Motorola Solutions 89FT4892 BLUETOOTH TRANSMITTER User Manual USER GUIDE
Motorola Solutions, Inc. BLUETOOTH TRANSMITTER USER GUIDE
Contents
- 1. USER GUIDE
- 2. USERS MANUAL
- 3. User Manual
USER GUIDE
APX⢠Two-Way Radios APX 6000 User Guide Model 1 m Receiving and Transmitting ASTROÂŽ APX⢠6000 Series Digital Portable Radios Quick Reference Card 1 Select zone/channel. 16-Position Select Knob __________ Product Safety and RF Exposure Compliance Before using this product, read the operating instructions for safe usage contained in the Product Safety and RF C a u t i o n Exposure booklet enclosed with your radio. ATTENTION This radio is restricted to occupational use only to satisfy FCC RF energy exposure requirements. Before using this product, read the RF energy awareness information and operating instructions in the Product Safety and RF Exposure booklet enclosed with your radio (Motorola Publication part number 6881095C98) to ensure compliance with RF energy exposure limits. Radio Controls Top (Orange) Button __________ 3-Position A/B/C Switch __________ On/Off/Volume Control Knob Antenna Top Display Microphone 2 Listen for a transmission. OR Press and hold Volume Set button. OR Press Monitor button and listen for activity. 3 Adjust volume, if necessary. 4 Press the PTT button to transmit; release to Top Side (Select) Button __________ Main Speaker PTT Button Bluetoo h Pairing Indicator Side Button 1 __________ Battery receive. Sending an Emergency Alarm Side Button 2 __________ 1 Press the Emergency button. 2 The display shows EMERGNCY and the current zone/channel. A short, mediumpitched tone sounds, and the LED rapidly blinks red. 3 When acknowledgment is received, you hear Microphone 2-Position Concentric Switch __________ Accessory Connector Radio On/Off ⢠On â On/Off/Volume knob clockwise. ⢠Off â On/Off/Volume knob counterclockwise. four beeps; alarm ends; and radio exits emergency. To exit emergency at any time, press and hold the Emergency button. Zones and Channels ⢠Zone â Zone switch to desired zone. ⢠Channel â Channel switch to desired channel. Š 2010 by Motorola, Inc. All Rights Reserved. 12/10 1301 E. Algonquin Rd., Schaumburg, IL 60196-1078, U.S.A. *PMLN5715A* PMLN5715A English Sending an Emergency Call 1 Press the Emergency button. 2 Press and hold the PTT button. Speak clearly into the microphone. 3 Release the PTT button to end call. 4 Press and hold Emergency button to exit emergency. To exit emergency at any time, press and hold the Emergency button. Sending a Silent Emergency Call 1 Press the Emergency button. 2 The display does not change; the LED does not light up, and there is no tone. 3 Silent emergency continues until you: Press and hold the Emergency button to exit emergency state. OR Press and release the PTT button to exit the Silent Emergency Alarm mode and enter regular dispatch or Emergency Call mode. To exit emergency at any time, press and hold the Emergency button. Display Status Icons Blinks when the battery is low. The more stripes, the stronger the signal strength for the current site (trunking only). Direct radio to radio communication or connected through a repeater. On = Direct Off = Repeater M This channel is being monitored. is set at Low power. H L LH == Radio Radio is set at High power. i Scanning a scan list. OR Blinking dot = Detects activity on the Priority-One Channel during scan. Steady dot = Detects activity on the Priority-Two Channel during scan. The vote scan feature is enabled. On = Secure operation. Off = Clear operation. Blinking = Receiving an encrypted voice call. On steady = View mode Blinking = Program mode English Aor Bor Basic Zone Bank 1 A = Radio is in Zone 1. B = Radio is in Zone 2. C = Radio is in Zone 3. Dor Eor Basic Zone Bank 2 D = Radio is in Zone 4. E = Radio is in Zone 5. F = Radio is in Zone 6. Enhanced Zone Bank A = Contains Zone 1, Zone 2 and Zone 3, B = Contains Zone 4, Zone 5 and Zone ... ... 6, C = Contains Zone 7, Zone 8 and Zone or 9, X = Contains Zone 70, Zone 71 and Zone 72, Y = Contains Zone 73, Zone 74 and Zone 75. AB Bluetooth is ready. Bluetooth is connected to the device. Declaration of Conformity DECLARATION OF CONFORMITY Per FCC CFR 47 Part 2 Section 2.1077(a) Responsible Party Name: Motorola, Inc. Address: 1301 East Algonquin Road, Schaumburg, IL 60196-1078, U.S.A. Phone Number: 1-800-927-2744 Declaration of Conformity This declaration is applicable to your radio only if your radio is labeled with the FCC logo shown below. Hereby declares that the product: Model Name: APX 6000 conforms to the following regulations: FCC Part 15, subpart B, section 15.107(a), 15.107(d) and section 15.109(a) Class B Digital Device As a personal computer peripheral, this device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions: 1. This device may not cause harmful interference, and 2. This device must accept any interference received, including interference that may cause undesired operation. English Note: This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: ⢠Reorient or relocate the receiving antenna. Declaration of Conformity ⢠Increase the separation between the equipment and receiver. ii English ⢠Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. ⢠Consult the dealer or an experienced radio/TV technician for help. Contents What Your Dealer/System Administrator Can Tell You . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Declaration of Conformity . . . . . . . . . . . . . . . . . .i Preparing Your Radio for Use . . . . . . . . . . . . . .3 Important Safety Information . . . . . . . . . . . . . vii Charging the Battery . . . . . . . . . . . . . . . . . . . . . . . . . 4 Battery Charger . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Product Safety and RF Exposure Compliance . . . . vii Attaching the Battery . . . . . . . . . . . . . . . . . . . . . . . . . 4 Software Version . . . . . . . . . . . . . . . . . . . . . . . vii Computer Software Copyrights . . . . . . . . . . .viii Contents This User Guide contains all the information you need to use the APX⢠6000 Series Digital Portable Radios. Encrypted Integrated Data (EID) . . . . . . . . . . . . . . . 2 SecureNet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Attaching the Antenna . . . . . . . . . . . . . . . . . . . . . . . . 5 Attaching the Accessory Connector Cover . . . . . . . . 6 Attaching the Belt Clip . . . . . . . . . . . . . . . . . . . . . . . . 6 Turning On the Radio . . . . . . . . . . . . . . . . . . . . . . . . 7 Documentation Copyrights . . . . . . . . . . . . . . .viii Adjusting the Volume . . . . . . . . . . . . . . . . . . . . . . . . 8 Disclaimer . . . . . . . . . . . . . . . . . . . . . . . . . . . . .viii Identifying Radio Controls . . . . . . . . . . . . . . . . .8 Getting Started . . . . . . . . . . . . . . . . . . . . . . . . . . 1 How to Use This Guide . . . . . . . . . . . . . . . . . . . . . . . 1 Notations Used in This Manual . . . . . . . . . . . . . . . . . 1 Additional Performance Enhancement . . . . . . . . . . . 2 Dynamic System Resilience (DSR) . . . . . . . . . . . . . .2 CrossTalk Prevention . . . . . . . . . . . . . . . . . . . . . . . .2 Radio Parts and Controls . . . . . . . . . . . . . . . . . . . . . 9 Programmable Features . . . . . . . . . . . . . . . . . . . . . 10 Assignable Radio Functions . . . . . . . . . . . . . . . . . 10 Assignable Settings or Utility Functions . . . . . . . . . 11 Accessing the Preprogrammed Functions . . . . . . . 11 Push-To-Talk (PTT) Button . . . . . . . . . . . . . . . . . . . 12 iii English Identifying Status Indicators . . . . . . . . . . . . . .12 Advanced Features . . . . . . . . . . . . . . . . . . . . . 25 Status Icons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Alert Tones . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 Advanced Call Features . . . . . . . . . . . . . . . . . . . . . 25 Receiving and Responding to a Selective Call (ASTRO Conventional Only) . . . . . . . . . . . . . . . . . .25 Using the Dynamic Regrouping Feature (Trunking Only) . . . . . . . . . . . . . . . . . . . . . . . . . . . .26 General Radio Operation . . . . . . . . . . . . . . . . .19 Requesting a Reprogram (Trunking Only) . . . . . . .26 Classifying Regrouped Radios . . . . . . . . . . . . . . . .27 LED Indicator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 Intelligent Lighting Indicators . . . . . . . . . . . . . . . . . 15 Selecting a Zone . . . . . . . . . . . . . . . . . . . . . . . . . . 19 Selecting a Radio Channel . . . . . . . . . . . . . . . . . . . 20 Receiving and Responding to a Radio Call . . . . . . 20 Receiving and Responding to a Talkgroup Call . . . 21 Receiving and Responding to a Private Call (Trunking Only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 Receiving and Responding to a Telephone Call (Trunking Only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 Contents Making a Radio Call . . . . . . . . . . . . . . . . . . . . . . . . 23 Making a Talkgroup Call . . . . . . . . . . . . . . . . . . . . . 23 Repeater or Direct Operation . . . . . . . . . . . . . . . . . 23 Monitoring Features . . . . . . . . . . . . . . . . . . . . . . . . 24 Monitoring a Channel . . . . . . . . . . . . . . . . . . . . . . . 24 Conventional Mode Operation . . . . . . . . . . . . . . . . 24 iv English Scan Lists . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 Viewing a Scan List . . . . . . . . . . . . . . . . . . . . . . . . .27 Viewing and Changing the Priority Status . . . . . . . .28 Scan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 Turning Scan On or Off . . . . . . . . . . . . . . . . . . . . . .28 Making a Dynamic Priority Change (Conventional Scan Only) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .29 Deleting a Nuisance Channel . . . . . . . . . . . . . . . . .29 Restoring a Nuisance Channel . . . . . . . . . . . . . . . .29 Call Alert Paging . . . . . . . . . . . . . . . . . . . . . . . . . . 30 Receiving a Call Alert Page . . . . . . . . . . . . . . . . . .30 Emergency Operation . . . . . . . . . . . . . . . . . . . . . . 30 Sending an Emergency Alarm . . . . . . . . . . . . . . . .31 Sending an Emergency Call (Trunking Only) . . . . .31 Sending an Emergency Alarm with Emergency Call . . . . . . . . . . . . . . . . . . . . . . . . . . . .32 Sending a Silent Emergency Alarm . . . . . . . . . . . .33 Using the Emergency Keep-Alive Feature . . . . . . .33 Loading an Encryption Key . . . . . . . . . . . . . . . . . . 35 Using the Multikey Feature . . . . . . . . . . . . . . . . . . 35 Erasing the Selected Encryption Keys . . . . . . . . . . 36 Requesting an Over-the-Air Rekey (ASTRO Conventional Only) . . . . . . . . . . . . . . . . . . . . . . . . 36 MDC Over-the-Air Rekeying (OTAR) Page . . . . . . 37 Hear Clear . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37 Trunking System Controls . . . . . . . . . . . . . . . . . . . . 38 Using the Failsoft System . . . . . . . . . . . . . . . . . . . .38 Going Out of Range . . . . . . . . . . . . . . . . . . . . . . . .38 Using the Site Trunking Feature . . . . . . . . . . . . . . .39 Locking and Unlocking a Site . . . . . . . . . . . . . . . . .39 Viewing and Changing a Site . . . . . . . . . . . . . . . . .39 Utilities . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 Using the Flip Display . . . . . . . . . . . . . . . . . . . . . . 44 Selecting a Basic Zone Bank . . . . . . . . . . . . . . . . . 44 Selecting an Enhanced Zone Bank . . . . . . . . . . . . 45 Selecting the Power Level . . . . . . . . . . . . . . . . . . . 46 Controlling the Display Backlight . . . . . . . . . . . . . . 46 Turning Voice Mute On or Off . . . . . . . . . . . . . . . . 47 Using the Time-Out Timer . . . . . . . . . . . . . . . . . . . 47 Using the Conventional Squelch Operation Features . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 Viewing the Current Site . . . . . . . . . . . . . . . . . . . . 39 Changing the Current Site . . . . . . . . . . . . . . . . . . . 39 Analog Options . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 Digital Options . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 Mission Critical Wireless - Bluetooth - . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 Turning On Bluetooth . . . . . . . . . . . . . . . . . . . . . . .40 Turning Off Bluetooth . . . . . . . . . . . . . . . . . . . . . . .40 Re-Pair Timer . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40 Bluetooth Drop Timer . . . . . . . . . . . . . . . . . . . . . . .41 Using the PL Defeat Feature . . . . . . . . . . . . . . . . . Using the Digital PTT ID Feature . . . . . . . . . . . . . . Using the Smart PTT Feature (Conventional Only) Voice Announcement . . . . . . . . . . . . . . . . . . . . . . . Contents Secure Operations . . . . . . . . . . . . . . . . . . . . . . . . . 34 Selecting Secure Transmissions . . . . . . . . . . . . . . .34 Selecting Clear Transmissions . . . . . . . . . . . . . . . .34 Managing Encryption . . . . . . . . . . . . . . . . . . . . . . .35 Pairing Bluetooth Device with the Radio . . . . . . . . 42 Indicating Bluetooth Connection is Lost . . . . . . . . . 43 Turning On the Bluetooth Audio (Routing the Audio from the Radio to the Headset) . . . . . . . . . . . . . . . 43 Turning Off the Bluetooth Audio (Routing the Audio from the Headset to the Radio) . . . . . . . . . . . . . . . 43 Adjusting the Volume of the Radio from Bluetooth Audio Device . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 49 49 49 50 English Helpful Tips . . . . . . . . . . . . . . . . . . . . . . . . . . . .52 Caring for Your Radio . . . . . . . . . . . . . . . . . . . . . . . 52 Cleaning Your Radio . . . . . . . . . . . . . . . . . . . . . . . 53 Handling Your Radio . . . . . . . . . . . . . . . . . . . . . . . 53 Servicing Your Radio . . . . . . . . . . . . . . . . . . . . . . . 54 Appendix: Maritime Radio Use in the VHF Frequency Range . . . . . . . . . . . . . . . . . . . . . . 57 Special Channel Assignments . . . . . . . . . . . . . . . . 57 Emergency Channel . . . . . . . . . . . . . . . . . . . . . . . .57 Non-Commercial Call Channel . . . . . . . . . . . . . . . .57 Taking Care of the Battery . . . . . . . . . . . . . . . . . . . 54 Checking the Battery Charge Status . . . . . . . . . . . 54 Operating Frequency Requirements . . . . . . . . . . . 58 LED and Sounds . . . . . . . . . . . . . . . . . . . . . . . . . . 54 Fuel Gauge Icon . . . . . . . . . . . . . . . . . . . . . . . . . . 54 Glossary . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 Battery Recycling and Disposal . . . . . . . . . . . . . . . 55 Commercial Warranty . . . . . . . . . . . . . . . . . . . 64 Contents Accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . .56 vi English Software Version Product Safety and RF Exposure Compliance All the features described in the following sections are supported by the radio's software version R05.00.00 or later. Caution Before using this product, read the operating instructions for safe usage contained in the Product Safety and RF Exposure booklet enclosed with your radio. Check with your dealer or system administrator for more details of all the features supported. )&&DQG,QGXVWU\&DQDGD1RWLFHWR8VHUV ATTENTION! This radio is restricted to occupational use only to satisfy FCC RF energy exposure requirements. Before using this product, read the RF energy awareness information and operating instructions in the Product Safety and RF Exposure booklet enclosed with your radio (Motorola Publication part number 6881095C98) to ensure compliance with RF energy exposure limits. For a list of Motorola-approved antennas, batteries, and other accessories, visit the following website: 7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&& UXOHVDQG566RIWKH,QGXVWU\&DQDGDUXOHV SHUWKHFRQGLWLRQVOLVWHGEHORZ 7KLVGHYLFHPD\QRWFDXVHKDUPIXOLQWHUIHUHQFH 7KLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHG LQFOXGLQJLQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHG RSHUDWLRQ &KDQJHVRUPRGLILFDWLRQVPDGHWRWKLVGHYLFHQRW Important Safety Information Important Safety Information H[SUHVVO\DSSURYHGE\0RWRURODFRXOG YRLGWKHXVHU VDXWKRULW\WRRSHUDWHWKLVHTXLSPHQW http://www.motorola.com/governmentandenterprise vii English Computer Software Copyrights Computer Software Copyrights Documentation Copyrights The Motorola products described in this manual may include copyrighted Motorola computer programs stored in semiconductor memories or other media. Laws in the United States and other countries preserve for Motorola certain exclusive rights for copyrighted computer programs, including, but not limited to, the exclusive right to copy or reproduce in any form the copyrighted computer program. Accordingly, any copyrighted Motorola computer programs contained in the Motorola products described in this manual may not be copied, reproduced, modified, reverse-engineered, or distributed in any manner without the express written permission of Motorola. Furthermore, the purchase of Motorola products shall not be deemed to grant either directly or by implication, estoppel, or otherwise, any license under the copyrights, patents or patent applications of Motorola, except for the normal non-exclusive license to use that arises by operation of law in the sale of a product. No duplication or distribution of this document or any portion thereof shall take place without the express written permission of Motorola. No part of this manual may be reproduced, distributed, or transmitted in any form or by any means, electronic or mechanical, for any purpose without the express written permission of Motorola. viii English Disclaimer The information in this document is carefully examined, and is believed to be entirely reliable. However, no responsibility is assumed for inaccuracies. Furthermore, Motorola reserves the right to make changes to any products herein to improve readability, function, or design. Motorola does not assume any liability arising out of the applications or use of any product or circuit described herein; nor does it cover any license under its patent rights, nor the rights of others. Getting Started How to Use This Guide . . . . . . . . . . . . . . . . . . . . . . . . . page 1 Notations Used in This Manual . . . . . . . . . . . . . . . . . . . page 1 Additional Performance Enhancement . . . . . . . . . . . . . page 2 What Your Dealer/System Administrator Can Tell You. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 3 How to Use This Guide This User Guide covers the basic operation of the APX⢠6000 Portables. However, your dealer or system administrator may have customized your radio for your specific needs. Check with your dealer or system administrator for more information. Throughout the text in this publication, you will notice the use of WARNING, Caution, and Note. These notations are used to emphasize that safety hazards exist, and the care that must be taken or observed. An operational procedure, practice, or condition, etc., which may result in injury or death if not carefully observed. An operational procedure, practice, or condition, etc., which may result in damage to the equipment if not carefully observed. WARNING Caution Note: Getting Started Take a moment to review the following: Notations Used in This Manual An operational procedure, practice, or condition, etc., which is essential to emphasize. English Additional Performance Enhancement The following are some of the latest creations designed to enhance the security, quality and efficiency of APX radios. Dynamic System Resilience (DSR) DSR ensures the radio system is seamlessly switched to a backup master site dynamically in case of system failure. DSR also provides additional indication e.g. failure detection, fault recovery, and redundancy within the system to address to the user in need. Mechanisms related to the Integrated Voice and Data (IV & D) or data centric are all supported by DSR. Getting Started CrossTalk Prevention This feature prevents crosstalk scenario from happening, especially when a wideband antenna is used. This feature allows the adjustment of the Trident Transmitting SSI clock rate in the radio to be varied from the Receiving Frequency. This subsequently reduced the possibilities of radio frequency interfering spurs and prevents the issues of crosstalk. English Encrypted Integrated Data (EID) EID provides security encryption and authentication of IV & D data bearer service communication between the radio and the Customer Enterprise Network. SecureNet SecureNet allows user to perform secured communications on an Analog or Motorola Data Communication (MDC) channel. The MDC OTAR feature will allow users to perform OTAR activities on an MDC channel. What Your Dealer/System Administrator Can Tell You Preparing Your Radio for Use You can also consult your dealer or system administrator about the following: ⢠Is your radio preprogrammed with any preset conventional channels? ⢠Which buttons have been preprogrammed to access other features? ⢠What optional accessories may suit your needs? Charging the Battery . . . . . . . . . . . . . . . . . . . . . . . . . . . page 4 Battery Charger . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 4 Attaching the Battery . . . . . . . . . . . . . . . . . . . . . . . . . . . page 4 Attaching the Antenna . . . . . . . . . . . . . . . . . . . . . . . . . . page 5 Attaching the Belt Clip . . . . . . . . . . . . . . . . . . . . . . . . . . page 6 Attaching the Accessory Connector Cover . . . . . . . . . . page 6 Turning On the Radio . . . . . . . . . . . . . . . . . . . . . . . . . . . page 7 Adjusting the Volume . . . . . . . . . . . . . . . . . . . . . . . . . . . page 8 Preparing Your Radio for Use Assemble your radio by following these steps: Check with your dealer or system administrator, if the radio is to be operated in extremely cold temperatures (less than -20 °C), for the correct radio settings to ensure proper top display operation. English Charging the Battery To avoid a possible explosion: Preparing Your Radio for Use WARNING ⢠DO NOT replace the battery in any area labeled âhazardous atmosphereâ. ⢠DO NOT discard batteries in a fire. The Motorola-approved battery shipped with your radio is uncharged. Prior to using a new battery, charge it for a minimum of 16 hours to ensure optimum capacity and performance. For a list of Motorola-authorized batteries available for use with your radio, see Accessories on page 56. Note: When charging a battery attached to a radio, turn the radio off to ensure a full charge. Battery Charger To charge the battery, place the battery, with or without the radio, in a Motorola-approved charger. The chargerâs LED indicates the charging progress; see your chargerâs user guide. For a list of chargers, see Accessories on page 56. English Attaching the Battery With the radio turned off, slide the battery into the radioâs frame until side latches click into place. Battery Latch Attaching the Antenna With the radio turned off, set the antenna in its receptacle and turn clockwise to attach it to the radio. Note: If your radio is preprogrammed with volatile-key retention, the encryption keys are retained for approximately 30 seconds after battery removal. Check with your dealer or system administrator for more information. Preparing Your Radio for Use To remove the battery, turn the radio off. Squeeze the release latches on the bottom of the battery until the battery releases from the radio. Remove the battery from the radio. To remove the antenna, turn the antenna counterclockwise. Make sure you turn off the radio first. English Attaching the Accessory Connector Cover The accessory connector is located on the antenna side of the radio. It is used to connect accessories to the radio. Preparing Your Radio for Use Note: To prevent damage to the connector, shield it with the connector cover when not in use. Insert the hooked end of the cover into the slot above the connector. Press downward on the coverâs top to seat it in the slot. Once in place, rotate the thumbscrew clockwise by hand until tight. Align the grooves of the belt clip with those of the radio and press upward until you hear a click. Hooked End Thumbscrew Hex Socket ead To remove the accessory connector cover, rotate the thumbscrew counterclockwise until it disengages from the radio. If the thumbscrew is too tight, use an Allen wrench to loosen it first. Rotate and lift the connector cover to disengage it from the radio. English Attaching the Belt Clip To remove the clip, use a flat-bladed object to press the belt clip tab away from the radio. Then, slide the clip downward and away from the radio. Turning On the Radio To turn off the radio, rotate the On/Off/Volume Control Knob counterclockwise until you hear a click. If the power-up test is successful, you see SELFTEST on the radioâs display momentarily, followed by the Home screen. Note: Preparing Your Radio for Use Rotate the On/Off/Volume Control Knob clockwise until you hear a click. If the power-up test is unsuccessful, you see ERROR XX/YY (XX/YY is an alphanumeric code). Turn off the radio, check the battery, and turn the radio back on. If the radio fails the power-up test again, record the ERROR XX/YY code and contact your dealer. English Adjusting the Volume Identifying Radio Controls Identifying Radio Controls To increase the volume, turn the On/Off/Volume Control Knob clockwise. Take a moment to review the following: Radio Parts and Controls. . . . . . . . . . . . . . . . . . . . . . . . page 9 Programmable Features . . . . . . . . . . . . . . . . . . . . . . . page 10 Assignable Radio Functions. . . . . . . . . . . . . . . . . . . page 10 Assignable Settings or Utility Functions . . . . . . . . . . page 11 Accessing the Preprogrammed Functions. . . . . . . . . . page 11 Push-To-Talk (PTT) Button . . . . . . . . . . . . . . . . . . . . . page 12 Main Speaker To decrease the volume, turn this knob counterclockwise. Note: English Ensure that the main speaker is pointed towards you for increased loudness and intelligibility, especially in areas with loud background noises. Radio Parts and Controls 8 LED 16-Position 3-Position A/B/C Switch* 9 Select Knob* Top 19 Display On/Off/Volume 10 Control Knob Top (Orange) 2 Button* 18 Microphone 2-Position Concentric 6 Switch* Top Side (Select) 11 Button* Main 16 Speaker 3 Microphone Push-to-Talk 12 (PTT) Button Identifying Radio Controls 1 Antenna Accessory 4 Connector 5 Battery Latch 13 Side Button 1* 14 Side Button 2* Bluetooth 17 Pairing Indicator 15 Battery * These radio controls/buttons are programmable. English Programmable Features Any reference in this manual to controls that are âpreprogrammedâ means that a qualified radio technician must use the radioâs programming software to assign a feature to a control. Identifying Radio Controls Your dealer can program the programmable buttons as shortcuts to radio functions or preset channels/groups depending on the duration of a button press: 10 ⢠Press â Pressing and releasing rapidly. ⢠Long press â Pressing and holding for the preprogrammed duration (between 0.25 seconds and 3.75 seconds). ⢠Hold down â Keeping the button pressed. Assignable Radio Functions Bluetooth On/Off â Allows you to turn on/off the Bluetooth. Dynamic Priority (Conventional Only) â Allows any channel in a scan list (except for the Priority-One channel) to temporarily replace the Priority-Two channel. Emergency â Depending on the programming, initiates or cancels an emergency alarm or call. Internet Protocol â Displays the Internet Protocol (IP) address, device name and status of the radio. Monitor (Conventional Only) â Monitors a selected channel for all radio traffic until function is disabled. Nuisance Delete â Temporarily removes an unwanted channel, except for priority channels or the designated transmit channel, from the scan list. One Touch 1 â 4 â Launches a specific feature with one single button-press. You can setup as much as four separately programmed buttons for four different features. Private Line Defeat (Conventional Only) â Overrides any coded squelch (DPL or PL) that is preprogrammed to a channel. Bluetooth Audio Reroute â Allows you to toggle the audio route between radio speaker or Remote Speaker Microphone and Bluetooth headset. Rekey Request â Notifies the dispatcher that you require a new encryption key. Bluetooth Headset PTT â Function like a PTT button, but is used to keyup the Bluetooth Headset's microphone. Repeater Access Button (RAB) (Conventional Only) â Allows to manually send a repeater access codeword. Bluetooth Clear All Pairing â Allows you to clear all pairing info for Bluetooth. Reprogram Request (Trunking Only) â Notifies the dispatcher that you want a new dynamic regrouping assignment. Call Response â Allows you to answer a private call. English Voice Announcement â Audibly indicates the current feature mode, Zone or Channel the user has just assigned. Scan â Toggles scan on or off. Voice Mute â Toggles voice mute on or off. Scan List Programming â Selects the scan list for editing. Volume Set â Sets the volume set tone. Secure/Clear â Toggles secure operation on or off. Site Display (Trunking Only) â Displays the current site ID and RSSI value. Site Lock/Unlock (Trunking Only) â Locks onto a specific site. Site Search (Trunking Only) â Performs site search for AMSS (Automatic Multiple Site Select) or SmartZone operation. Talkaround/Direct (Conventional Only) â Toggles between using a repeater and communicating directly with another radio. Basic Zone Bank â Allows selection from a larger list of zones. Accessing the Preprogrammed Functions You can access various radio functions through a short or long press of the relevant programmable buttons. Identifying Radio Controls Request-To-Talk (Conventional Only) â Notifies the dispatcher that you want to send a voice call. Enhanced Zone Bank â Allows selection from a list of banks with three different zones in each bank. Assignable Settings or Utility Functions Flip â Flips the content of the top display. Light â Toggles display backlight on or off. TX Power Level â Toggles transmit power level between high and low. 11 English Push-To-Talk (PTT) Button The PTT button on the side of the radio serves two basic purposes: Your radio indicates its operational status through the following: Status Icons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 12 LED Indicator . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 14 Intelligent Lighting Indicators . . . . . . . . . . . . . . . . . . . . page 15 Alert Tones. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 16 ⢠While a call is in progress, Identifying Status Indicators the PTT button allows the radio to transmit to other radios in the call. Press and hold down PTT button to talk. Release the PTT button to listen. The microphone is activated when the PTT button is pressed. ⢠While a call is not in progress, the PTT button is used to make a new call. See Making a Radio Call on page 23 for more information. 12 English Identifying Status Indicators PTT Button Status Icons The 112 x 32 pixel top monochrome display screen of your radio shows the radio status and operating conditions. Battery The icon shown indicates the charge remaining in the battery. Blinks when the battery is low. Received Signal Strength Indicator (RSSI) The number of bars displayed represents the received signal strength for the current site, for trunking only. The more stripes in the icon, the stronger the signal. ⢠On = Radio is currently configured for direct radio to radio communication (during conventional operation only). Top Display ⢠Off = Radio is connected with other radios through a repeater. H L or Monitor (Carrier Squelch) Selected channel is being monitored (during conventional operation only). View/Program Mode Radio is in the view or program mode. ⢠On steady = View mode ⢠Blinking = Program mode Basic Zone Bank 1 A B â˘â˘ C ⢠or Power Level ⢠L = Radio is set at Low power. or A = Radio is in Zone 1. B = Radio is in Zone 2. C = Radio is in Zone 3. ⢠H = Radio is set at High power. Basic Zone Bank 2 Scan Radio is scanning a scan list. D E â˘â˘ F ⢠or or Vote Scan Enabled The vote scan feature is enabled. Priority Channel Scan D = Radio is in Zone 4. Identifying Status Indicators Direct E = Radio is in Zone 5. F = Radio is in Zone 6. ⢠Blinking dot = Radio detects activity on channel designated as PriorityOne. ⢠Steady dot = Radio detects activity on channel designated as Priority-Two. 13 English AB x y ... ... Identifying Status Indicators or 14 English Enhanced Zone Bank A = Contains Zone 1, Zone 2 and Zone 3, B = Contains Zone 4, Zone 5 and Zone 6, C = Contains Zone 7, Zone 8 and Zone 9, X = Contains Zone 70, Zone 71 and Zone 72, Y = Contains Zone 73, Zone 74 and Zone 75. Secure Operation LED Indicator The LED indicator shows the operational status of your radio. Solid red â Radio is transmitting. Blinking red â Radio is transmitting at low battery condition. ⢠Off = Clear operation. Rapidly blinking red â Radio has failed the self test upon powering up or encountered a fatal error. ⢠Blinking = Receiving an encrypted voice call. Solid yellow â Channel is busy. ⢠On = Secure operation. Bluetooth On Bluetooth is on and ready for bluetooth connection. Bluetooth Connected Bluetooth is currently connected to the external bluetooth device. LED Indicator Blinking yellow â Radio is receiving a secured transmission. Solid green â Radio is powering up, or is on a non-priority channel while in the Scan List Programming mode. Blinking green â Radio is receiving an individual or telephone call, or is on a Priority-Two channel while in the Scan List Programming mode. Rapidly blinking green â Radio is on a Priority-One channel while in the Scan List Programming mode. Intelligent Lighting Indicators Note: This feature must be preprogrammed by a qualified radio technician. Backlight Notification Orange Emergency Alerts When The radio initiates an emergency alarm or call. The radio receives an emergency alarm or call. The radio battery is low. The radio is out of range. Red Critical Alerts The radio enters failsoft mode. The radio is unable to establish a full connection with the system. The radio is unable to authenticate or register with the system. The radio receives a private call. Green Call Alerts Identifying Status Indicators This feature temporary changes the backlight of the top display screen to help signal that a radio event has occurred. The radio receives a phone call. The radio receives a call alert. The radio receives a selective call. 15 English Alert Tones An alert tone is a sound or group of sounds. Your radio uses alert tones to inform you of your radioâs conditions. The following table lists these tones and when they occur. Identifying Status Indicators You Hear 16 English Short, Low-Pitched Tone Tone Name Radio Self Test Fail When radio fails its power-up self test. Reject When unauthorized request is made. Time-Out Timer Warning No ACK Received Individual Call Warning Tone Long, Low-Pitched Tone A Group of Low-Pitched Tones Heard Time-Out Timer Timed Out Talk Prohibit/PTT Inhibit Four seconds before time out. When radio fails to receive an acknowledgment. When radio is in an individual call for greater than 6 seconds without any activity. After time out. (When PTT button is pressed) transmissions are not allowed. Out of Range (When PTT button is pressed) the radio is out of range of the system. Invalid Mode When radio is on an unpreprogrammed channel. Busy When the system is busy. You Hear Tone Name Radio Self Test Pass Short, Medium-Pitched Tone Clear Voice Priority Channel Received Emergency Alarm Entry Central Echo Long, Medium-Pitched Tone Volume Set Emergency Exit Failsoft Automatic Call Back A Group of Medium-Pitched Tones Talk Permit Keyfail Console Acknowledge When correct key is pressed. When radio passes its power-up self test. At beginning of a non-coded communication. When activity on a priority channel is received. When entering the emergency state. When central controller has received a request from a radio. When volume is changed on a quiet channel. When exiting the emergency state. When the trunking system fails. When voice channel is available from previous request. (When PTT button is pressed) verifying system accepting transmissions. When encryption key has been lost. Identifying Status Indicators Valid Key-Press Heard When emergency alarm, or reprogram request ACK is received. Received Individual Call When Call Alert or Private Call is received. Site Trunking When a SmartZone trunking system fails. 17 English You Hear Tone Name Short, High-Pitched Tone (Chirp) Low-Battery Chirp Fast Ringing Identifying Status Indicators Ringing Heard When battery is below preset threshold value. When system is searching for target of Private Call. Enhanced Call Sent When waiting for target of Private Call to answer the call. Phone Call Received When a land-to-mobile phone call is received. Gurgle Dynamic Regrouping (When the PTT button is pressed) a dynamic ID has been received. Unique, Low-Pitched Chirp New Message When a new message is received. Unique, High-Pitched Chirp Priority Status When a priority message is received. IncrementalPitched Tone DecrementalPitched Tone 18 English Bluetooth Paired Tone When Bluetooth accessory is paired with the radio. Bluetooth Connected Tone When Bluetooth accessory is connected to the radio. Bluetooth Unpaired Tone When Bluetooth accessory is unpaired from the radio. Bluetooth Disconnected Tone When Bluetooth accessory is disconnected from the radio. General Radio Operation General Radio Operation Once you understand how your APX 6000 Portable is configured, you are ready to use your radio. Selecting a Zone A zone is a group of channels. Use this navigation guide to familiarize yourself with the basic Call features: 3-Position A/B/C Switch Selecting a Zone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 19 Selecting a Radio Channel . . . . . . . . . . . . . . . . . . . . . page 20 Receiving and Responding to a Radio Call . . . . . . . . . page 20 Making a Radio Call . . . . . . . . . . . . . . . . . . . . . . . . . . page 23 Repeater or Direct Operation . . . . . . . . . . . . . . . . . . . page 23 Monitoring Features. . . . . . . . . . . . . . . . . . . . . . . . . . . page 24 Use the following procedure to select a zone. Note: Your radio must be preprogrammed to allow you to use this feature. Procedure: 1 Move the preprogrammed Zone (3-Position A/B/C) switch to the position of the required zone. 2 Press the PTT button to transmit on the displayed zone channel. 19 English Selecting a Radio Channel A channel is a group of radio characteristics, such as transmit/ receive frequency pairs. Receiving and Responding to a Radio Call Once you have selected the required channel and/or zone, you can proceed to receive and respond to calls. General Radio Operation LED Indicator Use the following procedure to select a channel. Note: Your radio must be preprogrammed to allow you to use this feature. If you select a channel that is not within the preprogrammed band, the radio indicates that it is on an unsupported frequency with an audio warning. Procedure: 1 Turn the preprogrammed 16-Position Select knob to the desired channel. 2 Press the PTT button to transmit on the displayed zone 20 channel. English The LED lights up solid red while the radio is transmitting, and solid yellow when the radio is receiving a transmission (conventional mode only). There is no LED indication when the radio receives a transmission in trunking mode. If the radio is receiving a secure transmission, the LED blinks yellow. Receiving and Responding to a Talkgroup Call Procedure: When you receive a talkgroup call (while on the Home screen), depending on how your radio is preprogrammed: 1 ASTRO Conventional Only: The LED lights up solid yellow. OR Trunking Only: The display shows the caller alias or ID. 2 Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from your mouth. 3 Press the PTT button to respond to the call. The LED lights up solid red. 4 Release the PTT button to listen. See Making a Talkgroup Call on page 23 for details on making a Talkgroup Call. (Trunking Only) A Private Call is a call from an individual radio to another individual radio. These one-to-one calls between two radios are not heard by others in the current talkgroup. The calling radio automatically verifies that the receiving radio is active on the system and can display the callerâs ID. Note: The radio automatically exits the feature, if the feature inactivity timer is enabled, when the radio is left idle and the timer expires. You will hear the Inactive Exit Tone upon feature exit. Procedure: When you receive a Private Call: General Radio Operation To receive a call from a group of users, your radio must be configured as part of that talkgroup. Receiving and Responding to a Private Call 1 You hear two alert tones and the LED blinks green. The backlight of the screen turns green and the display shows CALL RCV, alternating with the caller alias (name) or ID (number). 21 English 2 Press the Call Response button within 20 seconds after the call indicators begin. 3 Press and hold the PTT button to talk. Release the PTT button to listen. 4 Press the Call Response button to hang up and return to the Home screen. Procedure: When you receive a Telephone Call: 1 You hear a telephone-type ringing and the LED blinks green. The backlight of the screen turns green and the display shows PHN CALL. 2 Press the Call Response button within 20 seconds after the call indicators begin. You cannot initiate a Private Call. General Radio Operation Receiving and Responding to a Telephone Call (Trunking Only) This feature allows you to receive calls similar to standard phone calls from a landline phone. Note: 22 English The radio automatically exits the feature, if the feature inactivity timer is enabled, when the radio is left idle and the timer expires. You will hear the Inactive Exit Tone upon feature exit. 3 Press and hold the PTT button to talk. Release the PTT button to listen. 4 Press the Call Response button to hang up and return to the Home screen. You cannot initiate a Telephone Call. Making a Radio Call ⢠The preprogrammed Zone switch ⢠The Channel Selector Knob Making a Talkgroup Call To make a call to a group of users, your radio must be configured as part of that talkgroup. Procedure: 1 Turn the Channel Selector Knob to select the channel with the desired talkgroup. 2 Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from your mouth. 3 Press the PTT button to make the call. The REPEATER operation increases the radioâs range by connecting with other radios through a repeater. The transmit and receive frequencies are different. The DIRECT or âtalkaround operationâ allows you to bypass the repeater and connect directly to another radio. The transmit and receive frequencies are the same. Procedure: 1 Press the preprogrammed Repeater/Direct switch to toggle between talkaround and repeater modes. 2 The display shows RPTR MOD if the radio is currently in Repeater mode. OR The display shows DIR MODE and the Talkaround icon if the radio is currently in Direct mode (during conventional operation only). General Radio Operation You can select a zone, channel, or talkgroup by using: Repeater or Direct Operation 4 ASTRO Conventional Only: The LED lights up solid red. The display shows the talkgroup alias or ID. OR Trunking Only: The LED lights up solid red. 5 Speak clearly into the microphone. 6 Release the PTT button to listen. 23 English Monitoring Features General Radio Operation Radio users who switch from analog to digital radios often assume that the lack of static on a digital channel is an indication that the radio is not working properly. This is not the case. Digital technology quiets the transmission by removing the ânoiseâ from the signal and allowing only the clear voice or data information to be heard. 24 Conventional Mode Operation Your radio may be preprogrammed to receive Private-LineÂŽ (PL) calls. Procedure: 1 Momentarily press the Monitor button to listen for activity. The Carrier Squelch indicator appears on the display. Use the Monitor feature to make sure a channel is clear before transmitting. 2 Press and hold the Monitor button to set continuous Monitoring a Channel 3 Press the Monitor button again, or the PTT button, to return Procedure: 1 Press the preprogrammed Monitor button. 2 Press and hold the Volume Set button to hear the volume set tone. 3 Adjust the Volume Control knob if necessary. 4 Release the Volume Set button. 5 Press and hold the PTT button to transmit. The LED lights up solid red. 6 Release the PTT button to receive (listen). The Carrier Squelch indicator appears on the display when you monitor a channel via the preprogrammed Monitor button. English monitor operation. The duration of the button press is programmable. to the original squelch setting. If you try to transmit on a receive-only channel, you hear an invalid tone until you release the PTT button. Advanced Features Receiving and Responding to a Selective Call (ASTRO Conventional Only) This feature allows you to receive a call from or to call a specific individual. It is intended to provide privacy and to eliminate the annoyance of having to listen to conversations that are of no interest to you. Procedure: 1 When you receive a Selective Call, you hear two alert tones and the LED lights up solid yellow. The backlight of the screen momentarily turns green and the display briefly shows CALL RCV. Advanced Features Use this navigation guide to learn more about advanced features available with your radio: Advanced Call Features . . . . . . . . . . . . . . . . . . . . . . . page 25 Scan Lists . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 27 Scan . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 28 Call Alert Paging . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 30 Emergency Operation . . . . . . . . . . . . . . . . . . . . . . . . . page 30 Secure Operations. . . . . . . . . . . . . . . . . . . . . . . . . . . . page 34 Trunking System Controls . . . . . . . . . . . . . . . . . . . . . . page 38 Mission Critical Wireless - Bluetooth - . . . . . . . . . . . . . page 40 Utilities . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . page 44 Advanced Call Features 2 The speaker unmutes. 3 Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from your mouth. 4 Press and hold the PTT button to talk. Release the PTT button to listen. You cannot initiate a Selective Call. 25 English Using the Dynamic Regrouping Feature (Trunking Only) This feature allows the dispatcher to temporarily reassign selected radios to a single special channel so they can communicate with each other. This feature is typically used during special operations and is enabled by a qualified radio technician. You will not notice whether your radio has this feature enabled until a dynamic regrouping command is sent by the dispatcher. Advanced Features Note: If you try to access a zone or channel that has been reserved by the dispatcher as a dynamically regrouped mode for other users, an invalid tone sounds. Procedure: 1 When your radio is dynamically regrouped, it automatically switches to the dynamically regrouped channel. A âgurgleâ tone sounds and the display shows the dynamically regrouped channelâs name. 2 Press the PTT button to talk. Release PTT button to listen. When the dispatcher cancels dynamic regrouping, the radio automatically returns to the zone and channel that you were using before the radio was dynamically regrouped. 26 English Requesting a Reprogram (Trunking Only) This feature lets you notify the dispatcher that you want a new dynamic regrouping assignment. Procedure: 1 Press the preprogrammed Reprogram Request button to send reprogram request to the dispatcher. 2 The display alternates between RPGM and PLS WAIT. 3 If you hear five beeps, the dispatcher has acknowledged the reprogram request. The display shows ACK RCVD and the radio returns to the Home screen. OR If the dispatcher does not acknowledge the reprogram request within six seconds, a low-pitched alert tone sounds and the display shows NO ACK. The radio returns to the Home screen. Classifying Regrouped Radios ⢠Select-enabled radios are free to change to any available channel, including the dynamic-regrouping channel, once the user has selected the dynamic-regrouping position. ⢠Select-disabled radios cannot change channels while dynamically regrouped. The dispatcher has forced the radio to remain on the dynamic-regrouping channel. The Scan or Private Call feature cannot be selected while your radio is Select Disabled. Scan lists are created and assigned to individual channels/ groups. Your radio scans for voice activity by cycling through the channel/group sequence specified in the scan list for the current channel/group. Your radio supports different types of Scan Lists: ⢠Trunking Priority Monitor Scan List ⢠Conventional Scan List ⢠Talkgroup Scan List A maximum of 200 Scan Lists can be programmed in your radio. These lists must be preprogrammed by a qualified radio technician. Advanced Features The dispatcher can classify regrouped radios into either of two categories: Select Enabled or Select Disabled. Scan Lists Viewing a Scan List Procedure: Turn the 16-Position Select knob to view the members on the list. 27 English Viewing and Changing the Priority Status Procedure: 1 Press the Top Side (Select) button to change the priority status of the currently displayed channel or the scan list status icon of the currently displayed channel. Advanced Features 2 A Scan icon indicates that the current channel is in the scan list as a non-priority channel. The LED lights up solid green. OR A Priority-Two Channel Scan icon indicates that the current channel is in the scan list as the Priority-Two channel. The LED blinks green. OR A Priority-One Channel Scan icon indicates that the current channel is in the scan list as the Priority-One channel. The LED rapidly blinks green. You hear all traffic on the PriorityOne channel, regardless of traffic on non-priority channels. OR No icon indicates that the current channel is deleted from the scan list. 28 English Scan This feature allows you to monitor traffic on different channels by scanning a preprogrammed list of channels. Turning Scan On or Off Procedure: 1 Press the preprogrammed Scan button, or turn the preprogrammed Scan switch to the Scan on or Scan off position. 2 The display shows SCAN ON and the scan icon, indicating that scan is enabled. OR The display shows SCAN OFF, indicating that scan is disabled. Making a Dynamic Priority Change (Conventional Note: Scan Only) This change remains in effect until scan is turned off. Scan then reverts to the preprogrammed (original) setting. Procedure: 1 When the radio locks onto the channel designated as the new Priority-Two channel, press the preprogrammed Dynamic Priority button. 2 The radio continues scanning the remaining channels in the list. Deleting a Nuisance Channel If a channel continually generates unwanted calls or noise (termed a ânuisanceâ channel), you can temporarily remove the unwanted channel from the scan list. Procedure: 1 When the radio is locked onto the channel to be deleted, press the preprogrammed Nuisance Delete button. 2 The radio continues scanning the remaining channels in the list. Restoring a Nuisance Channel Procedure: To restore the deleted nuisance channel, do one of the following: Advanced Features While the radio is scanning, the dynamic priority change feature allows you to temporarily assign any channel in a scan list (except for the Priority-One channel) as the Priority-Two channel. Deleting a ânuisanceâ channel is only possible through the preprogrammed Nuisance Channel Delete button. ⢠Turn the radio off and then turning it on again. OR ⢠Stop and restart a scan via the preprogrammed Scan button. OR ⢠Change the channel via the 16-Position Select knob. This capability does not apply to priority channels or the designated transmit channel. 29 English Call Alert Paging This feature allows your radio to work like a pager. The Emergency feature is used to indicate a critical situation. Note: If the Top (Orange) button is preprogrammed to send an emergency signal, this signal overrides any other communication over the selected channel. This feature must be preprogrammed by a qualified radio technician. Receiving a Call Alert Page Procedure: 1 When you receive a Call Alert page, you hear four repeating alert tones and the LED blinks green. 2 The backlight of the screen turns green and the display briefly shows PAGE RCV. Advanced Features Emergency Operation You cannot send a Call Alert page. 30 English Your radio supports the following Emergency modes: ⢠Emergency Alarm ⢠Emergency Call (Trunking Only) ⢠Emergency Alarm with Emergency Call ⢠Silent Emergency Alarm Check with your dealer or system administrator for more information on the programming of this feature. Only one of the Emergency modes above can be assigned to the preprogrammed Emergency button. Note: To exit emergency at any time, press and hold the preprogrammed Emergency button for about a second. Sending an Emergency Call (Trunking Only) This feature allows you to send a data transmission, which identifies the radio sending the emergency, to the dispatcher. This feature gives your radio priority access on a channel. Procedure: 1 Press the preprogrammed Emergency button. 2 The display shows EMERGNCY and the current zone or channel. A short, medium-pitched tone sounds and the LED rapidly blinks red. OR An invalid tone sounds, if the selected channel does not support emergency. 3 When you receive the dispatcherâs acknowledgment, the display shows ACK RCVD. Four tones sound, the alarm ends, and the radio exits the Emergency Alarm mode. OR If no acknowledgement is received, the display shows NO ACK. The alarm ends and the radio exits the Emergency Alarm mode. Note: The radio operates in the normal dispatch manner while in Emergency Call, except, if enabled, it returns to one of the following: ⢠Tactical/Non-Revert â You talk on the channel you selected before you entered the emergency state. ⢠Non-Tactical/Revert â You talk on a preprogrammed emergency channel. The emergency alarm is sent on this same channel. Procedure: 1 Press the preprogrammed Emergency button. Advanced Features Sending an Emergency Alarm 2 The display shows EMERGNCY and the current zone or channel. A short, medium-pitched tone sounds and the LED rapidly blinks red. OR An invalid tone sounds, if the selected channel does not support emergency. 31 English 3 Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from your mouth. 4 Press and hold the PTT button. Speak clearly into the microphone. 5 Release the PTT button to end the transmission and wait for a response from the dispatcher. 6 Press and hold the preprogrammed Emergency button for about a second to exit the Emergency Call mode. Sending an Emergency Alarm with Emergency Call Advanced Features Procedure: 1 Press the preprogrammed Emergency button. 2 The display shows EMERGNCY and the current zone or channel. A short, medium-pitched tone sounds and the LED rapidly blinks red. OR An invalid tone sounds, if the selected channel does not support emergency. 32 English 3 The radio enters the Emergency Call state when: You receive the dispatcherâs acknowledgment. The display shows ACK RCVD. OR You receive no acknowledgement. The display shows NO ACK. OR You press the PTT button while in the Emergency Alarm mode. 4 Hold the radio vertically 1 to 2 inches (2.5 to 5.0 cm) from your mouth. 5 Press and hold the PTT button. Speak clearly into the microphone. 6 Release the PTT button to end the transmission and wait for a response from the dispatcher. 7 Press and hold the preprogrammed Emergency button for about a second to exit the Emergency Call mode. Using the Emergency Keep-Alive Feature This feature allows you to send an Emergency Alarm to another radio without any audio or visual indicators. This feature, when enabled, prevents the radio from being turned off via the On/Off Control knob when the radio is in the Emergency state. Procedure: 1 Press the preprogrammed Emergency button. Note: The radio only exits the Emergency state using one of the ways mentioned in the previous sections. 2 The display shows no changes, the LED does not light up, and you hear no tones. 3 The silent emergency state continues until you: Press and hold the preprogrammed Emergency button for about a second to exit the Silent Emergency Alarm mode. OR Press and release the PTT button to exit the Silent Emergency Alarm mode and enter regular dispatch or Emergency Call mode. Note: See Sending an Emergency Alarm on page 31, Sending an Emergency Call (Trunking Only) on page 31, Sending an Emergency Alarm with Emergency Call on page 32, or Sending a Silent Emergency Alarm on page 33. Advanced Features Sending a Silent Emergency Alarm For ALL Emergency signals, when changing channels: ⢠If the new channel is also preprogrammed for Emergency, you can change channels while in Emergency operation. The emergency alarm or call continues on the new channel. ⢠If the new channel is NOT preprogrammed for Emergency, the display shows NO EMERG, and you hear an invalid tone until you exit the Emergency state or change to a channel preprogrammed for Emergency. 33 English Secure Operations Secure radio operation provides the highest commercially available level of voice security on both trunked and conventional channels. Unlike other forms of security, Motorola digital encryption provides signaling that makes it virtually impossible for others to decode any part of an encrypted message. Selecting Secure Transmissions Advanced Features Procedure: Turn the preprogrammed Secure/Clear switch to the secure position. Note: 34 English If the selected channel is preprogrammed for clear-only operation â when you press the PTT button, an invalid mode tone sounds and the display shows CLR TX. The radio will not transmit until you set the Secure/ Clear switch to the clear position. Selecting Clear Transmissions Procedure: Turn the preprogrammed Secure/Clear switch to the clear position. Note: If the selected channel is preprogrammed for secureonly operation â when you press the PTT button, an invalid mode tone sounds and the display shows SEC TX. The radio will not transmit until you set the Secure/ Clear switch to the secure position. Using the Multikey Feature Loading an Encryption Key This feature allows the radio to be equipped with different encryption keys and supports the DES-OFB algorithm. Note: There are two types: Refer to the key-variable loader (KVL) manual for equipment connections and setup. Procedure: 1 Attach the KVL to your radio. 2 The display shows KEYLOAD, and all other radio functions, except for power down, backlight, and volume, are locked out. 3 Select the required keys and press the Menu Select button directly below LOAD on the KVL. This loads the encryption keys into your radio. 4 When the key has been loaded successfully, the radio sounds a short tone for single-key radios. OR When the key has been loaded successfully, the radio sounds an alternating tone for multikey radios. ⢠Conventional Multikey â The encryption keys can be tied (strapped), on a one-per-channel basis, through Customer Programming Software. In addition, you can have operatorselectable keys, operator-selectable keysets, and operatorselectable key erasure. If talkgroups are enabled in conventional, then the encryption keys are strapped to the talkgroups. ⢠Trunked Multikey â If you use your radio for both conventional and trunked applications, you have to strap your encryption keys for trunking on a per-talkgroup or announcement-group basis. In addition, you may strap a different key to other features, such as dynamic regrouping, failsoft, or emergency talkgroup. You can have operatorselectable key erasure. Advanced Features Managing Encryption 35 English Erasing the Selected Encryption Keys This feature allows you to erase all or selected encryption keys. Procedure: Use the preprogrammed Top Side (Select) button and Top (Orange) button to erase the single key in radios with the single-key option, and to erase all keys in radios with the multikey option. 1 Press and hold the Top Side (Select) button. 2 While holding Top Side (Select) button down, press the Top (Orange) button. Requesting an Over-the-Air Rekey (ASTRO Conventional Only) This feature, also known as OTAR, allows the dispatcher to reprogram the encryption keys in the radio remotely. The dispatcher performs the rekey operation upon receiving a rekey request from the user. Procedure: 1 Press and hold the preprogrammed Rekey Request button to send the rekey request. 2 If the rekey operation fails, a bad-key tone sounds and the display shows RKY FAIL. Advanced Features 3 The display shows PLS WAIT. 4 When all the encryption keys have been erased, the display shows ALL ERASED. Note: 36 English DO NOT press the Top (Orange) button before pressing the Top Side (Select) button, unless you are in an emergency situation as this sends an emergency alarm. Note: The rekey operation failure indicates that your radio does not contain the Unique Shadow Key (USK). This key must be loaded into the radio with the key-variable loader (KVL) before the rekey request can be sent. Refer to your local key management supervisor for more information. Hear Clear This feature allows to view or define MDC Over-the-Air Rekeying (OTAR) features.It is applied only when operating in secure encrypted mode and only for conventional communications. In additional to Rekey Requests, OTAR transmissions include Delayed Acknowledgements, and Powerup Acknowledgements. There are two components of Hear Clear. Some of the options selected may also need to be set up at the Key Management Controller (KMC) site to work properly. Note: This feature must be preprogrammed by a qualified radio technician. Check with your dealer or system administrator for more information. 1 Companding: Reduces the channel noise, e.g. OTA transmission, that is predominantly present in UHF2 and 900 MHz channel with the following features. ⢠Compressor â reduces the background noise flow and the speech signal at transmitting radio. ⢠Expander â expands the speech while the noise flow remains the same at receiving radio. 2 Random FM Noise Canceller (Flutter Fighter): Reduces the unwanted effects of random FM noise pulses caused by channel fading under high Signal-to-Noise (S/N) conditions such as in a moving in a transportation. The fading effects, heard as audio pops and clicks, are cancelled without affecting the desired audio signal. Advanced Features MDC Over-the-Air Rekeying (OTAR) Page The Random FM Noise Canceller operates only in receive mode. Note: This feature must be preprogrammed by a qualified radio technician. Check with your dealer or system administrator for more information. 37 English Trunking System Controls Using the Failsoft System The failsoft system ensures continuous radio communications during a trunked system failure. If a trunking system fails completely, the radio goes into failsoft operation and automatically switches to its failsoft channel. Procedure: 1 During failsoft operation, your radio transmits and receives in conventional operation on a predetermined frequency. Advanced Features 2 A medium-pitched tone sounds every 10 seconds and the display shows FAILSOFT. When the trunking system returns to normal operation, your radio automatically leaves failsoft operation and returns to trunked operation. 38 English Going Out of Range When your radio goes out of the range of the system, it can no longer lock onto a control channel. Procedure: 1 A low-pitched tone sounds. AND/OR The display shows the currently selected zone/channel combination and OUT RNG. 2 Your radio remains in this out-of-range condition until: It locks onto a control channel. OR It locks onto a failsoft channel. OR It is turned off. Viewing and Changing a Site If the zone controller loses communication with any site, that site reverts to site trunking. This feature allows you to view the number of the current site or force your radio to change to a new one. The display shows the currently selected zone/channel combination and STE TRNK. Viewing the Current Site Note: When this occurs, you can communicate only with other radios within your trunking site. Locking and Unlocking a Site This feature allows your radio to lock onto a specific site and not roam among wide-area talkgroup sites. This feature should be used with caution, since it inhibits roaming to another site in a wide-area system. Procedure: 1 Use the preprogrammed Site Lock/Unlock button to toggle the lock state between locked and unlocked. 2 The radio saves the new site lock state and returns to the Home screen. Procedure: 1 Press the preprogrammed Site Search button. 2 The display momentarily shows the name of the current site and its corresponding received signal strength indicator (RSSI). Advanced Features Using the Site Trunking Feature Changing the Current Site Procedure: 1 Press and hold down the preprogrammed Site Search button. 2 A tone sounds and the display momentarily shows SCANNING. 3 When the radio finds a new site, it returns to the Home screen. 39 English Mission Critical Wireless - Bluetooth Note: The use of this feature requires the "Full Feature" expansion board and the purchase of the Bluetooth Software. This feature allows the Radio to extend its functionality by connecting to external proprietary Motorola Accessories. The default setting for enabled Bluetooth is Bluetooth ON. See Turning Off Bluetooth on page 40 to turn the Bluetooth OFF. Advanced Features Note: Your radio must be preprogrammed to allow you to use this feature. Turning On Bluetooth Procedure: 1 Press the preprogrammed button to turn on the Bluetooth. 2 A short, medium-pitched tone sounds. The display shows momentary BT ON, and b appears. OR The display shows BT ON FL to indicate Bluetooth fails to launch. 40 English Turning Off Bluetooth Procedure: 1 Press the preprogrammed button to turn off the Bluetooth. 2 A short, medium-pitched tone sounds. The display shows momentary BT OFF, and b disappears. Re-Pair Timer There are two options for configuring the Bluetooth pairing type on the radios. The type defines the duration the radio and the accessory retain the pairing information. ⢠Immediate â When the radio and/or device is turned off after pairing, the keys are lost. When the radio and the device are turned back on, they cannot re-connect as the pairing keys are lost. The user must re-pair the devices to re-establish a new set of pairing keys. See Pairing Bluetooth Device with the Radio on page 42. ⢠Infinite â When the radio and/or device are turned off after pairing, keys are NOT lost. When the radio and the device are turned back on, they can resume the Bluetooth connection without user intervention. Bluetooth Drop Timer Re-Pair Timer Scenarios ⢠When the radio is powered OFF, pairing key is lost immediately, and accessory attempts to pair again. If pairing is unsuccessful within the Drop Timer value, the accessory automatically powers OFF. Immediate The Bluetooth Drop Timer has two different settings and functions, depending upon the selection of the Re-Pair Timer. Re-Pair Timer Options ⢠0 â 15 minutes buffer time to re-establish Immediate ⢠When the accessory is powered OFF, all keys are lost immediately, and the user must re-pair the devices. Bluetooth Connection when the bluetooth signal is out of range; or when the devices are powered on/off. connection, the devices will attempt to reestablish Bluetooth Connection within the Drop Timer value. Infinite accessory attempts to re-establish the Bluetooth Connection for a period of time depending upon the Drop Timer value. If the devices fails to reconnect within the period, the accessory then powers OFF. Bluetooth Connection when the bluetooth signal is out of range; or when the devices are powered on/off. ⢠0 â 15 minutes buffer time to re-establish ⢠When the devices lose Bluetooth ⢠When the radio is powered OFF, the Drop Timer Options Infinite Advanced Features Re-Pair Timer Options ⢠2 hours, 4 hours or 8 hours period for the devices keeping the pairing keys even though they are disconnected or powered off. So when they detects the presence of each other they can automatically re-establish the Bluetooth Connection within this period. Check with your dealer or system administrator for more information about these timers. See Pairing Bluetooth Device with the Radio on page 42 to establish the Bluetooth Connection. 41 English Pairing Bluetooth Device with the Radio Procedure: With your radioâs Bluetooth feature ON: 1 Turn on the accessory, then place it close to the radio using the Blue dot-pairing indicator on the radio and the accessory. Bluetooth Pairing Indicator Advanced Features Note: 42 English Bluetooth range of operation is 10 meters line of sight. This is an unobstructed path between the location of the signal transmitter and the location of the receiver (the Radio and the Accessory). Obstacles that can cause an obstruction in the line of sight include trees, buildings, mountains, cars and etc. It is NOT recommended that the User leave their radio behind and expect that the Accessory to work with a high degree of reliability when they are separated. At the fringe areas of reception both voice and tone quality will start to sound "garbled" or "broken". To correct this problem, simply position the Accessory and Radio closer to each other (within the 10 meter defined range) to re-establish clear audio reception. 2 If the pairing process is successful, the radio sounds an incremental-pitched tone to indicate paired. OR If the pairing process fails, the radio sounds a short, lowpitched tone. The display shows PAIRFAIL. Repeat step 1 again. 3 The radio continues to connect to the device. If the connecting process is successful, the radio sounds an incremental-pitched tone. The display showsCONNCTED, and a turns solid. OR If the connecting process fails, the radio sounds a short, low-pitched tone. The display shows CON FAIL. Repeat step 2 to reconnect the bluetooth. OR If the connecting process fails, the radio sounds a short, low-pitched tone. The display shows CON FAIL. After Bluetooth Drop Timer expires, if the device is still not re-connecting with the radio, the radio sounds a decremental-pitched tone to indicate unpaired. The display shows UNPAIRED. Indicating Bluetooth Connection is Lost Procedure: 1 The Bluetooth icon starts blinking for 10 seconds. The radio sounds an decremental-pitched tone and the display shows alternates with CON LOST. 2 If the Bluetooth device successfully re-connects before the Bluetooth Drop Timer expires, the display shows momentary CONNCTED, and a turns solid. OR If reconnecting is unsuccessful after the 10 seconds blinking timer expires, the b becomes solid. Audio from the Radio to the Headset) Procedure: 1 Press the preprogrammed button to route the audio from the radio to the headset. 2 A short, medium-pitched tone sounds. The display shows HDSET ON. Turning Off the Bluetooth Audio (Routing the Audio from the Headset to the Radio) Procedure: Advanced Features The radio shows solid a when the devices have a Bluetooth connection. Below is the scenario and radio indications when the connection is interrupted. Turning On the Bluetooth Audio (Routing the 1 Press the preprogrammed button to route the audio from the headset to the radio. 2 A short, medium-pitched tone sounds. The display shows SPKR ON. 43 English Adjusting the Volume of the Radio from Bluetooth Utilities Audio Device Procedure: Using the Flip Display With the Bluetooth audio device connected to the radio: This feature allows you to flip the content of the top display upside down. It is particularly useful when you would like to read the top display while the radio is still in the attached to your belt. 1 Adjust volume up/down on the bluetooth audio device. 2 The radio display shows VOL XX and sounds a short, medium-pitched tone. Clearing All Pairing Information 1 Long press the preprogrammed Bluetooth On/Off button. A Advanced Features short, medium-pitched tone sounds. 2 The display shows PLS WAIT to indicate clearing is in Procedure: Press and hold the preprogrammed Light button to flip the display. Selecting a Basic Zone Bank This feature allows twice as many zones to be accessed from a switch, doubling the amount of switch positions. progress. 3 The display shows ALL CLR to indicate clearing is successful. OR The radio sounds a short, low-pitched tone. The display shows CLR FAIL to indicate clearing has failed. Note: 44 English If Re-Pair Timer is set to infinite and you clear keys on the radio, you must clear keys on all previously paired devices as well. (Please see your accessories manual for further details.) Note: The Zone Select feature must to be preprogrammed to the 3-position A-B-C switch, while the Basic Zone Bank feature must be preprogrammed to any side button or Top (Orange) button before you can use this feature. Selecting an Enhanced Zone Bank 1 Use the preprogrammed Basic Zone Bank button to toggle This feature is created in order to allow users to communicate in more zones. An Enhanced Zone Bank (EZB) consists of three zones. This also means each icon A, B, C, ... or Y consist of three zones. You can use the preprogrammed 3-position A-B-C switch to select the first, second or third zone in an EZB. the position between Bank 1 and Bank 2. 2 The top display shows the status icons (A, B, C, D, E or F) or the zone name based on the bank and switch position selected. See Basic Zone Bank 1 and Basic Zone Bank 2 on page 13 for more information on the status icons. This feature allows user to navigate from up to 75 zones in 25 EZBs. Note: The Enhanced Zone Bank Select feature must to be preprogrammed to the 3-position A-B-C switch, while the Enhanced Zone Bank feature must be preprogrammed to any side button or Top (Orange) button before you can use this feature. Advanced Features Procedure: Procedure: 1 Press the preprogrammed EZB Up or EZB Down button to scroll the EZB up or down. OR Press and hold the preprogrammed EZB Up or EZB Down button to fast scroll the EZB up or down. 2 Turn the 3-Position A/B/C Switch to select the first, second or third zone in the selected EZB. 45 English Selecting the Power Level Controlling the Display Backlight You can select the power level at which your radio transmits. The radio always turns on to the default setting. You can enable or disable the radioâs display backlight as needed, if poor light conditions make the display difficult to read. Note: Procedure: Press the preprogrammed Light button to toggle the backlight on or off. OR Press any programmable radio controls or buttons to turn the backlight on. This feature must be preprogrammed by a qualified radio technician. Settings: ⢠Select Low for a shorter transmitting distance and to conserve power. ⢠Select High for a longer transmitting distance. Advanced Features Procedure: 1 Press the preprogrammed Transmit Power Level Switch to toggle the power level between low and high power. 2 The display shows LOW PWR and the low power icon. OR The display shows HIGH PWR and the high power icon. 46 English Note: The backlight remains on for a preprogrammed time before it automatically turns off completely or returns to the minimum backlight level. Turning Voice Mute On or Off 1 Press the preprogrammed Voice Mute button to turn the Note: You can enable and disable voice transmission, if needed. feature off or on. 2 The display momentarily shows VMUT OFF, and a short tone sounds, indicating that the feature is disabled. OR The display momentarily shows VMUT ON, and a short tone sounds, indicating that the feature is enabled. Using the Time-Out Timer This feature turns off your radioâs transmitter. You cannot transmit longer than the preset timer setting. You will hear a brief, low-pitched, warning tone four seconds before the transmission times out. Procedure: 1 Hold down the PTT button longer than the preprogrammed time. You hear a short, low-pitched warning tone, the transmission is cut-off, and the LED goes out until you release the PTT button. 2 Release the PTT button. The timer resets. Advanced Features Procedure: The timer is defaulted at 60 seconds, but it can be preprogrammed from 3 to 120 seconds, in 15-second intervals, or it can be disabled entirely for each radio mode, by a qualified radio technician. 3 Press the PTT button to re-transmit. The time-out timer restarts and the LED lights up solid red. If you attempt to do so, the radio automatically stops your transmission, and you hear a talk-prohibit tone. 47 English Using the Conventional Squelch Operation Features This feature filters out unwanted calls with low signal strength or channels that have a higher than normal background noise. Analog Options Mode Result Carrier squelch (C) You hear all traffic on a channel. Advanced Features 48 English One or more of the following options may be preprogrammed in your radio. Check with your dealer or system administrator for more information. Option Tone Private Line (PL), Digital Private-Line (DPL), and carrier squelch can be available (preprogrammed) per channel. PL or DPL Digital Options The radio responds only to your messages. Digital Carrier-Operated Squelch (COS) Result You hear any digital traffic. Normal Squelch You hear any digital traffic having the correct network access code. Selective Switch You hear any digital traffic having the correct network access code and correct talkgroup. Using the Digital PTT ID Feature This feature allows you to override any coded squelch (DPL or PL) that might be preprogrammed to a channel. The radio will also unmute to any digital activity on a digital channel. This feature allows you to see the radio ID (number) of the radio from whom you are currently receiving a transmission. This ID, consisting up to a maximum of eight characters, can be viewed by both the receiving radio and the dispatcher. Procedure: Place the preprogrammed PL Defeat switch in the PL Defeat position. You hear any activity on the channel. OR The radio is muted if no activity is present. Note: When this feature is active, the Carrier Squelch status indicator is displayed. Your radioâs ID number is also automatically sent every time the PTT button is pressed. This is a per-channel feature. For digital voice transmissions, your radioâs ID is sent continuously during the voice message. Using the Smart PTT Feature (Conventional Only) Smart PTT is a per-personality, programmable feature used in conventional radio systems to keep radio users from talking over other radio conversations. Advanced Features Using the PL Defeat Feature When smart PTT is enabled in your radio, you cannot transmit on an active channel. 49 English If you try to transmit on an active smart-PTT channel, you hear an alert tone, and the transmission is inhibited. The LED lights up solid yellow to indicate that the channel is busy. Three variations of smart PTT are available: You cannot transmit if any traffic is detected on the channel. Transmit Inhibit on Busy Channel with Wrong Squelch Code You cannot transmit on an active channel with a squelch code or (if secure-equipped) encryption key other than your own. If the PL code is the same as yours, the transmission is not prevented. Advanced Features Transmit Inhibit on Busy Channel with Carrier 50 English Quick-Key Override This feature can work in conjunction with either of the two above variations. You can override the transmit-inhibit state by quick-keying the radio. In other words, two PTT button presses within the preprogrammed time limit. Voice Announcement This feature enables the radio to audibly indicate the current feature mode, Zone or Channel the user has just assigned. This audio indicator can be customized per customer requirements. This is typically useful when the user is in a difficult condition to read the content shown on the display. Each voice announcement is within a limit of three seconds maximum. The sum total duration for all voice announcements in a radio shall be no more than 1000 seconds. Note: This feature must be preprogrammed by a qualified radio technician. The features which Voice Announcement supports are: ⢠Zone ⢠Channel ⢠Scan ⢠PL Disabled ⢠Talkaround/Direct ⢠Tx Inhibit Note: Voice announcements support certain number of zonechannel, but not all. Seek advice from your dealer or qualified technician for the best selections for this feature. The two options of priority for the Voice Announcement available are: when the radio is receiving calls. ⢠Low â disables the voice of the feature from announcing when the radio is receiving calls. Procedure: Pressing this preprogrammed playback button will always enable the voice feature to announce in High priority. All the three programmable buttons at the side of the radio support this feature. ⢠Change to a new zone. The radio announces the current zone and channel it is transmitting. You hear a voice announcement when the features below are preprogrammed in the radio. ⢠Change to a new channel remaining within the current zone. ⢠The radio powers up. The radio announces the current zone ⢠Press either the preprogrammed button or switch of the radio and channel it is transmitting. ⢠Press the preprogrammed voice announcement button The radio announces the current channel. to launch or terminate Scan, PL Disabled, Talkaround/Direct or Transmit Inhibit. The radio announces the corresponding feature activation. Advanced Features ⢠High â enables the voice of the feature to announce even Note: (which specifically programmed to playback the current zone and channel). The radio announces the current zone and channel it is transmitting. 51 English Caring for Your Radio Helpful Tips Take a moment to review the following: Caring for Your Radio . . . . . . . . . . . . . . . . . . . . . . . . . Cleaning Your Radio . . . . . . . . . . . . . . . . . . . . . . . . Handling Your Radio . . . . . . . . . . . . . . . . . . . . . . . . Servicing Your Radio . . . . . . . . . . . . . . . . . . . . . . . . Taking Care of the Battery. . . . . . . . . . . . . . . . . . . . . . Checking the Battery Charge Status . . . . . . . . . . . . Battery Recycling and Disposal. . . . . . . . . . . . . . . . page 52 page 53 page 53 page 54 page 54 page 54 page 55 Caution ⢠The APX 6000 radio casting has a vent port that allows for pressure equalization in the radio. Never poke this vent with any objects, such as needles, tweezers, or screwdrivers. This could create leak paths into the radio and the radioâs submergibility will be lost. Vent Port Helpful Tips ⢠(For APX 6000 R 52 English Radios Only) The APX 6000 R radio is designed to be submerged to a maximum depth of 6 feet, with a maximum submersion time of 2 hours. Exceeding either maximum limit may result in damage to the radio. Caution Elastomer technology materials used for seals in rugged portable radios can age with time and environmental exposure. Therefore, Motorola recommends that rugged radios be checked annually as a preventive measure in order to assure the watertight integrity of the radio. Motorola details the disassembly, test, and reassembly procedures along with necessary test equipment needed to inspect, maintain and troubleshoot radio seals in the radioâs service manual. ⢠If the radio battery contact area has been submerged in water, dry and clean the radio battery contacts before attaching a battery to the radio. Otherwise, the water could short-circuit the radio. ⢠If the radio has been submerged in water, shake the radio well so that any water that may be trapped inside the speaker grille and microphone port can be removed. Otherwise, the water will decrease the audio quality of the radio. ⢠Do not disassemble the radio. This could damage radio seals and result in leak paths into the radio. Any radio maintenance should be performed only by a qualified radio technician. Cleaning Your Radio To clean the external surfaces of your radio: 1 Combine one teaspoon of mild dishwashing detergent to one gallon of water (0.5% solution). 2 Apply the solution sparingly with a stiff, non-metallic, shortbristled brush, making sure excess detergent does not get entrapped near the connectors, controls or crevices. Dry the radio thoroughly with a soft, lint-free cloth. Helpful Tips ⢠(For APX 6000 R Radios Only) 3 Clean battery contacts with a lint-free cloth to remove dirt or grease. Caution Do not use solvents to clean your radio. Spirits may permanently damage the radio housing. Do not submerge the radio in the detergent solution. Handling Your Radio ⢠Do not pound, drop, or throw the radio unnecessarily. Never carry the radio by the antenna. ⢠Avoid subjecting the radio to an excess of liquids. Do not submerge the radio unless it is a ruggedized, APX 6000 R model. 53 English ⢠Avoid subjecting the radio to corrosives, solvents or spirits. Taking Care of the Battery ⢠Do not disassemble the radio. ⢠Keep the accessory-connector cover in place until ready to use the connector. Replace the cover immediately once the accessory has been disconnected. Helpful Tips Servicing Your Radio Proper repair and maintenance procedures will assure efficient operation and long life for this product. A Motorola maintenance agreement will provide expert service to keep this and all other communication equipment in perfect operating condition. A nationwide service organization is provided by Motorola to support maintenance services. Through its maintenance and installation program, Motorola makes available the finest service to those desiring reliable, continuous communications on a contract basis. For a contract service agreement, please contact your nearest Motorola service or sales representative, or an authorized Motorola dealer. Express Service Plus (ESP) is an optional extended service coverage plan, which provides for the repair of this product for an additional period of either one or two years beyond the normal expiration date of the standard warranty. For more information about ESP, contact the Motorola Radio Support Center at 3761 South Central Avenue, Rockford, IL 61102 (800) 227-6772 / (847)725-4200. 54 English Checking the Battery Charge Status Your radio can indicate the batteryâs charge status through: ⢠the LED and sounds. ⢠the fuel gauge icon on the display. LED and Sounds When your battery is low: ⢠the LED blinks red when the PTT button is pressed. ⢠you hear a low-battery âchirpâ (short, high-pitched tone). Fuel Gauge Icon A blinking fuel gauge icon ( ) is displayed only when the battery voltage drops to low level. In this case, replace the battery with a fully charged one. Battery Recycling and Disposal 76% to 100% full In the U.S. and Canada, Motorola participates in the nationwide Rechargeable Battery Recycling Corporation (RBRC) program for NiCd battery collection and recycling. Many retailers and dealers participate in this program. 51% to 75% 26% to 50% 11% to 25% 10% or less (at 10%, the gauge begins blinking) For the location of the drop-off facility closest to you, access RBRC's Internet web site at www.rbrc.com or call 1-800-8BATTERY. This internet site and telephone number also provide other useful information concerning recycling options for consumers, businesses, and governmental agencies. Helpful Tips Battery Charge Gauge 55 English Accessories For a list of Motorola-approved antennas and other accessories, visit the following website: http://www.motorola.com/governmentandenterprise On the website, search for APX 6000 Portable Radio. You will see the accessories information besides the specifications of the radio. You can also contact your dealer for details. Contact your dealer for details. The certifications for the accessories are as below. VHF Band (FCC ID: AZ489FT3824) UHF Band (FCC ID: AZ489FT4899) 700/800 MHz Band (FCC ID: AZ489FT5859) Accessories Bluetooth Enabled Models: VHF Band (FCC ID: AZ489FT3829) UHF Band (FCC ID: AZ489FT4892) 700/800 MHz Band (FCC ID: AZ489FT5863) 56 English State the position of the vessel in distress, using any information that will help responders to locate you, e.g.: ⢠latitude and longitude ⢠bearing (state whether you are using true or magnetic north) ⢠distance to a well-known landmark ⢠vessel course, speed or destination State the nature of the distress. Specify what kind of assistance you need. State the number of persons on board and the number needing medical attention, if any. If you are in imminent and grave danger at sea and require emergency assistance, use VHF Channel 16 to send a distress call to nearby vessels and the United States Coast Guard. Transmit the following information, in this order: 1 âMAYDAY, MAYDAY, MAYDAY.â Mention any other information that would be helpful to responders, such as type of vessel, vessel length and/or tonnage, hull color, etc. âOVER.â 11 If you do not receive an immediate response, remain by the radio and repeat the transmission at intervals until you receive a response. Be prepared to follow any instructions given to you. Take a moment to review the following: Special Channel Assignments . . . . . . . . . . . . . . . . . . . page 57 Operating Frequency Requirements . . . . . . . . . . . . . . page 58 Special Channel Assignments Emergency Channel âTHIS IS _____________________, CALL SIGN __________.â State the name of the vessel in distress 3 times, followed by the call sign or other identification of the vessel, stated 3 times. Repeat âMAYDAYâ and the name of the vessel. âWE ARE LOCATED AT _______________________.â Appendix: Maritime Radio Use in the VHF Frequency Range Appendix: Maritime Radio Use in the VHF Frequency Range 10 Wait for a response. Non-Commercial Call Channel For non-commercial transmissions, such as fishing reports, rendezvous arrangements, repair scheduling, or berthing information, use VHF Channel 9. 57 English Appendix: Maritime Radio Use in the VHF Frequency Range Operating Frequency Requirements A radio designated for shipboard use must comply with Federal Communications Commission Rule Part 80 as follows: ⢠on ships subject to Part II of Title III of the Communications Act, the radio must be capable of operating on the 156.800 MHz frequency ⢠on ships subject to the Safety Convention, the radio must be capable of operating: ⢠⢠in the simplex mode on the ship station transmitting frequencies specified in the 156.025 â 157.425 MHz frequency band, and in the semiduplex mode on the two frequency channels specified in the table below. Note: Simplex channels 3, 21, 23, 61, 64, 81, 82, and 83 cannot be lawfully used by the general public in US waters. Additional information about operating requirements in the Maritime Services can be obtained from the full text of FCC Rule Part 80 and from the US Coast Guard. Table A-1: VHF Marine Channel List Frequency (MHz) Table A-1: VHF Marine Channel List (Continued) Frequency (MHz) Channel Number Transmit Receive 156.150 160.750 156.200 160.800 156.250 160.850 156.300 â 156.350 160.950 156.400 â 156.450 156.450 10 156.500 156.500 11 156.550 156.550 12 156.600 156.600 13** 156.650 156.650 14 156.700 156.700 15** 156.750 156.750 16 156.800 156.800 17** 156.850 156.850 18 156.900 161.500 156.950 161.550 Channel Number Transmit Receive 19 156.050 160.650 20 157.000 161.600 160.700 157.050 161.650 22 157.100 161.700 58 English 156.100 Table A-1: VHF Marine Channel List (Continued) Table A-1: VHF Marine Channel List (Continued) Frequency (MHz) Transmit 157.150 24 157.200 161.800 25 157.250 161.850 26 157.300 161.900 27 157.350 28 157.400 60 Frequency (MHz) Receive Channel Number Transmit Receive 161.750 75 *** *** 76 *** *** 77** 156.875 â 78 156.925 161.525 161.950 79 156.975 161.575 162.000 80 157.025 161.625 156.025 160.625 157.075 161.675 156.075 160.675 157.125 161.725 62 156.125 160.725 157.175 161.775 63 156.175 160.775 84 157.225 161.825 156.225 160.825 85 157.275 161.875 65 156.275 160.875 86 157.325 161.925 66 156.325 160.925 87 157.375 161.975 67** 156.375 156.375 88 157.425 162.025 68 156.425 156.425 69 156.475 156.475 71 156.575 156.575 72 156.625 â 73 156.675 156.675 74 156.725 156.725 Appendix: Maritime Radio Use in the VHF Frequency Range Channel Number Simplex channels 3, 21, 23, 61, 64, 81, 82, and 83 cannot be lawfully used by the general public in US waters. ** Low power (1 W) only *** Guard band Note: A â in the Receive column indicates that the channel is transmit only. 59 English Term Glossary This glossary is a list of specialized terms used in this manual. Glossary Term Acknowledgment of communication. Active Channel A channel that has traffic on it. Analog Signal An RF signal that has a continuous nature rather than a pulsed or discrete nature. ARS Automatic Registration Service ASTRO 25 Trunking Motorola standard for wireless digital trunked communications. ASTRO Conventional Motorola standard for wireless digital conventional communications. Autoscan A feature that allows the radio to automatically scan the members of a scan list. Bluetooth 60 English Bluetooth Pairing Bluetooth pairing occurs when two bluetooth devices exchanged a passkey to form a paired Bluetooth wireless connection. Call Alert Privately page an individual by sending an audible tone. Carrier Squelch Feature that responds to the presence of an RF carrier by opening or unmuting (turning on) a receiverâs audio circuit. A squelch circuit silences the radio when no signal is being received so that the user does not have to listen to ânoiseâ. Central Controller A software-controlled, computer-driven device that receives and generates data for the trunked radios assigned to it. It monitors and directs the operations of the trunked repeaters. Channel A group of characteristics such as transmit/ receive frequency pairs, radio parameters, and encryption encoding. Definition ACK Bluetooth is an open wireless technology standard for exchanging data over short distances from fixed and mobile devices with high levels of security. Definition In a trunking system, one of the channels that is used to provide a continuous, twoControl Channel way/data communications path between the central controller and all radios on the system. Term Definition Typically refers to radio-to-radio communications, sometimes through a repeater (see Trunking). Conventional Scan List A scan list that includes only conventional channels. Deadlock Displayed by the radio after three failed attempts to unlock the radio.The radio must be powered off and on prior to another attempt. Digital Private Line (DPL) A type of coded squelch using data bursts. Similar to PL except a digital code is used instead of a tone. Digital Signal An RF signal that has a pulsed, or discrete, nature, rather than a continuous nature. Dispatcher An individual who has radio system management duties. Dynamic Regrouping A feature that allows the dispatcher to temporarily reassign selected radios to a single special channel so they can communicate with each other. Definition Failsoft A feature that allows communications to take place even though the central controller has failed. Each trunked repeater in the system transmits a data word informing every radio that the system has gone into failsoft. FCC Federal Communications Commission. FM Frequency Modulation Hang Up Disconnect. Home screen The first display information after the radio completes its self test. KVL Key-variable loader: A device for loading encryption keys into the radio. LCD Liquid crystal display. LED Light-emitting diode. Monitor Check channel activity by pressing the Monitor button. If the channel is clear, you hear static. If the channel is in use, you hear conversation. It also serves as a way to check the volume level of the radio, since the radio âopens the squelchâ when the monitor button is pressed. Glossary Conventional Term 61 English Term Definition Multi-System Talkgroup Scan List A scan list that can include both talkgroups (trunked) and channels (conventional). Glossary Network Access Code (NAC) operates on Network Access digital channels to reduce voice channel Code interference between adjacent systems and sites. NiCd Nickel-cadmium NiMH Nickel-metal-hydride. Non-Tactical/ Revert The user talks on a preprogrammed emergency channel. The emergency alarm is sent out on this same channel. OTAR Over-the-air rekeying. Page A one-way alert, with audio and/or display messages. Personality A set of unique features specific to a radio. Preprogrammed Refers to a software feature that has been activated by a qualified radio technician. Private Line (PL) A sub-audible tone that is transmitted such that only receivers decoding the tone receives it. 62 English Term Definition Programmable Refers to a radio control that can have a radio feature assigned to it. PTT Push-To-Talk â the PTT button engages the transmitter and puts the radio in transmit (send) operation when pressed. Radio Frequency (RF) The part of the general frequency spectrum between the audio and infrared light regions (about 10 kHz to 10,000,000 MHz). Repeater A conventional radio feature, where you talk through a receive/transmit facility that re-transmits received signals, in order to improve communications range and coverage. Any digital P25 traffic having the correct Selective Switch Network Access Code and the correct talkgroup. Squelch Special electronic circuitry, added to the receiver of a radio, that reduces, or cuts off, unwanted signals before they are heard in the speaker. Standby An operating condition whereby the radioâs speaker is muted but still continues to receive data. Term Definition Term Definition Pre-defined text messages that allow the user to send a conditional message without talking. Trunking The automatic sharing of communications paths between a large number of users (see Conventional). Tactical/ Non-Revert The user talks on the channel that was selected before the radio entered the emergency state. Trunking Priority Monitor Scan List A scan list that includes talkgroups that are all from the same trunking system. Bypass a repeater and talk directly to another unit for easy local unit-to-unit communications. USK Unique Shadow Key. Talkaround Zone A grouping of channels. Talkgroup An organization or group of radio users who communicate with each other using the same communication path. Glossary Status Calls 63 English Product manufactured by MOTOROLA. MOTOROLA assumes no obligations or liability for additions or modifications to this warranty unless made in writing and signed by an officer of MOTOROLA. Commercial Warranty Limited Warranty MOTOROLA COMMUNICATION PRODUCTS Commercial Warranty I. WHAT THIS WARRANTY COVERS AND FOR HOW LONG: 64 MOTOROLA INC. (âMOTOROLAâ) warrants the MOTOROLA manufactured Communication Products listed below (âProductâ) against defects in material and workmanship under normal use and service for a period of time from the date of purchase as scheduled below: ASTRO APX 6000 Portable Units One (1) Year Product Accessories One (1) Year MOTOROLA, at its option, will at no charge either repair the Product (with new or reconditioned parts), replace it (with a new or reconditioned Product), or refund the purchase price of the Product during the warranty period provided it is returned in accordance with the terms of this warranty. Replaced parts or boards are warranted for the balance of the original applicable warranty period. All replaced parts of Product shall become the property of MOTOROLA. This express limited warranty is extended by MOTOROLA to the original end user purchaser only and is not assignable or transferable to any other party. This is the complete warranty for the English Unless made in a separate agreement between MOTOROLA and the original end user purchaser, MOTOROLA does not warrant the installation, maintenance or service of the Product. MOTOROLA cannot be responsible in any way for any ancillary equipment not furnished by MOTOROLA which is attached to or used in connection with the Product, or for operation of the Product with any ancillary equipment, and all such equipment is expressly excluded from this warranty. Because each system which may use the Product is unique, MOTOROLA disclaims liability for range, coverage, or operation of the system as a whole under this warranty. II. GENERAL PROVISIONS: This warranty sets forth the full extent of MOTOROLA'S responsibilities regarding the Product. Repair, replacement or refund of the purchase price, at MOTOROLAâs option, is the exclusive remedy. THIS WARRANTY IS GIVEN IN LIEU OF ALL OTHER EXPRESS WARRANTIES. IMPLIED WARRANTIES, INCLUDING WITHOUT LIMITATION, IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE, ARE LIMITED TO THE DURATION OF THIS LIMITED WARRANTY. IN NO EVENT SHALL MOTOROLA BE LIABLE FOR DAMAGES IN EXCESS OF THE PURCHASE PRICE OF THE PRODUCT, FOR ANY LOSS OF USE, LOSS OF TIME, INCONVENIENCE, COMMERCIAL LOSS, LOST PROFITS OR SAVINGS OR OTHER INCIDENTAL, SPECIAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE SUCH PRODUCT, TO THE FULL EXTENT SUCH MAY BE DISCLAIMED BY LAW. SOME STATES DO NOT ALLOW THE EXCLUSION OR LIMITATION OF INCIDENTAL OR CONSEQUENTIAL DAMAGES OR LIMITATION ON HOW LONG AN IMPLIED WARRANTY LASTS, SO THE ABOVE LIMITATION OR EXCLUSIONS MAY NOT APPLY. This warranty gives specific legal rights, and there may be other rights which may vary from state to state. IV. HOW TO GET WARRANTY SERVICE: You must provide proof of purchase (bearing the date of purchase and Product item serial number) in order to receive warranty service and, also, deliver or send the Product item, transportation and insurance prepaid, to an authorized warranty service location. Warranty service will be provided by MOTOROLA through one of its authorized warranty service locations. If you first contact the company which sold you the Product (e.g., dealer or communication service provider), it can facilitate your obtaining warranty service. You can also call MOTOROLA at 1-800-927-2744 US/Canada. V. WHAT THIS WARRANTY DOES NOT COVER: A) Defects or damage resulting from use of the Product in other than its normal and customary manner. B) Defects or damage from misuse, accident, water, or neglect. Commercial Warranty III. STATE LAW RIGHTS: C)Defects or damage from improper testing, operation, maintenance, installation, alteration, modification, or adjustment. D)Breakage or damage to antennas unless caused directly by defects in material workmanship. E) A Product subjected to unauthorized Product modifications, disassembles or repairs (including, without limitation, the addition to the Product of non-MOTOROLA supplied equipment) which adversely affect performance of the Product or interfere with MOTOROLA's normal warranty inspection and testing of the Product to verify any warranty claim. F) Product which has had the serial number removed or made illegible. G)Rechargeable batteries if: (1) any of the seals on the battery enclosure of cells are broken or show evidence of tampering. (2) the damage or defect is caused by charging or using the battery in equipment or service other than the Product for which it is specified. H)Freight costs to the repair depot. I) A Product which, due to illegal or unauthorized alteration of the software/firmware in the Product, does not function in accordance with MOTOROLAâs published specifications or the FCC certification labeling in effect for the Product at the time the Product was initially distributed from MOTOROLA. J) Scratches or other cosmetic damage to Product surfaces that does not affect the operation of the Product. K) Normal and customary wear and tear. 65 English Commercial Warranty VI. PATENT AND SOFTWARE PROVISIONS: MOTOROLA will defend, at its own expense, any suit brought against the end user purchaser to the extent that it is based on a claim that the Product or parts infringe a United States patent, and MOTOROLA will pay those costs and damages finally awarded against the end user purchaser in any such suit which are attributable to any such claim, but such defense and payments are conditioned on the following: A) that MOTOROLA will be notified promptly in writing by such purchaser of any notice of such claim; B) that MOTOROLA will have sole control of the defense of such suit and all negotiations for its settlement or compromise; and C)should the Product or parts become, or in MOTOROLAâs opinion be likely to become, the subject of a claim of infringement of a United States patent, that such purchaser will permit MOTOROLA, at its option and expense, either to procure for such purchaser the right to continue using the Product or parts or to replace or modify the same so that it becomes non-infringing or to grant such purchaser a credit for the Product or parts as depreciated and accept its return. The depreciation will be an equal amount per year over the lifetime of the Product or parts as established by MOTOROLA. 66 English MOTOROLA will have no liability with respect to any claim of patent infringement which is based upon the combination of the Product or parts furnished hereunder with software, apparatus or devices not furnished by MOTOROLA, nor will MOTOROLA have any liability for the use of ancillary equipment or software not furnished by MOTOROLA which is attached to or used in connection with the Product. The foregoing states the entire liability of MOTOROLA with respect to infringement of patents by the Product or any parts thereof. Laws in the United States and other countries preserve for MOTOROLA certain exclusive rights for copyrighted MOTOROLA software such as the exclusive rights to reproduce in copies and distribute copies of such MOTOROLA software. MOTOROLA software may be used in only the Product in which the software was originally embodied and such software in such Product may not be replaced, copied, distributed, modified in any way, or used to produce any derivative thereof. No other use including, without limitation, alteration, modification, reproduction, distribution, or reverse engineering of such MOTOROLA software or exercise of rights in such MOTOROLA software is permitted. No license is granted by implication, estoppel or otherwise under MOTOROLA patent rights or copyrights. VII. GOVERNING LAW: This Warranty is governed by the laws of the State of Illinois, U.S.A. Motorola, Inc. 1301, E. Algonquin Rd. Schaumburg, IL 60196-1078, U.S.A. MOTOROLA and the Stylized M Logo are registered in the U.S. Patent and Trademark Office. All other product or service names are the property of their respective owners. Š 2010 Motorola, Inc. All rights reserved. December 2010. *68012001081* 68012001081-B
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.4 Linearized : Yes XMP Toolkit : 3.1-702 Producer : Acrobat Distiller 7.0.5 (Windows) Create Date : 2011:02:09 14:05:52-05:00 Creator Tool : PScript5.dll Version 5.2.2 Modify Date : 2011:02:09 15:35:28-05:00 Metadata Date : 2011:02:09 15:35:28-05:00 Format : application/pdf Creator : emr003 Title : D:\Profiles\emr003\Local Sett...er_Guide_68012001081_b[1].pdf Document ID : uuid:4414ee05-988f-46b4-b53d-bfb70bf79535 Instance ID : uuid:5f9465f5-b67e-42be-be3c-ae7e57c26805 Page Count : 80 Author : emr003EXIF Metadata provided by EXIF.tools