ASUSTeK Computer F9AWGE780 NOTEBOOK P.C. User Manual AD5EA4E5A4E2A5552E706466
ASUSTeK Computer Inc NOTEBOOK P.C. AD5EA4E5A4E2A5552E706466
Contents
- 1. USERS MANUAL 1
- 2. USERS MANUAL 2
USERS MANUAL 2
Appendix Bluetooth Mouse (optional) Windows XP 2. Install two âAAâ batteries. OFF ON 1. A Bluetooth icon should be located on your Windows taskbar. Right click the taskbar Bluetooth icon and choose Add New Connection. ESET 3. Turn ON the switch on the bottom of the mouse. 4. Push the âRESETâ button on the bottom of the mouse. If you do not see the Bluetooth mouse here. Push the âRESETâ button on the bottom of the mouse and click Refresh here. 5. Select âExpress Modeâ and click Next. 6. A list of available Bluetooth devices will appear. Select âLogitech Travel Mouseâ and click Next. 7. The software will register the Bluetooth mouse. Click Finish when complete. 8. A mouse icon with a pair of green and yellow hands will show in this window. 1RWH´5(6(7ÂľPD\EHQHFHVVDU\DIWHUFKDQJLQJEDWWHULHV5HSHDWVWHSVLIQHFHVVDU\ Appendix Troubleshooting (Windows XP) 4XHVWLRQ +RZ GR , FKHFN LI P\ %OXHWRRWK LV ready? In âDevice Managerâ, check if âBluetooth Personal Area Networkâ is available as shown here. 4XHVWLRQ,FDQQRWVHHP\%OXHWRRWKPRXVHLQ the list. What do I do? Click Refresh in the software and âRESETâ on the mouse. Repeat if necessary. OFF ON ESET 4XHVWLRQ , DOUHDG\ UHJLVWHUHG WKH %OXHWRRWK mouse before. Why is it not working now? How do I connect to it? Double-click on the Bluetooth Icon. Double-click on the registered Bluetooth mouse. After connection, the icon will show a pair of green and yellow hands. $SURPSWZLOODSSHDUIRUFRQĂUPDWLRQ&OLFNOK. A Appendix Operating System and Software This Notebook PC may offer (depending on territory) its customers the choice of a pre-installed operating system such as Microsoft Windows âXPâ or âVistaâ. The choices and languages will depend on the territory. The levels of hardware and software support may vary depending on the installed operating system. The stability and compatibility of other operating systems cannot be guaranteed. Support Software This Notebook PC comes with a support disc that provides BIOS, drivers and applications to enable hardware features, extend functionality, help manage your Notebook PC, or add functionality not provided by the native operating system. If updates or replacement of the support disc is necessary, contact your dealer for web sites to download individual software drivers and utilities. The support disc contains all drivers, utilities and software for all popular operating systems including those that have been pre-installed. The support disc does not include the operating system LWVHOI7KHVXSSRUWGLVFLVQHFHVVDU\HYHQLI\RXU1RWHERRN3&FDPHSUHFRQĂJXUHGLQRUGHUWRSURYLGH additional software not included as part of the factory pre-install. A recovery disc is optional and includes an image of the original operating system installed on the hard drive at the factory. The recovery disc provides a comprehensive recovery solution that quickly restores the Notebook PCâs operating system to its original working state provided that your hard disk drive is in good working order. Contact your retailer if you require such a solution. Note: Some of the Notebook PCâs components and features may not work until the device drivers and utilities are installed. Appendix System BIOS Settings Boot Device 1. On the Boot screen, select Boot Device Priority. 2. Select each item and press [Enter] to select a device. Security Setting To clear the password: 2. Type in a password and press [Enter]. 1. Leave the password ĂHOGEODQNDQGSUHVV [Enter]. 3. Re-type the password and press [Enter]. 2. Password is then cleared. 4. Password is then set. 1. On the Security screen, select Change Supervisor or Change User Password. A Appendix Password Check Select whether to ask for a password during bootup (Always) or only when entering the BIOS setup utility (Setup). User Access Level Select the level of access to allow the âUser Passwordâ to have in the BIOS setup utility. Save Changes ,I\RXZDQWWRNHHS\RXUFRQĂJXUDWLRQVHWWLQJV\RXPXVW save changes before exiting the BIOS setup utility. If you want to restore default settings, choose Load Manufacture Defaults. You must then save changes to keep the manufacture default settings. Appendix Common Problems and Solutions Hardware Problem - Optical Disc The optical disc drive is not able to read or write discs. 1. Update the BIOS to the latest version and try again. 2. If updating the BIOS does not help, try better quality discs and try again. 3. If the problem still exist, contact your local service center and ask an engineer for assistance. Unknown Reason - System Unstable Cannot wake up from the hibernation. 5HPRYHXSJUDGHGSDUWV 5$0+'':/$1%7 LIWKH\ZHUHLQVWDOOHGDIWHUSXUFKDVH 2. If not the case, try MS System Restore to an earlier date. ,ISUREOHPVWLOOSHUVLVWVWU\UHVWRULQJ\RXUV\VWHPXVLQJWKHUHFRYHU\SDUWLWLRQRU'9' (NOTE: You must backup all your data to another location before recovering.) 4. If the problem still exist, contact your local service center and ask an engineer for assistance. Hardware Problem - Keyboard / Hotkey The Hotkey (FN) is disabled. $5HLQVWDOOWKH´$7.ÂľGULYHUIURPWKHGULYHU&'RUGRZQORDGLWIURPWKH$686ZHEVLWH Hardware Problem - Built-in Camera The built-in camera does not work correctly. &KHFN´'HYLFH0DQDJHUÂľWRVHHLIWKHUHDUHDQ\SUREOHPV 2. Try reinstalling the webcam driver to solve the problem. 3. If the problem is not solved, update the BIOS to the latest version and try again. 4. If the problem still exist, contact your local service center and ask an engineer for assistance. Hardware Problem - Battery Battery maintenance. 1. Register the Notebook PC for a one-year-warranty using the following website: http://member.asus.com/login.aspx?SLanguage=en-us 'R127UHPRYHWKHEDWWHU\SDFNZKLOHXVLQJWKH1RWHERRN3&ZLWKWKH$&DGDSWRUWRSUHYHQW damage caused by the accidental power loss. The ASUS battery pack has protection circuitry to prevent over-charging so it will not damage the battery pack if it is left in the Notebook PC. 6WRUHWKHEDWWHU\SDFNLQDGU\ORFDWLRQZLWKWHPSHUDWXUHVEHWZHHQÉ DQGÉ LI\RXZLOO not be using it for a long time. It is strongly recommended that you charge the battery pack every three months. A Appendix Common Problems and Solutions (Cont.) Hardware Problem - Power ON/OFF Error I cannot power ON the Notebook PC. Diagnostics: 1. Power On by Battery only? (Y = 2, N = 4) 2. Able to see BIOS (ASUS Logo)? (Y = 3, N = A) 3. Able to load the OS? (Y = B, N = A) $GDSWHUSRZHU/('21" < 1 & 5. Power ON by Adapter only? (Y = 6, N = A) 6. Able to see BIOS (ASUS Logo)? (Y = 7, N = A) $EOHWRORDGWKH26" < '1 $ Symptom & Solutions: $3UREOHPPLJKWEHLQWKH0%+''RU1%YLVLWDORFDOVHUYLFHFHQWHUIRUDVVLVWDQFH B. Problem caused by the operating system, try restoring your system using the recovery partition or disc. (IMPORTANT: You must backup all your data to another location before recovering.) C. Adapter problem; check the power cord connections, otherwise visit a local service center for replacement. '%DWWHU\SUREOHPSOHDVHFKHFNWKHEDWWHU\FRQWDFWVRWKHUZLVHYLVLWDORFDOVHUYLFHFHQWHUIRU repair. Mechanical Problem - FAN / Thermal Why is the cooling fan always ON and the temperature high? 1. Make sure that the FAN works when the CPU temperature is high and check whether there is DLUĂRZIURPWKHPDLQDLUYHQW 2. If you have many applications running (see taskbar), close them to decrease system load. 3. The problem may also be caused by some viruses, use anti-virus software to detect them. ,IQRQHRIWKHDERYHKHOSWU\UHVWRULQJ\RXUV\VWHPXVLQJWKHUHFRYHU\SDUWLWLRQRU'9' (IMPORTANT: You must backup all your data to another location before recovering.) &$87,21'RQRWFRQQHFWWRWKH,QWHUQHWEHIRUH\RXKDYHLQVWDOOHGDQDQWLYLUXVVRIWZDUH DQG,QWHUQHWĂUHZDOOWRSURWHFW\RXUVHOIIURPYLUXVHV 6HUYLFH6SHFLĂFDWLRQIXQFWLRQSULFH How to check whether a Notebook PC is equipped with a wireless card? A. Enter Control Panel!Device Manager. You will see whether the Notebook PC has a WLAN card under the âNetwork Adapterâ item. Appendix Common Problems and Solutions (Cont.) Software Problem - ASUS bundled software :KHQ,SRZHU21WKH1RWHERRN3&WKHUHZLOOEHDQ´2SHQSROLF\ĂOHHUURUÂľPHVVDJH A. Reinstall the latest version âPower4 Gearâ utility to solve your problem. It is available on the ASUS website. Unknown Reason - Blue screen with white text A blue screen with white text appears after system bootup. 1. Remove additional memory. If additional memory was installed after purchase, power OFF, remove the additional memory, and power ON to see if the problem is due to incompatible memory. 2. Un-install software applications. If you have installed software applications recently, they may not be compatible with your system. Try to un-install them in Windows Safe Mode. 3. Check your system for viruses. 8SGDWHWKH%,26WRWKHODWHVWYHUVLRQZLWK:,1)/$6+LQ:LQGRZVRU$)/$6+LQ'26PRGH 7KHVHXWLOLWLHVDQG%,26ĂOHVFDQEHGRZQORDGHGIURPWKH$686ZHEVLWH :$51,1*0DNH VXUH\RXU1RWHERRN3&GRHVQRWORRVHSRZHUGXULQJWKH%,26ĂDVKLQJSURFHVV 5. If problem still cannot be solved, use the recovery process to reinstall your entire system. (IMPORTANT: You must backup all your data to another location before recovering.) &$87,21'RQRWFRQQHFWWRWKH,QWHUQHWEHIRUH\RXKDYHLQVWDOOHGDQDQWLYLUXVVRIWZDUHDQG ,QWHUQHWĂUHZDOOWRSURWHFW\RXUVHOIIURPYLUXVHV 127(0DNHVXUHWKDW\RXLQVWDOOWKH´,QWHO ,1)8SGDWHÂľDQG´$7.$&3,ÂľGULYHUVĂUVWVRWKDWKDUGZDUHGHYLFHVFDQEHUHFRJQL]HG 6. If the problem still exist, contact your local service center and ask an engineer for assistance. A Appendix Software Problem - BIOS Updating the BIOS. 3OHDVHYHULI\WKH1RWHERRN3&¡VH[DFWPRGHODQGGRZQORDGWKHODWHVW%,26ĂOHIRU\RXUPRGHO from the ASUS website. 8VHWKH´:,1)/$6+ÂľXWLOLW\WRXSGDWH\RXU%,267KHXWLOLW\FDQEHIRXQGLQ\RXU'ULYHU 8WLOLW\&'WKDWFDPHZLWK\RXU1RWHERRN3& ([WUDFWWKH%,26ĂOHWRDWHPSRUDU\ORFDWLRQ VXFKDVWKHURRWLQ&? 4. Click Start | All Programs | ASUS Utility | WINFLASH | WINFLASH D6HOHFWWKHQHZ%,26LPDJHĂOH E&RQĂUPWKHVHOHFWHG%,26LQIRUPDWLRQ&KHFNWKHPRGHOYHUVLRQDQGGDWD c. Click Flash to initialize the BIOS updating procedure. d.Click Exit when procedure completes. H5HERRWWKHV\VWHP$VVXPLQJWKDW\RXKDYHVXFFHVVIXOO\ĂDVKHGWKH%,26ĂOHSUHVV>F2@WR enter BIOS setup page when the ASUS logo appears during system boot-up. f. After entering BIOS setup page, go to Exit page and choose Load Manufacture Defaults. Then select Save and Exit and reboot the system again. J7KH%,26ĂDVKSURFHGXUHLVQRZFRPSOHWH You can also use the âEasy Flashâ function on the Advanced page of the BIOS Setup Utility. Follow the instructions shown. You must âLoad Manufacture Defaultsâ after XSGDWLQJ ĂDVKLQJ WKH%,26 Appendix Common Problems and Solutions (Cont.) Symantecâs Norton Internet Security (NIS) 1. Sometimes NIS will show an alert to stop a Trojan virus from a local IP address. 7KLVSUREOHPFDQEHVROYHGE\PDNLQJVXUHWKHYLUXVGHĂQLWLRQĂOHLVWKHODWHVWRQHDQGUHJXODUO\ XSGDWLQJWKHYLUXVGHĂQLWLRQĂOH 2. Reinstalling fails at the âInformation Wizardâ after uninstalling Norton Antivirus. Make sure NIS has been uninstalled from your computer, reboot your system, install NIS again, use ´/LYH8SGDWHÂľDQGXSGDWHWKHYLUXVGHĂQLWLRQĂOH 3. Norton accidently blocks desired web pages or reduces download speeds. &KDQJHWKHVHFXULW\FRQĂJXUDWLRQWRDORZHUOHYHO1,6VFDQVYLUXVZKLOHGRZQORDGLQJGDWDVRQHWwork speed will be decreased. 4. Cannot login to MSN or Yahoo messenger services. Make sure NIS has been updated and also update the Windows system by using âWindows Updateâ. If the problem still exist, try: 1. Open NIS 200x by clicking on the NIS icon in your system tray. 2. Open âNorton AntiVirusâ in âOptionsâ menu. 3. Click on âInstant Messengerâ uncheck âMSN/Windows Messengerâ from âWhich Instant messengers to protect.â 5. NIS is damaged and need reinstalling. NIS is located in the provided disc in the âNIS200xâ folder (x is the version number). 7KH´6WDUWĂUHZDOOZKHQV\VWHPLVERRWHGÂľRSWLRQLVVHOHFWHGEXWLWWDNHVDERXWRQHPLQXWHWR VWDUWXSWKHĂUHZDOOHYHU\WLPH,HQWHU:LQGRZV:LQGRZVLVQRWUHVSRQVLYHGXULQJWKLVWLPH ,I1,6ĂUHZDOOUHGXFHV\RXUV\VWHPVSHHGWRDQLQWROHUDEOHOHYHOGHVHOHFWWKDWRSWLRQ A Appendix Common Problems and Solutions (Cont.) 7. Much of my system speed has been reduced by NIS. NIS will reduce your system speed (both booting and running performance) if you are using NISâs full protection functions, NIS scans and tracks all data in the background. You can speed up your system by stopping NISâs auto scan functions in system bootup. You can then scan virus manually when your computer is not in use. 8. Cannot uninstall NIS. Go to Control Panel | Add or Remove Programs. Look for âNorton Internet Security 200x (Symantec Corporation)â. Click Change/Remove and choose Remove All to uninstall NIS. 9. Windows Firewall must be stopped before installing âNorton Internet Securityâ or âNorton Personal Firewallâ. How to stop Windows Firewall: 1. Click Start and then Control Panel. 2. You will have one of two control panels. Click on the Security Center icon. 3. Click on the Windows Firewall icon beneath the status updates. 4. Click Off and then click OK. 10. Why is the âPrivacy Controlâ icon showing âxâ? Turn off Privacy Control from âStatus & Settingsâ. ,QVXIĂFLHQWSULYLOHJHPHVVDJH Many settings, including disabling or uninstalling NIS, require you to be logged into Windows with Administrator privileges. Log Off and switch to a user account with Administrator privileges. Appendix Windows XP Software Recovery Using Hard Disk Partition The Recovery Partition includes an image of the operating system, drivers, and utilities installed on your Notebook PC at the factory. The Recovery Partition provides a comprehensive recovery solution that quickly restores your Notebook PCâs software to its original working state, provided that your hard GLVNGULYHLVLQJRRGZRUNLQJRUGHU%HIRUHXVLQJWKH5HFRYHU\3DUWLWLRQFRS\\RXUGDWDĂOHV VXFKDV 2XWORRN367ĂOHV WRĂRSS\GLVNVRUWRDQHWZRUNGULYHDQGPDNHQRWHRIDQ\FXVWRPL]HGFRQĂJXUDWLRQ settings (such as network settings). Using the Recovery Partition: 3UHVV>)@GXULQJERRWXS UHTXLUHVD5HFRYHU\3DUWLWLRQ About the Recovery Partition The Recovery Partition is a space reserved on your hard disk drive used to restore the operating system, drivers, and utilities installed on your Notebook PC at the factory. ,03257$17'RQRWGHOHWHWKHSDUWLWLRQQDPHG´5(&29(5<Âľ The Recovery Partition is created at the factory and cannot be restored by the user if deleted. Take your Notebook PC to an authorized ASUS service center if you have problems with the recovery process. Select menu item (within 60 seconds): 1. Reboot to Windows XP _____. This option will automatically execute after 60 seconds if no selections are made. This option will reboot your Notebook PC and enter Windows. 5HFRYHU:LQGRZV;3BBBBBWRĂUVWSDUWLWLRQRQO\ 7KLVRSWLRQZLOOGHOHWHRQO\WKHĂUVWSDUWLWLRQDOORZLQJ\RXWRNHHSRWKHUSDUWLWLRQVDQGFUHDWHDQHZ system partition as drive âCâ. 3. Recover Windows XP _____ to entire HD. This option will delete all partitions from your hard disk drive and create a new system partition as drive âCâ. 4. Recover Windows XP _____ to entire HD with 2 partition. This option will delete all partitions from your hard disk drive and create two new partitions âCâ DQG´'Âľ Follow the on-screen instructions to complete the recovery process. NOTE: Please visit www.asus.com for updated drivers and utilities. A Appendix Windows XP Software Recovery (Cont.) Using CDs (on selected models) 7KH5HFRYHU\&'VLQFOXGHVDQLPDJHRIWKHRSHUDWLQJV\VWHPGULYHUVDQGXWLOLWLHVLQVWDOOHGRQ\RXU 1RWHERRN3&DWWKHIDFWRU\7KH5HFRYHU\&'VSURYLGHVDFRPSUHKHQVLYHUHFRYHU\VROXWLRQWKDWTXLFNO\ restores your Notebook PCâs software to its original working state, provided that your hard disk drive LVLQJRRGZRUNLQJRUGHU%HIRUHXVLQJWKH5HFRYHU\&'VFRS\\RXUGDWDĂOHV VXFKDV2XWORRN367 ĂOHV WRĂRSS\GLVNVRUWRDQHWZRUNGULYHDQGPDNHQRWHRIDQ\FXVWRPL]HGFRQĂJXUDWLRQVHWWLQJV VXFK as network settings). Detailed procedure on using the Recovery CDs: ,QVHUW5HFRYHU\&'LQWR\RXURSWLFDOGULYH 2. Turn ON your notebook PC or restart if it is already ON. 3UHVV(VF!RQERRWXSDQGVHOHFWWKHRSWLFDOGULYHXVLQJWKHGRZQFXUVRUDQGSUHVV(QWHU!WRERRW IURP5HFRYHU\&'2UVHW\RXURSWLFDOGULYHWRERRWLQ%,26 5. Select menu item (within 60 seconds): 1. MS-DOS with CD-ROM Support. This option will automatically execute after 60 seconds if no selections are made. This option is like XVLQJD'26VWDUWXSGLVNDQGORDGWKH&'520GULYHUIRU'26DQGJLYH\RXD'26SURPSW6HYHUDO '26XWLOLWLHVZLOOEHDYDLODEOHRQGULYH´$Âľ 5HFRYHU:LQGRZV;3BBBBBWRĂUVWSDUWLWLRQRQO\ 7KLVRSWLRQZLOOGHOHWHRQO\WKHĂUVWSDUWLWLRQDOORZLQJ\RXWRNHHSRWKHUSDUWLWLRQVDQGFUHDWHDQHZ system partition as drive âCâ. 3. Recover Windows XP _____ to entire HD. This option will delete all partitions from your hard disk drive and create a new system partition as drive âCâ. 4. Recover Windows XP _____ to entire HD with 2 partition. This option will delete all partitions from your hard disk drive and create two new partitions âCâ DQG´'Âľ 6. Follow the on-screen instructions to complete the recovery process. You will be asked for Recovery &'DIWHUDIHZPLQXWHVDQG$686'ULYHUDQG8WLOLW\&'DIWHUDIHZPRUHPLQXWHV 5HPRYHWKH5HFRYHU\&'DQGUHVWDUW\RXU1RWHERRN3&WRFRQĂJXUH:LQGRZV 8. Follow the on-screen wizards to complete Windows setup. WARNING: Do not remove the Recovery CD (unless instructed to do so) during the recovery process or else your partitions will be unusable. NOTE: Please visit www.asus.com for updated drivers and utilities. Appendix NTFS Converter (Windows XP only) 'RXEOHFOLFNWKH17)6LFRQRQWKHGHVNWRS7KH conversion command will be executed once for each partition on your Notebook PC so you will have to answer additional questions. NOTE: If your local disk is already in NTFS format, â...is already NTFSâ will be shown for the relevant hard disk drive. 'LVPRXQWLVQHFHVVDU\IRUWKHFRQYHUVLRQ3UHVV Y to continue. 3. Restart your system and check the details of your local disk to see if conversion is successful. Open My Computer and click the disk drive for details. (Click the expand icon if necessary.) (This drive has not been converted.) (This drive has been converted to NTFS.) A Appendix Glossary $&3, $GYDQFHG&RQĂJXUDWLRQDQG3RZHU0DQDJHPHQW,QWHUIDFH Modern standard for reducing power usage in computers. APM (Advanced Power Management) Modern standard for reducing power usage in computers. AWG (American Wire Gauge) NOTE: This table is for general reference only and should not be used as a source of the American Wire Gauge standard as this table may not be current or complete. Gauge AWG 33 32 30 29 27 26 25 Diam (mm) 0.18 0.19 0.20 0.25 0.30 0.35 0.40 0.45 Area (mm2) 0.026 0.028 0.031 0.049 0.071 0.096 0.13 0.16 (ohm/km) 676 605 547 351 243 178 137 108 I@3A/mm2 (mA) 75 85 93 147 212 288 378 477 Gauge AWG 24 22 20 Diam (mm) 0.50 0.55 0.60 0.65 0.70 0.75 0.80 0.85 Area (mm2) 0.20 0.24 0.28 0.33 0.39 0.44 0.50 0.57 (ohm/km) 87.5 72.3 60.7 51.7 44.6 38.9 34.1 30.2 I@3A/mm2 (mA) 588 715 850 1.0 A 1.16 A 1.32 A 1.51 A 1.70 A BIOS (Basic Input/Output System) BIOS is a set of routines that affect how the computer transfers data between computer components, such as memory, disks, and the display adapter. The BIOS instructions are built into the computerâs read-only PHPRU\%,26SDUDPHWHUVFDQEHFRQĂJXUHGE\WKHXVHUWKURXJKWKH%,266HWXSSURJUDP7KH%,26 FDQEHXSGDWHGXVLQJWKHSURYLGHGXWLOLW\WRFRS\DQHZ%,26ĂOHLQWRWKH((3520 Bit (Binary Digit) Represents the smallest unit of data used by the computer. A bit can have one of two values: 0 or 1. Boot Boot means to start the computer operating system by loading it into system memory. When the manual instructs you to âbootâ your system (or computer), it means to turn ON your computer. âRebootâ means WRUHVWDUW\RXUFRPSXWHU:KHQXVLQJ:LQGRZVRUODWHUVHOHFWLQJ´5HVWDUWÂľIURP´6WDUW_6KXW'RZQÂľ will reboot your computer. Byte (Binary Term) One byte is a group of eight contiguous bits. A byte is used to represent a single alphanumeric character, punctuation mark, or other symbol. Clock Throttling Chipset function which allows the processorâs clock to be stopped and started at a known duty cycle. Clock throttling is used for power savings, thermal management, and reducing processing speed. Appendix Glossary (Cont.) CPU (Central Processing Unit) The CPU, sometimes called âProcessor,â actually functions as the âbrainâ of the computer. It interprets and executes program commands and processes data stored in memory. Device Driver A device driver is a special set of instructions that allows the computerâs operating system to communicate with devices such as VGA, audio, Ethernet, printer, or modem. DVD '9'LVHVVHQWLDOO\DELJJHUIDVWHU&'WKDWFDQKROGYLGHRDVZHOODVDXGLRDQGFRPSXWHUGDWD:LWK WKHVHFDSDFLWLHVDQGDFFHVVUDWHV'9'GLVFVFDQSURYLGH\RXZLWKGUDPDWLFDOO\HQKDQFHGKLJKFRORU IXOOPRWLRQYLGHRVEHWWHUJUDSKLFVVKDUSHUSLFWXUHVDQGGLJLWDODXGLRIRUDWKHDWHUOLNHH[SHULHQFH'9' aims to encompass home entertainment, computers, and business information with a single digital format, HYHQWXDOO\UHSODFLQJDXGLR&'YLGHRWDSHODVHUGLVF&'520DQGYLGHRJDPHFDUWULGJHV ExpressCard ExpressCard slot is 26 pins and support one ExpressCard/34mm or one ExpressCard/54mm expansion card. This new interface is faster by using a serial bus supporting USB 2.0 and PCI Express instead of the slower parallel bus used in the PC card slot. (Not compatible with previous PCMCIA cards.) Hardware Hardware is a general term referring to the physical components of a computer system, including peripherals such as printers, modems, and pointing devices. IDE (Integrated Drive Electronics) ,'(GHYLFHVLQWHJUDWHWKHGULYHFRQWUROFLUFXLWU\GLUHFWO\RQWKHGULYHLWVHOIHOLPLQDWLQJWKHQHHGIRUD VHSDUDWHDGDSWHUFDUG LQWKHFDVHIRU6&6,GHYLFHV 8OWUD'0$RU,'(GHYLFHVFDQDFKLHYHXS to 33MB/Sec transfer. IEEE1394 (1394) Also known as iLINK (Sony) or FireWire (Apple). 1394 is a high speed serial bus like SCSI but has simple connections and hot-plugging capabilities like USB. The popular 1394a interface has a bandwidth of 400Mbits/sec and can handle up to 63 units on the same bus. The newer 1394b interface can support twice the speed and will appear in future models when peripherals support higher speeds. It is very likely WKDWWRJHWKHUZLWK86%ZLOOUHSODFH3DUDOOHO,'(6&6,DQG(,'(SRUWVLVDOVRXVHGLQ KLJKHQGGLJLWDOHTXLSPHQWDQGVKRXOGEHPDUNHG´'9ÂľIRU'LJLWDO9LGHRSRUW Infrared Port (IrDA) (on selected models) 7KHLQIUDUHG ,U'$ FRPPXQLFDWLRQSRUWDOORZVFRQYHQLHQWZLUHOHVVGDWDFRPPXQLFDWLRQZLWKLQIUDred-equipped devices or computers up to 4Mbits/sec. This allows easy wireless synchronization with 3'$VRUPRELOHSKRQHVDQGHYHQZLUHOHVVSULQWLQJWRSULQWHUV6PDOORIĂFHVFDQXVH,U'$WHFKQRORJ\WR VKDUHDSULQWHUEHWZHHQVHYHUDOFORVHO\SODFHG1RWHERRN3&VDQGHYHQVHQGĂOHVWRHDFKRWKHUZLWKRXW a network. A Appendix Glossary (Cont.) KensingtonÂŽ Locks KensingtonÂŽ locks (or compatible) allow the Notebook PC to be secured usually using a metal cable and ORFNWKDWSUHYHQWWKH1RWHERRN3&WREHUHPRYHGIURPDĂ[HGREMHFW6RPHVHFXULW\SURGXFWVPD\DOVR include a motion detector to sound an alarm when moved. /DVHU&ODVVLĂFDWLRQV As lasers became more numerous and more widely used, the need to warn users of laser hazards became DSSDUHQW7RPHHWWKLVQHHGODVHUFODVVLĂFDWLRQVZHUHHVWDEOLVKHG&XUUHQWFODVVLĂFDWLRQOHYHOVYDU\IURP optically safe, requiring no controls (Class 1) to very hazardous, requiring strict controls (Class 4). CLASS 1: A Class 1 laser or laser system emits levels of optical energy that are eye-safe and consequently require no controls. An example of this class of laser system is the checkout scanning device found in most grocery stores or lasers used in optical drives. CLASS 2 & CLASS 3A: Class 2 and Class 3A lasers emit visible, continuous-wave (CW) optical radiation levels slightly above the maximum permissible exposure (MPE) level. Although these lasers can cause eye damage, their brightness usually causes observers to look away or blink before eye damage occurs. These lasers have strict administrative controls requiring placement of signs warning personnel not to stare directly into the beam. Class 3A lasers must not be viewed with optically-aided devices. CLASS 3B: Class 3B lasers, and Class 3A lasers with outputs of 2.5mW, are hazardous to personnel ZKRDUHZLWKLQWKHEHDPSDWKDQGORRNDWWKHEHDPVRXUFHGLUHFWO\RUE\VSHFXODUUHĂHFWLRQ7KHVH ODVHUVFDQQRWSURGXFHKD]DUGRXVGLIIXVHUHĂHFWLRQV3HUVRQQHOZRUNLQJZLWKWKHVHODVHUVVKRXOGZHDU appropriate protective eye wear during any operation of the laser. Class 3B lasers have both administrative and physical controls to protect personnel. Physical controls include limited access work areas. Administrative controls include special warning signs posted outside the entrances to the laser work spaces and lights outside the entrances that warn personnel when the lasers are in use. CLASS 4: Class 4 lasers are high-power lasers that will cause damage to unprotected eyes and skin WKURXJKLQWUDEHDPYLHZLQJDQGVSHFXODURUGLIIXVHUHĂHFWLRQV&RQVHTXHQWO\QRSHUVRQQHOVKRXOG be in a room where a Class 4 laser is operating without proper eye protection. PCI Bus (Peripheral Component Interconnect Local Bus) 3&,EXVLVDVSHFLĂFDWLRQWKDWGHĂQHVDELWGDWDEXVLQWHUIDFH3&,LVDVWDQGDUGZLGHO\XVHGE\H[pansion card manufacturers. POST (Power On Self Test) :KHQ\RXWXUQRQWKHFRPSXWHULWZLOOĂUVWUXQWKURXJKWKH3267DVHULHVRIVRIWZDUHFRQWUROOHGGLDJnostic tests. The POST checks system memory, the motherboard circuitry, the display, the keyboard, the diskette drive, and other I/O devices. Appendix Glossary (Cont.) RAM (Random Access Memory) RAM (usually just called memory) is the place in a computer where the operating system, application programs, and data in current use are temporarily kept so that they can be quickly reached by the computerâs processor instead of having to read from and write to slower storage such as the hard disk or optical disc. Suspend Mode ,Q6DYHWR5$0 675 DQG6DYHWR'LVN 67' WKH&38FORFNLVVWRSSHGDQGPRVWRIWKH1RWHERRN3& devices are put in their lowest active state. The Notebook PC enters Suspend when the system remains LGOHIRUDVSHFLĂHGDPRXQWRIWLPHRUPDQXDOO\XVLQJWKHIXQFWLRQNH\V7KHWLPHRXWVHWWLQJRIERWK +DUG'LVNDQG9LGHRFDQEHVHWE\WKH%,266HWXS7KH3RZHU/('EOLQNVZKHQWKH1RWHERRN3&LV LQ675PRGH,Q67'PRGHWKH1RWHERRN3&ZLOODSSHDUWREHSRZHUHG2)) System Disk $V\VWHPGLVNFRQWDLQVWKHFRUHĂOHRIDQRSHUDWLQJV\VWHPDQGLVXVHGWRERRWXSWKHRSHUDWLQJV\VWHP TPM (Trusted Platform Module) (on selected models) The TPM is a security hardware device on the system board that will hold computer-generated keys for encryption. It is a hardware-based solution that can help avoid attacks by hackers looking to capture passwords and encryption keys to sensitive data. The TPM provides the ability to the PC or Notebook PC to run applications more secure and to make transactions and communication more trustworthy. Twisted-Pair Cable The cable used to connect the Ethernet card to a host (generally a Hub or Switch) is called a straightthrough Twisted Pair Ethernet (TPE). The end connectors are called RJ-45 connectors, which are not compatible with RJ-11 telephone connectors. If connecting two computers together without a hub in between, a crossover twisted-pair is required. UltraDMA/66 or 100 8OWUD'0$RUDUHQHZVSHFLĂFDWLRQVWRLPSURYH,'(WUDQVIHUUDWHV8QOLNHWUDGLWLRQDO3,2PRGH ZKLFKRQO\XVHVWKHULVLQJHGJHRI,'(FRPPDQGVLJQDOWRWUDQVIHUGDWD8OWUD'0$RUXVHVERWK rising edge and falling edge. USB (Universal Serial Bus) A new 4-pin serial peripheral bus that allows plug and play computer peripherals such as keyboard, PRXVHMR\VWLFNVFDQQHUSULQWHUDQGPRGHP,6'1WREHDXWRPDWLFDOO\FRQĂJXUHGZKHQWKH\DUHDWtached physically without having to install drivers or reboot. With USB, the traditional complex cables from back panel of your PC can be eliminated. A Appendix Declarations and Safety Statements DVD-ROM Drive Information 7KH1RWHERRN3&FRPHVZLWKDQRSWLRQDO'9'520GULYHRUD&'520GULYH,QRUGHUWRYLHZ'9' WLWOHV\RXPXVWLQVWDOO\RXURZQ'9'YLHZHUVRIWZDUH2SWLRQDO'9'YLHZHUVRIWZDUHPD\EHSXUFKDVHG ZLWKWKLV1RWHERRN3&7KH'9'520GULYHDOORZVWKHXVHRIERWK&'DQG'9'GLVFV Regional Playback Information 3OD\EDFNRI'9'PRYLHWLWOHVLQYROYHVGHFRGLQJ03(*YLGHRGLJLWDO$&DXGLRDQGGHFU\SWLRQRI&66 protected content. CSS (sometimes called copy guard) is the name given to the content protection scheme adopted by the motion picture industry to satisfy a need to protect against unlawful content duplication. Although the design rules imposed on CSS licensors are many, one rule that is most relevant is playback reVWULFWLRQVRQUHJLRQDOL]HGFRQWHQW,QRUGHUWRIDFLOLWDWHJHRJUDSKLFDOO\VWDJJHUHGPRYLHUHOHDVHV'9'YLGHR WLWOHVDUHUHOHDVHGIRUVSHFLĂFJHRJUDSKLFUHJLRQVDVGHĂQHGLQ´5HJLRQ'HĂQLWLRQVÂľEHORZ&RS\ULJKWODZV UHTXLUHWKDWDOO'9'PRYLHVEHOLPLWHGWRDSDUWLFXODUUHJLRQ XVXDOO\FRGHGWRWKHUHJLRQDWZKLFKLWLVVROG :KLOH'9'PRYLHFRQWHQWPD\EHUHOHDVHGIRUPXOWLSOHUHJLRQV&66GHVLJQUXOHVUHTXLUHWKDWDQ\V\VWHP capable of playing CSS encrypted content must only be capable of playing one region. 127(7KHUHJLRQVHWWLQJPD\EHFKDQJHGXSWRĂYHWLPHVXVLQJWKHYLHZHUVRIWZDUH then it can only play DVD movies for the last region setting. Changing the region code after that will require factory resetting which is not covered by warranty. If resetting is desired, shipping and resetting costs will be at the expense of the user. 5HJLRQ'HĂQLWLRQV Region 1 Canada, US, US Territories Region 2 Czech, Egypt, Finland, France, Germany, Gulf States, Hungary, Iceland, Iran, Iraq, Ireland, Italy, Japan, Netherlands, Norway, Poland, Portugal, Saudi Arabia, Scotland, South Africa, Spain, Sweden, Switzerland, Syria, Turkey, UK, Greece, Former Yugoslav Republics, Slovakia Region 3 Burma, Indonesia, South Korea, Malaysia, Philippines, Singapore, Taiwan, Thailand, Vietnam Region 4 $XVWUDOLD &DULEEHDQ ([FHSW 867HUULWRULHV &HQWUDO$PHULFD 1HZ =HDODQG 3DFLĂF ,VODQGV 6RXWK America Region 5 CIS, India, Pakistan, Rest of Africa, Russia, North Korea Region 6 China Appendix Internal Modem Compliancy The Notebook PC with internal modem model complies with JATE (Japan), FCC (US, Canada, Korea, 7DLZDQ DQG &757KH LQWHUQDO PRGHP KDV EHHQ DSSURYHG LQ DFFRUGDQFH ZLWK &RXQFLO 'HFLVLRQ 98/482/EC for pan-European single terminal connection to the public switched telephone network (PSTN). However due to differences between the individual PSTNs provided in different countries, the approval does not, of itself, give an unconditional assurance of successful operation on every PSTN network termination point. In the event of problems you should contact your equipment supplier in the ĂUVWLQVWDQFH Overview 2QWK$XJXVWWKH(XURSHDQ&RXQFLO'HFLVLRQUHJDUGLQJWKH&75KDVEHHQSXEOLVKHGLQWKH 2IĂFLDO-RXUQDORIWKH(&7KH&75DSSOLHVWRDOOQRQYRLFHWHUPLQDOHTXLSPHQWZLWK'70)GLDOOLQJ which is intended to be connected to the analogue PSTN (Public Switched Telephone Network). CTR 21 (Common Technical Regulation) for the attachment requirements for connection to the analogue public switched telephone networks of terminal equipment (excluding terminal equipment supporting WKHYRLFHWHOHSKRQ\MXVWLĂHGFDVHVHUYLFH LQZKLFKQHWZRUNDGGUHVVLQJLISURYLGHGLVE\PHDQVRIGXDO tone multifrequency signalling. Network Compatibility Declaration 6WDWHPHQWWREHPDGHE\WKHPDQXIDFWXUHUWRWKH1RWLĂHG%RG\DQGWKHYHQGRU´7KLVGHFODUDWLRQZLOO LQGLFDWHWKHQHWZRUNVZLWKZKLFKWKHHTXLSPHQWLVGHVLJQHGWRZRUNDQGDQ\QRWLĂHGQHWZRUNVZLWK ZKLFKWKHHTXLSPHQWPD\KDYHLQWHUZRUNLQJGLIĂFXOWLHVÂľ Network Compatibility Declaration Statement to be made by the manufacturer to the user: âThis declaration will indicate the networks with ZKLFKWKHHTXLSPHQWLVGHVLJQHGWRZRUNDQGDQ\QRWLĂHGQHWZRUNVZLWKZKLFKWKHHTXLSPHQWPD\ KDYHLQWHUZRUNLQJGLIĂFXOWLHV7KHPDQXIDFWXUHUVKDOODOVRDVVRFLDWHDVWDWHPHQWWRPDNHLWFOHDUZKHUH network compatibility is dependent on physical and software switch settings. It will also advise the user to contact the vendor if it is desired to use the equipment on another network.â 8SWRQRZWKH1RWLĂHG%RG\RI&(7(&20LVVXHGVHYHUDOSDQ(XURSHDQDSSURYDOVXVLQJ&757KH UHVXOWVDUH(XURSH¡VĂUVWPRGHPVZKLFKGRQRWUHTXLUHUHJXODWRU\DSSURYDOVLQHDFKLQGLYLGXDO(XURSHDQ country. Non-Voice Equipment Answering machines and loud-speaking telephones can be eligible as well as modems, fax machines, auto-dialers and alarm systems. Equipment in which the end-to-end quality of speech is controlled by regulations (e.g. handset telephones and in some countries also cordless telephones) is excluded. A Appendix Internal Modem Compliancy (Cont.) This table shows the countries currently under the CTR21 standard. Country Austria1 Belgium Czech Republic 'HQPDUN1 Finland France Germany Greece Hungary Iceland Ireland Italy Israel Lichtenstein Luxemburg The Netherlands1 Norway Poland Portugal Spain Sweden Switzerland United Kingdom Applied Yes Yes No Yes Yes Yes Yes Yes No Yes Yes Still Pending No Yes Yes Yes Yes No No No Yes Yes Yes More Testing No No Not Applicable Yes No No No No Not Applicable No No Still Pending No No No Yes No Not Applicable Not Applicable Not Applicable No No No This information was copied from CETECOM and is supplied without liability. For updates to this table, you may visit http://www.cetecom.de/technologies/ctr_21.html National requirements will apply only if the equipment may use pulse dialling (manufacturers may state LQWKHXVHUJXLGHWKDWWKHHTXLSPHQWLVRQO\LQWHQGHGWRVXSSRUW'70)VLJQDOOLQJZKLFKZRXOGPDNH DQ\DGGLWLRQDOWHVWLQJVXSHUĂXRXV ,Q7KH1HWKHUODQGVDGGLWLRQDOWHVWLQJLVUHTXLUHGIRUVHULHVFRQQHFWLRQDQGFDOOHU,'IDFLOLWLHV Appendix Federal Communications Commission Statement This device complies with FCC Rules Part 15. Operation is subject to the following two conditions: ⢠This device may not cause harmful interference, and ⢠This device must accept any interference received, including interference that may cause undesired operation. This equipment has been tested and found to comply with the limits for a class B digital device, pursuant to Part 15 of the Federal Communications Commission (FCC) rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses, and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: ⢠Reorient or relocate the receiving antenna. ⢠Increase the separation between the equipment and receiver. ⢠Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. ⢠Consult the dealer or an experienced radio/TV technician for help. WARNING! The use of a shielded-type power cord is required in order to meet FCC emission limits and to prevent interference to the nearby radio and television reception. It is essential that only the supplied power cord be used. Use only shielded cables to connect I/O devices to this equipment. You are cautioned that changes or PRGLĂFDWLRQVQRWH[SUHVVO\DSSURYHGE\WKHSDUW\UHVSRQVLEOHIRUFRPSOLDQFHFRXOG void your authority to operate the equipment. 5HSULQWHGIURPWKH&RGHRI)HGHUDO5HJXODWLRQVSDUW:DVKLQJWRQ'&2IĂFHRIWKH)HGHUDO 5HJLVWHU1DWLRQDO$UFKLYHVDQG5HFRUGV$GPLQLVWUDWLRQ86*RYHUQPHQW3ULQWLQJ2IĂFH CE Mark Warning This is a Class B product, in a domestic environment, this product may cause radio interference, in which case the user may be required to take adequate measures. A Appendix FCC Radio Frequency Interference Requirements RF exposure warning This equipment must be installed and operated in accordance with provided instructions and must not be co-located or operating in conjunction with any other antenna or transmitter. End-users and installers must be provide with antenna installation instructions and transmitter operating conditions for satisfying RF exposure compliance. )&&&DXWLRQ$Q\FKDQJHVRUPRGLĂFDWLRQVQRWH[SUHVVO\DSSURYHGE\WKHSDUW\UHsponsible for compliance could void the userâs authority to operate this equipment. The manufacturer declares that this device is limited to Channels 1 through 11 in the *+]IUHTXHQF\E\VSHFLĂHGĂUPZDUHFRQWUROOHGLQWKH86$Âľ Max. SAR Measurement (1g) 802.11b: 1.406 W/kg 802.11g: 0.949 W/kg R&TTE Directive (1999/5/EC) 7KHIROORZLQJLWHPVZHUHFRPSOHWHGDQGDUHFRQVLGHUHGUHOHYDQWDQGVXIĂFLHQWIRUWKH5 77( 5DGLR & Telecommunications Terminal Equipment) directive:         (VVHQWLDOUHTXLUHPHQWVDVLQ>$UWLFOH@ 3URWHFWLRQUHTXLUHPHQWVIRUKHDOWKDQGVDIHW\DVLQ>$UWLFOHD@ 7HVWLQJIRUHOHFWULFVDIHW\DFFRUGLQJWR>(1@ 3URWHFWLRQUHTXLUHPHQWVIRUHOHFWURPDJQHWLFFRPSDWLELOLW\LQ>$UWLFOHE@ 7HVWLQJIRUHOHFWURPDJQHWLFFRPSDWLELOLW\LQ>(1@ >(1@ 7HVWLQJDFFRUGLQJWR>@ (IIHFWLYHXVHRIWKHUDGLRVSHFWUXPDVLQ>$UWLFOH@ 5DGLRWHVWVXLWHVDFFRUGLQJWR>(1@ Appendix Wireless Operation Channel for Different Domains N. America Japan Europe ETSI 2.412-2.462 GHz 2.412-2.484 GHz 2.412-2.472 GHz Ch01 through CH11 Ch01 through Ch14 Ch01 through Ch13 France Restricted Wireless Frequency Bands Some areas of France have a restricted frequency band. The worst case maximum authorized power indoors are: ⢠10mW for the entire 2.4 GHz band (2400 MHzâ2483.5 MHz) ⢠100mW for frequencies between 2446.5 MHz and 2483.5 MHz NOTE: Channels 10 through 13 inclusive operate in the band 2446.6 MHz to 2483.5 MHz. There are few possibilities for outdoor use: On private property or on the private property of public SHUVRQVXVHLVVXEMHFWWRDSUHOLPLQDU\DXWKRUL]DWLRQSURFHGXUHE\WKH0LQLVWU\RI'HIHQVHZLWKPD[Lmum authorized power of 100mW in the 2446.5â2483.5 MHz band. Use outdoors on public property is not permitted. In the departments listed below, for the entire 2.4 GHz band: ⢠Maximum authorized power indoors is 100mW ⢠Maximum authorized power outdoors is 10mW 'HSDUWPHQWVLQZKLFKWKHXVHRIWKH²0+]EDQGLVSHUPLWWHGZLWKDQ(,53RIOHVVWKDQ 100mW indoors and less than 10mW outdoors: 01 Ain Orientales 08 Ardennes &KDUHQWH 32 Gers 45 Loiret 1RUG 64 PyrĂŠnĂŠes Atlantique +DXWH6D{QH 84 Vaucluse 94 Val de Marne 02 Aisne 09 Ariège 'RUGRJQH 36 Indre 50 Manche 2LVH 66 PyrĂŠnĂŠes 6D{QHHW/RLUH 88 Vosges 03 Allier 11 Aude 'RXEV 37 Indre et Loire 55 Meuse 2UQH 67 Bas Rhin 75 Paris 89 Yonne 05 Hautes Alpes 12 Aveyron 'U{PH 41 Loir et Cher 58 Nièvre 3X\GX'{PH 68 Haut Rhin 82 Tarn et Garonne 90 Territoire de Belfort This requirement is likely to change over time, allowing you to use your wireless LAN card in more areas within France. Please check with ART for the latest information (www.art-telecom.fr) NOTE: Your WLAN Card transmits less than 100mW, but more than 10mW. A Appendix UL Safety Notices Required for UL 1459 covering telecommunications (telephone) equipment intended to be electrically connected to a telecommunication network that has an operating voltage to ground that does not exceed 200V peak, 300V peak-to-peak, and 105V rms, and installed or used in accordance with the National Electrical Code (NFPA 70). When using the Notebook PC modem, basic safety precautions should always be followed to reduce the ULVNRIĂUHHOHFWULFVKRFNDQGLQMXU\WRSHUVRQVLQFOXGLQJWKHIROORZLQJ ⢠Do not use the Notebook PC near water, for example, near a bath tub, wash bowl, kitchen sink or laundry tub, in a wet basement or near a swimming pool. ⢠Do not use the Notebook PC during an electrical storm. There may be a remote risk of electric shock from lightning. ⢠Do not use the Notebook PC in the vicinity of a gas leak. Required for UL 1642 covering primary (non-rechargeable) and secondary (rechargeable) lithium batteries for use as power sources in products. These batteries contain metallic lithium, or a lithium alloy, or a lithium ion, and may consist of a single electrochemical cell or two or more cells connected in series, parallel, or both, that convert chemical energy into electrical energy by an irreversible or reversible chemical reaction. ⢠Do not GLVSRVHWKH1RWHERRN3&EDWWHU\SDFNLQDĂUHDVWKH\PD\H[SORGH&KHFNZLWKORFDO codes for possible special disposal instructions to reduce the risk of injury to persons due to ĂUHRUH[SORVLRQ ⢠Do not use power adapters or batteries from other devices to reduce the risk of injury to perVRQVGXHWRĂUHRUH[SORVLRQ8VHRQO\8/FHUWLĂHGSRZHUDGDSWHUVRUEDWWHULHVVXSSOLHGE\WKH manufacturer or authorized retailers. Power Safety Requirement Products with electrical current ratings up to 6A and weighing more than 3Kg must use approved power cords greater than or equal to: H05VV-F, 3G, 0.75mm2 or H05VV-F, 2G, 0.75mm2. Appendix Nordic Lithium Cautions (for lithium-ion batteries) CAUTION! 'DQJHURIH[SORVLRQLIEDWWHU\LVLQFRUUHFWO\UHSODFHG5HSODFHRQO\ZLWK WKHVDPHRUHTXLYDOHQWW\SHUHFRPPHQGHGE\WKHPDQXIDFWXUHU'LVSRVHRIXVHGEDWteries according to the manufacturerâs instructions. (English) ATTENZIONE! Rischio di esplosione della batteria se sostituita in modo errato. Sostituire la batteria con un una di tipo uguale o equivalente consigliata dalla fabbrica. Non disperdere le batterie nellâambiente. (Italian) VORSICHT! Explosionsgetahr bei unsachgemäĂen Austausch der Batterie. Ersatz nur durch denselben oder einem vom Hersteller empfohlenem ähnlichen Typ. Entsorgung gebrauchter Batterien nach Angaben des Herstellers. (German) ADVARSELI! Lithiumbatteri - Eksplosionsfare ved fejlagtig hĂĽndtering. Udskiftning mĂĽ kun ske med batteri af samme fabrikat og type. LevĂŠr det brugte batteri tilbage til OHYHUDQGÂĄUHQ 'DQLVK VARNING! Explosionsfara vid felaktigt batteribyte. Använd samma batterityp eller en ekvivalent typ som rekommenderas av apparattillverkaren. Kassera använt batteri enligt fabrikantens instruktion. (Swedish) VAROITUS! Paristo voi räjähtää, jos se on virheellisesti asennettu. Vaihda paristo ainoastaan laitevalmistajan sousittelemaan tyyppiin. Hävitä käytetty paristo valmistagan ohjeiden mukaisesti. (Finnish) ATTENTION! Il y a danger dâexplosion sâil y a remplacement incorrect de la batterie. Remplacer uniquement avec une batterie du mĂŞre type ou dâun type ĂŠquivalent recommandĂŠ par le constructeur. Mettre au rebut les batteries usagĂŠes conformĂŠment aux instructions du fabricant. (French) ADVARSEL! Eksplosjonsfare ved feilaktig skifte av batteri. Benytt samme batteritype eller en tilsvarende type anbefalt av apparatfabrikanten. Brukte batterier kasseres i henhold til fabrikantens instruksjoner. (Norwegian) (Japanese) A Appendix Optical Drive Safety Information Laser Safety Information ,QWHUQDORUH[WHUQDORSWLFDOGULYHVVROGZLWKWKLV1RWHERRN3&FRQWDLQVD&/$66/$6(5352'8&7 /DVHUFODVVLĂFDWLRQVFDQEHIRXQGLQWKHJORVVDU\DWWKHHQGRIWKLVXVHU¡VPDQXDO :$51,1*0DNLQJDGMXVWPHQWVRUSHUIRUPLQJSURFHGXUHVRWKHUWKDQWKRVHVSHFLĂHG in the userâs manual may result in hazardous laser exposure. Do not attempt to disassemble the optical drive. For your safety, have the optical drive serviced only by an authorized service provider. Service warning label CAUTION: INVISIBLE LASER RADIATION WHEN OPEN. DO NOT STARE INTO BEAM OR VIEW DIRECTLY WITH OPTICAL INSTRUMENTS. CDRH Regulations 7KH&HQWHUIRU'HYLFHVDQG5DGLRORJLFDO+HDOWK &'5+ RIWKH86)RRGDQG'UXJ$GPLQLVWUDWLRQLPSOHmented regulations for laser products on August 2, 1976. These regulations apply to laser products manufactured from August 1, 1976. Compliance is mandatory for products marketed in the United States. WARNING: Use of controls or adjustments or performance of procedures other than WKRVHVSHFLĂHGKHUHLQRULQWKHODVHUSURGXFWLQVWDOODWLRQJXLGHPD\UHVXOWLQKD]DUGous radiation exposure. Macrovision Corporation Product Notice This product incorporates copyright protection technology that is protected by method claims of certain U.S.A. patents and other intellectual property rights owned by Macrovision Corporation and other rights owners. Use of this copyright protection technology must be authorized by Macrovision Corporation, and is intended for home and other limited viewing uses only unless otherwise authorized by Macrovision Corporation. Reverse engineering or disassembly is prohibited. Appendix CTR 21 Approval (for Notebook PC with built-in Modem) Danish Dutch English Finnish French German Greek Italian Portuguese Spanish Swedish A Appendix Appendix Notebook PC Information This page is provided for recording information concerning your Notebook PC for future reference or IRUWHFKQLFDOVXSSRUW.HHSWKLV8VHU¡V0DQXDOLQDVHFXUHGORFDWLRQLISDVVZRUGVDUHĂOOHGRXW Ownerâs Name: ___________________________ Ownerâs Telephone: ______________ Manufacturer:_______________ Model: ___________ Serial Number: ______________ Display Size: ___________ Resolution: _____________Memory Size: ______________ Retailer: _________________Location: ___________ Purchase Date: ______________ Hard Drive Manufacturer: ____________________________ Capacity: ______________ Optical Drive Manufacturer: _____________________________ Type: ______________ BIOS Version:__________________________________________Date: ______________ Accessories: _____________________________________________________________ Accessories: _____________________________________________________________ Software Operating System:__________Version: ___________ Serial Number: ______________ Software: _________________Version: ___________ Serial Number: ______________ Software: _________________Version: ___________ Serial Number: ______________ Security Supervisor Name: _______________________ Supervisor Password: ______________ User Name:___________________________________User Password: ______________ Network User Name:______________Password: _________________ Domain: ______________ User Name:______________Password: _________________ Domain: ______________ Copyright Information No part of this manual, including the products and software described in it, may be reproduced, transmitted, transcribed, stored in a retrieval system, or translated into any language in any form or by any means, except documentation kept by the purchaser for backup purposes, without the express written permission of ASUSTeK COMPUTER INC. (âASUSâ). $686 3529,'(6 7+,6 0$18$/ ´$6 ,6Âľ :,7+287 :$55$17< 2)$1< .,1' (,7+(5 (;35(6625,03/,(',1&/8',1*%87127/,0,7('727+(,03/,(':$55$17,(625 &21',7,2162)0(5&+$17$%,/,7<25),71(66)25$3$57,&8/$5385326(,112 (9(17 6+$//$686 ,76 ',5(&7256 2)),&(56 (03/2<((6 25$*(176 %( /,$%/( )25$1<,1',5(&763(&,$/,1&,'(17$/25&216(48(17,$/'$0$*(6 ,1&/8',1* '$0$*(6)25/2662)352),76/2662)%86,1(66/2662)86(25'$7$,17(55837,212)%86,1(66$1'7+(/,.( (9(1,)$686+$6%((1$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(6$5,6,1*)520$1<'()(&725(5525,17+,60$18$/ 25352'8&7 Products and corporate names appearing in this manual may or may not be registered trademarks or FRS\ULJKWVRIWKHLUUHVSHFWLYHFRPSDQLHVDQGDUHXVHGRQO\IRULGHQWLĂFDWLRQRUH[SODQDWLRQDQGWRWKH RZQHUV¡EHQHĂWZLWKRXWLQWHQWWRLQIULQJH 63(&,),&$7,216$1',1)250$7,21&217$,1(',17+,60$18$/$5()851,6+(')25 ,1)250$7,21$/86(21/<$1'$5(68%-(&772&+$1*($7$1<7,0(:,7+287127,&($1'6+28/'127%(&216758('$6$&200,70(17%<$686$686$6680(612 RESPONSIBILITY OR LIABILITY FOR ANY ERRORS OR INACCURACIES THAT MAY APPEAR ,17+,60$18$/,1&/8',1*7+(352'8&76$1'62)7:$5('(6&5,%(',1,7 Copyright Š 2007 ASUSTeK COMPUTER INC. All Rights Reserved. Limitation of Liability Circumstances may arise where because of a default on ASUSâ part or other liability, you are entitled to recover damages from ASUS. In each such instance, regardless of the basis on which you are entitled to claim damages from ASUS, ASUS is liable for no more than damages for bodily injury (including death) and damage to real property and tangible personal property; or any other actual and direct damages resulted from omission or failure of performing legal duties under this Warranty Statement, up to the listed contract price of each product. ASUS will only be responsible for or indemnify you for loss, damages or claims based in contract, tort or infringement under this Warranty Statement. This limit also applies to ASUSâ suppliers and its reseller. It is the maximum for which ASUS, its suppliers, and your reseller are collectively responsible. 81'(512&,5&8067$1&(6,6$686/,$%/()25$1<2)7+()2//2:,1* 7+,5' 3$57<&/$,06$*$,167<28)25'$0$*(6 /2662)25'$0$*(72<2855(&25'625'$7$25 63(&,$/,1&,'(17$/25,1',5(&7'$0$*(625)25$1< (&2120,&&216(48(17,$/'$0$*(6 ,1&/8',1*/267352),76256$9,1*6 (9(1 ,)$686,766833/,(5625<2855(6(//(5,6,1)250('2)7+(,53266,%,/,7< Service and Support Visit our multi-language web site at http://support.asus.com
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.4 Linearized : No Modify Date : 2007:07:11 15:14:21+08:00 Create Date : 2007:07:11 15:14:10+08:00 Title :EXIF Metadata provided by EXIF.toolsAuthor : amytsai1 Creator : PScript5.dll Version 5.2 Producer : Acrobat Distiller 7.0.5 (Windows) Page Count : 31 Mod Date : 2007:07:11 15:14:21+08:00 Creation Date : 2007:07:11 15:14:10+08:00 Metadata Date : 2007:07:11 15:14:21+08:00