ZyXEL Communications PRESTIGE310 User Manual 49082
ZyXEL Communications Corporation 49082
Contents
- 1. 8
- 2. User Manual
8
Prestige 310 User 's Guide Version 1.0 ZyXEL TOTAL INTERNET Access SOLunoN Preslige 310 Bmadband Internet Access Router The declarations of CE marking: The Prestige 310 has been approved for connection to the Public Switched Telecommunication Network using interfaces compatible with lTU-TSS recommendation L420 (Basic Rate ISDN user access). The Prestige 310 complies with the following directiVes: 1. The Council Directive 89/336/EEC of 3 May 1992 on the approximation of the laws of the member states relation to Electra Magnetic Compatibility. (EMC Directive). 2. Council Directive 9l/263/EEC of29 April 1991 on the approximation of the laws of the Member States concerning telecommunication terminal equipment. (The Telecom Terminal Equipment Directive). 3. 93/6S/EEC of 22 July 1993 amending the Directives 89/336/EEC, 91/263 IEEC and 92/31/EEC. (Marking Directive). 4. The Council Directive 92/31/EEC of 28 April 1992 amending directive on the approximation of the laws of the member states relating to Electra Magnetic Compatibility ECG Interference Statement iii Customer Suppon Prestige 3 I 0 Broadband Internet Access Router Ifyou have questions about your ZyXEL product or desire assistance, contact ZyXEL Communicanons Corporatmn offices worldwide, in one of the following ways: Method E-MaiI-Tech Support E-Mail~ Sales lnlemalional support@zyxel.oom.tw suggon@zyxe!.co.at (Europe) sales@zyxel.com,tw NorthAmarica gunmfizyxslxom su rt Ldk sale 1 xI m §§I§@zyxel.dk Web Site Phone FTP 401mm and ROM upwzdes Regular Mail WW wee-36733942 Ext.sz +888—3A5782439 ftgzyxeLdk ZyXEL Communications Corp., 6 Innovation Road II, Science-Based Industrial Park, Hsin—chu, Taiwan 300, R.O.C< www gyxgldk +45-3955—0700 www.zyxeLcom +1-714—S320882 800-255-4101 +1-714-632—0858 +45-3955-0707 Mum ZyXEL ZyXEL AIS fizv‘nmumcatbns Columbusvs] 5, 1650 Miraloma 235° subm- Avenue, P|aoenlia, Copenhagen, Denmafk CA 92870, U.S.A. Customer Suppan‘ Prestige 3 IO Broadband Internet Access Rauler Table of Contents Table of Contents .............. in List of Figures ............... List of Tables ................ Preface .......................... Chapter 1 ....................... Getting to Know Your Router. 1.1 Prestige 310 Broadband Route 1.2 Features of Prestige 310 ................................................................................................... 1-1 13 Applications for Prestige 310 ............................................................................................ 1—3 1.3.1 Intemet Access .......................................................................................................... 1-3 Chapter 2 .......... Hardware lnstalla on a In Setup 2.1 Front Panel LEDs and Back Panel Ports. 2.1.1 FrontPanelLEDS 2.2 Prestige 310 Rear Panel and Connections ....................................................................... 2-2 2.3 Additional Installation Requirements ................................................................................. 2-3 2.4 Slacking ZyXEL Routers 2.5 Power On Your Prestige... 2.6 Navigating the SMT Interfac 2.6.1 MamMenuZ-7 2.6.2 System Management Terminal Interface Summary .................................................. 2.7 2.7 Changing the System Password ....................................................................................... 248 2.8 General Setup ................................................................................................................... 2-9 2.9 WAN Semg......... 2.10 LAN Setup...... Table of Contents vii Prestige 3 I 0 Broadband [merrier Access Rnuter 6.2.3 TCP/IP Filter Rule 62.4 Generic Filter Ru1e 6.3 Applying a Filter......... 6.3.1 Ethernet traffic ........................................................................................................ 641 6.3.2 Remote Node Filters ............................................................................................... 6-12 Chapter 7 .............................. 7-1 System Malntenance ........... ...1-1 7.1 System Status ............................................................... .7-2 7.2 Console Port Speed .7-4 7.3 Log and Trace. 7.3.1 Viewing Error Log 7.3.2 Unix Syslog ............................................................................................................... 7-6 74 Diagnostic ....................................................................................................................... 7~7 7.5 Backup Configuration ........................................................................................................ 7—8 7.6 Restore Configuration ........................................ 7,7 Firmware Update .................. 7.7.1 Uploading the RAS Code 7.7.2 Uploading ROM File 7.7.3 TFTP Transfer...... 7.8 Cummand Interpreter Mode ............................................................................................ 7-13 7.8.1 Boot commands7-14 chapter 8 ...... Telnet Configuration and Capabllltles .......... 8.1 About Telnet Configuration 8.2 Telnet UnderSUA 8.3 Telnet Capabilities. 8.3.1 Single AdmmtstratorS-Z Table of Contents ix Pres/we 310 Broadband lnte‘mel Access Router List of Figures Figure l-l lntemet Access Application ...... 1.3 Figure 2-1 Front Panel ...2-1 Figure 2-2 Prestige 310 Rear Panel and Connections ...2—2 Figure 2—3 Initial Screen ...... 2—4 Figure 2—4 Login Screen. 2-5 Figure 2-5 Prestige 310 Main Menu. 2-7 Figure 2-6 Menu 23 - System Security 248 Figure 2-7 Menu 1 - General Setup,. FigureZ-S Menu 2 — WAN Setup... Figure2-9 Menu 3 - LAN Setupw Figure 2-10 Menu 3.1 - General LAN Setup... Figure 3-1 Menu 3 - LAN(10/100Mbps Ethernet) Setup,.... Figure 3-2 Menu 3.2 — TCP/lP and DHCP LAN Setup Figure 3-3 Menu 4 - Internet Access Setupm 2-9 -10 Figure 34 Single User Account Topology ...... Figure 3-5 Menu 4 — Internet Access Semp for Single User Account Figure 4-1 Example of Static Routing Topology Figure 4:2 Menu 12.1 » Edit IP Static Route Figure 4-3 Menu 12. Edit H’ Static Route Figure 5-1 Multiple Sewer Configuration Figure 6-1 Outgoing Packet Filtering Process Figure 6-2 Menu 21 - Filter Set Configuration Figure 6—3 Menu 21.1 » Filter Rules Summary Figure 6-4 Menu 212 » Filter Rules Summary Figure 6-5 Menu 21.1.1 ~ TCPIIP Filter Rule ..... Figure 6-6 Menu 21.1.2 - Generic Filter Rule..... List of Figures/Tablas xi Pres/[gs 3 / 0 Broadband Internet Access Rouler List of Tables Table 2-1 LED functions ..... ...2-l Table 2~2 Main Menu Commands“. 2-6 Table 2~3 Main Menu Summary 2-7 Table 2-4 General Setup Menu Fields... ,..2»9 Table 3-1 DHCP LAN Setup Menu Fields ....... 345 Table 3»2 TCP/lP LAN Setup Menu Fields 3-6 Table 3-3 lntemet Access Setup Menu Fields ..... Table 3—4 Single User Account Menu Fields ...... Table 4~l 1? Static Route Menu Fields , Table 5-1 Services vs. Port number Table 6-1 Abbreviations Used in the Filter Rules Summary Men Table 7~1 System Maintenance - Status Menu Fields Table 7-2 System Maintenance Menu Syslog Parameters ..... Table 7-3 System Maintenance Menu Diagnostic... Table 9-1 Troubleshooting the Start-Up of your Prestige Table 9-2 Troubleshooting the LAN Interface Table 9-3 Troubleshooting the WAN interface..." List of Figures/Tables xiii Prestige 310 Broadband Internet Access Roulet- Syntax Conventions For brevity's sake, we will use “cg." as a shorthand for “for instance" and “Le." for “that is" or “in other words" throughout this manual. Preface xv Pres/iqe 3 I 0 Broadband [meme] Access Ron/er Chapter 1 Getting to Know Your Router This chapter describes the key features and applications of your Prestige. 1.1 Prestige 310 Broadband Router The Prestige 310 is a high bandwidth Internet access router that connects your LAN to the Internet using the existing television cable. It is ideal for cable users with more than one PC and as an alternative to the more expensive leased lines. 1.2 Features of Prestige 310 The following are the key features of the Prestige 310. Auto-negotiating 10/100Mbps Ethernet The LAN interface automatically detects if it’s on a 10/100 Mbps Ethernet. Single User Account (SUA) The SUATM (Single User Account) features allows multiple users to share a single ISP account. Packet Filter The Packet Filter blocks unwanted traffic from entering your network DHCP Server The Prestige's DHCP (Dynamic Host Configuration Protocol) server capability allows you to automatically assign TCP/[P settings to a workstation on your network. ‘ DHCP Client ['he Prestige's DHCP client capability allows it to get automatically its IP address from the ISP on he WAN. Full Network Management Accessing SMT (System Management Terminal) through the console port or telnet connection. Getting to know your Prestige 1-1 Prestige 1 I 0 Broadband Internet Access Router 1.3 Applications for Prestige 310 The followmg sections show you the possible applications for your Prestige. 1.3.1 Internet Access The Prestige is the ideal high-speed Intemet access solution. Your Prestige supports the TCP/IP protocol, which the Internet uses excluswely. A typical Internet Access application is shown below. small I Home Office LAN 1 0/1 DOM Ethernet lNTERN E 10m Etnemet Cable Modem Prestige 310 Figure 1-1 Internet Access Application Meme! Single User Account Tor a SOHO (small office/Home Office) environment, your Prestige offers a Single User Account SUA) feature that allows multiple users on the LAN (Local Area Network) to access the Internet zencun'ently for the cost of a single userl Getting to know your Prestige Prestige 310 Broadband lntzrnet Access Ron/er Chapter 2 Hardware Installation & Initial Setup This chapter shows you how to connect the hardware and to perform the initial setup. 2.1 Front Panel LEDs and Back Panel Ports 2.1.1 Front Panel LEDS The LED indicators on the front panel indicate the functional status of the Prestige. ZyXEL PRESTIZG‘E km "‘1;' "4 «rm 4 Figure 2-1 Front Panel The following table describes the LED functions: Table 24 LED functions LEDs Funcfion [Fm-cater Status Active Description =WFt Power Green I9" The power adapter is connected to the Prestige. SYS S/stem F— Off The system is not ready or failed. _I On The system is ready and running Flashing The system Is rebooting. 10M LAN LAN Green On The Prestige is connected to a 10Mbps LAN. Flashing The 1DM LAN is sendinglraceiving packets. r— Off Ths10M LAN is not connected. any Orange On The Prestlge is connected to a 100Mbps LANi ——l Flashing The 100M LAN is sending/receiving packets. _._'_ l _r— Hardwans Installation and Setup 2-1 Prestige 310 Broadband lnlernet Access Router This section outlines how to connect your Prestige 3l 0 to the LAN and the WAN. Step 1. Connecting the Cable Modem Connect the coaxial cable from your cable service to the threaded coaxial CABLE connector on the back of the cable modern. Step 2. Connecting the Presn'ge to Cable Modem Connect the WAN port (silver) on the Prestige to the LAN port on the cable modem using a straight through Ethernet cable. The Ethernet port on the cable modem is sometimes labeled "PC" or "Workstation'fl Step 3. Connecting the Prestige to the LAN If you have more than one PC, you must use an external hubt Connect the 10/ IOOM LAN port (gold) on the Prestige to a port on the hub using a straight through Ethernet cable. If you only have on PC, you can connect the Prestige to the PC directly without a hub. For a single PC, connect the lO/lOOM LAN port on the Prestige to the Network Adapter on the PC using a crossover cable (red tag). Step 4. Connecting the Power Adapter to your Prestige Connect the power adapter to the port labeled POWER on the rear panel of your Prestige. Step 5. Connecting the Console Port For the initial configuration of your Prestige, you need to use terminal emulator sofiware on a workstation and connect it to the Prestige through the console port. Connect the 9-pin (smaller) end of the console cable to the console port of the Prestige and the 25»pin (bigger) end to a serial wort (COMl, COMZ or other COM port) of your workstation. You can use an extension RS-232 table if the enclosed one is too short. \fier the initial setup, you can modify the configuration remotely through telnet connections. 2.3 Additional Installation Requirements n addition to the contents of your package, there are other hardware and software requirements you need before you can install and use your Prestige. These requirements include: \ computer with an Ethernet NIC (Network Interface Card) installed. \ computer equipped with communications sofiware configured to the following parameters: 0 VT] 00 terminal emulationi 0 9600 Baud. 0 No parity, 8 Data bits, 1 Stop bitt Hardware Installation and Setup 2-3 Pleslige 310 Broadband [merrier Accexs Router Step 2. Entering Password The login screen appears after you press [Enter], promptmg you to enter the password, as shown below. For your first login, enter the default password 1234. As you type the password, the screen displays an (X) for each character you type. Please note that ifthere is no activity for longer than 5 minutes after you log in, your Prestige will automatically log you out and will display a blank screen If you see a blank screen, press [Enter] to bring up the login screen again. Enter Plsiword xxxx Figure 2-4 Login Screen Hardware Installation and Setup 2-5 Preslige 5 l 0 Emndband Internet Access Router 2.6.1 Main Menu Afier you enter the password, the SMT displays the Prestige 310 Main Menu, as shown below. presuge nu nun Wenu Geccmg Started Advanced mmgemenz L General Setup 21. Filter set: Cenfkquratsflfl 2. mm Setup 3. w Setup 23. system Password 14. System Maintenance Advanced Applicatxuns 11. Static Hauling Setup 12. sun Server Setup 99. man Enter Menu Selectman Number: Figure 2-5 Prestige 310 Main Menu 2.6.2 System Management Terminal Interface Summary Table 2-3 Main Menu Summary g at Menu Title Description 1 General Setup Use this menu in setup general information. 2 jWAN Setup Use this menu to setup the WAN, 3 LAN Setup Use this menu to setup the LAN. 4 Internet Access Setup rA quick and easy way to setup lntemet connection 12 Static Routing Setup Use this menu to setup static route for dlflerent protocols 15 SUA SSW“ 59109 Use this menu to specify lnsida sewers when SUA is enabled. 21 Filter Set Configuration Use this menu to setup filters to provide eewrity. A 1 23 System Passworfl Use this menu to setup a new password. 24 System Maintenance 1T_hls menu provides system status, diagnostics, firmware upload, etc. 99 Exit To exit from SMT and return to the blank screen. Hardware Installation and Setup 2-7 Prestige 3 I 0 Bmadband Internet Access Router 2.7 Changing the System Password The first thing your should do before anything else is to change the default system password by following the steps below. Stop 1. Enter 23 in the Main Menu to open Menu 23 - System Password as shown below. Menu 23 l , system Password old Fasswcrd- xxxx New Password: xxxx Retype to cannrm: xxxx Enter here =o CONFIRM or as: no CANCEL- Flgure 2-6 Menu 23 - System Security Step 2. Enter your existing password and press [Enter]. Stop 3. Enter yuur new system password and press [Enter]. Step 4. Re—type your new system password for confirmation and press [Enter]. Note that as you type a password, the screen displays a (X) for each character you type. 2-B Hardware Installation and Seth Prestige 3 I 0 Broadband [merrier Access Router 2.6 Navigating the SMT Interface The SMT (System Management Terminal) is the interface that you use to configure your Prestige. Several operations that you should be familiar with before you attempt to modify the configuration are listed in the table below. Table 2-2 Main Menu Commands Operation PrastlDescription Move lorward to [Enter] To move forward to a sub-menu, type in the number of the desired another menu sub-menu and press [Enter]. Move backward to [Esc] Press the [Esc] key to move back to the previous menu. a previous menu [Enter] or Within a menu, press [Enter] to move to the next field. You can also M°Ve the cursor use the [Up]/[Down] arrow keys to move to the previous and the nexl [U PVlDOWn] field, respectively. arrow keys Enter‘irrferrnation Fill in, or You need to fill in two types of fields. The first requires you to type ir the appropriate information. The second allows you to cycle through Press the the available choices by pressing the [Space] bar. [Space bar] to toggle Required fields <7) All fields with the symbol <7> must be filled in order be able to save the new configuration. N/A fields Some of the fields in the SMT will show a . This symbol refer to an option that is Not Appllcable. [Enter] Save your configuration by pressing [Enter] at the message [Press Save WW, ENTER to confirm or ESC to cancel]. Saving the data on the soreer configuration will take you. in most cases to the previous menu. T e 99, then T e 99 at the Ma'n Men rom and ress Enter to exit the SMT ExittheSMT W Y” ' "p m p l ] press [Enter]. interface. 245 Hardware Installation and Sen. Prestige 3 I 0 Broadband Inlernet Access Ran/er A cable modem and an 15? account After the Prestige is properly set up, you can make future changes to the configuration through telnet connections. 2.4 Stacking ZyXEL Routers Your Presttge's has legs that fit together for sturdy stacking. You should not stack more than four routers for maximum stack stability. 2.5 Power On Your Prestige At this point, you should have connected the console port, the LAN port, the WAN port and the power port to the appropriate devices or lines, Plug the power adapter into a wall outlet. The Power LED should be on. The SYS LED will come on afier the system tests are complete. The WAN LED and one of the LAN LED‘s come on immediately after the SYS LED comes on, if connections have been made to the LAN and WAN ports. Step 1. Initial Screen When you power on your Prestige, it performs several internal tests as well as line initialization. After the tests, the Prestige asks you to prefi [Enter] to continue, as shown. ZyXEL Bros. Build en en Mar 05 1315.20 1999 um: Size = cuss Khytes nun POST: Testing: mssk ox Fus‘u. inter an romoxnsooauou zyxei. Buotzxtensinn Version beam], mind at wed Mar in 11:13:21 1995 Press any key to enter debug mode menu. 3 “Candi. Enter Debug mode. Figure 2-3 Initial Screen 24 Hardware Installation and Sam Prestige 3 10 Broadband Internet Access Router Of! The 100M LAN is not connected. WAN WAN Green Of! The WAN Link is not ready. or failed. On The WAN Link is ok Flashing The 100M LAN link is sending/receiving packets. 2.2 Prestige 310 Rear Panel and Connections The figure below shows the rear panel of your Prestige 310 and the connection diagram. [E [D Power Outlet 10/100Mbps Ethernet Power Adapter SMT Management Cable Modem ou'cToE’iaCE Figure 2-2 Prestige 310 Rear Panel and Connections 2-2 Hardware Installation and Sam; Pres/[gs 3 IO andband Internet Access Romer- 1.4 Getting to know your Prestig‘ Prestige 1 I 0 andband Inlemer Access Router RoadRunner Support In addition to standard cable modem services, the Presnge supports Time Warner's RoadRunner Service. Logging and Tracing 0 Built-in message logging and packet tracing. 0 Unix syslog faculty support. Upgrade P310 Firmware via LAN The firmware of the Prestige 310 can be upgraded via the LAN, 1-2 Getting to know your Prestigl Prextige 31 0 Broadband Inlernel Access Ramm- xvi Prefac Prestige 3 [0 Broadband Internet Access Router Preface About Your Router Congratulations on your purchase of the Prestige 310 Broadband Router. The Prestige 3 IO router connects your 10/ lOOMbps LAN to the Internet through your a cable modem. Your Prestige 310 is easy to install and to configure since you do not need to set any switches, The Prestige Network Corru-nander (PNC) is a GUI based utility that allows you to access the Prestige‘s management settings. Moreover, all functions of the Prestige 310 are software configurable via the SMT (System Management Terminal) Interface. The SMT 15 a menu-driven interface that you can access from either a terminal emulator or Telnet on a PC. About This User's Manual The nine chapters ofthis manual are designed to guide you through the configuration of your Prestige 310 for its various applications. Structure of this Manual This manual is divided into five parts: 1. Getting Started (Chapters 1-2) is structured as a step-by-step guide to help you connect, install and setup your Prestige to operate on your network. 2. The Intemet (Chapter 3) describes how to configure your Prestige for Internet access. 3. Management & Maintenance (Chapters 4-7) provides information on management and maintenance facilities for network administrators 4. Telnet Configuration and Capabilities (Chapter 8) provides information configuring using Telnet. 5. Troubleshooting (Chapter 9), provides information about solving common problems. Regardless of your particular application, it is important that you follow the steps outlined in Chapters 1-2 to connect your Prestige to your LAN. You can then refer to the appropriate chapters of the manual, depending on your applications. xiv Prefer: Prestige 3/0 Broadband Internet Access Router ...6-1l ,. 6-12 Figure 67 Filtering Ethernet traffic ...... Figure 6-8 Filtering Remote Node traffic Figure 7-l Menu 24 - System Maintenance ..... Figure 7-2 Menu 24.1 - System Maintenance — Status Figure 7-3 Menu 24.2 — System Maintenance — Change Console Port Speed ..... Figure 7-4 Examples of Ermr and lnfonnation Messages... Figure 7-5 Menu 24.3 2 - System Maintenance - Syslog and Accounting ..... Figure 7-6 Menu 24.4 - System Maintenance - Diagnostic Figure 7-7 Menu 24.7 - System Maintenance - Backup Configuration... Figure 7-8 Menu 24.5 ~ System Maintenance - Backup Configuration... Figure 7-9 Menu 24.7 - System Maintenance - Upload Firmware Figure 7-10 Menu 24.7.1 — System Maintenance - Upload RAS Code Figure 7-11 Menu 24.7.2 - System Maintenance — Upload ROM File ..... ,. 7413 Figure 7-12 Command mode Figure 7~13 Boot module commands... Figure 8-1 Telnet Configuration on a TCPIIP Network... xii List of Figures/Table. Prexn'ge 3 If} Bmmflmnd Intemel Anem- Router 8.3.2 System Timeout ...................... Chapter 9 .......................... Troubleshootlng 9.1 Problems Starting Up the Prestige 9.2 Problems with the LAN Interface, 93 Problems with the WAN interface Appendix A ...... Acronyms and Abbreviations ..... Index x Table of Content Prestige 3 I 0 Broadband Internet Access aner 2.10.l General LAN Setup ............................................................................................. 2-H 2.11 Protocol Dependent LAN Setup. .......................... 2-12 Chapter 3 .. .3-1 .3-1 lnternet Access 3.1 TCP/IP and DHCP for LAN ................................................................... .3-1 3.1.1 Factory LAN Defaults ............................................................................................... 3-1 3.1.2 1? Address and Subnet Mask .................................................................................... 3—1 3.1.3 RIP Setup ................................................................................................. 3-2 31.4 DHCP Configuration ................................................................................................. 3-2 3.2 TCP/lP LAN Setup and DHCP .......................................................................................... 3-4 3.3 internal Access Setup ......................... 3-7 3.4 Single User Account" 3.4.1 Advantages of SUA 3.4.2 Single User Account Configuration Chapter 4 ..................................... lP Static Route Setup .................................................................................................................. 4-1 4.1 IP Stalic Route Setup. Chapter 5 Multiple SUA Servers 5.1 Multiple Servers behind SUA ............................................... 5.1.1 Configuring a Server behind SUA ............................................................................ 5- Chapter 6... Filter Configuration 62 Configuring a Filter Se 6.2.1 Filter Rules Summary Menu ........................... 6.2.2 Configuring a Filter Rule . viii Table of Content Prestige 310 Broadband Internet Access Rauter vi Customer Supper Prestige 310 Broadband Internet Access Router FC C I D ‘. I 81 ‘P R 25116 a 9 /0 ZyXEL Limited Warranty ZyX EL warrants to the original end user (purchaser) that this product is free from any defects in materials or workmanship For a period of up to two (1) years from the date of purchase. During the warranty period, and upon proof ptpurcnnse, should the product have indications offailure due to rnulty workmanship and/or materials, ZyXEL will, at Its discretion, repair or replace the defective products or components wtthour charge for either pans or labor‘ and to whatever extent it shall deem necessary to restore the product or components to proper operating condition. Any replacement will consist ofa new or re—manufaclurcd functionally equivalent product of equal value, and will be solely at the discretlon onyXEL. This warranty shall not apply it'the product is modified, misused, tampered with, damaged by an act of God, or subjected to abnormal working condilicns Note Repair or replacement, as pmVided under this warranty, is the exclusive remedy oflhe purchaser. This warranty is in lieu orsii other warranties express or implied. including any implied warranty ofmcrchamability or fitness for a particular use or purpose. ZyXEL shall in no event be held liable for indirect or consequential damages of any kind of character to the purchaser. To obtain the services of this warranty, contact ZyXEL‘s Service Center; refer to the separate Warranty Card for your Return Material Authorization number(RMA). Products must be retumed Postage Prepaid. it is recommended that the unit be insured when shipped. Any returned products without proof of purchase or those with an out—dated warranty will be repaired or replaced (at the discretion onyXEL) and the customer will be bllled for parts and labor. All repaired or replaced products will be shipped by ZyXEL to the corresponding return address, Postage Paid (USA and territories only). If the customer desires some other retum destination beyond the Us. borders, the customer shall bear the cost of the return shipment. This warranty gives you specific legal rights, and you may also have other rights which vary fi-om state to state. Thiseqiumnem' hasbecntefledandfmmdmumplywiththclimitsfmaClxss‘Bdtglml device, pursumtml’nn l5 ofthe FCC Rules. Theselimits'atedcst'gnedtoynwdc reasonable protection agamsthmnfullmerfetmoemnmdmmlmsullaunn This equipment gmemes, um and can radiate radio flcqncncy energy end, ifnot mstallcd mdusodntamdmcewnbthcmmncfimmaycanschamfiumtetmmwmxddm oummmtications HoweverJhcxeisnoguamntoethminmfemoevuflnotoccnrma panicularinmflatim. chiseqinymentdocsunsehmfifllntetfemoetondinm televiximrowpfimwhichunbedeteminedhymmingmeoqmpmmtofl‘mdmthe userisoncmmgedwttytc correct the interferencehynne ofthe followmg measures: - Romimtotrelocuethercoeivinsantmna. and ' - lncteasethcsepanfionbetweentlieeqmpmcnt _t'ewlvet. , , Connoameomnpmemmmanmkxmacimmwfl‘exmfivmthatwwhmh thereceivexisconnouetl .. - Consultthedoalet oranexpetienccdradiofI‘V technician for help. FCCCautinn: Toessntecunfinnodmpfianwmsemlyshieldidnmdfimfice cableswhmcmmect’mgLANandWANnetworkcannomuns. y {363m 4 iv modifications not expresslyapptovod hythe panyrcspnnsxble for compliance ounldvmd thensct‘sauthoritytnopemtethiseqmpnent. Varranh Prestige 3117 Broadband Internal Access [miner Prestige 310 Broadband Internet Access Router Copyright Copyright © 1999 by ZyX EL Communications Curpnmtion. The contents oflhis publication may not be reproduced in any pm or as a whole, transcribed, stored in a relrievzl] system, translated into any language. or transmitted in any form or by any means, electronic, mechanical, magnetic, optical, chemical, photocopying, manual, or otherwise, without the prior written permission onyXEL Communications Corporation, Published by ZyXEL Communications Corporation All rights reserved. Disclaimer ZyXEL does not assume any liability arising out ofihs application or use ofsny producls. or software described herein. Neither does it convey any license under its patent rights not the patent rights ofothers. ZyXEL further reserves the right to make changes in any products described herein Without notice. This publication is subject to change Without notice. Trademarks Trademarks mentioned in this publication are used for identification purposes only and may be pmperiies uitheir respective owners. Prestige 3/0 Hmadband Inlernet Access Router 2.8 General Setup Menu 1 - General Setup contains administrative and system-related information. To enter Menu 1 and fill in the required information, follow these steps: step 1. Enter 1 in the Main Menu to open Menu 1 - General Setupt Step 2. The Menu 1 - General Setup screen appears, as shown below. Fill in the required field marked [7]. Menu 1 , General Setup System Mime: 7 Prgls ENTER to cannm or has: to Cancel: Figure 2-7 Menu 1 — General Setup The fields for General Setup as shuwn belnw Table 24 General Setup Menu Fields Field Description Choose a descriptive name for identification purposes. Thls name can be up to 30 alphanumeric characters long. Spaces are not silt/wed. but dashes "-' and underscores "." are accepted. System Name Hardware Installation and Setup 2-9 Prexggg 310 Broadband Inlemet Access Router 2.10 LAN Setup This section describes how to configure the LAN using Menu 3 — LAN Setup (10/100Mbps Ethernet). From the Main Menu, enter 3 to open Menu 3. Menu J , mu Setup i. Genazai Setup 4 2. rep/n: and DHCP Setup i Enter Menu seleceten Number: . ; i%¢;a¢.xmwwsflwv1~a Flgure2-9 Menu 3 - LAN Setup 2.10.1 General LAN Setup This menu allows you to specify the filter sets that you wish to apply to the LAN traffic, You ;eldom need to filter the LAN traffic, however, the filter sets may be useful to block certain 7ackets, reduce traffic and prevent security breaches. Menu 3.x A Better!) um Setup input me" Sens: protocol filters- duviee sneer;- output 1:11“: sees: prneocnl unen- aemee ixlcnrss Press mm to confirm or 55: to Cancel: Figure 2-10 Menu 3.1 - General LAN Setup 5 you need to define filters, please read Chapter 7- Filter Slat Configuration, then retum ta this menu to apply the filter sets. Hardware Installation and Setup 2—11 Prestige 310 Broadband Internet Access Ron/er Chapter 3 Internet Access This chapter shows you how to configure the LAN as well as the WAN of your Prestige for Internet access. 3.1 TCPIIP and DHCP for LAN The Prestige has built-in DHCP server capability that assrgns IP addresses and DNS sewers to systems that support DHCP client capability. 3.1.1 Factory LAN Defaults l'he LAN parameters of the Prestige are preset in the factory with the following values: IP address of l92.168.l.l with subnet mask of255.255.255.0 (24 bits) DHCP server enabled with 32 client IP addresses starting from l92.168.1.33. These parameters should work for the majority of installations lithe parameters are satisfactory, you can skip to section 3.2 TCP/IP LAN Setup and DHCP to enter the DNS server address(es) it‘ your ISP gives you explicit DNS sewer address(es). If you wish to change the factory defaults or to learn more about TCP/IP, please read on. :.1.2 IP Address and Subnet Mask imilar to the houses on a street that share a common street name, the machines on a LAN share ne common network number, also ’here you obtain your network number depends on your particular situation. If the ISP or your etwork administrator assigns you a block of registered 1? addresses, follow their instructions in electing the IP addresses and the subnet mask. fthe ISP did not explicitly give you an IP network number, then most likely you have a single ser account and the ISP will assign you a dynamic IP address when the connection is established. {this is the case, it is recommended that you select a network number from 192.168.00 to 92,168.2550 (ignoring the trailing zero) and you must enable the Single User Account feature of he Prestige. The lntemet Assigned Number Authority (IANA) reserved this block of addresses specifically for private use; please do not use any other number unless you are told otherwise, lntemet Access 3-1 Pnexngiila Broadband Internet Access Router When configured as a relay, the Prestige relays the requests and responses between the clients and the real DHCP sever. IF Pool Setup The Prestige is pre-configured with a pool of 32 IP addresses staning from 192.168.1314 to 192.168, 1.64. This configuration leaves 31 IP addresses (excluding the Prestige itself) in the lower range for other server machines, e.g., server for mail, FTP, telnet, web, etc., that you may have. DNS Server Address DNS (Domain Name System) is for mapping a domain name to its corresponding IP address and vice versa, e.g.. the IP address of www.zyxel.com is 204.2l 7.0.2. The DNS server is extremely important because without it, you must know the IP address of a machine before you can access it. The DNS server addresses that you enter in the DHCP setup are passed to the client machines along With the assrgned [P address and subnet mask. [here are two ways that an ISP disseminates the DNS server addresses. The first is for an ISP to all a customer the DNS server addresses, usually in the form of an information sheet, when you ign up. If your lSP does give you the DNS server addresses, enter them in the DNS Server fields n DHCP Setup, otherwise leave this field blank Erelay Server Address When the DHCP is set to Relay, the Prestige will request H> addresses from a real DHCP server nd relay the address to the workstation making the request. meme! Access 3-3 Pres/Age 3 I 0 Broadband Internal Access Ron/er Follow the instructions in the foilowmg table on how to configure the DHCP fields. Table 3-1 DHCP LAN Setup Menu Fields Field Description Example DHCP Setup DHCP= This field enables/disabled the DHCP server/relay. If it is set to None Server. your Prestige will act as a DHCP sewer. If set to None, Se d 1 I DHCP service will be disabled and you must have another rveri e au ‘) DHCP sever or relay on your LAN, or else the workstation must Relay be manually configured. When DHCP is set to Server, the following five items need to be set. it set to Relay, you must specify the Remote DHCP server. Client IP Pool This field specifies the first of the ecntigucus addresses in the 192.168.1433 Starting Address IP address pool. Size of Client lF' Pool This field specifies the size, or count, of lhe IP address pool. 32 Primary DNS Server Secondary DNS Sewer Remote DHCP Server = Enter the IP addresses of the DNS sewers. The DNS sewers are passed to the DHCP clients along with the IP address and the subnet mask. Enter the lP address of the true DHCP server when the Prestige is configured as a DHCP Relay. lntemstAccsss 3-5 Prestige 3 I 0 Broadband Internet Accexs Router 3.3 Internet Access Setup Menu 4 allows you to enter the lntemet Access information m one screen. From the Main Menu, enter 4 to go to Menu 4 - Internet Access Setup, as displayed below. Menu 4 » xmeme: Access Setup ISP'! Blame; Sarvlce Type- Standard server KP: m/A My Logm. N/A My Password: u/A 11> Address Assignmenz- Dynamxl: n: Addresl- N/A n= Subnel Hask- N/l Gateway-0.0.0.0 up DSracL’in—m: Nene Vazsxonx luv-1 single User Account- Yes Enter hue (o comma or use to CANCEL: Figure 3-3 Menu 4 — Intarnot Access Setup ntemet Access 3-7 Preslige 31!) Broadband Internet Access Router 3.4 Single User Account Typically, if there are multiple users on the LAN wanting to concurrently access the Internet, you will have to lease a block of legal, or globally unique, IP addresses from the ISP. Same Network Number 192.158.1.33 1924584434 192.155.141 192.168.1.35 Canle Modem Prestige 310 192.168.1.36 The SUA network appears as a single host to the Internet Figure 3-4 Single User Account Topology he IP address for the SUA can be either fixed or dynamically assigned, In addition, you can esignate servers, e.g., a web sewer and a telnet server, on your local network and make them caessible to the outside world. {you do not define any server, SUA offers the additional benefit of firewall protection If no ervcr is defined, incoming inquiries will be filtered out by your Prestige thus preventing intruders tom probing your network. ’our Prestige accomplishes this address sharing by translating the internal LAN IP addresses to a ingle address that is globally unique on the Intemctr For more information on IP address ranslation, refer to RFC 1631, The IP Network Address Translator (NAT). meme! Access 3-9 Prexrrge J I 0 Broadband Internet Access Router 3.4.2 Single User Account Configuration The steps for configuring your Prestige for Single User Account are identical to the conventional Internet access with the exception that you need to fill in one extra fields in Menu 4 - Internet Access Setup, as shown below; Menu 1 , Internet Access Setup 15p- 5 Name- HI Senate Tm: Home Server rp- N/A My Loginx N/l My Paesword= Nu it: Address Asstgnment- Stan: xp Addresh zn: 132,154,125 1p Subnet Hask- 255.255.2554: my ouecnom None [313m - single User Accoun a Knee: here no coupmn Or 535 to cmczn. SUA Figure 3-5 Menu 4 — Int-mat Access Setup for Single User Account to enable the SUA feature in Menu 4, move the cursor to the Single User Account field and elect Yes (or No to disable SUA). Then follow the instructions on how to configure the SUA ields. Table 3-4 Single User Account Menu Fields =Ielcl Description Single User Account Select Ves to enable SUA. 3fess [Enter] at the message [Press ENTER to Confirm ...] to save your configuration, or press [Eco] at anytime to cancel. nlernet Access 3-1 1 Prerrige 3/0 Broadband Internet Access Romm- Chapter 4 IP Static Route Setup This chapter shows you how to configure Static routes of your Prestige. Static routes tell the Prestige routing information that it cannot learn automatically through other means. This can arise in cases where RIP is disabled on the LAN. Each remote node specrfies only the network to which the gateway is directly connected, and the Prestige has no knowledge of the networks beyond. For instance, the Prestige knows about network N2 in the following diagram through remote node Router 1, However, the Prestige is unable to route a packet to network N3 because it doesn't know that there IS a route through remote node Router 2. The static routes are for you to tell the Prestige about the networks beyond the remote nodes. 911] Huh Prenize 31 0 Figure 4-1 Example of Static Routing Topology P Static Route Setup 4.1 Prestige 3 I 0 Broadband Internet Access Router The following table describes the IP Static Route Menu. Table 4-1 IF Static Route Menu Fields Field Descrlptton Route it The stafic route. (lvB) Route Name Enter a name tor the lF‘ static route for identification purposes. Active Activate/deactivate the static route. Destination IP Enter the Destination lP Address Address IP Subnet Mast Enter the IP subnet mast. Gateway IP Enter the number of the remote node that is the gateway of this static route. When a LAddress packers destination LAN (MAC) address matches the value entered above Metric Metric represents the “cost" of transmission for muting purposes. IP routing uses hop count as the measurement of cost. with a minimum at1 for directly connected networks. Enter a number that approximates the cost for this link. The number need not be precise, but it must be between 1 and 15. In practice. 2 or 3 is usually a good number. 1 to 15 Private This parameter determines if the Prestige will inctude the route to this remote node in its RlP broadcasts. ll set to Yes, this mute is kept private and not included In RIP broad—st, If No, the route to this remote node will be propagated to other hosts through RIP broadcasts. Yes/Nu Once you have completed filling in this menu. press [Enter] at the message [Press ENTER to Confirm...] to save your configuration. or press [Esc] to cancel. P Static Route Setup 4-3 Flange 310 Broadband Internet Access Router Chapter 5 Multiple SUA Servers The Chapter describes how to SetAup multiple servers when SUA is enabled, 5.1 Multiple Sewers behind SUA If you wish, you can make inside servers for different services, e.g., web or FTP, Visible to the outside users, even though SUA makes your whole insrde network appear as a single machine to the outside world. A service is identified by the port number, e,g., web service is on port 80 and FTPon port 21. As an example, ifyou have a web server at 192.168.12 and an FTP server 192.16S.l.3, then you need to specify for port 80 (web) the server at IP address 192.168.12 and for pon 21 (FTP) another at IP address l92.168. I .3. Please note that a server can support more than one service, e.g., a server can provide both FTP and DNS servrce, while another provides only web service. Also, since you need to specify the IP address of a server in the Prestige, a server must have a fixed IP address and not be a DHCP client whose IP address potentially changes each time it is powered-on. In addition to the sewers for specific services, SUA supports a default sewer. A service request that does not have a server explicitly designated for it is forwarded to the default server. If the default server is not defined, the service request is simply discarded. To make a sewer visible to the outside world, specify the port number of the service and the inside IP address of the server in Menu 15 - SUA Server Setup. 5.1.1 Configuring a Sewer behind SUA Follow the steps below to configure a sewer behind SUA: 1. Enter 15 in the min menu to go to Menu 15 - Multiple Server Configuration. 2. Enter the service port number in the Port it field and the inside IP address of the server in the IP Address field. Multiple S UA Servers 5—1 Pregng 310 Broadband Internet Access Rauter Chapter 6 Filter Configuration 6.1 About Filtering Your Prestige uses filters to decide whether to allow passage of a data packet. Data filters screen the data to determine if the packet should be allowed to pass. Data filters are further divided into incoming and outgoing filters, depending on the direction of the packet relative to a port. N0 Cum Data Packet ’ file's mm Matt" Drop padret Figure 6-1 Simpllfled outgoing Packet Fllterlng Process "he Filter Structure of the Prestlge L filter set consists of one or more filter rules. Usually, you would group related rules, e.g., all the iles for NetBIOS, into a single set and give it a descriptive name. The Prestige allows you to onfigure up to twelve filter sets with six rules in each set, for a total of 72 filter rules in the ystem. ’ou can apply up to four filter sets to a particular port to block multiple types ofpackets, With ach filter set having up to six rules, you can have a maximum of 24 rules active for a single port. rilter Configuration 6-1 Preslige 310 Broadband Internet Access Router Menu 21.1 — hue: Rulzs hungry u A Type Filter Rules 71 1 y m Pr-G, sn-umvmo, mm.n.o,n, nP-117 N 2 y m Pr=6. snxa.u,n.o, m-u,q,oln, np-ua n 1 y 1? lane, 5A-n.n.o.a, DA-o c,o,o,up-139 u A y 1? ppm. s more, DA .o.a.u, DF=1J7 u s y n: pr-n, SA-DvOfi-fl, nA-o.o.n.a, 01,1119 1- s v 1? mm, s .DADAD, DA=0 0.0.0, DF=lJS u Enter Filter Rule Number (1—5) m Contiguxe. 1 mn (claimants; Netams_wm a . uwmzumW-M ,,m.m WM ~ Figure 6-3 Menu 2141 - Filter Rules Summary Menu 11 z , Filter Rules summary u A Type filter Rules u m .o.u.u, 59 137. DA=O.V.U.U, mas; Entgr mm Rule Number (145) to Configure; 1 Figure 8-4 Menu 21.2 - Filter Rules Summary filter Configuration 6-3 Prestige 310 Broadband Internet Access Router The protocol dependent filter rules abbreviation are listed as follows: 0 If the filter type is [Pr the following abbreviations listed in the following table will be used. Table 6-2 Abbreviations Used If Filter Type Is IP Abbreviation Description Pr Protocol SA Source Address SP Source Port number DA Destination Address DP Destination Port number 0 If the filter type is GEN (generic), the following abbreviations listed in the following table will be used, Table 6-3 Abbreviations Used if Filter Type Is GEN Abbrevlatlon Description Off Oflset Len Length Refer to the next section for information on configuring the filter rules. i.2.2 Configuring a Filter Rule ”0 configure a filter rule, enter its number in Menu 21.1 - Filter Rules Summary and press Enter 3 open Menu 21.I,1 for the rule. here are two types of filter rules: TCP/IP and Generic. Depending on the type of rule, the iarameters below the type will be different. Use the space bar to select the type of rule that you vish to create in the Filter Type field and press Enter to open the respective menu. Fhe network layer filters are collectively called protocol filters. When NAT/SUA (Network \ddress Translation/Single User Account) is enabled, the inside IP address and port number are eplaced on a connection-by-connection basis, which makes it impossible to know the exact lddl’ESS and port on the wire. Therefore, the Prestige applies the protocol filters to the “native” IP iddreSS and port number before NAT ISUA for outgoing packets and after NAT/SUA for =ilter Configuration 6-5 Prestige 3/0 Broadband Internet Access Router incoming packets. On the other hand, the generic, or device, filters are applied to the raw packets that appear on the wire. To speed up filtering, all rules in a filter set must be of the same class, i.e., protocol filters or generic filters. The class of a filter set is determined by the first rule that you create. When applying the filter ses to a port, separate menu fields are provided for protocol and device filter sets. If you include a protocol filter set in a device filters field or Vice versa. the Prestige will warn you and will not allow you to save. 6.2.3 TCPIIP Filter Rule This section shows you how to configure a TCP/IP filter rule. TCP/IP rules allow you to base th rule on the fields in the IP and the upper layer protocol, e.g., UDP and TCP, headers. To configure a TCP/IP rules, select TCP/IP Filter Rule from the Filter Type field and press Entev to open Menu 21ll.l - TCP/IP Filter Rule, as shown below, Menu 21 1 1 ~ TCP/XP sneer Rule Filter a: 1,1 Filter Type- TCF/XP Fillet Rule Active- Yes tr Protocol: 5 rt: source Route: no Destination- rl> Addr- olu.o.n IP Mask 0.0 a n Farr. u: m Porr. » cenp- Equal Sauxce: rp Mdr- o o.o.n re Maek= 0.0 0.0 Part u- o For: n Ccnrp! Non- rel: Ester no More! Me Log- Nam Action Matched= Cheek Next. Rule Action Nor, Matched- Check Next Rule pr“: men to Confirm at ES: to c-nc-l: Pres: Space Bar to Toggle. Figure 6-5 Menu 21.1.1 - TCPIIP Filter Rule 6-6 Filter Configurati Prestige 3 l 0 Broadband Internet Access Router 6.2.1 Filter Rules Summary Menu This screen shows the summary of the existing rules in the filter set The following tables contain a brief description ofthe abbreviations used in Menu 21.1. Table 6-1 Abbreviations Used in the Filter Rules Summary Menu Abbrevlatlons Description Display it Relers to the filter rule number (1-6). A Refers to Active. [Y] means the filter rule IS active. L [N] means the filler rule is inactive. Type Refers to the type cf filter rule [GEN] for Generic This shows GEN for generic, IP for [IP] tor TCP/IP TCF’HF' Filter Rules The lilter rule parameters will be displayed here (see below). M Raters; to More. fl [Y] means there are more mles to check. 4 [N] means there are no more rules to the m Refers ta Action Matched. [F] means to torward the packet. [D] means to drop the packet. [N] means check the next mist n Relers to Acficn Net Matched [F] means to iorward the packet. [D] means to drop the packet. [N] means check the next rule. 6-4 Filter Configuratl Prexlzgg310 Broadband Interner Access Router 6.2 Configuring a Filter Set To configure a filter sets, follow the procedure below: Step 1r Select option 21, Filter Set Configuration from the Main Menu to open Menu 21. Menu 21 , leeer Ser. Configuration Filter Fxlter Set it Set u Comments 1 7 2 a J 9 4 1c 5 n e n Enter meg: Set. Number [a Cuntxgure: em: Comments- Press err-rs: to com-1m ax use no emcee Mowemwm M. Ma Figure 6-2 Menu 21 - Ftlter Sal Configuration Step 2A Select the filter set you wish to configure (no, l~12) and press [Enter]. Step 3. Enter a descriptive name or comment in the E111! Cements field and press Enter. Step 4. Press [Enter] at the message: [Press ENTER to confirm] to open Menu 2141 - Ftlter Rules Summary, 6-2 Filter Conflgurati Prestige 3 [0 Broadband Internet Access Runner 3. Press [ENTER] at the “Press ENTER Io confirm .. prompt to save your configuration afler you define all the servers or press ESC at any time to cancel, Menu 15 - Multiple Server Setup Fun: v [F Address Default 1. aaaaaoo Prees ENTER [0 Confirm or ESC to Cancel: Figure 5-1 Multiple Server Configuration The most oflen used port numbers are: Table 5-1 Services vs. Port number Services Part Number FTP (File Transfer Protocol) 21 . Telnet $3 POPS (Post Office Protocol, version 3) 110 SMTP (Simple Mail Transfer Protocol) 25 DNS (Domain Name Syswm) 53 _l HTTP (Hyper Text Transfer protocol or W, Web) 80 PPTP (Point-m-Poinl Tunneling Protocol) 1723 J 5-2 MultipIe SUA Serve. Prestige 3/ 0 Broadband Inlernet Access Router 4-4 IP Static Route Set Preslige_310 Broadband Internet Access Router 4.1 IP Static Route Setup Similar to network layer static routes, an 1? static route tells the Prestige about the route to a node before'a connection is established. You configure IP static mules in Menu 12. 1, by pressing selecting one of the IP static routes as shown below. Menu 12 - u> scant: Route Setup Enter selection number Flgure 4-2 Menu 12.1 - Edit IP Static Route Menu 11.1 , Bax: 1p sun: Rants Rance h 1 Route Mama: daE-lult Activa- Y“ Deltlnatinn (1: Address: 0.01 u 11: Sub“! Haflk- u.n.o.o Gateway us Address: “12432454459 Metric: z Pxxvate- Yes Pres: sum to cowsmn or ESC m CANCEL: Figure 4-3 Menu 12. Edit IP Static Route 4.2 [P Static Raute Se. Prestige 3 I (I Bmadbaml Internet Access Rauter 3.4.1 Advantages of SUA In summary: 0 SUA is a cost»effect1ve solution for small offices with less than 64 hosts to access the Intemeti 0 SUA supports servers to be accessible to the outslde world. 0 SUA can provide firewall protection if you do not specify a server. All incoming inquiries will be filtered out by your Prestige. 0 UDP and TCP packets can be routed. In addition, partial lCMP, including echo and trace route, is supported. 3-10 Internet Acce‘ Prestige 3 l 0 Broadband Internet Access Router The following table contains instructions on how to confi gure your Prestige for Internet access. Time Warner Table 3-3 Internet Access Setup Menu Fields Field Description ISP’s Name Enter the name of your Internet Service Provider, e.g.. mylSP. This information is for identification purposes only. Service Type Toggle between Standard and RoadRunner, the Time Warner's RoadRunner Service. Sewer IP Enter the IP Address of the remote gateway at the ISP's site. it you don't have this data, just leave it blank. My Login Name Enter the login name given to you by your ISP. My Password Enter the password associated with the login name above, IP Address Assignment If your ISP did not assign you an explicit ip address. select Dynamic, othsnnise select Static and enter the IP address & subnet mask in the following fields. IP Address Enter the IP address assigned to you when Static Assignment is selected. IP Subnut Mask Enter the subnet mask you assign when Static Assignment is selected, Getaway Enter the delault gateway L RIP Direction Select the RIP Direction. Verslon Select the RP Version. Single User Account Please see the following section for a more detailed discussion on the Singlt User Account feature. The default is You. 3»8 Internet Acoe. Prestige 3 I 0 Broadband Internet After: Router Follow the instructions in the following table to configure TCP/IP parameters for the LAN port. Table 3-2 TCPIIP LAN Setup Menu Fields Field LDQSCflpflOn Example TOP/IF| Setup IP Address Enter the IP address at your Prestige in dotted decimal notation 192.168.“ (delault) IF' Subnet Mask Your Prestige will automatically calculate the subnel mask based 255,255.255.C on the IP address that you assign. Unless yuu are implementing suhnetting. use the subnet mask computed by the Prestige RIP Direction Press the space bar to select the RIP direction from Both/In Non. Only/Out Only/Nona. (default) Version Press the space bar to select the RIP version lrorn RlP-lIRIP- RlP-‘l 2BIRlP-2M, (default) When you have completed this menu, press [Ente your configuration, or press [Esc] at any time to cancel. r] at the prompt [Press ENTER to Confinn...] to sa~ Internet Aces. Prestige 310 anrlbzmd [VI/emf! ACCESX Router 3.2 TCPIIP LAN Setup and DHCP From the Main Menu, enter 3 to open Menu 3 - LAN (IO/ODMbps Ethernet) Setup to configure TCP/IP LAN and DHCP. Menu 1 , LAN ua/mthps Ethernet) Setup x General Setup 2 TCP/IP and DHCP Setup Press Menu Selectian Numbar: Figure 3-1 Menu 3 - LAN (10/100Mbps Ethernet) Setup To edit me TCPIIP and DHCP configuration, enter 2 to open Menu 3.2 - TCP/[P and BBC" LAN Setup, as shown below. Menu 3,2 - TCP/IP and mac? LAN setup use? Satup: DHCP. sen-r Client 11: Pool Snarting Addresi- 192.153 1.13 Sue at Client 11: Pool- 5 Primary nus Servez- c o n.u Secnndary Bus Servers u/A xemc. DHCP server: N/A rep/n: Setup: 1? Mdress- 19245me 11> subuet Mask- 255455355» 1m: Direction- "one Vexsxen= RIP-1 Enter here tn commm or use to mum: Exes; Syace Bar cc Toggle. Figure 3-2 Menu 32 — TCPIIP and DHCP LAN Setup 3.4 Intems! Aces Pres_li‘ge J/ 0 Broadband Internet Access Router Let‘s say you select [92,168.10 as the network number; which covers 254 individual addresses, from l92.168.l.l to 192.168.1254 (zero and 255 are reserved). In other words, the first 3 numbers specify the network number while the last number identifies an individual workstation on that network. Once you have decided on the network number, pick an IP address that is easy to remember, e.g., l92.l68.l.l. for your Prestige The subnet mask specifies the network number portion of an IP address. Your Prestige will compute the subnet mask automatically based on the IP address that you entered. You don’t need to change the subnet mask computed by the Prestige unless you are instructed to do otherwise. 3.1.3 RIP Setup RIP (Routing Information Protocol) allows a router to exchange routing information with other routers. The RIP Direction field controls the sending and receiving of RIP packets. When set to Both or Out Only, the Prestige wrll broadcast its routing table periodically. When set to Both In Only, it will incorporate the RIP information that it receives; when set to None, it will not send any RIP packets and will ignore any RIP packets received. The default is None, i.e., RIP i disabled. The Version field controls the format and the broadcasting method of the RIP packets that the Prestige sends (it recognizes both formats when receiving). RIP-1 is universally supported; but RIP-2 carries more information. RIP-1 is probably adequate for most networks, unless you have an unusual network topology. Both RIP-28 and RIP-2M sends the routing data in RIP-2 format; the difference being that RIF ZB uses subnet broadcasting while RIP-2M uses multicasting. Multicasting can reduce the loar' on non~router machines since they generally do not listen to the RIP multicast address and so vs. not receive the RIP packets. However, if one router uses multicasting, then all routers on your network must use multicasting, also. By default, RIP direction is set to None and the Version set to RIP-1. 3.1.4 DHCP Configuration DHCP (Dynamic Host Configuration Protocol) allows the individual clients (workstations) to obtain the TCP/IP configuration at start-up from a server. Unless you are instructed by your ISI leave the DHCP at the Server. the default You can configure the Prestige as a DHCP sewer or relay. When configured as a server, the Prestige provides the TCP/D> configuration for the clien. 312 Intemel Acce. Prestige 3 I 0 Bmadband [rue/net Access Router 2.11 Protocol Dependent LAN Setup For TCP/IP LAN Setup, refer to Chapter 3 - Internet Access. 2-12 Hardware lnsiallatl’an and Sen Prestige 3! 0 Bmadband Interns! Acres: Router 2.9 WAN Setup This section describes how to configure the WAN using Menu 2 — WAN (lOMbps Ethernet) Setup. From the Main Menu, enter 2 to open menu 2. Menu 2 , Hun Setup (innings Ethernet! Link Mode; Half duplex Press mm m Confirm or as: to Clueel: Frees space Bar m Toggle FigureZ-s Menu 2 — WAN Setup Use the space bar to toggle between half and full duplex, Half-duplex means the link is used to Hansrnit or to receive exclusively at any given time, while full duplex means it can transmit am receive at the same time Half duplex will always work. While full duplex is obviously faster, i requires the modem to support it in order to work. You can try full duplex first; if it works, the leave it at full duplex; otherwise, change it back to half duplexr 2-10 Hardware Installation and Sen Prestige 310 Broadband Internet Access Router The following table describes how to configure your TCP/IP filter mle. Table 6-4 TCP/IP Filter Rule Menu Fields TCP. If yes, the rule matches only established TCP connections: else the rule matches all TCP packets. Field Description Option Active This field activates/deactivatos the filter rule. Yes/No IP Protocol Protocol refers to the upper layer protocol, e.g., TCP is 6, 0-255 UDP is 17 and ICMP is 1, This value must be between 0 and 255. 0 means IP protocol is a don't-care. IP Source Route If Yes. the rule applies to packet with IP source route Yes/No option; else the packet must not have source route optlon. The majority of IP packets do not have source route. Destination: IF" Enter the destination IF‘ Address of the packet you wish to IP address Addr filter. This field is a don'taoare if it is 0.0.0.0, Destination: IP Enter the P subnet mask to apply to the Destination: IF Subnet mask Mask Addr. If you wish to filter a single host. enter 255255255255. Destination: Port it Enter the destination port of the packets that you wish to 0-65535 filter. The range of this field is 0 to 55535. Thls field is a don't—care if it is 0. Destination: Port # Select the comparison to apply to the destination port in Nonn/LusIGroaterI Comp the packet against the value given in Destination: Port #. Equal/Not Equal] Source: IP Addr Enter the source IP Address of the packet you wish to IP Address filter. This field is a don‘t-care if it is 0.0.0.0. Source: IP Mask Enter the IP subnet mask to appty to the Source: IP Adar." lP Mask you wish t fiter a single host. enter 255255255255. Source: Port it Enter the source port of the packets that you wish to filter. 0435535 The range at this field is 0 to 65535. This field Is a don't- care if it is 0. Source: Port # Select the comparison to apply to the source port in the None/LesslGroator/ . Comp packet against the value given in Source: Port #. Equal/Not Equal TCl= Estab This field is appllcaole only when IP Protocol field is S, Yes/No Filler Configuration 6—7 Prestige 3/0 Broadband Internet Access ROM/er 6.2.4 Generic Filter Rule This section shows you how to configure a generic filler rule. The purpose of generic rules is to allow you to filter non-[P packets. For IP, it is generally easier to use the IP rules directly. For generic rules, the Prestige treats a packet as a byte stream as opposed to an IP or IPX packet. You specify the portion of the packet to check with the Offset (from 0) and the Length fields, both in bytes. The Prestige applies the Mask (bit-wise ANDing) to the data portion before comparing the result against the Value to determine a match. The Mask and Value are specified in hexadecimal numbers. Note that it takes two hexadecimal digits to represent a byte, so if the length is 4, the value in either field will take 8 digits, e.g.. FFFFFFFF. To configure a generic rule, select Genetic Filter Rule in the Filter Type field and press Enter lo open Menu 21.1.2 - Generic Filter Rule, as shown below. Menu 21.1.2 , GEnQKlC Fxlrer Rule mm- in: Ll Filter 1-pr- Generic Filter Rule Active- Na Offser- 0 Length: u nuk- H/A value. N/A um.- No mg- None Action Matched: Check Next Rule Action Not Hutched- Check Nexr Rule Puss ENTER to eunrmn or ass to Cancel: Figure 6-6 Menu 21.1.2 - Generic Filter Rule Filter Configuration &9 Pres/we 310 Bmadband Internet Access Ran/er Action Not Select the action for a packet not l'l'lzlchlng the rule. Check Next Rule Forward Drop Once you have completed filling in Menu 21.1.2 - generic Filler Rule, press [Enter] at the message [Press Enter (0 Confirm] lo save your configuration, or press [Esc] to cancel. This dala will new be displayed on Menu 21.1 - Filler Rules Summary. 6.3 Applying a Filter This section shows you where to apply the filter(s) aflcr you deny it (them). 6.3.1 Elhemet traffic Go tn Menu 3.1 (shown below) and enter the number(s) of the filter sel(s) that you Want to apply as appropriate. You can specify up to four filler sets (from twelve) by entering their numbers separated by commas, e.g., 3, 4, 6, l]. Menu ;.1 - General Ethernet sung Ethernet Interface: ”Base“! rnpuz rum sus- prezneoz Exlterl= device filters- Output hue: sets: prutuccl fxlters- dwice tilt-rs- pzau men to confirm or 85: to CAncel: Figure 5-7 Filtering Ethernet traffic Filter Configuration 6-11 Prestige 310 Broadband Internet Access Router Chapter 7 System Maintenance This chapter covers the diagnostic tools that help you to maintain your Prestige These tools include updates on system status, port status, log and trace capabilities and upgrades for the system software This chapter describes how to use these tools in detail. Select menu 24 in the main menu to open Menu 24 - System Maintenance, as shown below, Menu 24 ~ System Maintenance System status console Port Speed Lo; and Trace Diagnaszic Backup Cunflguxatlun Reltuxe Configuratxnn Firmware Update Cnmmand Interprzte! Mode mdmmfiuwu Enter Menu Selection nut-mu. Flgure 7-1 Menu 24 - System Malntenanoe 7-l Presri e 3 I 0 Broadband Internet Access Router The following table describes the fields present in Menu 24.1 - System Maintenance - Status. Table 7-1 System Maintenance - Status Menu Fields Field Description Port The WAN or LAN port. ?tatus Shows the port‘s speed and duplex setting. TXPkts The number of transmitted packets on this port. Rkats The number of received packets on this port. Cols The number of collisions on this port. Tx Bis Shows the transmit Bytes per second on this port. Rx Bis Shows the receive Bytes per second on this port, Up Time Time the line has been up. LAN Ethernet Address The LAN side Ethernet address. IP Address The LAN side lF' address, IP Mask The LAN side IF’ mask. DHCP The LAN side DHCP role. WAN Elhemet Address The WAN side Ethemel address. IP Address The WAN side lP address IP Mask The WAN side lF' mask. DHCP The WAN slde DHCP role. System up Time The total time the Prestige has been powered on CPU Load Shows the load on the CPU in percent Name The name that identifies the Prestige, RAS FNV Version The RAS Firmware version. Telnet Configuration and Capabilities 7-3 Pres/(gs 3 I 0 Bmadband Internet Access Router After the Prestige finishes displaying, you will have the option to clear the error log. Examples of typical error and information messages are presented in the figure below. mm. and » System Muxnterunel ~ Leg and Trace i. Vxew Error Log 2. Syslug Please enter selectxun Figure 7-4 Examples of Error and Information Messages Telnet Configuration and CapabiIilies 7-5 Preslige J 10 Broadband Internet Access Router Your Prestige sends two types of syslog messages: error information messages and session information messages Some examples of these syslog messages are shown below: 7.4 Diagnostic The diagnostic facility allows you to test the different aspects of your Prestige to determine if it is working properly. Menu 244 allows you to choose among various types of diagnostic tests to evaluate your system, as shown below. Menu 14.4 , Diagnostic system Maintenance - TcP/XP 1. pins Host System 11. lehnnt System 12, Command Mode Enter Menu Selection Number- Host it: Address- n/A Figure 7-6 Menu 24.4 - System Maintenance - Diagnostic Follow the procedure below to get to Diagnostic Step 1. From the Main Menu, select option 24 to open Menu 24 - System Maintenance. Step 2. From this menu, select option 4. Diagnostic. This will open Menu 24.4 - System Maintenance - Diagnostic. Telnet Configuration and CapabiIi‘tiex 7-7 Pres/age 3 I 0 Broadband Internet Access Ramer 7.6 Restore Configuration Menu 24.5 —— System Maintenance - Restore Configuration allows you to restore tte configuration via the console port. Note that this function erases the current configuration before restoring to the previous back up configuration; please do not attempt to restore unless you have the a backup configuration stored on disk Menu uvs ~- System Maintenance , Restore Conftguratlon Ready [a restore canhgumnan na Xmodem, Do you want. to conctnue ly/m: Flgure 7-8 Menu 24.5 - System Maintenance - Backup Configuration 7.7 Firmware Update Menu 24.7 —— System Maintenance - Upload Firmware allows you to upgrade the firmware and the configuration file via the console port. Note that this function erases the old data before installing the new one; please do not attempt to update unless you have the new firmware at hand There are two components in the system: the router firmware and the configuration file, as shown below. mm. us: -- System mtnzemmce - Upload Firm-are 1. Load us coder 2. Load RDH me Enter Menu sn-cnen "umber: Flgure 7-9 Menu 24.7 - System Maintenance - Upload Firmware Telnet Configuration and Capabilities 7.9 Prexlige 310 Broadband Internet Access Router lf you replace the current configuration file with the default configuration file, i.e., p310.rom, you will lose all configurations that you had before and the speed of the console port will be reset to the default of 9600 bps With 8 data bit, no parity and 1 stop bit (8nl). You will need to change your serial communications software to the default before you can connect to the Prestige again. The password will be reset to the default of 1234, also. Menu 24 7.2 - System Maintenance - Upload son rue To load the ROM file. type “Anni" while in debug mode and wait for "Startxng mom upload" ”before beguuung to upload me. Type ‘atgo" after rue hal succeasruny loaded to start: RAS. Then change the baud rate to 9500. Proceeding with the upload will erase the current: ROM file. Dc You which Tc Proceed: u/Ni mm . , ”mum-w .. w , ~ tsnwv-wmm Flgure 7-11 Menu 24.7.2 - system Maintenance - Upload ROM File 7.7.3 TFTP Transfer In addition to the direct console port connection, the Prestige supports the up/downloading ofthe firmware and the configuration file using [F] P (Trivial File Transfer Protocol) over LAN, Although TFI'P should work over WAN as well, it is not recommended because of the potential data corruption problems. To use TFTP, your workstation must have both telnet and TFTP clients. To transfer the firmware and the configuration file, follow the procedure below: step 1. Use telnet from your workstation to connect to the Prestige and log in. Because TFTP does not have any security check, the Prestige records the IP address of the telnet client and accepts TFTP requests only from this address. Step 2. Put the SMT in command interpreter (Cl) mode by entering 8 in Menu 24 — System Maintenance. Telnet Configuration and Capabilities 7-11 Prestige 310 Broadband Internet Access Router 7.8 Command Interpreter Mode This option allows you to enter the command interpreter mode. A list of valid commands can be found by typing [help] at the command prompt. For more detailed information, check the ZyXEL Web site or send e-mail to the ZyXEL Support Group Menu 24 - System Maintenance system Status console port Speed 10g and Trace Diagnostic Backup Configuration Restore Configuration saftware Update command Interpreter Mode Enter Menu selection “what: 8 Copyright (c) 1994 ~ 1999 ZyXEL Communications corpl ras> Figure 7-12 Command mode Telnet Configuration and Capabilities 7-13 Prestige 3 / 0 Broadband Internet Access Rainer Chapter 8 Telnet Configuration and Capabilities This chapter covers the Telnet Configuration and Capabilities of the Prestige. 8.1 About Telnet Configuration Before the Prestige is properly setup for TCP/fl’, the only option for configuring it is through the console port. Once your Prestige IS configured, you can use telnet to configure it remotely as shown below. Prestige 310 Ca”? ”we” Figure 8-1 Telnet Configuration on a TCPIIP Network When H’ routing is disabled, the Prestige can still function as a host. Telnet Configuration and Capabilities 8-1 Prestige 3 I 0 Broadband Internet Access Router Chapter 9 Troubleshooting This chapter covers the potential problems you may run into and the possible remedies. Afier each problem description, some instructions are provided to help you to diagnose and to solve the problem. 9.1 Problems Starting Up the Prestige Table 9-1 Troubleshooting the Start-Up of your Prestige Problem Corrective Action None of the LEDs are on when Check the connection between the AC adapter and the Prestige. y°” WW” ““ the P “351.95 I! the error persists, you may have a hardware problem. In this case, you should contact technical support Cannot access the Prestige via 1. Check to see if the Prestige is oonneoted to your computer's serial the console port. port. 2. Check to see it the VT100 terminal emulation communications program is M configured oorrectiyi The 9600 bps communicah‘ons software should be configured as follows: No parity, 8 Data bilS. 1 Stop bil- Troub/eshooting 9-1 Prestige 310 Broadband Internet Access Router Appendix A Acronyms and Abbreviations DCE Data Communications Equipment DHCP Dynamic Host Configuration Protocol DNS Domain Name System DTE Data Tenmnal Equipment IANA Internet Assigned Number Authority IP Internet protocol IPCP IP Control Protocol ISP Internet Service Provider LAN Local Area Network MAC Media Access Control NAT Network Address Translation RIP Routing Information Protocol SAP (IPX) Service Advertising Protocol SNAP Sub~Network Access Protocol SNMP Simple Network Management Protocol SUA Single User Account TA (ISDN) Terminal Adapter TFI‘ P Trivial File Transfer Protocol TCP Transmission Control Protocol UDP User Datagmm Protocol UTP Unshielded Twisted Pair (cable) WAN Wide Area Network Acronyms and Abbreviations A-l console pan, 24 DHCP, 3-2 diagnostic, 7-7 DNS, 3-3, 3—5 fi|l€f, 2-12. fi-I Geneml Setup, 2-10 generic filler mic, 6-3 IANA, 3—I Internet access, 1-3. 3-1 IP address, 3-2. 3—6 IP network number, 3~l IP Poo]. 3-3 [F static route. 4-l LAN, 7-3. 74 log, 7-4 Main Menu, 28 password, 2-6, 2»? Prestige 310 Broadband Internet Access Router power adapter, 24 Remote Node, 7—3. 7-8 RIP, 3-2, 3-6 ROM Fllc, 740 Smgle User Account, 3»8. See SUA SMT, 2—7 suflwnre update, 7-10 SUA, I-3, 341 Subnet mask, 3-2, 3—6 syslog, 7-6 system name, 2-10 system slams, 7»: TCP/IP filler rule, 6-6 lelnct, 8-15 (race, 7-4 troubl:shooting, 9-1 VTIOO, 2-4 Index Index Prestige 3/ 0 Broadband lnlernet Acres: Rourer A-Z Acronyms and Abbreviations Pnexn‘ge J 10 Broadband Internet Access Router 9.2 Problems with the LAN Interface Table 9-2 Troubleshooting the LAN interface Problem Corrective Actlon Can't ping any workstation on the LAN Check the 10MI100M LEDs on the front panel. One at these LED's should be on. If they are both oft, check the cables between your Prestige and hub or the station‘ Verify that the IP address and the subnet mask are consistent between the Prestige and the workstations. 9.3 Problems with the WAN interface Table 9-3 Troubleshootlng the WAN interface Problem I Corrective Action Can't connect to a remote node or ISF‘ Check Menu 24.1 to verify the line status if it indicates [down]. then refer to the section on the llne problems‘ 9-2 Troubleshooting Prestige 3! 0 Bmadbrmd Internet Access Router 8.2 Telnet Under SUA When Single User Account (SUA) is enabled and an inside server is specified, telnet connections from the outside will be forwarded to the inside server. So to configure the Prestige via telnet from the outside, you must first telnet to the inside server, and then telnet from the server to the Prestige using its inside LAN IP address. If no insider server 18 specified, telnet to the SUA's IP address will connect to the Prestige directly. 8.3 Telnet Capabilities 8.3.1 Single Administrator To prevent confusion and discrepancy on the configuration, your Prestige only allows one administrator to log in at any time. Your Prestige also gives priority to the console port over telnet. If you have already connected to your Prestige via telnet, you will be logged out if another user logs in to the Prestige via the console port. 8.3.2 System Timeout There is a system timeout of 5 minutes (300 seconds) for either the console port or telnet. Your Prestige will automatically log you out if you do nothing in this timeout period, except when it is continuously updating the status in Menu 24.l. 8-2 Telnet Configuration and Capabilities Preslize 3 I 0 Broadband Internet Access Ron/er 7.8.1 Boot commands Prestige boot module commands are shown below, For ATBAx, x denotes the number preceding the colon to give the baud rate following the colon in the list of numbers that follows; ego, ATBA} will give a baud of 96 kbps. ATSE displays the seed that is used to generate a password to turn on the debug flag in the firmware. The ATSH command shows product related information such as boot module version, vendor name, product model, RAS code revision, em = Debug Command Listing = ATHE A print help ATGO boot system ATUR upload RAS oode ATUR3 upload RAS mnfigurallon file ATEAx change baud rats. 1:38.4,2:19.2,3:9.6,4:57.6,5:115.2 ATTD download oonfiguration to PC ATSE dlsplay seed for password genemfion ATSH display Revision and etc Figure 7-13 Boot module commands 7-14 System Maintenance Prestige 3 I 0 andband Internet Access Router stop 3. Enter command “sys stdio 0" to disable SMT timeout, so the TFTP transfer will not be interrupted. Step 4. Launch TFTP client on your workstation and connect to the Prestige. Set the transfer mode to binary before starting data transfer. Stop 5‘ Use the TH“? climt to transfer files between the Prestige and the workstation. The file name for the firmware is “ras” and for the configuration file, “rome 0" (rom»zero, not capital 0). If you upload the firmware to the Prestige, it will reboot automatically when the file transfer is completed . Note that the telnet connection must be active and the SMT in CI mode before and during the TFTP transfer. For details on TI-‘l‘P commands, please consult the documentation of your TFFP client program. For UNIX, use “get" to transfer from the Prestige to the workstation, “put” the other way around, and “binary" to set binary transfer mode. 7-12 System Maintenance Prestige 3 IO Broadband Internet Access Router 7.7.1 Uploading the RAS Code Menu 24.7.2 shows you the instructions for uploading the RAS Code. If you answer yes to the prompt, the Prestige will go into debug mode. Follow the procedure below to upload the configuration file: Step 1. Enter “atur” alter the “Enter Debug Mode" message. Step 2. Wait for the “5 bar: ing XMODEM upload" message before activating Xmodem upload on your terminal. Step 3. After successful firmware upload, enter “atgo” to restart the Prestige. Menu 24.7.1 - Syotem Maintenance - Upload Rns Code To load the nuts code, type men" while in debug mode and waie in: "Starting xnonm uninaa- before beginning to upload code Type "atgc' alter code has Sirens-furry loaded to stare ms. Pmceedxng with the upload will erase the current as code. Do You wish To Proceed: (r/m .. _1. . ... . Figure 7-10 Menu 24.7.1 - System Maintenance - Upload RAS Code 7.7.2 Uploading ROM File The configuration data, system-related data, the error log and the trace log are all stored in the configuration file. Please be aware that uploading the configuration file replaces everything contained within. Menu 24.7.2 shows you the instructions for uploading the ROM file. If you answer yes to the prompt, the Prestige will go into debug mode. Follow the procedure below to upload the configuration file: Step 1. Enter “atur” after the “Enter Debug Mode" message. step 2. Wait for the “Starting xMODEM upload” message before activating Xmodem upload on your terminal. Step 3. After successful] firmware upload, enter “at-.go" to restart the Prestige. 7-10 System Maintenance Prestige 3 I 0 Broadband Internet Access Router The following table describes the diagnostic tests available in Menu 24.4 for your Prestige and the connections. Table 7-3 System Maintenance Menu Diagnostic Field 4Description Ping Host This diagnostic test pings the host, which determines the functionality of the TCP/IP protocol on both systems and the links in between. Reboot System This option reboots the Prestige. Command Mode This option allows you to enter the command mode. This mode allows you to diagnose and test your Prestige using a specified set of commands. 7.5 Backup Configuration Option 5 from Menu 24 - System Maintenance allows you to backup the current Prestige configuration to your workstation. Backup is highly recommended once your Prestige is functioning properly. You can only perform the backup and restore using menu 24 through the console port, not telnet. Any serial communications program should work fine; however, you must use XMODEM protocol to perform the download/upload. Please note that terms “download" and “upload“ are relative to the workstation. Download means to transfer from another machine to the workstation, while upload means from your workstation to another machine. Menu 24.5 -- system neinumnee - Backup Configuration Ready to haCkup configuratiun vu made-n. Do you want: to continue ly/nix Figure 7-7 Menu 24.7 - System Maintenance - Backup Configuration 7»8 System Maintenance Prestige 3 I 0 Broadband Internet Access Router 7.3.2 Unix Syslog The Prestige uses the UNIX syslog facility to log the messages to 3 syslog sewer. Syslog can be configured in Menu 24.3.2 - System Maintenance - Syslug, as shown below. Menu u.3.z ., System Mnntenance , SyleS Unxx Syslng: Active: Ho Sysleg 1p Addrese- 1 bag nanny- meat 1 Figure 7-5 Menu 24.3.2 - System Maintenance - Syslog and Accounting You need to configure the following three parameters described in the table below to activate syslog. Table 7-2 System Maintenance Menu Syslog Parameters Parameter Description Active Use the space bar to turn on or off syslog. Syslog IP Address Enter the IP Address of your syslog server. Log Facility Use the space bar to toggle between the 7 different Local options. The log facility allows you to log the message in different files in the serverr Please refer to your UNIX manual for more detail. 7-6 System Maintenance Prestige 3 I 0 Broadband Internet Access Router 7.2 Console Port Speed You can set up different port speeds for the console port through Menu 24.2 — Console Port Speed. Your Prestige supports 9600 (default), 19200, 38400, 57600, and 115200 bps for the console port. Use the space bar to select the desired speed in Menu 24.2, as shown below. Menu 24,2 - System Mintenance - Change Console Port Speed Consote Pox: speed; usznn Fresi mm cu confirm or ES: to Cancel: Press Spice Bar to Toggle. Figure 7-3 Menu 24.2 — System Maintenance — Change Console Port Speed 7.3 Log and Trace There are two logging facilities in the Prestige. The first is the error logs and trace records that are stored locally. The second is the UNIX syslog facility for message logging. 7.3.1 Viewing Error Log The first place you should look for clues when something goes wrong is the error/trace log. Follow the procedure below to view the local error/trace log: step 1. Select option 24 from the Main Menu to open Menu 24 - System Maintenance. Step 2. From Menu 24, select option 3 to open Menu 24.3 - System Maintenance - Log and Trace. Step 3. Select the first option from Menu 24.3 - System Maintenance - Lng and Trace to display the error log in the system. 74 System Maintenance Prestige 310 Bmadbzmd Internet Access Router 7.1 System Status The first selection, System Status, gives you information on the version of your system firmware and the status and statistics of the ports, as shown in below System Status is a tool that can be used to monitor your Prestige. Specifically, it gives you information on your system firmware version, number of packets sent and number of packets received. To get to the System Status, Enter number 24 to go to Menu 24 - System Maintenance. in this menu, enter number 1 to open, System Maintenance - Status. There are two commands in Menu 24.1 - System Maintenance - Status. Entering 9 resets the counters, and E80 takes you back to the previous screen. The table below describes the fields present in Menu 24.1 - System Maintenance - Status. It should be noted that these fields are READ-ONLY and are meant to be used for diagnostic purposes. Menu 24.) ., Syltem Maintenance A sums Farr. status ‘rxekrs nxeku Eels 1x E/s Rx 815 um mun/Pull an a u o u wan Down (2! o o a a Part: Ethernet Address re Address re Mask um no - ax.“ 202.132.5n.17 255.255.zss.z¢u mm at - 102,112,154 125 25515455» System up rime. ems-z: cw Load: llama: Roun'xngx it) we F/n version. Anzlssnsw Press Commanfi: mes amen: Counter! Flgure 7-2 Menu 24.1 - System Maintenance — status 7»2 System Maintenance Prexnge 310 Broadband Internet ACEEJ‘S Router 6.3.2 Remote Node Filters Go to Menu 11.5 (shovm below) and enter the number(s) of the filter sct(s) as appropnate. You can specify up to four filter sets by entering their numbers separated by commas. Menu us — nemu Node mm: Input sun: sets: prnceccl filtexsx dens; Ulcers. Output Fxlter Secs ptetecol filters. device filters: Call Filter Sets: protocol filtars: device tuneu- Figure 6-8 Fllterinq Remote Node traffic 6-12 Filter Configuration Prestige 1 I 0 Broadband Internet Access Router The following table describes the fields in the Generic Filter Rule Menu. Table 6-5 Generic Filter Rule Menu Fields Field Description Option Filter ff This is the filter set, tilter rule eta-ordinates, i.e.. 2.3 refers to the second filter set and the third mle of that set. Filter Type Use the space bar to toggle between both types of rules. Parameters Generic Filter displayed below each type will be dlflerent. Rule! TCPIIP Filter Rule Active Select Yes to turn on the filter rule. Yes/No Offset Enter the starting byte of the data portion in the packet that you wish to Default = 0 compare. The range tor this field is from D to 255, Length Enter the byte count at the data portion in the packet that you wish to Default = 0 compare. The range for this field is 0 to a. Mask Enter the mask (in Hexadecimal) to apply to the data portion before comparison. Value Enter the value (in Hexadecimal) to compare with the data portion. More If yes, a matching packet is passed to the next fitter rule beiore an action is Yes I N/A taken; else the packet is disposed of according m the action fields. It More is Yes. then Action Matched and Action Not Matched will be NIA. Log Select the logging option from the iollowing: 0 None — No packets will be logged, None 0 Action Matched — Only packem that match the rule parameters will Action be logged. Matched 0 Action Not Matched - Only packets that do not match the mle Action Not parameters Will be logged. Matched l Both — All packets will be logged, Both Action Select the action for a matching packet. check Next_| Matched Rule Forward Drop 6-10 Filter Configuration Prestige 3 I 0 Broadband [merrier Access Router Field Description Option More ll yes. a matching packet is passed to the next filter rule before an action is taken; else the packet is disposed of according to the acuon fields. It More is Yes, then Action Matched and Action Not Matched will be NIA. Select the logging option from lhe following: 0 None — No packets will be logged. 0 Action Matched - Only packets that match the mle parameters will be tagged, 0 Action Not Matched - Only packets that do not match the rule parameters will be logged. 0 Both - All packets will be logged. Yes I NIA None Action Matched Action Not Matched Both Action Matched l_____— Atm‘on Not Matched Select the action for a matching packet. Sclccl the action for a packet not matching the rule. Check Next Rule Forward Drop Check Next Rule Forward Drop Once you have completed filling in Menu 21.1.1 ~ TCPIIP Fitter Rule. press {Enter} at the message [Press Enter to Confirm] to save your configuration, or press [5501 to ancelt This data will now be displayed on Menu 21.1 - Fitter Rules Summary, Filter Configuration
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.3 Linearized : Yes Create Date : 2001:06:13 03:17:48 Producer : Acrobat Distiller 4.0 for Windows Author : jsoscia Title : 49082.pdf Modify Date : 2001:06:13 03:18:10-04:00 Page Count : 84EXIF Metadata provided by EXIF.tools