TON ELECTRONICS TECHNOLOGY TK210 Wireless GPS Car Alarm User Manual TK210 V2 0 201110

TOPTEN ELECTRONICS TECHNOLOGY LIMITED Wireless GPS Car Alarm TK210 V2 0 201110

Users manual

WirelessGPS Car Alarm SystemUSER MANUAL(Model: TK210)GUANGZHOU TOPTEN ELECTRONICS FACTORYAddress: 20/F, Tower B, Gaoke Building, Tianhe North Road, Guangzhou, China.Tel: (+86)20-38351400, 38351401 Fax: (+86)20-38351400Website:http://www.t10.cn Email: sales@t10.cnVersion 2.0(Date: Oct., 2011)TOPTll::TTKK2120)ENUUAALL
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 1CONTENTPreface ....................................................................................................................................2I. Features & Functions ...........................................................................................................3II. How to Operate it ................................................................................................................4SMS Command Format...................................................................................................4Authorize the Alert-received Mobile.................................................................................4Change User Password...................................................................................................4Check the Real Physical Address....................................................................................5Check the GPS Coordinates by SMS..............................................................................5Check the location by Google Map’s URL.......................................................................5Arm/Disarm the System by SMS .....................................................................................6Arm/Disarm by Phone Calling .........................................................................................6Stop the Car by SMS .......................................................................................................6Restore the Stopped Car to Normal Status .....................................................................7Monitor the Voice around the Car....................................................................................7Two-way Talking with the Car ..........................................................................................7Set up Movement Alert ....................................................................................................7Set up Geo-Fence Alert ...................................................................................................8Set up Over-speed Alert ..................................................................................................8Adjust the Vibration Sensor’s Sensitivity .........................................................................9Turn ON/OFF Sleep Mode...............................................................................................9Setting for Mute Alarm. ..................................................................................................10Setting for Odometer......................................................................................................10Check the IMEI No.........................................................................................................10Change the Heart-beating Interval. ...............................................................................10SOS Anti-robbery Alert...................................................................................................11III. The Setting for GPRS Connection ...................................................................................11IV. Specifications ...................................................................................................................12VI. Packing List......................................................................................................................14VII. Installation.......................................................................................................................15VIII. Maintenance ..................................................................................................................19T........AAlleerrtt..............ensorr’’ssSSeO..............................................................................O.....P.............................................................T............ss..........................................EN..........................................................................................................................................................
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 2PrefaceTK210 GPS car alarm provides a reliable solution for safeguard & trackingthe vehicle. It has 2 unique functions:It is specially used to work with the central lock system or ordinary caralarm system. The user can use the original remote control toarm/disarm the TK210 for car security.It has wireless immobilizer, which will lock the engine secretly. In armingstatus, even the main unit is destroyed, the car can not be started.TK210 supports tracking by SMS/GPRS, user can check the car’s realphysical address easily by mobile SMS. It is not only an advanced car securityproduct, but also a reliable tracker for fleet management.Read it Firstly:Please read this manual thoroughly before you use the device; please keep itfor future reference.Attention:(1) Please keep the device away from water, humidity, high temperature,heavy dust or strong magnetism.(2) Please prepare a valid GSM SIM card (850/900/1800/1900Mhz) inadvance.Warning:We strongly suggest user let the professional car electrician to install thesystem.Olt thhorooughughPhhllyybbefTttiisslleeeettmmaanagENcarccaannSS,,useerrccaannchnnoottonolyyaannEeemm
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 3I. Features & Functions1. Arm/disarm by SMS remotely, or by the remote controller of original centrallock system or existing car alarm system, or by phone call.2. Upgrade the ordinary car alarm to GPS alarm system;3. Check the car’s real physical address(such as city name, street name..) ;4. Track by mobile SMS to get the coordinates or the Google map’s URL;5. Live tracking by web-based tracking center via GPRS network;6. Track on command or by time interval via SMS/GPRS.7. Cut off engine to stop the car safely by SMS/GPRS;8. Two-way talking function(optional) & voice monitoring function;9. Wireless immobilizer which will kill the engine secretly & reliably;10. Vibration alert, door opening alert and ignition on alert;11. Power cut-off alert & low power alert;12. Movement alert;13. Geo-fence alert (radius range: 0.1~99KM);14. Over-speed alert (speed range:1~999km/h);15. SOS button to call for help in case of emergency;16. Inbuilt 4Mb data logger tostoretheofflineGPSdatawherethereisnoGSMcoverage;17. Mileage calculation function (=odometer)18. Built-in rechargeable backup battery; when the car battery is cut off ordamaged, the built-in 580mAH backup battery can work for emergency check,and the system will send out power failure alert immediately.19. Two kinds of location information; user can check the GPS latitude, longitude,speed, direction. If there is no GPS signal, user could also locate the car byGSM base station code (the GSM operator’s support is needed)20. Power save design, the power consumption is very low.21. Strong ability of anti-tamper.Inarmingstatus, theenginewillbelocked,eventhe main unit is completely destroyed, there is no way to start the car.TggggereTfunccttiiooOaannggeeheellpincaasseettoosstoreetthP::00.1~9999K11~~99999km/ooffTgg;;KM);EN;ttoorriinggffuunncceesseccrreettly&&rreellnniittiioonoonnalerrttrrr;;
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 4II. How to Operate itSMS Command FormatUser can send SMS instruction to operate the tracker by any mobile phone,the format of the instruction is:User Password(******)+ Control Code(XXX)The default user password is 111111.If the user password is changed, user should send the SMS instruction withthe new user password instead of 111111.XXX is the control code, all the letters must be capital lettersThere is no space between the user password & the control instruction.Authorize the Alert-received MobileSMS command: 111111*10 Mobile #1 *20 Mobile #2*In case of alarm, if user wants to get the alert SMS from the tracker, he/sheneeds send the following SMS to program the system firstly, otherwise, the alertinformation can not be received correctly.Example: User sends the SMS 111111*10 13922713571 *20 13711189059 * to thetracker’s SIM card number, if there is any alert, system will send alert SMS to both of thesetwo mobiles. In case of SOS alert, the system will only send alert to the mobile #2Change User PasswordSMS command: 111111PSWnnnnnnThis instruction is used to change the user password. The length of the user’spassword is 3~6 digits. Users are suggested to change to the new password inuse.Example: User sends the SMS “111111PSW12345” to the system SIM card number, andgets the conf irmed SMS “111111PSW12345” in 3 seconds. It means that the user passwordhas been changed to 12345.Remark: Please keep the password deep in mind if it is changed.TrreeccendndssttheheSMSer,ifthheerreealOwwaannttssSMMSStoOpprroogivvededcorrrreecS1111Pobobiile##11PPPPttooggettherraamTobobileileT*20MMooTTTTTTTTENappitalllleettrrdd&tthheecoonnttrroo
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 5Check the Real Physical AddressSMS command: 111111ADDWhen user sends this SMS command to the tracker, the tracker will automatically sendback the car’s real physical address (such as city name, street name) to your mobile by SMS.There is no need for the user to setup any server.Remark: (1) The GPRS service of the tracker’s SIM card must be activated, and thecorrect GPRS setting is needed (refer to the chapter of the setting of GPRS connection),user can set up the GPRS upload time interval to 0 so as to save the GPRS flow; (2) Thephysical address depends on the Google map’s address information. If the place has verydetailed information on Google map, then the physical address by SMS is very detailed.Check the GPS Coordinates by SMSSMS command: 111111CHKThis instruction is used to inquiry the vehicle’s location & system’s status.The system will send back the SMS, includes the similar information, such as“Car is Armed……”Check the location by Google Map’s URLSMS command: 111111MAPThe user sends this SMS command to the tracker’s SIM number, the trackerwill automatically send back the SMS including the Google map’s URL, the usercan use smart phone(be able to visit internet) to open the URL link, the car’slocation will be showed on the Google map.T1111111MtthhiisSSMMScobackktthhOyyGGyyooOooggOMMAAPomPllee M MapPTnncclluudENcclele’’slooccatiioonn&eesstthhessiimm
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 6Arm/Disarm the System by SMSSMS command: 111111ARMThis SMS instruction is used to arm the systemSMS command: 111111DSMThis SMS instruction is used to disarm the systemArm/Disarm by Phone CallingUser could also use the first alarm-received mobile phone to call the systemSIM card number, so as to arm/disarm the system.Arm: After hearing several ring tones, if the systems hang up the callautomatically, and call back you, it means that the system is armed.Disarm: After hearing several ring tones, if the system hangs up the callautomatically, and don’t call back you, it means that the system is disarmed.Note:(1) There is no communication fee for this operation, it is a very convenient way to arm& disarm the system.(2)The SIM card inside the device must have the function of Caller ID Display.(3) Only the 1st authorized mobile phone can realize this function.Stop the Car by SMSSMS command: 111111STPThis instruction is used to cut off the car’s power supply or fuel supply, so asto stop the car.If the car’s speed is less than 30KM/H, the car will be stopped immediately. Ifthe car’s speed is over 30KM/H, the instruction will not be carried out until the caris slow down at speed of less than 30KM/H.In some emergency case, you can send this SMS instruction twice, the carwill be stopped immediately, no matter what the speed is.Attention: It is very dangerous to stop the car when the vehicle is running at high speed.We do not take any responsibility to the consequence caused by this action.TyySSMSMT111SSTTOobobilileeppPeemmusthahavehhoonencanTiissooppeeratiotheffENstemmiisseessysystteemmhhaannggss t thhattthheessyystenniittiiss
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 7Restore the Stopped Car to Normal StatusSMS command: 111111RESThis instruction is used to restore the car to normal status after stopping thecar.It is also used to stop the receiving of SOS alert SMS once the anti-robberySOSswitchispresseddown.Monitor the Voice around the CarSMS command: 111111MONThis instruction is used to monitor the voice around the car.After sending out this SMS, the tracker will call back immediately, then, usercan monitor the voice around the car upon picking up the call.Two-way Talking with the CarSMS command: 111111MON:TelThis instruction is used to program the phone number which is used forcarrying out direct monitoring or talking.User uses this phone number to call the tracker, it will be connectedautomatically without driver’s permission. By this way, user can monitor the voiceor talk with the driver freely.Example: 111111MON:13922713571Note: If the Tel is the same as the first alarm-received phone (111111*10Mobile #1*20 Mobile #2*), then this telephone can only be used to carry outdirect monitoring, it can not realize the function arm/disarm by calling any more.Set up Movement Alert111111MOV1 to enable the movement alert, the present location is thecenter.111111MOV0 to disable the movement alert111111MOVto check the setting of movement alertIf user sends 111111MOV1 to activate the movement alert function, everytime when the system is armed, if the car moves away from the presentToonneuuttddrriivvere’spfreelyy.392OopnnggortaallkkiinenunmbeerrtpeerrmmiiPTTeeTTTllPPPPrrooggrraammthegg..TENackkiimmgguupptthheeccaallll..
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 8parking point for about 80 meters, the movement alert will be triggered.Set up Geo-Fence Alert111111FEN0 Disable the Geo-fence111111FEN1 Enable the Geo-fence, using the stored setting111111FENCheck the setting of geo-fence111111FEN1(YL:a,XL:b,DL:C)Set up the all the parameters111111FEN1(YL:a)Setup the latitude separately111111FEN1(XL:b)Setup the longitude separately111111FEN1(DL:C)Setup the radius separatelyYL:a, a is latitude of the reference pointXL:b, b is the longitude of the reference pointDL:c, c is radius of latitude & longitude, the range of the value is (0-990),the unit is :100 meters. The range is 0~99000 meters.(0-99KM)Remark: (1) FEN, XL, YL,DL must be in capital letter.(2) The Setting will be stored and used all the time.Example: If the fence’s center coordinate is: latitude:+23.1400, longitude:+113.4500, theradius is 5KM, then the SMS instruction is:111111FEN1(YL: +23.1400,XL: +113.4500,DL:50) .If the vehicle is running across the boundary of the fence, the system will automatically sendout alert SMS.Set up Over-speed Alert111111SPD:X x is the speed in KM/H , maximum value is 255M/H(For example: 111111SPD:120, if the car speed is over 120KM/H, it willsend SMS to warn you)111111SPD:0 to disable the over-speed alert. It is the default settingWhen the over-speed alert function is activated, if the car is running over thespeed limitation, the tracker will send out alert message.Remark: this function is just for reference, because there might be sometime delay or error in detecting the running car’s real speed by GPS.TnnggaacrossOSSiinnssttrruucc00,,XXL:+113.44505sstthheebbouounPssttootttrrddiinnateiiss::latitiioonniis:00T9999ssttbbeeinicarerdandandusetudeENnttttheherannggeeofth90009000mmeterrss((00aappiittiiiaatttllll
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 9Adjust the Vibration Sensor’s Sensitivity111111SHK0Normal status, when sensor is activated, it will trigger the alarm immediately.It is the default setting.111111SHK1Time-delay status, if the sensor is activated for 3 seconds continuously, it willtrigger the alarm. This setting can avoid some false vibration alarm.Turn ON/OFF Sleep Mode.111111SLEEP0 Turn off sleep mode, it is the default setting111111SLEEP1 Turn ON sleep mode, it is used to save power & GPRS flow.In this working mode, if the engine is OFF, the system will go into sleep modeafter 3 minutes, the power consumption is very low & GPRS connection is close.Once there is any vibration, or alarm, or incoming call/SMS, the system will wakeup immediately. In sleep mode, the device will wake up for every one hour, andreport the location by GPRS.TOPdedevvTvveeiinnccoomingicewwiillllwakENNauulltteeddttoossaavveeppeessysteemmwillgrryyrrrllooww&&GGPPRRggccaallll//SS
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage10Setting for Mute Alarm.111111MUTE:0 The siren will sound if there is alarm, it is the default setting111111MUTE:1 The siren will not sound if there is alarm, but system will stillsend out alarm by GSM network.Setting for Odometer.111111ODO: It is used to read the present odometer value.111111ODO:R It will reset the device’s odometer reading to 00000 & startcalculation from the beginning.111111ODO:0 It will reset the device’s odometer reading to 00000 & closethe calculation of odometer.111111ODO:1~999999 It will make the device to start calculation ofodometer from the base value. Example: 111111ODO:38980, then the device willreset the initial odometer reading as 38980KM & start the calculation again.Check the IMEI No.111111REGThis instruction is used to check the GSM module’s IMEI number.Change the Heart-beating Interval.111111HRT:1~999This instruction is used to change the time interval of heart-beating GPRSdata package. The default setting is 3 minutes.If the GSM networks do not detect the tracker’s activities for a certain time, itwill close the GPRS connection and the device will be offline. User can adjust thevalue so as to avoid this situation. Example: 111111HRT:5 (set time interval ofhear-beating as 5 minutes)TNNo.o.TedtOgPmmpplleePaass38980898KTmmaakkeethe:11T11111111ODKM&ENerrrreaeadodommeterrrreadeindedevviicc
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage 11SOS Anti-robbery Alertonce the SOS switch is pressed down & hold for at least 2 seconds, thesystem will send alarm SMS to the second alert-received mobile & the centernumber. User can send command 111111RES to release it.III. The Setting for GPRS ConnectionThe GPRS setting is necessary for using the following 2 functions:(1) Check the car’s real physical address by send 111111ADD(2) Online tracking service by web-based tracking platform(www.track800.com or www.topten-track.com )SMS format: 111111WWWItem (separated by )Compositive SMS Command for GPRS Setting(Please kindly noted that the device GPRS ID is the last 14 digits of the IMEI,you can check it on the sticker on the device or send 111111REG to get it)User can use one SMS to do all the GPRS setting. For example, if the APNname is internet, APN user name web and APN password gprs ,GPRSreporttime 3 minutes(=180seconds). Server’s IP: 98.143.144.145, Server’s Port:8500, then you can do all settings together in one SMS command:11111WWW:APN:internet,web,gprs;IPN:98.143.144.145;COM:8500;RPT:180;GPRS:1;IPN:XXX.XXX.XXX.XXX;This is to set the server’s IP address.Eg: 111111WWWIPN98.143.144.145If user wants to use domain name as server, please use DSN instead of IPNSuch as: 111111DSN:www.track800.com;If user wants to use UDP transmission, please use UDP instead of IPNSuch as: 111111WWW UDP98.143.144.145COM:XXXX;This is to set the server’s COM port No.TsseecconTddooallllsseettingweOooddooaaernnamewwebeOdds)s)O.SSeegsPeeGGnn t thheedeevvicelllltthheGPaaTPPRRSSSeTGGPRSSIIDDiseorENaaomNN))aattededby)eettittingngEtt
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage12Eg: 111111WWWCOM8500APN:XXX;This is to set the APN (access point name). Please use “,” to separate the APN,APN username & APN password.Eg: 111111WWWAPNweb.gprs.mtnnigeria.net,web,gprsRPT:XXX;This is to set the upload time interval. The unit is second, the value is between15-999 seconds.The default setting is 0, the tracker will not upload data but GPRS is online.Eg: 111111WWWRPT60(Upload time interval is every 60s)GPRS:0/1;GPRS:0; is to close down the GPRS;GPRS:1; is to open the GPRS.Eg: 111111WWWGPRS1(Open the GPRS connection)Check the GPRS Settings111111WWW:You can send 111111WWW: to check the parameters if you forgot.Default GPRS SettingThe default GPRS setting is:Server IP: www.track800.comServer Port:8500APN: internetGPRS report interval: 0GPRS connection: openIV. SpecificationsTWWTgOWWW:WOO tocchhecPTPPRRSENSSccononneccttiioo
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage13Size of the main unit: 98*64*25 (mm)Weight of the main unit: 0.1KGWorking temperature: -20 ~ 80Humidity: 0 ~ 95%GSM frequencies: Dual-band:900MHz/1800MHz(or Quad-band: 850MHz/900MHz/1800MHz/1900MHz)GPS chip: Latest SiRF-Star III chipsetReceiving ways 20 channelWorking frequencies 1575.42Mhz C/AGPSReceiving sensibility -162dbPositioning accuracy ≤10m (wide-open area)Speed accuracy ≤0.2M/S (wide-open area)Positioning mode Auto 2D/3DWorking voltage: 7~35 VDCPower Consumption: Working mode: <50mA;Sleep mode: <23mAInside Backup battery: Rechargeable 3.7V 580mAh Li-ion batteryV.FAQs & TroubleshootingFAQ TroubleshootingI call the tracker, it does not ring(1) The GSM SIM card has no credit;(2) The SIM card is protected by PIN code;(3) Fix the GSM antenna to open place to test;(4) The SIM card is placed correctly in the slot;(5) Check the connection of the GSM antenna, orchange another GSM antenna to test;I call the tracker, it rings, but itdoesn’t send back responseSMS(1)The user password is wrong, please use thecorrect password or reset the password to test;(2) Low power, please use outside 12VDC powersupply to power on the unit to testI can not get the alarm message(1) The SIM card inside the device has no credit;(2) The Alert-received mobile number is notprogrammed correctly, or the SMS instruction isnot in correct format;(3) The mailbox of the user’s mobile is full;I can not get the correct GPScoordinates or the location iswrong(1) Please make sure there is no metal obstaclesabove the GPS antenna. Fix the GPS antenna toopen place to test;(2) Please check the connection of the GPSTTnotriiTOOOOOOOOOOOOO((11))OOOOPPgPPPPTENN8800mmAhhLLii-ionbENEN
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage14antenna;(3) Chang another GPS antenna to test;(4) In cloudy condition, it is a little hard to get theGPS signal, and the GPS coordinate might havesome errors.I can check the location, but Ican not get the alert SMS whenthe car moves(1) Please setup the system firstly. (authorizeSMS-received mobile number, etc);(2) In arming status,the device only warn youonce the car moves at about 50 meters awayfrom the parking place;Much noise when monitoringvoice(1) Check the two sides of the MIC wire;(2) The MIC should be away from the engine,unit heater, GSM/GPS antenna and otherobstaclesVI.Packing ListStandard PackageItem name QuantitiesMain unit with internal shock sensor 1pcsGSM antenna 1pcsGPS antenna 1pcsMicrophone 1pcsSOS button 1pcsWiring harness 1pcsGSM antenna manufacturer:         TOPTEN ELECTRONICS TECHNOLOGY LIMITEDGSM antenna model:           GSM-0121001Note: only antenna sold together with TK210 could be used.Optional ComponentsItem name FunctionSpeaker It is used to carry out 2-way talking, to broadcast the voice tothe carsix-tones siren It will sound when the alarm is triggeredTTcturer:         Tcturer:    TTT:        OOOOOTOPPPPPPPPPPPPPPPTTTTTTTTENQuQuENEE
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage15VII.InstallationWiring DiagramEN
Important Notice       (1) Please read the manual carefully before installation and make sure you understand the installation wiring diagram and the car circuit & wiring firstly. We strongly advise you to ask professional car electricians to do the installation.        (2) Please prepare a valid GSM card (CDMA card not supported) with Caller ID Display & GPRS function. And use an ordinary mobile phone to check it is not PIN-code protected and the SMS has sending & receiving function. Note: installation for SIM card
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage17Please make sure that main unit is powered off, and then use a pin to pressthe yellow button, then insert SIM card into the SIM card holder. (Attention): Ifyou want to take out the SIM card from the main unit, please power off the mainunit firstly, otherwise, it might damage the unit.Explanation on Installation(1) IMPORTANT! How to fix the accessoriesFix the Main UnitChoose a place for the main unit first. Please fix the main unit at a secretplace to avoid being destroyed by theft. Please keep it away from thehigh-temperature, humidity or strong magnetic object (such as reversing radar,alarm). Please fasten it tightly. (Recommended places: under dashboard, underseat)Fix the GPS antennaWhile fixing the GPS antenna, it is better to place the flat magnetic sidedownside. Make sure there are not any metal or shielded obstacles around theupside of the GPS antenna, so that it can receive the satellite signal from upsidethe sky very well, the GPS antenna should be placed at broad & secret place too.It should be drew straight and kept away from the sound box or speaker.(Recommended places: Upside & inner part of the driver’s door rim, insidedashboard, secret place of front windshield, under bumper)Fix the GSM antennaFix the GSM antenna at place where there is no metal shield, so that it canreceive signal very well. And keep it a certain distance from other wirelessequipments. It is better fixed at a secret place so as to avoid tamper. The antennais external antenna for the non-standard SMA antenna, max Gian is 3dBi. Fix the microphone & speakerTPSPSssttrraaiighgt aces: UUppssideof frOe, ssootthhaattS aanntenna sshhoaannddkkeePaa,,iittiissnnoottannyymetttccaan rTs betttteerrtotalENkkeeeect (suucchhppllaaceess::unndederr
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage18Please fix the microphone at a secret place nearby the driver place so that itcan pickup the voice clearly, please keep speaker away from the microphone soas to avoid the echo interference.Fix the SOS buttonThe SOS button is already fixed to the wiring harness.Please fix the SOS button secretly under the left of the dashboard so thatthedrivercaneasily touchitincaseofemergency.Fix the ACC ignition wire (Yellow line)Connect the YELLOW line to the ignition key ON position.Fix the door switch wire (Blue line)Connect the BLUE line with the side-door switch.Fix car horn wire (Gray line)This line is optional installation. You can let it disconnected according to yourcar’s situation. It is used to assure that the tracker can detect the illegal intruderwhen the system is armed (/disarmed) by central lock signal lines.TOarPtthhaatttthhmmeedd))bbyycenToouuccaannlletithetraacckkentENsswwiittchh.ddiiscsc
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage19The gray line can also be connected to the positive pole of the directionlamp.Fix the power supply wire (Red line and black line)The tracker is specially designed for normal car which has +12VDC powersupply. Please connect the power supply lines directly to the car’s battery.For the truck, it is 24VDC power supply, the device can also work on truck,but the cut-off function can not work. That is to say, the wireless immobilizer andthe 2 white lines will not function.(2) Check the wiring:Try to use the double-sticky paper or other material to fix the device. Fastentightly the junction point of accessories and wires. Pay attention to insulation andprecaution of water and hot temperature. Please check the installation accordingto the wiring diagram.(3) Check the functionPlease check the key functions after installation, such as--Sending 111111CHK to see if it gets correct location.--Sending 111111STP to check if the car can be stopped---Sending 111111MON to check if monitoring is OKIf there is no GSM or GPS signal, please check the connection of the GSMantenna, or to place it to other place to test; If there is many noise whenmonitoring the voice, please fix the microphone away from the speaker ormagnetism; If it can not stop the car, please check the connection of the wirelessimmobilizer or the 2 white lines.VIII.MaintenanceSuggestionsPlease let the professional to do the installation & maintenance of the GPSterminal. If there is any disassembling or repair without our permission, wekeep no responsibility for any loss caused thereafter.TMMoorGcceeitttooothepleasseeOcchheecckkONNt tochecckkifGGPSPSssiiggnnePaaffttffeeeeiiffitggeettssciif tf thhecammTerinsttaallllatioorreENayatttteenncchheecckktthheeiinnsstt
TK210 GPS Car Alarm Website: http://www.GPScaralarm.com User ManualPage20Please keep the terminal in dry place. In case of soaking or leaking water,contact the local professionals. Do not start the car yourself, or we take noresponsibility for any loss caused thereafter.When the car is inside buildings, cave, tunnel, or very close to tall buildings, itis normal that the device might not get GPS signal at that moment.Please check the balance of the tracker’s SIM card periodically. If there is nocredit in the SIM card, the device can not work normally.The backup battery. The backup battery can only work for a certain time whenthe car battery is temporarily powered off.If the device can not get GSM signal or GPS signal, please try to check theconnection of the antennas, it might get loosen or damaged. Please try toexchange to use another good antenna to test.TOPTEN
This equipment complies with FCC RF radiation exposure limits set forth for anuncontrolled environment. This device and its antenna must not be co-located oroperating in conjunction with any other antenna or transmitter.To comply with FCC RF exposure compliance requirements. The device must beinstalled by professional car electrician. The antennas and Microphone and speakerused for this transmitter must be installed to provide a separation distance of at least 25cm from all persons (driver and passengers) and must not be co-located or operating inconjunction with any other antenna or transmitter.”Changes or modifications not expressly approved by the party responsible forcompliance could void the user's authority to operate the equipmentNOTE: This equipment has been tested and found to comply with the limits for a ClassB digital device, pursuant to Part 15 of the FCC Rules. These limits are designed toprovide reasonable protection against harmful interference in a residential installation.This equipment generates, uses and can radiate radio frequency energy and, if notinstalled and used in accordance with the instructions, may cause harmfulinterference to radio communications. However, there is no guarantee thatinterference will not occur in a particular installation. If this equipment does causeharmful interference to radio or television reception, which can be determined byturning the equipment off and on, the user is encouraged to try to correct theinterference by one or more of the following measures:-- Reorient or relocate the receiving antenna.-- Increase the separation between the equipment and receiver.-- Connect the equipment into an outlet on a circuit differentfrom that to which the receiver is connected.-- Consult the dealer or an experienced radio/TV technician for help.FCC ID: X3U-TK210Model No.: TK210Manufacturer: Topten electronics Technology Limited.This device complies with Part 15 of the FCC Rules.Operation is subject to the following two conditions: (1) thisdevice may not cause harmful interference, and (2) thisdevice must accept any interference received, includinginterference that may cause undesired operation.

Navigation menu