)
(0.014–0.015)
(0.022–0.023)
(0.033–0.033)
(0.018–0.018)
(0.030–0.031)
(0.046–0.130)
(0.034–0.110)
(0.020–0.069)
(0.025–0.074)
(0.035–0.110)
(0.039–0.120)
(0.038–0.120)
(0.170–0.840)
(0.120–0.500)
(0.120–0.490)
(0.120–0.390)
(0.140–0.570)
(0.140–0.610)
(0.180–0.760)
(4.8–7.7)
(3.7–6.8)
(2.8–6.1)
(2.0–5.5)
(1.5–5.2)
(1.5–5.2)
(1.4–5.1)
(<0.01–0.200)
(<0.01–0.230)
(<0.01–0.230)
(0–0.250)
(0–0.260)
(0–0.280)
(0–0.300)
(24–170)
(32–180)
(36–190)
(33–160)
(28–110)
(27–110)
(27–110)
(0.030–0.032)
(0.016–0.017)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.061–1.9)
(0.068–2.1)
(0.075–2.3)
(0.091–2.8)
(0.100–3.1)
(0.100–3.2)
(0.110–3.2)
(1.7–12)
(1.8–9.7)
(1.9–9.7)
(1.9–8.9)
(2.3–11)
(2.4–11)
(2.5–12)

a

RATE

31
49
53
39
35
36
37
7
3.5
2.5
0.85
0.44
0.39
0.34
99
60
57
83
82
79
76
3.2
2.5
1.7
1.1
0.58
0.71
0.46
4.6
5.4
3.8
3
3
3.1
2.9
6.9
5.7
4.7
3.9
3.2
3
2.9
1.2
0.93
0.81
0.7
0.57
0.55
0.53
0.94
1.4
0.76
0.99
1.1
0.58
0.94
3.1
2.2
1.2
1.2
1.5
1.6
1.5
10
5.9
5.3
4.2
5.4
5.5
6.8
25
19
15
12
9.8
9.5
9.2
3.2
2.3
1.8
1.4
1
0.97
0.92
72
71
69
53
37
35
34
6.5
3.3
0.7
0.15
0.22
0.19
0.17
3.9
3.8
3.9
3.9
3.9
3.9
3.9
90
79
68
56
59
61
64

(7.3–72)
(17–100)
(19–102)
(16–73)
(15–65)
(15–66)
(15–68)
(6.5–7.4)
(3.2–3.8)
(2.2–3.0)
(0.78–0.93)
(0.38–0.51)
(0.32–0.46)
(0.28–0.41)
(24–226)
(23–114)
(25–102)
(33–156)
(34–149)
(34–144)
(33–139)
(2.5–3.9)
(1.9–3.2)
(1.3–2.2)
(0.97–1.2)
(0.54–0.62)
(0.66–0.76)
(0.43–0.50)
(1.5–9.4)
(1.8–11)
(1.3–7.7)
(0.97–6.0)
(0.98–6.0)
(1.0–6.3)
(0.92–6.1)
(2.3–14)
(1.5–13)
(0.77–12)
(0.38–11)
(0.13–11)
(0.10–11)
(<0.1–11)
(0–9.9)
(0–9.0)
(0–8.6)
(0–7.8)
(0–6.5)
(0–6.3)
(0–6.0)
(0.81–1.1)
(1.3–1.5)
(0.75–0.78)
(0.97–1.0)
(1.1–1.1)
(0.57–0.58)
(0.93–0.95)
(1.7–5.0)
(1.1–3.7)
(0.61–2.1)
(0.62–1.8)
(0.80–2.4)
(0.86–2.6)
(0.81–2.5)
(3.9–20)
(2.6–11)
(2.3–9.4)
(2.1–6.9)
(2.4–9.5)
(2.3–10)
(2.9–12)
(19–31)
(14–25)
(9.7–21)
(6.8–18)
(4.9–16)
(4.6–16)
(4.4–16)
(0.14–11)
(<0.1–10)
(0–10)
(0–10)
(0–9.4)
(0–9.2)
(0–9.0)
(22–152)
(25–139)
(25–135)
(21–101)
(16–66)
(15–63)
(15–61)
(6.3–6.6)
(3.1–3.4)
(0.62–0.78)
(0.12–0.17)
(0.15–0.30)
(0.12–0.27)
(0.10–0.25)
(0.37–11)
(0.37–11)
(0.37–11)
(0.37–11)
(0.37–11)
(0.37–11)
(0.39–11)
(27–190)
(29–153)
(26–131)
(23–105)
(24–111)
(24–115)
(25–120)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

38
79
92
92
99
100
110
0.16
0.081
0.37
0.42
0.34
0.32
0.38
6.2
5.4
5.6
7.1
7.7
7.7
7.7
48
37
28
24
23
23
23
29
35
27
23
24
25
25
17
16
14
19
24
23
24
0.61
0.65
0.48
0.47
0.57
0.57
0.6
0.48
0.46
0.77
0.71
1.7
0.98
1.1
1.2
1.1
0.66
0.61
0.83
0.91
0.95
3.6
2.9
3
2.8
3.5
3.7
4.1
57
64
46
41
44
46
46
0.8
0.4
0.57
0.36
0.45
0.51
0.6
650
740
820
760
670
670
670
0.28
0.54
0.43
0.53
0.82
0.78
1.2
4
3.9
5.3
5.1
7.7
6.1
4.9
46
42
45
45
53
56
59

(13–77)
(37–140)
(43–160)
(46–150)
(50–160)
(52–170)
(54–180)
(0.049–0.350)
(0.024–0.170)
(0.180–0.630)
(0.170–0.790)
(0.110–0.690)
(0.120–0.630)
(0.180–0.650)
(2.2–12)
(2.2–10)
(2.4–10)
(3.4–12)
(3.7–13)
(3.6–13)
(3.6–13)
(22–84)
(19–61)
(14–46)
(12–41)
(12–39)
(12–39)
(12–39)
(12–53)
(15–64)
(11–51)
(9.4–42)
(9.9–44)
(11–47)
(10–47)
(4.9–35)
(4.9–34)
(5.0–29)
(8.8–33)
(13–40)
(12–39)
(12–40)
(0.230–1.2)
(0.250–1.2)
(0.180–0.930)
(0.170–0.910)
(0.240–1.0)
(0.250–1.0)
(0.280–1.0)
(0.230–0.830)
(0.160–0.930)
(0.300–1.5)
(0.240–1.4)
(0.860–2.9)
(0.330–2.0)
(0.360–2.1)
(0.460–2.3)
(0.340–2.2)
(0.220–1.3)
(0.260–1.1)
(0.370–1.5)
(0.410–1.6)
(0.390–1.7)
(1.7–6.4)
(1.3–5.1)
(1.3–5.4)
(1.1–5.5)
(1.5–6.3)
(1.8–6.4)
(1.9–7.0)
(24–110)
(30–110)
(20–84)
(17–75)
(19–79)
(20–82)
(19–83)
(0.360–1.4)
(0.140–0.790)
(0.280–0.960)
(0.120–0.730)
(0.170–0.870)
(0.200–0.950)
(0.260–1.1)
(250–1 300)
(330–1 300)
(370–1 400)
(380–1 300)
(330–1 100)
(330–1 100)
(320–1 100)
(0.110–0.520)
(0.260–0.910)
(0.180–0.780)
(0.230–0.950)
(0.290–1.6)
(0.260–1.6)
(0.560–2.1)
(1.8–7.0)
(1.4–7.6)
(2.2–9.7)
(1.9–9.8)
(3.7–13)
(2.5–11)
(1.6–10)
(17–89)
(19–73)
(21–76)
(23–76)
(27–89)
(28–94)
(29–99)

INCIDENCE (INCLUDING HIV)
a

RATE

327
447
449
369
350
352
358
33
14
56
48
27
25
29
1 050
809
775
920
922
911
897
85
60
42
34
30
29
29
51
58
41
32
32
34
33
94
79
61
70
78
73
73
18
15
10
9
8.8
8.5
8.5
23
29
41
31
58
31
33
45
35
20
15
19
20
20
86
61
57
51
58
61
66
232
240
161
137
138
143
140
44
18
26
14
16
17
18
589
584
573
483
389
381
376
59
107
72
64
47
41
60
25
21
26
21
28
22
17
732
663
604
537
555
566
581

(112–655)
(208–775)
(210–775)
(185–617)
(177–580)
(177–585)
(181–595)
(9.9–70)
(4.3–30)
(27–94)
(19–89)
(9.0–55)
(9.0–49)
(14–49)
(368–2 070)
(326–1 510)
(333–1 400)
(444–1 570)
(440–1 580)
(430–1 570)
(418–1 560)
(39–149)
(31–99)
(20–70)
(17–57)
(15–50)
(15–49)
(15–48)
(21–93)
(24–106)
(17–77)
(13–60)
(13–59)
(14–62)
(13–61)
(28–200)
(24–167)
(21–121)
(32–122)
(41–128)
(37–123)
(36–122)
(6.8–35)
(5.8–29)
(3.8–20)
(3.3–17)
(3.8–16)
(3.7–15)
(3.9–15)
(11–40)
(9.9–59)
(16–77)
(11–62)
(29–98)
(11–63)
(11–65)
(17–87)
(11–72)
(6.9–41)
(6.5–28)
(8.6–34)
(9.1–36)
(8.5–37)
(39–150)
(27–108)
(24–104)
(19–98)
(25–104)
(29–105)
(31–113)
(97–426)
(112–415)
(68–292)
(57–251)
(59–251)
(62–257)
(58–257)
(20–78)
(6.5–37)
(13–44)
(4.9–29)
(6.1–31)
(6.7–31)
(7.8–33)
(222–1 130)
(262–1 030)
(260–1 010)
(239–810)
(191–657)
(185–647)
(181–641)
(24–108)
(52–182)
(30–132)
(28–115)
(17–92)
(14–82)
(27–105)
(11–43)
(7.7–41)
(11–48)
(7.8–40)
(13–48)
(9.1–40)
(5.5–36)
(272–1 410)
(305–1 160)
(291–1 030)
(267–900)
(279–925)
(283–947)
(287–975)

NUMBER
(THOUSANDS)

22
33
39
47
54
55
56
0.13
0.049
0.24
0.32
0.28
0.26
0.26
3.7
4.1
4.5
4.8
5.2
5.2
5.3
19
19
17
15
14
14
14
18
21
17
14
15
16
16
9.5
11
12
13
14
14
15
0.48
0.51
0.38
0.38
0.41
0.4
0.4
0.32
0.39
0.59
0.59
1.1
0.77
0.85
0.94
0.88
0.56
0.45
0.6
0.67
0.73
1.7
1.9
2.1
2.2
2.4
2.4
2.5
36
41
33
30
32
33
33
0.55
0.32
0.37
0.3
0.35
0.39
0.44
260
290
330
370
400
410
410
0.21
0.35
0.32
0.37
0.67
0.64
0.84
2.8
3.1
4
4.1
5.1
4.5
4.2
18
18
21
24
28
28
29

(14–33)
(27–40)
(32–47)
(38–56)
(44–64)
(45–66)
(47–67)
(0.120–0.150)
(0.043–0.056)
(0.210–0.270)
(0.280–0.360)
(0.250–0.320)
(0.230–0.290)
(0.230–0.290)
(2.3–5.3)
(3.4–4.9)
(3.8–5.2)
(3.9–5.8)
(4.3–6.2)
(4.3–6.2)
(4.4–6.3)
(16–23)
(16–23)
(14–20)
(13–18)
(12–16)
(12–16)
(12–16)
(13–23)
(16–28)
(12–22)
(10–19)
(11–19)
(11–21)
(11–21)
(8.3–11)
(9.4–12)
(10–14)
(11–15)
(12–16)
(13–16)
(13–17)
(0.420–0.550)
(0.450–0.580)
(0.340–0.440)
(0.330–0.430)
(0.360–0.460)
(0.350–0.460)
(0.360–0.460)
(0.280–0.360)
(0.340–0.440)
(0.520–0.670)
(0.520–0.670)
(0.960–1.2)
(0.680–0.870)
(0.740–0.960)
(0.820–1.1)
(0.770–1.0)
(0.490–0.630)
(0.400–0.510)
(0.530–0.680)
(0.590–0.760)
(0.640–0.830)
(1.4–2.0)
(1.5–2.3)
(1.7–2.5)
(1.9–2.6)
(2.0–2.9)
(2.0–2.9)
(2.0–2.9)
(27–47)
(33–49)
(29–38)
(26–34)
(28–36)
(29–37)
(29–38)
(0.490–0.630)
(0.280–0.360)
(0.320–0.420)
(0.260–0.340)
(0.310–0.400)
(0.340–0.440)
(0.380–0.500)
(160–380)
(240–350)
(270–400)
(300–440)
(330–480)
(340–490)
(340–490)
(0.190–0.240)
(0.310–0.400)
(0.280–0.360)
(0.330–0.420)
(0.580–0.750)
(0.560–0.720)
(0.730–0.950)
(2.4–3.1)
(2.7–3.5)
(3.5–4.5)
(3.6–4.6)
(4.5–5.8)
(4.0–5.1)
(3.7–4.8)
(11–27)
(15–22)
(17–25)
(20–29)
(23–33)
(23–34)
(24–35)

RATEa

189
189
189
189
189
189
189
27
8.8
36
37
23
20
20
619
619
619
619
620
620
620
34
32
26
21
18
17
17
31
35
26
20
20
21
21
54
53
50
48
45
45
45
14
12
8.1
7.2
6.3
6
5.8
15
24
31
26
37
25
26
35
29
17
11
14
15
16
40
40
40
40
40
40
40
147
152
117
100
100
103
103
31
15
17
12
13
13
13
231
231
231
231
231
231
231
44
70
54
46
38
33
41
17
17
20
16
19
16
15
285
285
285
285
286
286
286

(117–279)
(155–227)
(155–227)
(155–227)
(156–225)
(156–225)
(156–226)
(24–31)
(7.7–9.9)
(31–40)
(32–41)
(20–26)
(18–23)
(17–22)
(395–893)
(506–744)
(528–718)
(506–744)
(512–738)
(512–738)
(512–738)
(29–40)
(27–37)
(22–30)
(18–25)
(15–21)
(15–20)
(14–19)
(23–41)
(26–46)
(19–34)
(15–27)
(14–26)
(15–27)
(15–28)
(47–62)
(46–60)
(44–57)
(42–54)
(40–52)
(39–51)
(39–51)
(13–16)
(10–13)
(7.1–9.1)
(6.3–8.1)
(5.5–7.1)
(5.2–6.8)
(5.1–6.5)
(14–18)
(21–28)
(27–35)
(23–29)
(32–42)
(22–28)
(23–30)
(31–39)
(26–33)
(15–20)
(10–13)
(12–16)
(13–17)
(14–18)
(33–48)
(33–48)
(33–48)
(34–46)
(33–48)
(33–48)
(33–48)
(110–189)
(124–182)
(102–132)
(88–113)
(88–114)
(90–117)
(90–117)
(27–35)
(13–17)
(15–19)
(10–13)
(11–14)
(11–15)
(12–15)
(143–341)
(189–278)
(189–278)
(189–278)
(190–276)
(190–276)
(190–276)
(39–50)
(61–79)
(47–61)
(40–52)
(33–43)
(29–38)
(36–46)
(15–19)
(15–19)
(17–22)
(14–19)
(17–21)
(14–18)
(13–17)
(176–421)
(233–343)
(233–343)
(233–343)
(236–340)
(236–340)
(236–340)

EASTERN MEDITERRANEAN REGION

MORTALITY (EXCLUDING HIV)
POPULATION
(MILLIONS)

Rates are per 100 000 population.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

209

7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±
MORTALITY (EXCLUDING HIV)

South Sudan
Sudan

Syrian Arab
Republic

Tunisia

United Arab
Emirates

West Bank
and Gaza Strip

Yemen

a

YEAR

POPULATION
(MILLIONS)

2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

10
11
26
30
34
40
46
36
37
12
14
16
18
22
22
22
8
9
10
10
11
11
11
2
2
3
4
8
9
9
2
3
3
4
4
4
4
12
15
18
20
23
23
24

NUMBER
(THOUSANDS)

3.1
3.2
11
9
9.3
9.3
10
8
8
0.97
0.85
0.56
0.47
0.47
0.47
0.46
0.24
0.3
0.26
0.25
0.31
0.33
0.32
0.017
0.022
0.029
0.02
0.022
0.015
<0.01
<0.01
0.035
0.018
0.012
<0.01
<0.01
<0.01
3.8
3.5
3.3
2.8
1.4
1.4
1.3

(1.3–5.6)
(1.4–5.8)
(4.4–22)
(3.8–16)
(4.0–17)
(4.0–17)
(4.3–18)
(3.4–15)
(3.3–15)
(0.270–2.1)
(0.370–1.5)
(0.280–0.930)
(0.220–0.810)
(0.210–0.830)
(0.210–0.830)
(0.210–0.820)
(0.130–0.370)
(0.160–0.470)
(0.140–0.410)
(0.140–0.400)
(0.170–0.500)
(0.180–0.520)
(0.170–0.500)
(0–0.110)
(0–0.140)
(0–0.190)
(0–0.150)
(0–0.150)
(0–0.097)
(<0.01–0.045)
(<0.01–<0.01)
(0.034–0.036)
(0.018–0.019)
(0.012–0.012)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(1.1–8.2)
(1.5–6.3)
(1.4–6.0)
(1.2–5.2)
(0.640–2.5)
(0.630–2.5)
(0.600–2.4)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

RATEa

30
30
44
30
27
24
22
22
22
7.8
5.9
3.4
2.6
2.2
2.2
2.1
2.9
3.3
2.7
2.5
2.9
3.1
2.9
0.95
0.95
0.95
0.49
0.26
0.17
0.1
0.45
1.3
0.57
0.34
0.23
0.23
0.23
32
23
19
14
6.2
6
5.6

(13–54)
(13–54)
(17–84)
(13–55)
(12–49)
(10–42)
(9.4–40)
(9.3–40)
(9.0–40)
(2.2–17)
(2.6–11)
(1.7–5.7)
(1.2–4.4)
(0.99–3.9)
(0.98–3.8)
(0.96–3.7)
(1.6–4.6)
(1.8–5.3)
(1.5–4.3)
(1.4–4.0)
(1.6–4.7)
(1.7–4.8)
(1.6–4.6)
(0–6.1)
(0–6.1)
(0–6.1)
(0–3.6)
(0–1.8)
(0–1.1)
(0–0.49)
(0.43–0.46)
(1.3–1.4)
(0.56–0.58)
(0.33–0.35)
(0.23–0.24)
(0.22–0.23)
(0.22–0.23)
(9.3–70)
(9.8–42)
(8.1–34)
(5.9–26)
(2.8–11)
(2.7–11)
(2.5–9.9)

28
28
99
89
90
90
96
76
77
11
9.3
7
5.9
5.6
5.5
5.3
3.2
3.9
3.3
3.3
4.1
4.4
4.5
0.39
0.51
0.65
0.44
0.52
0.37
0.22
0.18
0.27
0.45
0.29
0.25
0.34
0.47
35
36
35
29
17
17
17

(13–47)
(13–47)
(48–170)
(45–150)
(45–150)
(45–150)
(48–160)
(38–130)
(39–130)
(3.6–22)
(3.9–17)
(2.5–14)
(2.1–12)
(2.1–11)
(2.1–10)
(2.1–9.9)
(1.3–5.8)
(1.7–6.9)
(1.4–6.0)
(1.4–5.9)
(1.7–7.6)
(1.8–8.1)
(1.7–8.5)
(0.170–0.710)
(0.220–0.910)
(0.280–1.2)
(0.190–0.800)
(0.230–0.930)
(0.160–0.660)
(0.077–0.440)
(0.091–0.320)
(0.230–0.800)
(0.340–1.3)
(0.240–0.910)
(0.240–0.870)
(0.290–1.1)
(0.370–1.4)
(13–66)
(18–60)
(17–59)
(14–48)
(7.5–29)
(7.4–30)
(7.1–30)

RATEa

268
257
386
296
262
226
210
209
207
86
65
43
33
26
25
24
39
43
35
33
39
41
41
22
22
22
11
6.2
4.2
2.4
8.6
10
14
8.1
6.1
8.3
11
293
239
198
142
73
72
70

(129–456)
(124–437)
(185–659)
(149–491)
(132–436)
(113–378)
(105–350)
(105–347)
(104–345)
(29–174)
(27–119)
(15–85)
(11–65)
(9.8–50)
(9.8–47)
(9.7–45)
(16–72)
(18–77)
(15–63)
(14–59)
(16–71)
(17–75)
(16–78)
(9.2–39)
(9.2–39)
(9.3–39)
(4.5–19)
(2.7–11)
(1.8–7.4)
(0.84–4.8)
(4.4–15)
(8.7–31)
(11–41)
(6.8–26)
(6.0–22)
(7.1–26)
(8.7–32)
(112–558)
(118–401)
(97–335)
(71–239)
(33–129)
(32–129)
(30–127)

INCIDENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

15
16
44
47
50
53
54
42
42
7.5
6.6
5.7
4.8
4.3
4.1
3.9
2.3
2.7
2.4
2.4
3
3.2
3.4
0.22
0.28
0.36
0.21
0.26
0.21
0.16
0.12
0.22
0.33
0.23
0.21
0.26
0.32
16
21
20
16
11
11
12

(13–18)
(13–19)
(36–52)
(39–56)
(41–59)
(43–63)
(45–65)
(35–51)
(35–51)
(5.3–10)
(5.4–7.9)
(4.9–6.6)
(4.0–5.6)
(3.5–5.1)
(3.4–4.9)
(3.2–4.6)
(2.0–2.6)
(2.4–3.1)
(2.1–2.7)
(2.1–2.7)
(2.6–3.4)
(2.8–3.6)
(3.0–3.8)
(0.160–0.280)
(0.200–0.370)
(0.260–0.480)
(0.150–0.270)
(0.190–0.340)
(0.150–0.270)
(0.120–0.210)
(0.110–0.140)
(0.200–0.250)
(0.290–0.370)
(0.200–0.260)
(0.190–0.240)
(0.230–0.290)
(0.280–0.360)
(10–24)
(17–25)
(17–24)
(13–19)
(9.2–13)
(9.4–14)
(9.6–14)

Rates are per 100 000 population.

210

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

RATEa

146
146
170
158
144
133
119
117
114
61
46
35
26
20
19
18
29
31
25
23
28
30
31
12
12
12
5
3.1
2.3
1.7
6
8.6
10
6.5
5.3
6.3
7.6
137
137
116
81
49
49
49

(121–174)
(121–174)
(140–203)
(130–188)
(119–172)
(110–158)
(98–142)
(96–139)
(94–136)
(43–82)
(38–55)
(30–40)
(22–31)
(16–24)
(16–22)
(15–21)
(25–32)
(27–35)
(22–28)
(21–27)
(25–32)
(26–34)
(27–35)
(8.7–16)
(8.7–16)
(8.7–16)
(3.6–6.5)
(2.3–4.1)
(1.7–3.0)
(1.2–2.3)
(5.2–6.8)
(7.5–9.7)
(9.0–12)
(5.7–7.3)
(4.6–6.0)
(5.5–7.1)
(6.7–8.6)
(85–202)
(112–165)
(94–139)
(66–97)
(40–58)
(40–58)
(40–58)

7$%/($,QFLGHQFHQRWLILFDWLRQDQGFDVHGHWHFWLRQUDWHVDOOIRUPV±

Afghanistan

Bahrain

Djibouti

Egypt

Iran (Islamic
Republic of)

Iraq

Jordan

Kuwait

Lebanon

Libyan Arab
Jamahiriya

Morocco

Oman

Pakistan

Qatar

Saudi Arabia

Somalia

a
b

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

12
18
21
25
28
29
30
<1
<1
<1
<1
1
1
1
<1
<1
<1
<1
<1
<1
<1
56
61
66
72
78
79
81
56
60
66
70
74
75
76
18
20
24
27
31
32
33
3
4
5
5
6
7
7
2
2
2
2
3
3
3
3
3
3
4
4
4
5
4
5
5
6
6
6
6
25
27
29
30
32
32
33
2
2
2
3
3
3
3
111
127
144
158
173
176
179
<1
<1
<1
<1
2
2
2
16
19
20
25
27
28
28
6
6
7
8
10
10
10

NUMBER
(THOUSANDS)

22
33
39
47
54
55
56
0.13
0.049
0.24
0.32
0.28
0.26
0.26
3.7
4.1
4.5
4.8
5.2
5.2
5.3
19
19
17
15
14
14
14
18
21
17
14
15
16
16
9.5
11
12
13
14
14
15
0.48
0.51
0.38
0.38
0.41
0.4
0.4
0.32
0.39
0.59
0.59
1.1
0.77
0.85
0.94
0.88
0.56
0.45
0.6
0.67
0.73
1.7
1.9
2.1
2.2
2.4
2.4
2.5
36
41
33
30
32
33
33
0.55
0.32
0.37
0.3
0.35
0.39
0.44
260
290
330
370
400
410
410
0.21
0.35
0.32
0.37
0.67
0.64
0.84
2.8
3.1
4
4.1
5.1
4.5
4.2
18
18
21
24
28
28
29

(14–33)
(27–40)
(32–47)
(38–56)
(44–64)
(45–66)
(47–67)
(0.120–0.150)
(0.043–0.056)
(0.210–0.270)
(0.280–0.360)
(0.250–0.320)
(0.230–0.290)
(0.230–0.290)
(2.3–5.3)
(3.4–4.9)
(3.8–5.2)
(3.9–5.8)
(4.3–6.2)
(4.3–6.2)
(4.4–6.3)
(16–23)
(16–23)
(14–20)
(13–18)
(12–16)
(12–16)
(12–16)
(13–23)
(16–28)
(12–22)
(10–19)
(11–19)
(11–21)
(11–21)
(8.3–11)
(9.4–12)
(10–14)
(11–15)
(12–16)
(13–16)
(13–17)
(0.420–0.550)
(0.450–0.580)
(0.340–0.440)
(0.330–0.430)
(0.360–0.460)
(0.350–0.460)
(0.360–0.460)
(0.280–0.360)
(0.340–0.440)
(0.520–0.670)
(0.520–0.670)
(0.960–1.2)
(0.680–0.870)
(0.740–0.960)
(0.820–1.1)
(0.770–1.0)
(0.490–0.630)
(0.400–0.510)
(0.530–0.680)
(0.590–0.760)
(0.640–0.830)
(1.4–2.0)
(1.5–2.3)
(1.7–2.5)
(1.9–2.6)
(2.0–2.9)
(2.0–2.9)
(2.0–2.9)
(27–47)
(33–49)
(29–38)
(26–34)
(28–36)
(29–37)
(29–38)
(0.490–0.630)
(0.280–0.360)
(0.320–0.420)
(0.260–0.340)
(0.310–0.400)
(0.340–0.440)
(0.380–0.500)
(160–380)
(240–350)
(270–400)
(300–440)
(330–480)
(340–490)
(340–490)
(0.190–0.240)
(0.310–0.400)
(0.280–0.360)
(0.330–0.420)
(0.580–0.750)
(0.560–0.720)
(0.730–0.950)
(2.4–3.1)
(2.7–3.5)
(3.5–4.5)
(3.6–4.6)
(4.5–5.8)
(4.0–5.1)
(3.7–4.8)
(11–27)
(15–22)
(17–25)
(20–29)
(23–33)
(23–34)
(24–35)

RATEa

189
189
189
189
189
189
189
27
8.8
36
37
23
20
20
619
619
619
619
620
620
620
34
32
26
21
18
17
17
31
35
26
20
20
21
21
54
53
50
48
45
45
45
14
12
8.1
7.2
6.3
6
5.8
15
24
31
26
37
25
26
35
29
17
11
14
15
16
40
40
40
40
40
40
40
147
152
117
100
100
103
103
31
15
17
12
13
13
13
231
231
231
231
231
231
231
44
70
54
46
38
33
41
17
17
20
16
19
16
15
285
285
285
285
286
286
286

(117–279)
(155–227)
(155–227)
(155–227)
(156–225)
(156–225)
(156–226)
(24–31)
(7.7–9.9)
(31–40)
(32–41)
(20–26)
(18–23)
(17–22)
(395–893)
(506–744)
(528–718)
(506–744)
(512–738)
(512–738)
(512–738)
(29–40)
(27–37)
(22–30)
(18–25)
(15–21)
(15–20)
(14–19)
(23–41)
(26–46)
(19–34)
(15–27)
(14–26)
(15–27)
(15–28)
(47–62)
(46–60)
(44–57)
(42–54)
(40–52)
(39–51)
(39–51)
(13–16)
(10–13)
(7.1–9.1)
(6.3–8.1)
(5.5–7.1)
(5.2–6.8)
(5.1–6.5)
(14–18)
(21–28)
(27–35)
(23–29)
(32–42)
(22–28)
(23–30)
(31–39)
(26–33)
(15–20)
(10–13)
(12–16)
(13–17)
(14–18)
(33–48)
(33–48)
(33–48)
(34–46)
(33–48)
(33–48)
(33–48)
(110–189)
(124–182)
(102–132)
(88–113)
(88–114)
(90–117)
(90–117)
(27–35)
(13–17)
(15–19)
(10–13)
(11–14)
(11–15)
(12–15)
(143–341)
(189–278)
(189–278)
(189–278)
(190–276)
(190–276)
(190–276)
(39–50)
(61–79)
(47–61)
(40–52)
(33–43)
(29–38)
(36–46)
(15–19)
(15–19)
(17–22)
(14–19)
(17–21)
(14–18)
(13–17)
(176–421)
(233–343)
(233–343)
(233–343)
(236–340)
(236–340)
(236–340)

INCIDENCE HIV-POSITIVE
NUMBER
(THOUSANDS)

RATEa

0.041
0.072
0.1
0.16
0.25
0.28
0.31

(0.025–0.060)
(0.040–0.11)
(0.058–0.16)
(0.090–0.24)
(0.15–0.38)
(0.17–0.41)
(0.19–0.46)

0.4
0.4
0.5
0.6
0.9
1
1

(0.22–0.52)
(0.23–0.65)
(0.28–0.77)
(0.36–0.96)
(0.54–1.3)
(0.58–1.4)
(0.63–1.5)

0.011
0.012
0.012
0.082
0.43
0.74
0.74
0.6
0.57
0.54
<0.01
0.029
0.1
0.18
0.14
0.14
0.13
0.011
0.051
0.15
0.21
0.26
0.28
0.29
0
0
0
0
<0.01
0
0

(<0.01–0.022)
(<0.01–0.023)
(<0.01–0.025)
(0.052–0.12)
(0.35–0.52)
(0.63–0.86)
(0.61–0.89)
(0.49–0.71)
(0.47–0.68)
(0.45–0.64)
(<0.01–0.012)
(0.024–0.034)
(0.085–0.12)
(0.15–0.21)
(0.12–0.17)
(0.12–0.16)
(0.11–0.16)
(<0.01–0.014)
(0.037–0.067)
(0.11–0.20)
(0.15–0.27)
(0.19–0.34)
(0.20–0.37)
(0.21–0.39)
(0–0)
(0–0)
(0–0)
(0–0)
(0–0.010)
(0–0)
(0–0)

0.8
0.9
0.9
14
65
102
96
72
68
63
<0.1
<0.1
0.2
0.3
0.2
0.2
0.2
<0.1
<0.1
0.2
0.3
0.4
0.4
0.4
0
0
0
0
<0.1
0
0

(0.28–1.7)
(0.33–1.8)
(0.25–1.9)
(8.9–20)
(53–78)
(87–118)
(78–115)
(59–85)
(56–80)
(52–75)
(<0.1–<0.1)
(<0.1–<0.1)
(0.13–0.18)
(0.21–0.29)
(0.16–0.21)
(0.15–0.20)
(0.14–0.19)
(<0.1–<0.1)
(<0.1–0.11)
(0.16–0.30)
(0.21–0.39)
(0.25–0.46)
(0.27–0.49)
(0.28–0.51)
(0–0)
(0–0)
(0–0)
(0–0)
(0–<0.1)
(0–0)
(0–0)

<0.01 (0–<0.01)

<0.01 (<0.01–<0.01)
<0.01 (<0.01–<0.01)
<0.01 (<0.01–<0.01)
<0.01
<0.01
0.012
0.014
0.017
0.031
0.036
0.041

0.2 (<0.1–0.49)
0.2 (<0.1–0.41)
0.1 (<0.1–0.31)

(<0.01–<0.01) <0.1 (0–<0.1)
(<0.01–<0.01) 0.3 (0.23–0.30)
(0.011–0.014) 0.4 (0.35–0.45)
(0.012–0.015) 0.4 (0.37–0.48)
(0.015–0.019) 0.4 (0.37–0.47)
(0.027–0.035) 0.7 (0.62–0.80)
(0.032–0.041) 0.8 (0.71–0.92)
(0.036–0.047) 0.9 (0.77–1.0)

0.21 (0.16–0.26)
0.025
0.094
0.19
0.29
0.5
0.55
0.59
<0.01
<0.01
<0.01
<0.01
<0.01
0.011
0.014
0.026
0.059
0.23
0.8
2.4
3.1
3.8

0 (0–0)

3.4 (2.6–4.3)

(0.019–0.033) 0.1 (<0.1–0.13)
(0.076–0.11)
0.4 (0.28–0.42)
(0.16–0.21)
0.7 (0.57–0.74)
(0.26–0.33)
1 (0.85–1.1)
(0.43–0.56)
1.6 (1.4–1.8)
(0.48–0.62)
1.7 (1.5–1.9)
(0.51–0.67)
1.8 (1.6–2.0)
(<0.01–<0.01) 0.1 (0.10–0.14)
(<0.01–<0.01) 0.1 (<0.1–0.12)
(<0.01–<0.01) 0.1 (<0.1–0.11)
(<0.01–<0.01) 0.1 (<0.1–0.12)
(<0.01–<0.01) 0.3 (0.26–0.34)
(<0.01–0.012) 0.4 (0.31–0.41)
(0.013–0.016) 0.4 (0.38–0.49)
(0.016–0.038) <0.1 (<0.1–<0.1)
(0.048–0.070) <0.1 (<0.1–<0.1)
(0.19–0.28)
0.2 (0.13–0.19)
(0.65–0.98)
0.5 (0.41–0.62)
(2.0–2.9)
1.4 (1.1–1.7)
(2.5–3.7)
1.7 (1.4–2.1)
(3.1–4.6)
2.1 (1.7–2.6)

<0.01 (<0.01–<0.01) <0.1 (<0.1–0.12)
<0.01 (<0.01–<0.01) <0.1 (0–0.12)

0.12 (0.092–0.15)
0.1 (0.077–0.13)

0.4 (0.34–0.56)
0.4 (0.28–0.46)

0.3
0.56
0.77
0.85
0.85
0.85
0.85

4.8
8.9
10
10
8.9
8.6
8.3

(0.19–0.44)
(0.46–0.68)
(0.63–0.93)
(0.70–1.0)
(0.70–1.0)
(0.70–1.0)
(0.70–1.0)

(2.9–7.0)
(7.3–11)
(8.6–13)
(8.2–12)
(7.3–11)
(7.1–10)
(6.9–9.9)

NOTIFIED NEW AND RELAPSEb

CASE DETECTION

NUMBER

RATEa

PERCENT

4 332

37

20 (13–32)

7 107
21 844
28 029
27 983
29 381
117
43
207
280
246
225
225
2 100

35
88
99
96
99
24
7.6
31
32
20
17
17
356

18
46
52
51
52
87
87
87
87
87
87
87
57

3 971
3 109
4 172
3 686
3 474
2 142
11 145
10 762
11 446
9 260
8 974
8 453
9 255
15 936
11 850
9 212
10 362
10 980
11 042
14 735
9 697
9 697
9 454
9 707
8 837
8 664
439
498
306
367
338
328
331
277
336
513
517
957
672
737

549
400
500
435
404
3.8
18
16
16
12
11
10
16
26
18
13
14
15
14
84
48
41
35
31
28
26
13
12
6.4
7
5.2
4.9
4.7
13
21
27
23
32
22
23

89
65
81
70
65
11
58
63
75
66
65
62
53
75
70
65
70
70
70
160
90
81
72
69
62
59
91
97
80
98
83
81
82
87
87
87
87
87
87
87

(76–100)
(54–79)
(68–98)
(59–85)
(55–79)
(9.4–13)
(49–68)
(54–75)
(64–89)
(57–78)
(56–76)
(54–73)
(40–72)
(57–100)
(53–96)
(49–89)
(53–96)
(53–96)
(52–97)
(140–180)
(80–100)
(71–93)
(64–82)
(61–79)
(54–71)
(52–68)
(80–100)
(86–110)
(70–91)
(86–110)
(74–95)
(72–93)
(72–93)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)

983
571
391
513
496
630
442
1 440
1 341
2 098

32
18
9.8
12
11
14
10
30
26
38

110
100
86
85
74
86
26
76
65
94

(98–130)
(90–120)
(76–98)
(75–97)
(65–84)
(76–99)
(22–32)
(63–93)
(54–79)
(81–110)

1 518
1 549
27 658
29 829
28 852
26 269
28 359
28 640
28 635
482
276
321
261
308
337
382
156 759
13 142
11 050
142 017
264 235
264 934
267 475
184
304
279
325
580
553
728
2 415

25
25
112
111
100
87
90
89
88
27
13
15
10
11
11
12
141
10
7.7
90
153
150
149
39
61
47
40
33
29
36
15

62
63
76
73
86
87
89
87
86
87
87
87
87
87
87
87
61
4.5
3.3
39
66
65
65
87
87
87
87
87
87
87
87

(52–76)
(53–77)
(59–100)
(61–90)
(76–98)
(77–99)
(79–100)
(77–99)
(75–98)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(41–99)
(3.7–5.5)
(2.8–4.1)
(32–48)
(55–80)
(54–79)
(54–78)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)

3 452
3 539
4 465
3 932
3 690

17
14
16
14
13

87
87
87
87
87

(77–99)
(77–99)
(77–99)
(77–99)
(77–99)

2 504
5 686
12 904
10 139
11 653
11 975

39
77
152
105
118
117

14
27
53
37
41
41

(12–17)
(22–33)
(44–65)
(31–45)
(35–50)
(34–50)

(15–22)
(39–57)
(44–63)
(43–62)
(44–63)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(77–99)
(40–90)

EASTERN MEDITERRANEAN REGION

INCIDENCE (INCLUDING HIV)
YEAR

Rates are per 100 000 population.
NOTIFIED NEW AND RELAPSE includes cases for which the treatment history is unknown.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

211

7$%/($,QFLGHQFHQRWLILFDWLRQDQGFDVHGHWHFWLRQUDWHVDOOIRUPV±
INCIDENCE (INCLUDING HIV)
YEAR

South Sudan
Sudan

Syrian Arab
Republic

Tunisia

United Arab
Emirates

West Bank
and Gaza Strip

Yemen

a
b

2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

10
11
26
30
34
40
46
36
37
12
14
16
18
22
22
22
8
9
10
10
11
11
11
2
2
3
4
8
9
9
2
3
3
4
4
4
4
12
15
18
20
23
23
24

NUMBER
(THOUSANDS)

15
16
44
47
50
53
54
42
42
7.5
6.6
5.7
4.8
4.3
4.1
3.9
2.3
2.7
2.4
2.4
3
3.2
3.4
0.22
0.28
0.36
0.21
0.26
0.21
0.16
0.12
0.22
0.33
0.23
0.21
0.26
0.32
16
21
20
16
11
11
12

(13–18)
(13–19)
(36–52)
(39–56)
(41–59)
(43–63)
(45–65)
(35–51)
(35–51)
(5.3–10)
(5.4–7.9)
(4.9–6.6)
(4.0–5.6)
(3.5–5.1)
(3.4–4.9)
(3.2–4.6)
(2.0–2.6)
(2.4–3.1)
(2.1–2.7)
(2.1–2.7)
(2.6–3.4)
(2.8–3.6)
(3.0–3.8)
(0.160–0.280)
(0.200–0.370)
(0.260–0.480)
(0.150–0.270)
(0.190–0.340)
(0.150–0.270)
(0.120–0.210)
(0.110–0.140)
(0.200–0.250)
(0.290–0.370)
(0.200–0.260)
(0.190–0.240)
(0.230–0.290)
(0.280–0.360)
(10–24)
(17–25)
(17–24)
(13–19)
(9.2–13)
(9.4–14)
(9.6–14)

INCIDENCE HIV-POSITIVE
NUMBER
(THOUSANDS)

RATEa

146
146
170
158
144
133
119
117
114
61
46
35
26
20
19
18
29
31
25
23
28
30
31
12
12
12
5
3.1
2.3
1.7
6
8.6
10
6.5
5.3
6.3
7.6
137
137
116
81
49
49
49

(121–174)
(121–174)
(140–203)
(130–188)
(119–172)
(110–158)
(98–142)
(96–139)
(94–136)
(43–82)
(38–55)
(30–40)
(22–31)
(16–24)
(16–22)
(15–21)
(25–32)
(27–35)
(22–28)
(21–27)
(25–32)
(26–34)
(27–35)
(8.7–16)
(8.7–16)
(8.7–16)
(3.6–6.5)
(2.3–4.1)
(1.7–3.0)
(1.2–2.3)
(5.2–6.8)
(7.5–9.7)
(9.0–12)
(5.7–7.3)
(4.6–6.0)
(5.5–7.1)
(6.7–8.6)
(85–202)
(112–165)
(94–139)
(66–97)
(40–58)
(40–58)
(40–58)

0.4
1.5
3.5
5.2
5.6
4.4
4.3

<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01

(0.33–0.48)
(1.2–1.8)
(2.9–4.2)
(4.3–6.2)
(4.6–6.7)
(3.6–5.3)
(3.5–5.1)

(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)

RATEa

1.6
5
10
13
12
12
12

0
<0.1
<0.1
<0.1
<0.1
<0.1
<0.1

(1.3–1.9)
(4.1–6.0)
(8.5–12)
(11–16)
(10–15)
(10–14)
(9.5–14)

(0–0)
(<0.1–<0.1)
(<0.1–<0.1)
(<0.1–<0.1)
(<0.1–<0.1)
(<0.1–<0.1)
(<0.1–<0.1)

0.012 (<0.01–0.030) 0.2 (<0.1–0.35)
<0.01 (<0.01–0.021) <0.1 (<0.1–0.23)

<0.01
0.031
0.11
0.18
0.15
0.15
0.16

(<0.01–<0.01) <0.1 (<0.1–<0.1)
(0.022–0.042) 0.2 (0.14–0.28)
(0.074–0.14)
0.6 (0.42–0.81)
(0.12–0.25)
0.9 (0.58–1.3)
(0.093–0.21)
0.7 (0.41–0.93)
(0.096–0.22)
0.7 (0.41–0.94)
(0.098–0.23)
0.7 (0.41–0.95)

NOTIFIED NEW AND RELAPSE

b

RATEa

7 217
8 403
212
14 320
24 807
27 562
26 131
19 348
18 775
6 018
4 404
5 090
4 310
3 666
3 620
3 003
2 054
2 383
2 038
2 079
2 368
3 015
3 239
285

70
78
0.82
48
72
70
57
53
50
48
31
31
24
17
17
14
25
27
21
21
22
28
30
16

48
53
0.48
30
50
52
48
46
44
80
67
89
90
86
88
77
89
87
86
88
79
94
96
130

115
103
131
103
79
64
77
82
28
31
32
32
4 650
14 428
13 651
9 063
8 916
8 636
9 867

3.8
2.5
1.6
1.2
0.86
3.1
3
2.6
0.79
0.77
0.78
0.76
39
96
78
45
39
37
41

32
50
50
50
50
51
35
25
12
15
12
10
29
70
67
56
80
76
85

Rates are per 100 000 population.
NOTIFIED NEW AND RELAPSE includes cases for which the treatment history is unknown.

212

GLOBAL TUBERCULOSIS REPORT 2013

CASE DETECTION

NUMBER

Data for all years can be downloaded from www.who.int/tb/data

PERCENT

(40–58)
(45–64)
(0.41–0.59)
(25–37)
(42–61)
(44–64)
(40–58)
(38–55)
(37–54)
(59–110)
(56–82)
(77–100)
(77–110)
(72–100)
(74–110)
(65–93)
(78–100)
(77–99)
(76–98)
(78–100)
(70–90)
(83–110)
(84–110)
(100–180)
(24–44)
(38–69)
(38–69)
(38–69)
(38–69)
(45–59)
(30–39)
(22–28)
(11–14)
(13–17)
(11–14)
(8.8–11)
(20–47)
(58–86)
(56–83)
(46–68)
(67–97)
(64–92)
(71–100)

7$%/($&DVHQRWLILFDWLRQV±

YEAR

Afghanistan

• 37

99 •

Bahrain

• 24

17 •

Djibouti

• 356

404 •

Egypt

•4

10 •

Iran (Islamic
Republic of)

• 16

14 •

Iraq

• 84

26 •

Jordan

• 13

5•

Kuwait

• 13

23 •

Lebanon

•0

14 •

Libyan Arab
Jamahiriya

• 10

25 •

Morocco

• 112

88 •

Oman

• 27

12 •

Pakistan

• 141

149 •

Qatar

• 39

36 •

Saudi Arabia

• 15
a
b

13 •

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

NEW AND
b

RELAPSE
4 332

NEW CASES
% SMEARRE-TREAT EXCL. TOTAL
SMEAR- SMEAR-NEGATIVE/
EXTRAHISTORY POS AMONG
OTHER RELAPSE
NEW
PULM
POSITIVE
UNKNOWN
PULMONARY
RELAPSE
RETREAT UNKNOWN

7 107
21 844
28 029
27 983
29 381
117
43
207
280
246
225
225
2 100

2 892
9 949
12 947
13 789
13 319

2 358
6 085
7 085
6 155
7 405

1 620
4 954
6 248
6 286
6 906

633
623
702

237
856
1 116
1 130
1 049

17
23
101
90
89
101

14
16
72
58
47
47

85
8
107
98
89
77

0
0
0
0

3 971
3 109
4 172
3 686
3 474
2 142
11 145
10 762
11 446
9 260
8 974
8 453
9 255
15 936
11 850
9 212
10 362
10 980
11 042
14 735
9 697
9 697
9 454
9 707
8 837
8 664
439
498
306
367
338
328
331
277
336
513
517
957
672
737

1 391
1 120
1 181
1 336
1 170

518
739
538
569
547

1 875
1 058
2 253
1 587
1 567

0
0
0

4 229
4 606
5 217
4 679
4 508
4 295

9 204
2 693
2 617
1 158
1 055
937

4 684
2 843
3 163
3 048
3 074
2 915

5 347
5 361
4 581
5 188
5 539
5 409
1 587
3 194
3 194
3 096
3 618
3 059
2 760

6 432
2 642
1 807
1 985
1 980
2 191
12 394
13 962
3 188
2 887
2 693
2 463
2 315

3 779
3 442
2 530
2 869
3 076
3 105
754
1 367
2 753
2 703
3 009
2 957
3 261

187
89
86
117
103
85

210
69
76
69
81
73

175
180
187
385
222
328

983
571
391
513
496
630
442
1 440
1 341
2 098
1 518
1 549
27 658
29 829
28 852
26 269
28 359
28 640
28 635
482
276
321
261
308
337
382
156 759
13 142
11 050
142 017
264 235
264 934
267 475
184
304
279
325
580
553
728
2 415
3 452
3 539
4 465
3 932
3 690

209
184
197

237
856
1 325
1 314
1 246

0
0
0
0

0
0
0
0

0
0
0
0

0
0
0
0

184
192
200
194
190

61
19
37
72

184
253
219
231
262

0
0
0

0
0
0
0

753
620
449
375
337
306

289
328
333
300

753
620
738
703
670
606

0
0
0
0

0
0
0

477
405
274
320
385
337

154
440
515
441

477
405
428
760
900
778

20
0
0
0

0
0
0

68
562
768
387
358
328

390
411
435

68
562
768
777
769
763

0
0
0

101
145
187
150
128
172

12
0
0
0

6
3
6
2
2
1

4
16
16
18

6
3
10
18
18
19

0
0
14
0

42
89
95
163
141
140

115
244
234
407
309
269

0
0
0
0
0
0

4
0
1
2
0
0

0
0
0
0
0
0

4
0
1
2
0
0

0
0
0
0
0
0

197
202
131
194
188
240

528
149
75
99
101
131

255
214
181
210
206
250

0
0

3
6
4
10
1
9

0
2

0
0

0

3
6
4
12
1
9

607
860

626
82
474

814
652
762

731
644

305
372

462
533

0
0

14 171
12 872
12 757
12 239
11 822
11 572

4 095
2 934
2 142
2 174
2 272
2 343

11 563
13 046
11 370
12 730
13 331
13 522

135
164
131
152
180
205

60
37
37
28
32
39

81
112
89
124
122
131

2 578
3 285
48 220
104 263
105 733
110 545

3 806
5 578
68 337
105 623
103 824
109 425

3 037
1 846
22 789
45 443
45 537
41 410

60
53
96
223
197
180

135
98
73
101
120
331

109
128
156
256
236
217

1 595
1 722
2 302
2 055
2 028

722
545
687
586
549

1 023
1 067
1 311
1 227
1 022

0

0

0

0

2

269

271

20

27

47

0
0
0
0

1 216
1 215
1 198

429
1 130
764

1 645
2 345
1 962

0
0
0

0
0
0

0
8
4
4
3
7

5
0
1

0
8
4
9
3
8

0
0
0

0
0
0

184
341
2 671
5 870
5 947
6 095

2 754
5 055
5 460
5 622

184
341
5 425
10 925
11 407
11 717

3 036
3 893
0

1
0
0
0

0
0

1
0
0
0

0

0

0

0

0

112
205
122
64
91

84
83
143

112
205
206
147
234

43

0
0
0

0
0

–
–
55
62
65
69
64
–
55
59
58
61
65
68
–
–
73
60
69
70
68
–
31
63
67
80
81
82
–
45
67
72
72
74
71
11
19
50
52
57
55
54
–
47
56
53
63
56
54
–
81
67
66
70
61
70
–
27
58
64
66
65
65
–
–
88
64
–
71
63
–
78
81
86
85
84
83
–
69
82
78
84
85
84
–
40
37
41
50
50
50
–
31
35
57
69
62
35
–
–
69
76
77
78
79

EASTERN MEDITERRANEAN REGION

NEW AND RELAPSE
NOTIFICATION RATEa
1990–2012

Rates are per 100 000 population.
NEW AND RELAPSE includes cases for which the treatment history is unknown.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

213

7$%/($&DVHQRWLILFDWLRQV±

NEW AND RELAPSE
NOTIFICATION RATEa
1990–2012

YEAR

Somalia

•0

117 •

South Sudan
Sudan

•1

50 •

Syrian Arab
Republic

• 48

14 •

Tunisia

• 25

30 •

United Arab
Emirates

• 16

1•

West Bank
and Gaza Strip

•3

1•

Yemen

• 39

a
b

41 •

1990
1995
2000
2005
2010
2011
2012
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

NEW AND
b

RELAPSE

NEW CASES
% SMEARRE-TREAT EXCL. TOTAL
SMEAR- SMEAR-NEGATIVE/
EXTRAHISTORY POS AMONG
OTHER RELAPSE
POSITIVE
UNKNOWN
PULMONARY
RELAPSE
RETREAT UNKNOWN NEW PULM

2 504
5 686
12 904
10 139
11 653
11 975
7 217
8 403
212
14 320
24 807
27 562
26 131
19 348
18 775
6 018
4 404
5 090
4 310
3 666
3 620
3 003
2 054
2 383
2 038
2 079
2 368
3 015
3 239
285
115
103
131
103
79
64
77
82
28
31
32
32
4 650
14 428
13 651
9 063
8 916
8 636
9 867

1 572
3 776
7 068
5 225
5 884
6 127
2 797
3 120

692
837
3 168
2 654
3 159
3 188
2 610
3 413

318
722
2 258
1 885
2 261
2 271
1 639
1 685

102
330
368
310
366
521

134
351
512
705
717
699
537
706

8 761
12 311
12 730
9 958
7 266
6 587

2 655
6 512
9 212
9 144
6 746
6 948

1 675
3 843
5 434
6 217
4 624
4 561

0
0

474
2 141
186
812
712
679

1 616
1 110
1 037
1 056

474
2 141
1 802
1 922
1 749
1 735

0
0

1 295
1 584
1 350
1 122
1 027
809

1 507
1 409
796
544
393
364

1 574
2 000
2 103
1 948
1 915
1 702

0
0
0
0

28
97
61
52
60
44

83
161
55
32

28
97
144
213
115
76

0
225
84

1 243
1 099
915
1 091
1 031
1 059

407
179
239
151
317
282

733
727
874
1 090
1 616
1 853

0

61
51
36
51
45

19

61
51
36
51
64

0

73
62
56
46
42

3
12
28
27
15

41
25
47
30
20

0
0
0
0

0
4
0
0
2

2
1
3
6

0
6
1
3
8

0
0
0
0

9
37
7
13
11
17

58

10

6
6
5
6

15
12
13
8

0
0
0

0
3
1

0
0
0

0
3
1

0
0
0

3 681
5 565
3 379
3 584
3 135
3 321

7 390
4 176
2 780
2 313
2 400
2 808

3 082
3 470
2 553
2 715
2 880
3 486

0
0
0

275
440
351
304
221
252

134
77
83

275
440
351
438
298
335

0
0
0
0

0

134
351
410
375
349
389
171
185

Rates are per 100 000 population.
NEW AND RELAPSE includes cases for which the treatment history is unknown.

214

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

0
0
0
0
0

0
0

–
69
82
69
66
65
66
52
48
–
77
65
58
52
52
49
–
46
53
63
67
72
69
–
75
86
79
88
76
79
–
–
96
84
67
63
74
–
13
100
54
68
69
74
–
33
57
55
61
57
54

7$%/($7UHDWPHQWRXWFRPHVQHZVPHDUSRVLWLYHFDVHV±
% OF COHORT

Afghanistan

•0

91 •

Bahrain

•0

34 •

Djibouti

• 75

82 •

• 62

88 •

Egypt

Iran (Islamic
Republic of)

•0

85 •

• 80

89 •

• 92

92 •

• 71

93 •

• 91

80 •

Iraq

Jordan

Kuwait

Lebanon

Libyan Arab
Jamahiriya

• 65

59 •

• 90

80 •

• 84

97 •

• 70

92 •

• 81

49 •

Morocco

Oman

Pakistan

Qatar

Saudi Arabia

•0

61 •

• 86

86 •

Somalia

South Sudan
Sudan

• 79
a

70 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

2 892
9 949
12 497
12 947
13 789
17
23
101
131
90
89
1 391
1 120
1 377
1 181
1 336
4 229
4 606
5 217
5 201
4 679
4 508
5 347
5 361
4 581
5 152
5 188
5 539
3 194
3 194
3 096
3 347
3 618
3 059
187
89
86
109
117
103
175
180
187
386
385
222
197
202
131
179
194
188
607
860
936
731
14 171
12 872
12 757
11 907
12 239
11 822
135
164
131
164
152
180
2 578
3 285
48 220
101 887
104 263
105 733
60
53
96
220
223
197
1 595
1 722
2 201
2 302
2 055
1 572
3 776
7 068
6 047
5 225
5 884
2 797
8 761
12 311
12 730
10 541
9 958
7 266

SIZE OF
COHORT

3 136
10 013
12 497
12 947
13 789
22
15
192
162
124
1 751
1 391
1 120
1 277
1 177
1 334
2 118
4 611
5 154
5 201
4 682
4 508
5 866
4 581
5 201
5 269
5 532
11 553
3 194
3 096
3 347
3 618
3 059
193
89
86
109
117
103
175
180
187
386
385
222
200
190
131
179
192
188
626
860
792
731
14 171
12 872
12 683
11 935
12 492
11 822
93
112
104
334
152
212
802
4 074
48 205
101 809
104 434
105 733
43
53
96
5
219
294
1 285
1 722
2 201
2 302
2 055
1 278
3 776
7 059
6 047
5 225
5 884
2 114
2 767
8 326
14 599
12 730
10 883
7 729
7 266

COHORT AS
% NOTIFIED

–
108
101
100
100
100
–
96
15
147
180
139
–
100
100
93
100
100
50
100
99
100
100
100
–
109
100
101
102
100
362
100
100
100
100
100
103
100
100
100
100
100
100
100
100
100
100
100
102
94
100
100
99
100
–
–
100
–
–
100
100
100
99
100
102
100
69
68
79
204
100
118
31
124
100
100
100
100
72
100
100
2
98
149
–
81
100
100
100
100
81
100
100
100
100
100
–
99
95
119
100
103
78
100

CURED

COMPLETED

DIED

FAILED

DEFAULTED

NOT
EVALUATED

76
83
83
86
88

9
7
4
3
4

3
2
2
2
2

3
1
1
1
1

6
2
2
2
2

2
5
9
5
5

73
93
98
96
34
60
48
71
72
68
65
38
75
66
72
59
66

0
0
0
0
0
16
14
9
7
12
17
24
12
13
16
27
21

27
7
2
4
1
3
2
1
1
1
1
2
3
3
3
3
3

0
0
0
0
0
1
1
1
1
1
1
3
2
2
2
3
2

0
0
0
0
0
20
21
16
17
16
13
19
5
3
4
4
3

0
0
0
0
65
1
14
2
3
2
3
14
3
13
3
4
5

81
78
77
77
79
60
86
76
80
80
83
91
89
71
54
57
46
40
54
53
41
63
84
35
89
81
65
68
65
65

4
5
6
6
6
20
5
10
10
9
6
1
1
12
21
30
47
31
15
10
44
24
9
56
3
11
17
12
15
0

6
7
7
7
8
0
3
3
2
3
3
3
2
5
6
1
3
3
1
1
0
0
0
0
4
2
6
2
2
1

2
3
3
4
4
5
2
2
1
1
2
1
1
7
7
3
0
0
0
0
0
0
0
0
1
1
1
1
1

3
3
2
3
3
10
3
7
6
6
5
2
4
6
11
6
5
1
9
7
4
3
3
10
3
6
2
18
2
33

3
4
5
3
1
5
1
3
1
1
1
3
2
0
0
3
0
25
21
29
11
9
4
0
1
0
10
0
16
0

40

29

2

0

27

2

43
42
75
82
76
77
77
73
84
93
90
49
97
95
51
58
71
74
75
75
81
66
74
80
63
46

21
17
14
7
5
8
8
7
0
0

0
0
1
1
1
2
1
1
1
3

31
37
7
7
9
9
9
8
1
0

49
0
2
20
16
13
17
16
16
0
0
9
0
3
2

2
1
2
3
2
2
2
2
9
4
10
2
3
3
4
4
3
2
2
2
5
8
1
0
0
0

0
0
0
1
1
1
1
1
1
0
0
0
0
0
0

0
0
0
20
17
9
4
4
4
0
0
0
20
0
32

3
3
1
1
7
2
2
9
5
0
0
0
0
0
4
4
4
2
2
2
14
26
16
0
33
19

62
60
54
52
53
82
81
85
83
87
84
67
62
44
50
64
62
56
47

11
5
11
10
9
4
2
4
2
2
2
8
11
35
25
18
19
24
23

7
7
6
5
6
4
4
4
4
3
4
5
4
2
4
3
3
2
2

0
1
1
1
1
5
2
1
2
2
2
1
1
7
2
1
1
1
1

13
10
10
14
16
5
3
4
3
3
3
15
18
11
9
9
10
12
13

6
17
18
18
17
0
9
2
7
4
6
3
4
1
11
5
6
5
14

EASTERN MEDITERRANEAN REGION

TREATMENT SUCCESS (%)a
1995–2011

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

215

7$%/($7UHDWPHQWRXWFRPHVQHZVPHDUSRVLWLYHFDVHV±
% OF COHORT
a

TREATMENT SUCCESS (%)
1995–2011

Syrian Arab
Republic

• 61

84 •

Tunisia

•0

87 •

United Arab
Emirates

•0

73 •

West Bank
and Gaza Strip

• 100

100 •

• 52

88 •

Yemen

a

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

SIZE OF
COHORT

COHORT AS
% NOTIFIED

1 295
1 584
1 350
1 143
1 122
1 027
1 243
1 099
915
931
1 091
1 031

1 295
1 562
1 350
1 144
1 122
1 009

100
99
100
100
100
98
–
100
99
100
100
100
–
100
100
100
98
130
144
–
171
110
92
100
100
100
106
99
100
101

73
62
71
56
46
9
37
7
10
13
11
3 681
5 565
3 379
3 576
3 584
3 135

1 099
910
931
1 091
1 026
73
62
71
55
60
13
12
11
12
11
3 681
5 565
3 566
3 557
3 584
3 174

DIED

FAILED

DEFAULTED

COMPLETED

45
69
76
76
75
65

16
10
13
12
14
19

2
4
3
4
3
3

9
3
2
1
2
2

24
11
6
4
4
10

5
4
1
3
2
1

87
83
72
62
63

4
7
11
24
24

3
2
3
3
3

2
1
2
1
1

2
2
3
4
5

2
4
9
6
5

56
42
21
24
2
100

18
31
52
45
72

7
6
11
7
3

4
0
1
0
0

5
15
14
24
23

10
6
0
0
0
0

58
18
8
18
43
59
69
79
77
79

42
64
75
82
9
13
11
9
9
9

0
9
0
0
1
3
3
3
3
2

0
0
17
0
1
1
1
1
1
1

0
9
0
0
35
14
6
4
4
5

0
0
0
0
11
10
10
4
7
3

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

216

GLOBAL TUBERCULOSIS REPORT 2013

NOT
EVALUATED

CURED

Data for all years can be downloaded from www.who.int/tb/data

7$%/($7UHDWPHQWRXWFRPHVUHWUHDWPHQWFDVHV±
% OF COHORT

Afghanistan

•0

77 •

Bahrain

•0

0•

Djibouti

•0

63 •

Egypt

•0

72 •

Iran (Islamic
Republic of)

•0

72 •

Iraq

•0

75 •

Jordan

•0

80 •

Kuwait

•0

0•

Lebanon

•0

100 •

Libyan Arab
Jamahiriya

•0

0•

Morocco

• 76

66 •

Oman

•0

67 •

• 70

80 •

Pakistan

Qatar

• 67

0•

Saudi Arabia

•0

63 •

Somalia

•0

72 •

South Sudan
Sudan

•0
a

55 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

237
856
1 290
1 325
1 314
0
0
0
0
0
184
253
210
219
231
753
620
738
748
703
670
477
405
428
773
760
900
68
562
768
751
777
769
6
3
10
20
18
18
4
0
1
1
2
0
3
6
4
10
12
1

SIZE OF
COHORT

304
856
1 325
1 937

0
0
0
268
253
194
213
227
956
738
748
703
599
606
448
708
781
892

953
751
777
769
6
24
5
15

1
1
2
0
5
4
10
12
1

271
23
85
47
1 469

1 605
1 645
2 345
0
8
4
7
9
3
184
341
5 425
9 200
10 925
11 407
1
0
0
0
0

112
205
144
206
147
134
351
512
655
705
717
537
474
2 141
1 802
1 993
1 922
1 749

1 650
1 668
2 899
2 623
7
7
9
3
374
907
5 009
8 801
8 394
11 407
3

0
0
0
139
96
151
249
147
351
524
655
705
717
434
527

1 828
2 147
1 517
1 749

COHORT AS
% NOTIFIED

–
128
100
–
100
147
–
–
–
–
–
–
–
146
100
92
97
98
–
154
100
100
100
89
–
150
105
92
103
99
–
–
124
100
100
100
–
200
–
120
28
83
–
–
100
100
100
–
–
83
100
100
100
100
–
–
–
–
–
–
–
–
–
104
176
112
–
88
–
100
100
100
203
266
92
96
77
100
300
–
–
–
–
–
–
124
47
105
121
100
–
100
102
100
100
100
–
98
–
–
101
108
79
100

CURED

COMPLETED

DIED

FAILED

DEFAULTED

NOT
EVALUATED

73
87

5
2

4
3

4
1

11
2

3
5

73
58

6
19

3
2

3
2

1
2

14
17

27
58
67
53
47

9
10
8
17
16

0
3
3
6
4

3
2
2
2
5

22
24
18
19
22

37
2
3
3
6

52
41
39
38
35

11
17
39
34
36

7
10
6
6
6

12
12
5
8
6

13
8
7
8
10

5
12
4
6
7

63
68
48
49
49

13
8
25
20
22

6
9
8
8
9

5
3
3
5
4

6
4
5
4
4

7
8
11
15
12

60
57
36
39

12
27
40
36

4
3
4
5

8
3
5
7

12
9
13
12

4
1
3
1

83

17

0

0

0

0

17
0
13

62
60
67

4
0
0

0
20
0

17
0
20

0
20
0

0
0
0

100
100
100

0
0
0

0
0
0

0
0
0

0
0
0

25
20
17
100

0
0
8

0
0
0

0
0
17

20
0
20
0
0

20

80
75
60
58

11

22

2

0

45

65

12

4

4

10

7

55
60
40
38

17
9
24
28

4
4
4
3

5
3
3
3

14
16
21
21

5
8
9
8

86

0

0

14

0

0

57
44
67
48
37
61
63
68
63
67

43
56
0
22
17
15
18
16
17
0

0
0
33
2
6
5
4
3
4
0

0
0
0
5
3
3
3
3
3
0

0
0
0
24
29
11
8
6
8
0

0
0
0
0
8
5
3
3
4
33

43
40
45
31
41

15
9
15
19
22

7
9
8
8
9

3
5
1
2
3

13
18
17
22
10

19
19
14
17
15

53
76
50
48
43
23
20

1
5
10
14
29
34
38

5
6
6
6
7
5
7

5
2
4
5
6
9
2

3
5
3
4
4
23
28

34
6
27
23
11
5
5

53
33
28
22

29
38
40
33

3
3
2
3

1
1
1
1

9
15
14
13

6
10
16
27

EASTERN MEDITERRANEAN REGION

TREATMENT SUCCESS (%)a
1995–2011

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

217

7$%/($7UHDWPHQWRXWFRPHVUHWUHDWPHQWFDVHV±
% OF COHORT
TREATMENT SUCCESS (%)a
1995–2011

Syrian Arab
Republic

•0

70 •

Tunisia

•0

79 •

United Arab
Emirates

•0

33 •

West Bank
and Gaza Strip

•0

0•

Yemen

• 43

a

67 •

YEAR

1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011
1995
2000
2005
2009
2010
2011

NUMBER
NOTIFIED

28
97
144
176
213
115

SIZE OF
COHORT

189
144
176
213
225

61
51
42
36
51

52

0
6
0
1
3

5
0
3
3

2
0
3
275
440
351
314
438
298

42

0
0

14
437
351
291
298

COHORT AS
% NOTIFIED

–
195
100
100
100
196
–
69
–
–
–
102
–
–
83
–
300
100
–
–
–
0
–
–
5
99
100
93
–
100

CURED

COMPLETED

44
53
48
23
20

10
14
22
58
49

74

54

DIED

DEFAULTED

4
5
9
4
5

20
9
4
3
5

15
19
15
11
20

7
0
3
1
1

0

5

2

10

10

25

2

8

10

2

80

0

0

0

20

0

0
0

67
33

33
0

0
0

0
67

0
0

29
64
48
70

14
8
9
7

21
7
2
3

14
6
3
4

14
11
7
7

7
4
30
9

62

5

5

3

6

19

TREATMENT SUCCESS = percent cured + percent completed then rounded to the nearest digit.



GLOBAL TUBERCULOSIS REPORT 2013

NOT
EVALUATED

FAILED

Data for all years can be downloaded from www.who.int/tb/data

7$%/($+,9WHVWLQJDQGSURYLVLRQRI&37$57DQG,37–

Afghanistan

–

25 •

• 46

82 •

Bahrain

Djibouti

•7

36 •

Egypt

–

17 •

–

14 •

–

86 •

• 23

51 •

Iran (Islamic
Republic of)

Iraq

Jordan

Kuwait

• 100

100 •

Lebanon

•1

67 •

Libyan Arab
Jamahiriya
–

100 •

–

20 •

Morocco

Oman

• 98

100 •

Pakistan

•0

4•

• 100

0•

Qatar

Saudi Arabia

–

89 •

Somalia

•0

44 •

•1

15 •

•8

53 •

•6

18 •

–

62 •

South Sudan
Sudan

Syrian Arab
Republic

Tunisia

United Arab
Emirates

West Bank
and Gaza Strip
•0

100 •

•0

6•

Yemen

2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

NUMBER OF TB
% OF TB
PATIENTS WITH PATIENTS WITH
KNOWN HIV
KNOWN HIV
STATUS
STATUS
18
23
25
46
65
66
82
7.1
52
19
36

5 170
6 445
7 275
128
161
148
184
224
2 163
718
1 289

47
37
17

4 483
3 441
1 514

8.4
12
14

904
1 343
1 574

66
84
86
23
99
78
51
100
100
100
100
0.77
52
48
67

6 711
7 754
7 821
86
352
267
177
517
957
672
737
3
269
236
424

97
100

2 128
1 498
1 549

0.75
6.2
20
98
100
100
100
0
2.3
3.1
3.8
100
0
0
0.14

215
1 856
5 827
257
313
337
383
0
6 283
8 264
10 419
325
0
0
1

72
86
89
0
26
34
44
47
51
0.62
28
15
15
7.9
2.2
16
53
6.2
6.6
12
18

3 278
3 469
3 420
0
2 741
4 140
5 359
3 542
4 584
180
7 532
3 082
3 070
345
85
586
1 601
129
156
360
593

64
76
62
0
100
100
100
0
0
0
6.2

84
81
53
0
31
32
32
0
0
0
612

PATIENTS
NOTIFIED
(NEW AND
RETREAT)
21 844
28 238
28 167
29 578
280
246
225
225
3 170
4 191
3 723
3 546
11 735
9 588
9 307
8 753
9 366
10 802
11 495
11 483
9 454
10 097
9 248
9 099
371
354
344
349
517
957
672
737
391
515
496
630
2 367
1 545
1 549
26 269
28 788
29 770
29 399
261
313
337
383
144 771
269 290
270 394
273 097
325
580
553
728
3 539
4 549
4 015
3 833
13 006
10 469
12 021
12 285
7 583
8 924
29 178
27 241
20 385
19 831
4 393
3 827
3 675
3 035
2 079
2 368
3 015
3 258
105
132
106
85
28
31
32
32
9 063
9 050
8 713
9 950

NUMBER OF
HIV-POSITIVE
TB PATIENTS

% OF TESTED
TB PATIENTS
HIV-POSITIVE

% OF HIV% OF HIVNUMBER OF
POSITIVE TB POSITIVE TB HIV-POSITIVE
PATIENTS ON PATIENTS ON
PEOPLE
CPT
ART
PROVIDED IPT

2
5
5
6
6
7
1
135
248
177
130

<0.1
<0.1
<0.1
4.7
3.7
4.7
0.54
60
11
25
10

100
80
100
0
0
0
0
15
0

100
80
100
0
0
43
100
15
11
22
64

7
12
17

0.16
0.35
1.1

100
100
100

100
100
100

254
291
283

28
22
18

16
20
27

28
37
41

1
2
2
0
0
1
0
3
3
0
3
3
7
9
3

<0.1
<0.1
<0.1
0
0
0.37
0
0.58
0.31
0
0.41
100
2.6
3.8
0.71

100
100
50

0
50
50

100

100

100
100

100
100

100
0
100
100
100

100
100
100

212
128
105

10
8.5
6.8

1.4
0

17
41
357
10
4
8
14
0
28
34
30
0
0
0
1

7.9
2.2
6.1
3.9
1.3
2.4
3.7

100
100
100
100
100
88
100

100
68
100
100
100
88
100

0.45
0.41
0.29
0

39
100
100

43
56
73

100

100

100

38
68
85
79
82
62
10
160
0
0

0
26
20
27
27
28
10
100
25
17

100
100
100
100
100
100
100

0
100
100
100
100
100
100

100
100

100
100

77
77
79
21
231
206
192
428
534
150
247
292
231
0
5
7
5
2
7
10
14
4
3
4
0
0
0
0
0
0
0
26

4.8
3.7
7.5

0

0
0

161
155
0

0

100

2.3
2.2
2.3
8.4
5
3.6
12
12
83
3.3
9.5
7.5
0
5.9
1.2
0.31
1.6
4.5
2.8
2.4

25

EASTERN MEDITERRANEAN REGION

% OF TB PATIENTS WITH
YEAR
KNOWN HIV STATUS
2005–2012

68
9

0

14

0

0

24
38
54

0
0
0

4.2

Data for all years can be downloaded from www.who.int/tb/data

62

0
0
0

GLOBAL TUBERCULOSIS REPORT 2013

219

7$%/($7HVWLQJIRU0'57%DQGQXPEHURIFRQILUPHGFDVHVRI0'57%±

YEAR

TOTAL
CONFIRMED
CASES OF
a

MDR-TB
Afghanistan

Bahrain

Djibouti

Egypt

Iran (Islamic
Republic of)

Iraq

Jordan

Kuwait

Lebanon

Libyan Arab
Jamahiriya

Morocco

Oman

Pakistan

Qatar

Saudi Arabia

Somalia

South Sudan
Sudan

Syrian Arab
Republic

Tunisia

United Arab
Emirates

West Bank
and Gaza Strip

Yemen

a

b

2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012
2005
2010
2011
2012

19
19
31
4
0
9
4
39
0
96

134
116
27
58
43
50
110
84
62
19
10
4
13
6
5
0
4
3
7
3
6
8

NEW PULMONARY CASES
ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

% OF

BACT+VEb
TESTED FOR
MDR-TB

BACT+VE
TESTED FOR
MDR-TB
–
1.8
–
–
2.0
70
99
110
0
–
–
–
–
–
0.70
0.59
4.5
4.7
13
6.8
–
0
–
2.5
97
63
30
91
280
100
100
–
37
2.1
9.6
4.2
0.47
–
–
–
1.4
0.38
0.50
0.85
95
59
100
100
–
<0.1
–
0.42
190
100
1.6
2.0
–
–
–
–
–
9.3
4.4
0
–
–
–
–
0.29
0.65
0
1.7
12
13
–
0.55
0.19
0.28
–
–
5.0
52
–
0
0
0
–
1.5
–
5.5

238
1 100 (0–2 900)

750 (21–2 600)

2.8 (0.57–8.0)

2.8 (0.57–8.0)

81 (40–120)

31 (1.7–58)

330 (270–390)

180 (99–260)

750 (590–910)

380 (260–530)

2
162
154
160
0

39
31
205
271
717
411
0

420 (0–870)

180 (5.1–610)

15 (5.4–25)

10 (3.7–21)

0 (0–6.1)

0 (0–6.1)

9.9 (3.5–16)

3.9 (0.47–14)

69
98
74
55
77
516
437
282
48
4
18
10
4

1
36 (1.0–120)
180
54
45
80
5
1
4
6
444
344
1602
2
4
4
2
14
22
20
57
20
0
6
3
45
49
62
116
7
25
24
13
12
12
15
4
0
1
2

36 (1.0–120)

300 (190–410)

66 (22–150)

5.9 (1.2–11)

5.9 (2.2–13)

180
47
61
103
125
185
219
248
9

11 000 (0–29 000)

7 700 (220–27 000)

6.3 (1.7–16)

6.3 (1.7–16)

84 (64–100)

46 (36–62)

770 (600–930)

480 (250–720)

250 (120–390)

120 (6.5–220)

580 (280–870)

240 (14–460)

97 (65–130)

73 (46–110)

461
264
324
9
10

488
261
0

36
43
0
63
408
155
6
2
3

19 (7.0–30)

11 (0–23)

2.0 (1.5–2.5)

1.0 (0.51–1.5)

3
26

0.81 (<0.1–2.8)

0
0
0

0
0
0
1
4

1.1 (0–3.0)

8

150 (100–210)

89
110 (31–180)

PREVIOUSLY TREATED CASES

NUMBER OF

183

b

ESTIMATED CASES
OF MDR-TB AMONG
NOTIFIED

400 (93–700)

0 (0–0)

50 (19–81)

150 (130–180)

380 (270–480)

240 (57–430)

5.4 (0.70–13)

0 (0–0)

6.0 (2.0–8.6)

–

240 (150–350)

0 (0–3.0)

3 700 (880–6 600)

0 (0–0)

37 (28–48)

280 (160–410)
140 (52–220)

330 (130–540)

24 (16–33)

7.6 (2.9–12)

0.95 (0.74–1.2)

0.32 (<0.1–0.56)

49 (27–73)

NUMBER OF
% OF NOTIFIED
NOTIFIED
TESTED FOR
TESTED FOR
MDR-TB
MDR-TB
–
34
2.6
–
38
3.0
0
–
0
–
0
–
1
–
0
0
–
–
–
–
–
497
74
438
72
41
9.6
169
22
322
36
207
27
–
185
24
224
29
159
21
33
330
7
39
6
33
6
32
1
100
0
0
0
–
–
4
100
14
120
1
100
6
67
–
–
–
–
–
403
24
229
9.8
416
21
11
280
8
89
3
100
8
100
–
306
2.8
–
154
1.3
0
–
0
–
0
–
–
–
–
–
–
–
79
11
14
2.0
0
0
8
1.5
–
4
0.22
–
82
4.7
129
7.4
0
0
12
5.6
70
61
23
30
–
6
17
10
20
12
19
–
–
0
0
3
38
–
0
–
0
0
0
0
–
34
7.8
–
17
5.1

TOTAL CONFIRMED CASES OF MDR-TB includes cases with unknown previous treatment history (i.e. not included under NEW CASES or PREVIOUSLY TREATED
CASES).
BACT+VE = bacteriologically positive cases.

220

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($1HZVPHDUSRVLWLYHFDVHQRWLILFDWLRQE\DJHDQGVH[±

Afghanistan

Bahrain

Djibouti

Egypt

Iran (Islamic
Republic of)

Iraq

Jordan

Kuwait

Lebanon

Libyan Arab
Jamahiriya

Morocco

Oman

Pakistan

Qatar

Saudi Arabia

Somalia

South Sudan
Sudan

1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
2011
2012
1995
2000
2005
2010
2011
2012

FEMALE

0–14

15–24

25–34

35–44

45–54

55–64

65+

52
151
197
204
188
0
0
0
0
1
0

228
606
986
1 010
1 116
0
0
0
10
5
9

183
560
819
895
801
1
3
0
16
19
28

149
472
491
613
586
2
2
2
11
13
16

129
453
490
570
521
3
5
3
12
14
11

94
470
641
700
585
1
3
0
4
8
8

80
419
622
692
651
3
4
4
4
2
2

17
18
28
35
22
223
21
25
9
23
23
118
29
16
18
13
16
1 125
21
13
42
35
27
0
0
0
2
0
0
0
0
0
1
0
0
3
5
0
1
1
2
2
5
2

302
220
211
212
208
542
641
524
358
382
373
751
438
352
292
289
288
862
627
424
370
304
283
19
8
8
5
9
8
15
10
12
16
13
14
26
16
12
8
14
18
112
101
114

347
252
243
265
240
665
827
606
617
611
597
754
467
531
487
543
601
1 409
317
644
482
395
317
37
16
17
14
10
12
51
44
45
67
41
59
32
28
19
21
18
21
212
239
293

139
119
151
149
147
460
667
421
783
596
582
636
387
338
354
398
442
1 085
297
261
384
313
263
17
13
9
10
13
8
32
32
29
50
36
49
30
20
15
15
13
13
78
86
168

67
62
67
97
81
408
476
414
725
715
698
494
295
281
296
315
303
863
205
245
276
237
203
20
9
4
12
8
5
17
21
26
48
35
35
16
15
10
12
15
14
46
36
52

60
47
49
45
47
463
307
243
407
387
379
737
344
260
310
351
317
900
135
189
286
223
203
26
14
6
12
13
7
9
11
8
10
11
15
16
17
12
12
6
12
22
29
19

42
29
20
33
26
160
158
123
217
168
164
921
642
630
760
877
850
271
101
148
228
183
180
11
2
5
6
5
7
0
5
3
11
5
3
10
14
8
10
8
6
21
32
35

5
2
142
99
79
51
79
54
1
1
1
2
1
0
29
55
621
1 548
1 216
1 317
0
0
0
0
0

85
86
2 508
2 061
2 222
1 982
1 929
1 840
7
8
21
12
17
18
274
498
5 278
11 860
12 143
12 605
8
7
19
59
36
34

173
136
2 872
2 423
2 515
2 553
2 450
2 426
12
9
11
27
25
33
230
387
4 759
10 462
10 515
10 838
12
19
15
72
64
52

148
136
1 737
1 705
1 583
1 611
1 479
1 423
7
11
24
15
12
23
178
256
4 263
8 320
8 435
8 848
11
9
17
38
36
45

54
63
819
855
1 057
1 273
1 175
1 183
7
12
15
16
23
12
140
232
3 834
7 969
8 608
9 026
13
7
19
22
14
21

18
31
573
485
580
712
682
672
10
9
19
8
10
8
124
153
3 332
6 934
7 320
7 753
4
2
5
5
10
8

21
22
553
595
591
515
518
561
11
11
5
10
11
19
95
130
2 453
6 066
6 323
6 492
4
1
1
0
3
0

0
8
14
4
13
46
113
125
109
113
129
39
42
250
785
425
209
107
117

131
182
335
227
228
334
740
1 343
1 036
1 147
1 147
251
356
604
1 028
1 358
1 185
899
869

268
276
458
406
394
730
724
1 114
886
1 047
1 014
599
753
796
1 511
1 990
1 781
1 359
1 274

213
201
242
225
214
201
408
725
496
587
560
402
462
634
1 351
1 541
1 335
981
802

158
175
210
225
210
127
254
458
355
398
449
259
267
486
1 119
1 151
863
689
466

86
70
116
113
133
278
195
330
266
330
296
135
135
362
638
724
497
386
404

107
107
102
106
96
109
142
319
277
277
307
57
87
337
677
493
391
372
331

UNKNOWN

0
0

0
0
0

0
0

0
0
0

0
0
0

0

0
0
0

0
0
0

0

0
0

0
0
0

0
0
0

0

0
160

0
0
0

0
0
0
0

0
0

0–14

15–24

25–34

35–44

45–54

55–64

65+

93
320
445
465
400
0
0
1
0
0
1

414
1 651
2 107
2 167
2 280
1
1
1
8
9
2

565
1 959
2 263
2 325
2 204
1
2
0
15
5
11

339
1 302
1 455
1 564
1 482
2
0
3
7
6
8

205
869
1 112
1 146
1 150
0
1
1
1
6
4

99
471
831
903
850
1
1
0
1
0
1

36
246
488
535
505
1
1
0
1
1
0

12
23
20
31
20
134
55
48
8
7
8
234
77
45
54
37
43
725
37
44
73
66
36
1
0
1
3
0
1
0
1
0
4
0
3
1
4
1
0
0
2
5
6
8

147
123
104
139
132
288
457
431
199
192
187
1 039
593
394
433
473
434
304
338
305
394
368
340
15
8
6
14
8
9
8
11
13
41
23
40
16
31
25
36
37
48
34
43
36

156
117
120
118
94
367
343
298
352
355
346
890
410
205
288
313
318
1 208
241
260
294
258
225
4
9
6
24
11
12
24
24
31
78
30
73
18
26
14
48
51
72
31
35
36

47
66
89
104
73
274
257
205
423
387
379
664
322
186
208
184
206
915
136
151
198
164
154
10
1
6
4
8
7
9
12
11
30
15
15
13
9
8
17
12
16
19
24
35

31
23
36
57
36
256
211
218
292
280
274
613
320
260
276
296
252
800
134
197
205
159
186
14
2
5
3
4
1
4
5
3
10
9
12
8
7
3
7
9
9
20
24
21

17
13
24
30
26
160
112
132
192
198
193
685
407
382
398
441
374
886
103
135
220
201
174
12
2
8
5
8
3
4
3
1
11
2
6
5
4
3
4
1
4
13
16
21

10
8
19
21
18
75
48
42
97
94
92
788
647
701
1 014
1 009
965
200
87
80
166
153
169
7
5
5
3
6
5
2
1
5
8
2
4
3
6
1
3
3
3
11
22
20

8
10
191
170
167
117
100
77
2
2
2
3
5
0
85
130
1 447
3 212
2 679
2 630
1
0
0
0
2

59
47
1 708
1 530
1 330
1 098
1 153
1 162
18
17
13
18
20
20
375
591
6 463
14 481
14 652
15 445
2
0
5
7
9
6

47
37
1 288
1 121
943
841
794
832
13
5
5
22
21
37
381
416
5 611
10 513
10 684
10 902
3
4
10
16
15
9

37
19
703
672
546
426
433
408
5
7
3
6
9
10
267
274
3 987
7 749
7 880
8 263
1
3
2
2
6
1

22
24
461
398
403
386
371
306
5
5
4
4
13
10
178
163
2 866
6 410
6 590
6 876
0
1
1
1
1
1

25
18
317
406
343
310
324
286
6
11
5
4
7
9
143
103
2 060
4 879
4 977
5 494
0
0
2
1
2
0

29
13
299
352
398
364
335
342
3
6
3
5
6
6
79
56
1 338
4 338
3 711
4 056
1
0
0
0
1
1

28
31
33
35
28
38
85
169
91
114
121
60
58
359
817
381
195
113
115

172
205
239
200
207
158
354
752
467
495
553
181
212
490
925
1 102
761
512
536

182
184
271
245
236
139
319
636
444
465
554
318
302
613
1 134
1 203
979
620
562

79
98
105
110
107
97
219
436
341
348
396
239
221
299
905
978
772
513
470

51
73
70
64
50
40
110
292
188
260
267
172
139
403
771
729
520
352
299

50
51
49
49
49
25
72
212
137
168
165
59
62
342
327
411
279
188
170

70
61
58
46
63
16
41
157
132
135
169
26
24
305
323
244
191
175
172

Data for all years can be downloaded from www.who.int/tb/data

UNKNOWN

0
0

0
0

0
0

0
0
0

0
0
0

0

0
0
0

0
0
0

0

0
0

0
0
0

0
0
0

0

0
20

0
0
0

0
0
0
0

0
0

MALE:FEMALE
RATIO
–
0.52
0.46
0.49
0.51
0.50
1.7
2.8
1.5
1.7
2.3
2.7
–
2.3
2.0
1.9
1.7
1.9
1.9
2.1
1.7
2.0
1.9
1.9
0.90
0.94
1.1
0.94
1.0
1.1
1.3
1.6
1.6
1.3
1.2
1.1
2.1
2.3
1.3
1.1
1.3
1.2
2.4
2.2
1.9
1.1
1.7
1.1
2.1
1.3
1.4
0.69
0.66
0.56
3.7
3.1
3.9
–
2.2
2.8
1.9
1.8
2.1
2.5
2.4
2.4
1.1
1.2
2.7
1.5
1.2
1.2
0.71
0.99
1.0
1.0
1.1
1.1
6.5
5.6
3.8
7.3
4.8
8.0
–
1.5
1.4
1.8
1.7
1.7
3.6
2.1
1.7
1.9
2.0
1.8
1.7
2.1
1.2
1.4
1.5
1.7
1.9
1.8

GLOBAL TUBERCULOSIS REPORT 2013

EASTERN MEDITERRANEAN REGION

MALE
YEAR

221

7$%/($1HZVPHDUSRVLWLYHFDVHQRWLILFDWLRQE\DJHDQGVH[±
MALE

Syrian Arab
Republic

Tunisia

United Arab
Emirates

West Bank
and Gaza Strip

Yemen

222

FEMALE

YEAR

0–14

15–24

25–34

35–44

45–54

55–64

65+

1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012
1995
2000
2005
2010
2011
2012

13
8
9
7
8
7

332
359
266
170
139
91

255
289
237
212
195
146

111
125
111
101
116
90

70
86
112
80
81
85

59
76
62
65
49
46

50
55
63
49
45
41

16
5
9
6
10

139
103
115
110
88

208
172
194
194
191

156
133
170
118
149

109
115
125
126
114

65
53
93
108
93

101
81
88
63
88

2

4

4

6

5

12

10

1
0
0
1

7
3
2
2

13
7
4
0

7
3
4
0

3
5
5
1

4
1
5
0

4
3
2
3

0
1
0
57
110
48
68
33
30

1
2
0
2
400
789
493
507
406
436

0
1
2
605
689
553
569
471
472

2
1
1
256
493
366
322
297
315

1
1
1
2
201
314
242
231
193
232

3
1
0
4
148
255
149
164
143
172

3
3
2
45
127
78
138
96
122

GLOBAL TUBERCULOSIS REPORT 2013

UNKNOWN

UNKNOWN

0–14

15–24

25–34

35–44

45–54

55–64

65+

22
23
27
16
20
5

158
195
182
164
113
104

97
101
108
105
97
75

53
53
59
47
56
35

44
46
59
41
35
33

37
38
32
38
36
32

20
28
23
27
37
19

7
7
4
10
7

68
66
64
60
51

59
61
64
60
56

43
39
39
50
46

21
36
34
44
48

21
16
40
35
46

58
28
52
47
72

3

16

1

3

0

0

4

0
0
0

1
4
0
0

2
6
5
1

4
6
2
0

1
3
2
0

5
2
3
1

1
1
4
0

3
2
4
0

0
0
0

0
0
0

0
0
0
83
161
44
98
85
75

0
0
1
420
799
426
471
446
437

1
1
1
1
720
627
410
409
375
381

0
1
0
348
517
265
264
251
246

1
1
0
0
200
345
181
174
168
207

2
2
1
106
247
85
106
113
115

0
0
1
92
92
39
63
58
81

0
0
0

0
0

0
0

0
0

Data for all years can be downloaded from www.who.int/tb/data

0
0

0
0

0
0

MALE:FEMALE
RATIO
2.1
2.1
1.8
1.6
1.6
1.7
–
2.9
2.6
2.7
2.4
2.2
–
1.6
–
2.3
0.92
1.1
3.5
–
2.5
2.2
1.8
3.2
0.87
1.0
1.3
1.3
1.1
1.2

7$%/($/DERUDWRULHV173VHUYLFHVGUXJPDQDJHPHQWDQGLQIHFWLRQFRQWURO
FREE THROUGH NTP

Afghanistan

2.0

2

0.3

0

0

1

Bahrain

1.4

11

7.6

3.8

7.6

1

Djibouti
Egypt
Iran (Islamic Republic of)

2.1
0.2
0.5

0
0
0

5.8
1.1
3.6

5.8
<0.1
0.5

5.8
0
0

1
0
0

Iraq

0.8

0

1.5

0.2

0

5

Jordan
Kuwait

0.2
0.4

0
0

0.7
1.5

0.7
1.5

0
0

1
0

Lebanon

2.2

3

Out of
country
Out of
country
In country
In country
In country
Out of
country
No
No
Out of
country
No
No
In country

NRLd

TB DIAGNOSIS

Yes

Yes (all suspects)

Yes

No

No

Yes (all suspects)

Yes

Yes

Yes
Yes
Yes

Yes (all suspects)
Yes (all suspects)
Yes (all suspects)

Yes
Yes
Yes

Yes
Yes
Yes

Yes

Yes (all suspects)

Yes

Yes

1

Yes (all suspects)
Yes (all suspects)

Yes
Yes

Yes
Yes

0
0
0

6.0

0

3.2

1.1

0.4
0.5
7.5
0.8
<0.1
0.3
0.6

–
13
0
0
0
1
0

6.5
2.2
13.6
0.2
2.4
2.1
0

1.6
0.3
1.5
0.1
2.4
2.1
0

0
1.5
<0.1
2.4
0.4
0

0
0
15
1
8
3

South Sudan

0.6

–

Sudan

0.8

0

0.1

0.1

0

0

No Yes

Syrian Arab Republic
Tunisia
United Arab Emirates
West Bank and
Gaza Strip

1.4
0.7

–
0
–

0.2
5.1

0.2
2.3

0.2
0.5

0
2

0

0

a
b
c
d

1.5

0

1.2

0

1.0

–

0.8

0.4

0

Yes
Yes

Libya
Morocco
Oman
Pakistan
Qatar
Saudi Arabia
Somalia

Yemen

TB NOTIF.
RIFAMPICIN
RATE PER
USED
100 000
THROUGHOUT
HEALTH-CARE
TREATMENT
WORKERS

FIRSTLINE
DRUGS

Yes

Yes (all suspects)

Yes

Yes

Yes
Yes
Yes
Yes
Yes
No Yes
No
No
Out of
No
country

Yes (all suspects)
Yes (all suspects)
Yes (all suspects)
Yes (all suspects)
Yes (all suspects)
Yes (all suspects)
Yes (all suspects)

Yes
Yes
Yes
Yes
Yes
Yes
Yes

Yes
Yes
Yes
Yes
Yes
Yes
Yes

Yes (all suspects)

Yes

Yes

8
0

Yes

Yes

No Yes
In country Yes
No

Yes (if TB is
confirmed)
Yes (all suspects)
Yes (all suspects)
Yes (all suspects)

Yes
Yes
Yes

Yes
Yes
Yes

30 508

No Yes

Yes (all suspects)

Yes

Yes

204

No Yes

Yes (if TB is
confirmed)

Yes

Yes

36

EASTERN MEDITERRANEAN REGION

LABORATORIES
SECONDNUMBER OF
SMEAR LABS % OF SMEAR
CULTURE
DST b LABS
LPAc LABS
LABS USING LABS PER 5M
LINE DST
LABS USING
PER 100K
PER 5M
PER 5M
a
POPULATION
POPULATION POPULATION POPULATION XPERT MTB/RIF AVAILABLE
LED

LED = Light emitting diode microscopes
DST = Drug susceptibility testing
LPA = Line probe assay
NRL = National Reference Laboratory

Data for all years can be downloaded from www.who.int/tb/data

GLOBAL TUBERCULOSIS REPORT 2013

223

7$%/($0HDVXUHGSHUFHQWDJHRI7%FDVHVZLWK0'57%DPRVWUHFHQW\HDUDYDLODEOH
New TB cases
Afghanistan
Bahrain
Djibouti
Egypt
Iran (Islamic Republic of)
Iraq
Jordan
Kuwait
Lebanon
Libya
Morocco
Oman
Pakistan
Qatar
Saudi Arabia
Somalia
South Sudan
Sudan
Syrian Arab Republic
Tunisia
United Arab Emirates
West Bank and
Gaza Strip
Yemen

a

Year

Source

Coverage

2012

Surveillance

National

2011
1998

Survey
Survey

2009
2011
2003

Previously treated TB cases
Percentage

Year

Source

Coverage

Percentage

1.9 (0.39–5.4)

2012

Surveillance

National

100 (2.5–100)

National
National

3.4 (1.9–4.9)
5 (3.4–7.0)

2012
1998

Surveillance
Survey

National
National

25 (21–29)
48 (35–62)

Surveillance
Surveillance
Survey

National
National
National

6.3 (2.4–13)
0 (0–1.3)
1.1 (0.13–3.8)

2009
2011
2012

Surveillance
Surveillance
Surveillance

National
National
National

29 (3.7–71)
0 (0–98)
67 (22–96)

2006
2012

Survey
Surveillance

National
National

0.48 (0.15–1.1)
2.4 (0.89–5.2)

2006
2012

Survey
Surveillance

National
National

12 (7.8–18)
0 (0–37)

2010
2010
2011

Surveillance
Survey
Survey

National
National
National

1.2 (0.34–3.1)
1.8 (1.4–2.4)
5.2 (2.7–7.7)

2010
2010
2011

Surveillance
Survey
Survey

National
National
National

0 (0–98)
16 (12–21)
41 (23–58)

2003
2012

Survey
Survey

National
National

2011
2012

Surveillance
Survey

National
National

31 (21–44)
12 (4.5–19)

2011

Survey

National

2011

Survey

National

15 (8.1–22)

6.2 (3.9–9.3)
0.82 (0–1.7)

1.7 (0.50–3.0)

Empty rows indicate an absence of high-quality survey or surveillance data. In the absence of high-quality national data, high-quality sub-national data are used.

224

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

'7412'#04')+10
Table A4.1

Estimates of the burden of disease caused by TB, 1990–2012

227

6CDNG# +PEKFGPEGPQVKßECVKQPCPFECUGFGVGEVKQPTCVGUCNNHQTOU¿



6CDNG# %CUGPQVKßECVKQPU¿



Table A4.4

Treatment outcomes, new smear-positive cases, 1995–2011

239

Table A4.5

Treatment outcomes, retreatment cases, 1995–2011

242

6CDNG# *+8VGUVKPICPFRTQXKUKQPQH%26#46CPF+26¿



6CDNG# 6GUVKPIHQT/&46$CPFPWODGTQHEQPßTOGFECUGUQH/&46$¿



6CDNG# 0GYUOGCTRQUKVKXGECUGPQVKßECVKQPD[CIGCPFUGZ¿



Table A4.9

Laboratories, NTP services, drug management and infection control, 2012

252

6CDNG# /GCUWTGFRGTEGPVCIGQH6$ECUGUYKVJ/&46$OQUVTGEGPV[GCTCXCKNCDNG



Estimates of mortality, prevalence and incidence
Estimated values are shown as best estimates followed by lower and upper bounds. The lower and upper bounds are defined
as the 2.5th and 97.5th centiles of outcome distributions produced in simulations. See ANNEX 1 for further details.
Estimated numbers are shown rounded to two significant figures. Estimated rates are shown rounded to three significant
figures unless the value is under 100, in which case rates are shown rounded to two significant figures.
Estimates for all years are recalculated as new information becomes available and techniques are refined, so
they may differ from those published in previous reports in this series. The main updates implemented in this
report are explained in Box 2.1 of Chapter 2. Estimates published in previous global TB control reports should no
longer be used.

Data source
Data shown in this annex are taken from the WHO global TB database on 1 October 2013. Data shown in the main part of
the report were taken from the database in July 2013. As a result, data in this annex may differ slightly from those in the
main part of the report.
Data for all years can be downloaded from www.who.int/tb/data.

Country notes
EU/EEA countries
Notification and treatment outcome data for European Union and European Economic Area countries are provisional.

Denmark
Data for Denmark exclude Greenland.

France
Data from France include data from 5 overseas departments (French Guiana, Guadeloupe, Martinique, Mayotte and
Réunion).

Russian Federation
The reported number of TB patients with known HIV status in 2010–2012 (Table A4.6) is for new TB patients in the civilian
sector only. It was not possible to calculate the percentage of all TB patients with known HIV status.

226

GLOBAL TUBERCULOSIS REPORT 2013

Data for all years can be downloaded from www.who.int/tb/data

7$%/($(VWLPDWHVRIWKHEXUGHQRIGLVHDVHFDXVHGE\7%±

Albania

Andorra

Armenia

Austria

Azerbaijan

Belarus

Belgium

Bosnia and
Herzegovina

Bulgaria

Croatia

Cyprus

Czech Republic

Denmark

Estonia

Finland

France

a

1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012
1990
1995
2000
2005
2010
2011
2012

POPULATION
(MILLIONS)

3
3
3
3
3
3
3
<1
<1
<1
<1
<1
<1
<1
4
3
3
3
3
3
3
8
8
8
8
8
8
8
7
8
8
9
9
9
9
10
10
10
10
9
9
9
10
10
10
11
11
11
11
5
4
4
4
4
4
4
9
8
8
8
7
7
7
5
5
4
4
4
4
4
<1
<1
<1
1
1
1
1
10
10
10
10
11
11
11
5
5
5
5
6
6
6
2
1
1
1
1
1
1
5
5
5
5
5
5
5
57
58
59
61
63
64
64

NUMBER
(THOUSANDS)

0.11
0.023
0.027
0.018
0.012
0.011
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
<0.01
0.16
0.19
0.19
0.26
0.23
0.17
0.19
0.14
0.074
0.069
0.05
0.032
0.04
0.035
0.82
1.8
1.8
0.82
0.39
0.39
0.39
0.5
0.76
0.8
1.1
0.76
0.66
0.57
0.1
0.13
0.081
0.062
0.043
0.041
0.04
0.46
0.22
0.23
0.21
0.2
0.2
0.2
0.22
0.34
0.59
0.26
0.19
0.16
0.15
0.39
0.25
0.19
0.11
0.082
0.066
0.061
<0.01
<0.01
0
<0.01
<0.01
<0.01
<0.01
0.19
0.092
0.12
0.065
0.035
0.051
0.037
0.054
0.024
0.021
0.019
0.035
0.017
0.022
0.071
0.15
0.11
0.049
0.036
0.036
0.036
0.13
0.092
0.083
0.037
0.016
0.021
0.015
1
0.79
0.65
0.43
0.33
0.31
0.3

(0.081–0.130)
(0.018–0.028)
(0.019–0.037)
(0.013–0.025)
(<0.01–0.018)
(<0.01–0.017)
(<0.01–0.016)
(<0.01–<0.01)
(<0.01–<0.01)
(0–<0.01)
(0–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0–<0.01)
(0.110–0.200)
(0.160–0.230)
(0.170–0.220)
(0.190–0.320)
(0.180–0.280)
(0.130–0.210)
(0.150–0.230)
(0.140–0.140)
(0.074–0.074)
(0.069–0.069)
(0.050–0.051)
(0.032–0.033)
(0.040–0.041)
(0.035–0.036)
(0.610–1.1)
(1.3–2.3)
(1.4–2.2)
(0.660–1.0)
(0.330–0.440)
(0.340–0.450)
(0.340–0.450)
(0.470–0.540)
(0.700–0.830)
(0.760–0.850)
(0.990–1.1)
(0.700–0.820)
(0.600–0.720)
(0.510–0.630)
(0.097–0.100)
(0.130–0.130)
(0.080–0.083)
(0.062–0.063)
(0.043–0.044)
(0.041–0.042)
(0.039–0.040)
(0.440–0.480)
(0.210–0.230)
(0.210–0.240)
(0.200–0.230)
(0.180–0.220)
(0.170–0.220)
(0.180–0.220)
(0.210–0.220)
(0.340–0.350)
(0.570–0.600)
(0.260–0.270)
(0.190–0.190)
(0.160–0.160)
(0.150–0.150)
(0.380–0.410)
(0.240–0.270)
(0.180–0.200)
(0.110–0.110)
(0.082–0.083)
(0.066–0.067)
(0.060–0.062)
(<0.01–<0.01)
(<0.01–<0.01)
(0–0)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–<0.01)
(0.190–0.190)
(0.091–0.092)
(0.120–0.120)
(0.064–0.065)
(0.035–0.035)
(0.050–0.051)
(0.037–0.037)
(0.053–0.056)
(0.023–0.025)
(0.020–0.021)
(0.019–0.020)
(0.034–0.036)
(0.016–0.018)
(0.021–0.023)
(0.070–0.072)
(0.140–0.150)
(0.110–0.110)
(0.048–0.050)
(0.035–0.036)
(0.036–0.037)
(0.036–0.036)
(0.130–0.130)
(0.092–0.092)
(0.083–0.084)
(0.037–0.037)
(0.016–0.016)
(0.021–0.021)
(0.015–0.015)
(0.980–1.0)
(0.760–0.810)
(0.630–0.670)
(0.410–0.440)
(0.320–0.350)
(0.300–0.330)
(0.280–0.310)

a

RATE

3.1
0.68
0.82
0.57
0.38
0.34
0.31
2.4
2.1
1.3
0.86
0.58
0.32
0.91
4.4
6
6.3
8.5
7.7
5.6
6.3
1.8
0.93
0.86
0.61
0.38
0.48
0.42
11
23
22
9.6
4.2
4.2
4.2
4.9
7.5
8.1
11
8
7
6
1
1.3
0.79
0.59
0.4
0.38
0.36
10
6.3
5.9
5.5
5.2
5.1
5.2
2.4
4.1
7.3
3.4
2.6
2.2
2
8.2
5.4
4.2
2.5
1.9
1.5
1.4
0.2
0.2
0
0.37
0.11
0.21
0.2
1.8
0.89
1.2
0.63
0.33
0.48
0.35
1.1
0.47
0.38
0.36
0.63
0.3
0.4
4.5
10
8
3.7
2.7
2.8
2.8
2.5
1.8
1.6
0.71
0.3
0.39
0.29
1.8
1.4
1.1
0.7
0.53
0.5
0.46

(2.3–3.9)
(0.55–0.83)
(0.57–1.1)
(0.39–0.79)
(0.23–0.58)
(0.20–0.53)
(0.16–0.49)
(0.16–7.6)
(<0.1–8.5)
(0–6.2)
(0–3.9)
(<0.1–2.3)
(0.16–0.54)
(0–4.9)
(3.2–5.8)
(4.9–7.2)
(5.6–7.0)
(6.5–11)
(6.1–9.5)
(4.5–6.9)
(5.1–7.6)
(1.8–1.9)
(0.92–0.93)
(0.86–0.86)
(0.61–0.61)
(0.38–0.39)
(0.47–0.49)
(0.41–0.42)
(8.5–15)
(17–29)
(17–27)
(7.7–12)
(3.7–4.9)
(3.7–4.9)
(3.7–4.9)
(4.6–5.2)
(6.9–8.1)
(7.6–8.5)
(10–12)
(7.3–8.6)
(6.3–7.7)
(5.4–6.7)
(0.97–1.0)
(1.3–1.3)
(0.78–0.81)
(0.59–0.60)
(0.39–0.40)
(0.37–0.38)
(0.35–0.36)
(9.7–11)
(5.9–6.6)
(5.5–6.3)
(5.0–6.0)
(4.6–5.7)
(4.6–5.7)
(4.6–5.8)
(2.4–2.5)
(4.0–4.2)
(7.2–7.5)
(3.4–3.5)
(2.5–2.6)
(2.2–2.2)
(2.0–2.1)
(8.0–8.5)
(5.0–5.7)
(4.0–4.4)
(2.5–2.5)
(1.9–1.9)
(1.5–1.5)
(1.4–1.4)
(0.16–0.25)
(0.16–0.25)
(0–0)
(0.32–0.41)
(0.10–0.13)
(0.19–0.23)
(0.16–0.25)
(1.8–1.8)
(0.88–0.89)
(1.2–1.2)
(0.63–0.63)
(0.33–0.34)
(0.47–0.48)
(0.35–0.35)
(1.0–1.1)
(0.45–0.48)
(0.38–0.39)
(0.35–0.36)
(0.61–0.66)
(0.28–0.32)
(0.38–0.42)
(4.5–4.6)
(9.9–10)
(7.9–8.2)
(3.6–3.8)
(2.7–2.8)
(2.8–2.8)
(2.8–2.8)
(2.5–2.5)
(1.8–1.8)
(1.6–1.6)
(0.71–0.71)
(0.30–0.30)
(0.39–0.39)
(0.28–0.29)
(1.7–1.8)
(1.3–1.4)
(1.1–1.1)
(0.68–0.72)
(0.51–0.55)
(0.47–0.52)
(0.44–0.49)

PREVALENCE (INCLUDING HIV)
NUMBER
(THOUSANDS)

1.2
1.1
0.98
0.87
0.74
0.72
0.68
0.034
0.033
0.021
0.017
0.011
<0.01
0.017
1
1.9
2.9
3.5
2.7
2.3
2.4
2.5
2.5
2
1.5
1
1.1
0.91
54
120
140
66
20
16
12
5.2
11
13
11
10
10
10
2.6
2.2
2.1
1.7
1.7
1.5
1.4
6.5
4.6
2.8
2.3
2.6
2.7
2.8
4.2
8.4
7
6.2
3.9
3.5
3.1
4.4
3.3
2.5
1.6
1.1
0.96
0.84
0.038
0.05
0.045
0.051
0.1
0.069
0.069
3.1
2.8
2.2
1.6
0.99
0.9
0.77
0.61
0.64
1
0.67
0.46
0.58
0.56
0.81
0.93
1.3
0.7
0.37
0.44
0.38
1.3
1.1
0.85
0.55
0.48
0.48
0.39
16
16
11
8.5
8.9
8.7
7.4

(0.440–2.4)
(0.420–2.1)
(0.380–1.8)
(0.370–1.6)
(0.320–1.3)
(0.310–1.3)
(0.280–1.3)
(0.013–0.064)
(0.015–0.058)
(<0.01–0.035)
(<0.01–0.029)
(<0.01–0.020)
(<0.01–0.015)
(<0.01–0.028)
(0.420–1.8)
(0.890–3.3)
(1.4–4.8)
(1.7–6.0)
(1.2–4.8)
(1.0–4.2)
(1.1–4.1)
(1.1–4.5)
(1.2–4.4)
(0.890–3.5)
(0.690–2.7)
(0.420–1.9)
(0.510–2.0)
(0.370–1.7)
(25–94)
(56–220)
(62–240)
(31–110)
(9.9–34)
(7.3–28)
(4.1–23)
(2.2–9.5)
(5.1–19)
(6.0–23)
(4.4–19)
(4.6–18)
(4.6–18)
(4.7–18)
(1.1–4.6)
(0.930–3.9)
(0.920–3.7)
(0.690–3.0)
(0.740–2.9)
(0.660–2.8)
(0.560–2.6)
(1.9–14)
(2.1–8.1)
(0.830–5.9)
(0.640–5.0)
(1.1–4.7)
(1.2–4.8)
(1.3–4.8)
(1.9–7.5)
(4.2–14)
(3.3–12)
(3.0–11)
(1.6–7.1)
(1.4–6.4)
(1.3–5.8)
(2.1–7.7)
(1.3–6.1)
(1.0–4.7)
(0.620–3.0)
(0.420–2.0)
(0.390–1.8)
(0.340–1.6)
(0.011–0.080)
(0.017–0.100)
(0.015–0.091)
(0.020–0.095)
(0.049–0.180)
(0.023–0.140)
(0.021–0.150)
(1.3–5.6)
(1.1–5.3)
(0.880–4.1)
(0.690–2.8)
(0.420–1.8)
(0.380–1.6)
(0.310–1.4)
(0.300–1.0)
(0.220–1.3)
(0.490–1.7)
(0.310–1.2)
(0.170–0.880)
(0.260–1.0)
(0.240–1.0)
(0.410–1.3)
(0.350–1.8)
(0.610–2.3)
(0.280–1.3)
(0.130–0.740)
(0.200–0.780)
(0.160–0.680)
(0.550–2.3)
(0.500–1.9)
(0.370–1.5)
(0.240–0.980)
(0.190–0.900)
(0.190–0.900)
(0.130–0.790)
(7.7–26)
(8.5–27)
(5.6–19)
(4.0–15)
(4.6–15)
(4.5–14)
(3.7–12)

INCIDENCE (INCLUDING HIV)
a

RATE

36
32
30
27
24
23
22
62
51
31
21
14
9
21
28
59
93
118
92
79
79
33
32
25
19
12
13
11
744
1 600
1 690
776
221
172
124
51
106
130
109
107
107
108
26
21
20
16
15
14
13
145
131
73
59
67
70
73
48
101
88
81
53
48
43
92
70
57
36
24
22
20
5
5.8
4.8
4.9
9.4
6.2
6.1
30
27
21
15
9.4
8.5
7.2
12
12
19
12
8.3
10
10
52
65
97
53
29
34
29
25
22
16
10
9
8.9
7.2
28
28
19
14
14
14
12

(13–70)
(12–61)
(12–56)
(11–49)
(10–43)
(9.7–42)
(8.9–40)
(24–118)
(23–91)
(15–54)
(9.8–36)
(6.3–26)
(2.7–19)
(11–36)
(12–52)
(28–101)
(46–158)
(58–198)
(42–161)
(34–142)
(37–137)
(15–58)
(15–55)
(11–43)
(8.4–33)
(5.0–23)
(6.0–23)
(4.4–20)
(343–1 300)
(717–2 820)
(768–2 970)
(366–1 340)
(109–371)
(79–302)
(44–245)
(22–93)
(51–182)
(60–225)
(46–199)
(48–189)
(49–188)
(50–188)
(11–46)
(9.1–39)
(9.0–36)
(6.6–29)
(6.8–27)
(6.0–25)
(5.1–24)
(43–307)
(59–229)
(22–154)
(17–129)
(28–123)
(31–124)
(35–126)
(21–85)
(51–169)
(42–151)
(39–139)
(22–97)
(20–88)
(17–80)
(43–160)
(28–130)
(23–105)
(14–69)
(9.7–46)
(9.1–41)
(7.9–36)
(1.5–10)
(2.0–12)
(1.6–9.6)
(2.0–9.2)
(4.4–16)
(2.1–13)
(1.8–13)
(12–54)
(11–51)
(8.6–40)
(6.7–28)
(4.0–17)
(3.6–16)
(2.9–13)
(5.8–20)
(4.3–24)
(9.1–33)
(5.7–21)
(3.1–16)
(4.6–19)
(4.2–18)
(26–85)
(24–125)
(45–168)
(21–98)
(10–57)
(15–60)
(13–52)
(11–45)
(9.8–38)
(7.2–30)
(4.5–19)
(3.6–17)
(3.6–17)
(2.4–15)
(14–47)
(15–46)
(9.4–31)
(6.4–24)
(7.3–23)
(7.1–22)
(5.7–20)

NUMBER
(THOUSANDS)

0.84
0.82
0.75
0.63
0.53
0.52
0.51
0.026
0.023
0.014
0.012
<0.01
<0.01
0.01
0.63
1.2
1.9
2.3
1.8
1.6
1.5
1.7
1.7
1.4
1.1
0.76
0.77
0.67
22
49
55
29
12
10
8.9
3.5
6.9
8.4
6.9
6.7
6.6
6.6
1.8
1.6
1.5
1.2
1.2
1.1
1.1
4.2
3
2.4
2
1.9
1.9
1.9
2.9
5.2
4.6
4.1
2.8
2.6
2.3
3
2.4
1.9
1.2
0.79
0.71
0.62
0.033
0.041
0.038
0.039
0.07
0.059
0.061
2.2
2.1
1.6
1.1
0.72
0.65
0.57
0.4
0.52
0.68
0.45
0.36
0.41
0.41
0.49
0.72
0.91
0.55
0.33
0.34
0.3
0.89
0.76
0.61
0.39
0.36
0.36
0.3
11
11
7.7
6.3
6
5.9
5.3

(0.600–1.1)
(0.680–0.970)
(0.630–0.870)
(0.530–0.730)
(0.450–0.620)
(0.440–0.610)
(0.430–0.590)
(0.023–0.030)
(0.020–0.026)
(0.012–0.016)
(0.010–0.013)
(<0.01–<0.01)
(<0.01–<0.01)
(<0.01–0.012)
(0.470–0.810)
(1.0–1.4)
(1.6–2.1)
(2.1–2.6)
(1.6–2.2)
(1.3–1.9)
(1.3–1.8)
(1.5–2.0)
(1.5–1.9)
(1.2–1.5)
(0.940–1.2)
(0.660–0.860)
(0.680–0.870)
(0.590–0.760)
(18–26)
(41–59)
(46–66)
(24–34)
(9.8–14)
(8.6–12)
(7.3–11)
(2.8–4.3)
(5.9–8.1)
(6.9–9.9)
(5.3–8.8)
(5.3–8.1)
(5.4–8.0)
(5.4–8.0)
(1.6–2.1)
(1.4–1.8)
(1.3–1.7)
(1.1–1.4)
(1.0–1.3)
(0.990–1.3)
(0.940–1.2)
(2.6–6.2)
(2.4–3.6)
(2.0–2.9)
(1.7–2.4)
(1.6–2.2)
(1.6–2.2)
(1.6–2.1)
(2.5–3.3)
(4.5–5.9)
(4.0–5.3)
(3.6–4.6)
(2.5–3.2)
(2.2–2.9)
(2.0–2.6)
(2.6–3.4)
(2.1–2.8)
(1.6–2.1)
(1.1–1.4)
(0.690–0.900)
(0.620–0.810)
(0.540–0.700)
(0.029–0.038)
(0.036–0.047)
(0.033–0.043)
(0.034–0.044)
(0.061–0.079)
(0.051–0.066)
(0.053–0.069)
(2.0–2.5)
(1.8–2.4)
(1.4–1.8)
(0.980–1.3)
(0.630–0.820)
(0.570–0.740)
(0.500–0.640)
(0.350–0.460)
(0.450–0.580)
(0.590–0.760)
(0.400–0.510)
(0.320–0.410)
(