ASUSTeK Computer F9AWGE780 NOTEBOOK P.C. User Manual AD5EA4E5A4E2A5552E706466
ASUSTeK Computer Inc NOTEBOOK P.C. AD5EA4E5A4E2A5552E706466
Contents
- 1. USERS MANUAL 1
- 2. USERS MANUAL 2
USERS MANUAL 2
![](/img.php?id=824849&img=bg1.png)
A Appendix
1. A Bluetooth icon
should be located on
your Windows taskbar.
Right click the taskbar
Bluetooth icon and
choose Add New
Connection.
5. Select “Express Mode” and click Next.
3. Turn ON the switch on the
bottom of the mouse.
2. Install two “AA” batteries.
6. A list of available Bluetooth devices will appear.
Select “Logitech Travel Mouse” and click Next.
7. The software will register the Bluetooth mouse.
Click Finish when complete.
8. A mouse icon with a pair of green and
yellow hands will show in this window.
R
E
S
E
T
OFF ON
If you do not see the Bluetooth
mouse here. Push the “RESET”
button on the bottom of the
mouse and click Refresh here.
1RWH´5(6(7µPD\EHQHFHVVDU\DIWHUFKDQJLQJEDWWHULHV5HSHDWVWHSVLIQHFHVVDU\
Bluetooth Mouse (optional)
Windows XP
4. Push the “RESET” button on
the bottom of the mouse.
![](/img.php?id=824849&img=bg2.png)
Appendix A
Troubleshooting (Windows XP)
In “Device Manager”, check if “Bluetooth Personal
Area Network” is available as shown here.
4XHVWLRQ,FDQQRWVHHP\%OXHWRRWKPRXVHLQ
the list. What do I do?
Double-click on the
Bluetooth Icon.
Double-click on the
registered Bluetooth mouse.
After connection, the icon
will show a pair of green and
yellow hands.
Click Refresh in the software and
“RESET” on the mouse. Repeat if
necessary.
4XHVWLRQ , DOUHDG\ UHJLVWHUHG WKH %OXHWRRWK
mouse before. Why is it not working now? How
do I connect to it?
4XHVWLRQ +RZ GR , FKHFN LI P\ %OXHWRRWK LV
ready?
$SURPSWZLOODSSHDUIRUFRQÀUPDWLRQ&OLFNOK.
R
E
S
E
T
OFF ON
![](/img.php?id=824849&img=bg3.png)
A Appendix
Support Software
This Notebook PC comes with a support disc that provides BIOS, drivers and applications
to enable hardware features, extend functionality, help manage your Notebook PC, or
add functionality not provided by the native operating system. If updates or replace-
ment of the support disc is necessary, contact your dealer for web sites to download
individual software drivers and utilities.
The support disc contains all drivers, utilities and software for all popular operating systems
including those that have been pre-installed. The support disc does not include the operating system
LWVHOI7KHVXSSRUWGLVFLVQHFHVVDU\HYHQLI\RXU1RWHERRN3&FDPHSUHFRQÀJXUHGLQRUGHUWRSURYLGH
additional software not included as part of the factory pre-install.
A recovery disc is optional and includes an image of the original operating system installed on the hard
drive at the factory. The recovery disc provides a comprehensive recovery solution that quickly restores
the Notebook PC’s operating system to its original working state provided that your hard disk drive is
in good working order. Contact your retailer if you require such a solution.
Note: Some of the Notebook PC’s components and features may not work until the
device drivers and utilities are installed.
Operating System and Software
This Notebook PC may offer (depending on territory) its customers the choice of a pre-installed operat-
ing system such as Microsoft Windows “XP” or “Vista”. The choices and languages will depend on
the territory. The levels of hardware and software support may vary depending on the installed operating
system. The stability and compatibility of other operating systems cannot be guaranteed.
![](/img.php?id=824849&img=bg4.png)
Appendix A
System BIOS Settings
Boot Device
2. Select each item and press [Enter] to select a device.
1. On the Boot screen, select Boot Device Priority.
Security Setting
1. On the Security screen, select Change Supervisor or
Change User Password.
2. Type in a password
and press [Enter].
3. Re-type the password
and press [Enter].
4. Password is then set.
1. Leave the password
ÀHOGEODQNDQGSUHVV
[Enter].
To clear the password:
2. Password is then cleared.
![](/img.php?id=824849&img=bg5.png)
A Appendix
Password Check
Select whether to ask for a password during bootup (Always)
or only when entering the BIOS setup utility (Setup). Select the level of access to allow the “User Password” to
have in the BIOS setup utility.
User Access Level
Save Changes
,I\RXZDQWWRNHHS\RXUFRQÀJXUDWLRQVHWWLQJV\RXPXVW
save changes before exiting the BIOS setup utility.
If you want to restore default settings, choose Load
Manufacture Defaults. You must then save changes to
keep the manufacture default settings.
![](/img.php?id=824849&img=bg6.png)
Appendix A
Common Problems and Solutions
Hardware Problem - Optical Disc
The optical disc drive is not able to read or write discs.
1. Update the BIOS to the latest version and try again.
2. If updating the BIOS does not help, try better quality discs and try again.
3. If the problem still exist, contact your local service center and ask an engineer for assistance.
Unknown Reason - System Unstable
Cannot wake up from the hibernation.
5HPRYHXSJUDGHGSDUWV5$0+'':/$1%7LIWKH\ZHUHLQVWDOOHGDIWHUSXUFKDVH
2. If not the case, try MS System Restore to an earlier date.
,ISUREOHPVWLOOSHUVLVWVWU\UHVWRULQJ\RXUV\VWHPXVLQJWKHUHFRYHU\SDUWLWLRQRU'9'
(NOTE: You must backup all your data to another location before recovering.)
4. If the problem still exist, contact your local service center and ask an engineer for assistance.
Hardware Problem - Keyboard / Hotkey
The Hotkey (FN) is disabled.
$5HLQVWDOOWKH´$7.µGULYHUIURPWKHGULYHU&'RUGRZQORDGLWIURPWKH$686ZHEVLWH
Hardware Problem - Built-in Camera
The built-in camera does not work correctly.
&KHFN´'HYLFH0DQDJHUµWRVHHLIWKHUHDUHDQ\SUREOHPV
2. Try reinstalling the webcam driver to solve the problem.
3. If the problem is not solved, update the BIOS to the latest version and try again.
4. If the problem still exist, contact your local service center and ask an engineer for assistance.
Hardware Problem - Battery
Battery maintenance.
1. Register the Notebook PC for a one-year-warranty using the following website:
http://member.asus.com/login.aspx?SLanguage=en-us
'R127UHPRYHWKHEDWWHU\SDFNZKLOHXVLQJWKH1RWHERRN3&ZLWKWKH$&DGDSWRUWRSUHYHQW
damage caused by the accidental power loss. The ASUS battery pack has protection circuitry to
prevent over-charging so it will not damage the battery pack if it is left in the Notebook PC.
6WRUHWKHEDWWHU\SDFNLQDGU\ORFDWLRQZLWKWHPSHUDWXUHVEHWZHHQɅDQGɅLI\RXZLOO
not be using it for a long time. It is strongly recommended that you charge the battery pack
every three months.
![](/img.php?id=824849&img=bg7.png)
A Appendix
Common Problems and Solutions (Cont.)
Hardware Problem - Power ON/OFF Error
I cannot power ON the Notebook PC.
Diagnostics:
1. Power On by Battery only? (Y = 2, N = 4)
2. Able to see BIOS (ASUS Logo)? (Y = 3, N = A)
3. Able to load the OS? (Y = B, N = A)
$GDSWHUSRZHU/('21"< 1 &
5. Power ON by Adapter only? (Y = 6, N = A)
6. Able to see BIOS (ASUS Logo)? (Y = 7, N = A)
$EOHWRORDGWKH26"< '1 $
Symptom & Solutions:
$3UREOHPPLJKWEHLQWKH0%+''RU1%YLVLWDORFDOVHUYLFHFHQWHUIRUDVVLVWDQFH
B. Problem caused by the operating system, try restoring your system using the recovery partition or
disc. (IMPORTANT: You must backup all your data to another location before recovering.)
C. Adapter problem; check the power cord connections, otherwise visit a local service center for
replacement.
'%DWWHU\SUREOHPSOHDVHFKHFNWKHEDWWHU\FRQWDFWVRWKHUZLVHYLVLWDORFDOVHUYLFHFHQWHUIRU
repair.
Mechanical Problem - FAN / Thermal
Why is the cooling fan always ON and the temperature high?
1. Make sure that the FAN works when the CPU temperature is high and check whether there is
DLUÁRZIURPWKHPDLQDLUYHQW
2. If you have many applications running (see taskbar), close them to decrease system load.
3. The problem may also be caused by some viruses, use anti-virus software to detect them.
,IQRQHRIWKHDERYHKHOSWU\UHVWRULQJ\RXUV\VWHPXVLQJWKHUHFRYHU\SDUWLWLRQRU'9'
(IMPORTANT: You must backup all your data to another location before recovering.)
&$87,21'RQRWFRQQHFWWRWKH,QWHUQHWEHIRUH\RXKDYHLQVWDOOHGDQDQWLYLUXVVRIWZDUH
DQG,QWHUQHWÀUHZDOOWRSURWHFW\RXUVHOIIURPYLUXVHV
6HUYLFH6SHFLÀFDWLRQIXQFWLRQSULFH
How to check whether a Notebook PC is equipped with a wireless card?
A. Enter Control Panel!Device Manager. You will see whether the Notebook PC has a WLAN
card under the “Network Adapter” item.
![](/img.php?id=824849&img=bg8.png)
Appendix A
Common Problems and Solutions (Cont.)
Software Problem - ASUS bundled software
:KHQ,SRZHU21WKH1RWHERRN3&WKHUHZLOOEHDQ´2SHQSROLF\ÀOHHUURUµPHVVDJH
A. Reinstall the latest version “Power4 Gear” utility to solve your problem. It is available on the
ASUS website.
Unknown Reason - Blue screen with white text
A blue screen with white text appears after system bootup.
1. Remove additional memory. If additional memory was installed after purchase, power OFF,
remove the additional memory, and power ON to see if the problem is due to incompatible
memory.
2. Un-install software applications. If you have installed software applications recently, they may
not be compatible with your system. Try to un-install them in Windows Safe Mode.
3. Check your system for viruses.
8SGDWHWKH%,26WRWKHODWHVWYHUVLRQZLWK:,1)/$6+LQ:LQGRZVRU$)/$6+LQ'26PRGH
7KHVHXWLOLWLHVDQG%,26ÀOHVFDQEHGRZQORDGHGIURPWKH$686ZHEVLWH:$51,1*0DNH
VXUH\RXU1RWHERRN3&GRHVQRWORRVHSRZHUGXULQJWKH%,26ÁDVKLQJSURFHVV
5. If problem still cannot be solved, use the recovery process to reinstall your entire system.
(IMPORTANT: You must backup all your data to another location before recovering.)
&$87,21'RQRWFRQQHFWWRWKH,QWHUQHWEHIRUH\RXKDYHLQVWDOOHGDQDQWLYLUXVVRIWZDUHDQG
,QWHUQHWÀUHZDOOWRSURWHFW\RXUVHOIIURPYLUXVHV127(0DNHVXUHWKDW\RXLQVWDOOWKH´,QWHO
,1)8SGDWHµDQG´$7.$&3,µGULYHUVÀUVWVRWKDWKDUGZDUHGHYLFHVFDQEHUHFRJQL]HG
6. If the problem still exist, contact your local service center and ask an engineer for assistance.
![](/img.php?id=824849&img=bg9.png)
A Appendix
Software Problem - BIOS
Updating the BIOS.
3OHDVHYHULI\WKH1RWHERRN3&·VH[DFWPRGHODQGGRZQORDGWKHODWHVW%,26ÀOHIRU\RXUPRGHO
from the ASUS website.
8VHWKH´:,1)/$6+µXWLOLW\WRXSGDWH\RXU%,267KHXWLOLW\FDQEHIRXQGLQ\RXU'ULYHU
8WLOLW\&'WKDWFDPHZLWK\RXU1RWHERRN3&
([WUDFWWKH%,26ÀOHWRDWHPSRUDU\ORFDWLRQVXFKDVWKHURRWLQ&?
4. Click Start | All Programs | ASUS Utility | WINFLASH | WINFLASH
D6HOHFWWKHQHZ%,26LPDJHÀOH
E&RQÀUPWKHVHOHFWHG%,26LQIRUPDWLRQ&KHFNWKHPRGHOYHUVLRQDQGGDWD
c. Click Flash to initialize the BIOS updating procedure.
d.Click Exit when procedure completes.
H5HERRWWKHV\VWHP$VVXPLQJWKDW\RXKDYHVXFFHVVIXOO\ÁDVKHGWKH%,26ÀOHSUHVV>F2@WR
enter BIOS setup page when the ASUS logo appears during system boot-up.
f. After entering BIOS setup page, go to Exit page and choose Load Manufacture Defaults.
Then select Save and Exit and reboot the system again.
J7KH%,26ÁDVKSURFHGXUHLVQRZFRPSOHWH
You can also use the “Easy Flash” function
on the Advanced page of the BIOS Setup
Utility. Follow the instructions shown.
You must “Load Manufacture Defaults” after
XSGDWLQJÁDVKLQJWKH%,26
![](/img.php?id=824849&img=bga.png)
Appendix A
Common Problems and Solutions (Cont.)
Symantec’s Norton Internet Security (NIS)
1. Sometimes NIS will show an alert to stop a Trojan virus from a local IP address.
7KLVSUREOHPFDQEHVROYHGE\PDNLQJVXUHWKHYLUXVGHÀQLWLRQÀOHLVWKHODWHVWRQHDQGUHJXODUO\
XSGDWLQJWKHYLUXVGHÀQLWLRQÀOH
2. Reinstalling fails at the “Information Wizard” after uninstalling Norton Antivirus.
Make sure NIS has been uninstalled from your computer, reboot your system, install NIS again, use
´/LYH8SGDWHµDQGXSGDWHWKHYLUXVGHÀQLWLRQÀOH
3. Norton accidently blocks desired web pages or reduces download speeds.
&KDQJHWKHVHFXULW\FRQÀJXUDWLRQWRDORZHUOHYHO1,6VFDQVYLUXVZKLOHGRZQORDGLQJGDWDVRQHW-
work speed will be decreased.
4. Cannot login to MSN or Yahoo messenger services.
Make sure NIS has been updated and also update the Windows system by using “Windows Update”.
If the problem still exist, try:
1. Open NIS 200x by clicking on the NIS icon in your system tray.
2. Open “Norton AntiVirus” in “Options” menu.
3. Click on “Instant Messenger” uncheck “MSN/Windows Messenger” from “Which Instant mes-
sengers to protect.”
5. NIS is damaged and need reinstalling.
NIS is located in the provided disc in the “NIS200x” folder (x is the version number).
7KH´6WDUWÀUHZDOOZKHQV\VWHPLVERRWHGµRSWLRQLVVHOHFWHGEXWLWWDNHVDERXWRQHPLQXWHWR
VWDUWXSWKHÀUHZDOOHYHU\WLPH,HQWHU:LQGRZV:LQGRZVLVQRWUHVSRQVLYHGXULQJWKLVWLPH
,I1,6ÀUHZDOOUHGXFHV\RXUV\VWHPVSHHGWRDQLQWROHUDEOHOHYHOGHVHOHFWWKDWRSWLRQ
![](/img.php?id=824849&img=bgb.png)
A Appendix
7. Much of my system speed has been reduced by NIS.
NIS will reduce your system speed (both booting and running performance) if you are using NIS’s
full protection functions, NIS scans and tracks all data in the background. You can speed up your
system by stopping NIS’s auto scan functions in system bootup. You can then scan virus manually
when your computer is not in use.
8. Cannot uninstall NIS.
Go to Control Panel | Add or Remove Programs. Look for “Norton Internet Security 200x (Symantec
Corporation)”. Click Change/Remove and choose Remove All to uninstall NIS.
9. Windows Firewall must be stopped before installing “Norton Internet Security” or “Norton
Personal Firewall”. How to stop Windows Firewall:
1. Click Start and then Control Panel.
2. You will have one of two control panels. Click on the Security Center icon.
3. Click on the Windows Firewall icon beneath the status updates.
4. Click Off and then click OK.
10. Why is the “Privacy Control” icon showing ‘x’?
Turn off Privacy Control from “Status & Settings”.
,QVXIÀFLHQWSULYLOHJHPHVVDJH
Many settings, including disabling or uninstalling NIS, require you to be logged into Windows with
Administrator privileges. Log Off and switch to a user account with Administrator privileges.
Common Problems and Solutions (Cont.)
![](/img.php?id=824849&img=bgc.png)
Appendix A
Windows XP Software Recovery
Using Hard Disk Partition
The Recovery Partition includes an image of the operating system, drivers, and utilities installed on
your Notebook PC at the factory. The Recovery Partition provides a comprehensive recovery solution
that quickly restores your Notebook PC’s software to its original working state, provided that your hard
GLVNGULYHLVLQJRRGZRUNLQJRUGHU%HIRUHXVLQJWKH5HFRYHU\3DUWLWLRQFRS\\RXUGDWDÀOHVVXFKDV
2XWORRN367ÀOHVWRÁRSS\GLVNVRUWRDQHWZRUNGULYHDQGPDNHQRWHRIDQ\FXVWRPL]HGFRQÀJXUDWLRQ
settings (such as network settings).
Using the Recovery Partition:
3UHVV>)@GXULQJERRWXSUHTXLUHVD5HFRYHU\3DUWLWLRQ
About the Recovery Partition
The Recovery Partition is a space reserved on your hard disk drive used to restore the operating system,
drivers, and utilities installed on your Notebook PC at the factory.
,03257$17'RQRWGHOHWHWKHSDUWLWLRQQDPHG´5(&29(5<µ
The Recovery Partition is created at the factory and cannot
be restored by the user if deleted. Take your Notebook PC
to an authorized ASUS service center if you have problems
with the recovery process.
Select menu item (within 60 seconds):
1. Reboot to Windows XP _____.
This option will automatically execute after 60 seconds if no selections are made. This option will
reboot your Notebook PC and enter Windows.
5HFRYHU:LQGRZV;3BBBBBWRÀUVWSDUWLWLRQRQO\
7KLVRSWLRQZLOOGHOHWHRQO\WKHÀUVWSDUWLWLRQDOORZLQJ\RXWRNHHSRWKHUSDUWLWLRQVDQGFUHDWHDQHZ
system partition as drive “C”.
3. Recover Windows XP _____ to entire HD.
This option will delete all partitions from your hard disk drive and create a new system partition as
drive “C”.
4. Recover Windows XP _____ to entire HD with 2 partition.
This option will delete all partitions from your hard disk drive and create two new partitions “C”
DQG´'µ
Follow the on-screen instructions to complete the recovery process.
NOTE: Please visit www.asus.com for updated drivers and utilities.
![](/img.php?id=824849&img=bgd.png)
A Appendix
Windows XP Software Recovery (Cont.)
Using CDs (on selected models)
7KH5HFRYHU\&'VLQFOXGHVDQLPDJHRIWKHRSHUDWLQJV\VWHPGULYHUVDQGXWLOLWLHVLQVWDOOHGRQ\RXU
1RWHERRN3&DWWKHIDFWRU\7KH5HFRYHU\&'VSURYLGHVDFRPSUHKHQVLYHUHFRYHU\VROXWLRQWKDWTXLFNO\
restores your Notebook PC’s software to its original working state, provided that your hard disk drive
LVLQJRRGZRUNLQJRUGHU%HIRUHXVLQJWKH5HFRYHU\&'VFRS\\RXUGDWDÀOHVVXFKDV2XWORRN367
ÀOHVWRÁRSS\GLVNVRUWRDQHWZRUNGULYHDQGPDNHQRWHRIDQ\FXVWRPL]HGFRQÀJXUDWLRQVHWWLQJVVXFK
as network settings).
Detailed procedure on using the Recovery CDs:
,QVHUW5HFRYHU\&'LQWR\RXURSWLFDOGULYH
2. Turn ON your notebook PC or restart if it is already ON.
3UHVV(VF!RQERRWXSDQGVHOHFWWKHRSWLFDOGULYHXVLQJWKHGRZQFXUVRUDQGSUHVV(QWHU!WRERRW
IURP5HFRYHU\&'2UVHW\RXURSWLFDOGULYHWRERRWLQ%,26
5. Select menu item (within 60 seconds):
1. MS-DOS with CD-ROM Support.
This option will automatically execute after 60 seconds if no selections are made. This option is like
XVLQJD'26VWDUWXSGLVNDQGORDGWKH&'520GULYHUIRU'26DQGJLYH\RXD'26SURPSW6HYHUDO
'26XWLOLWLHVZLOOEHDYDLODEOHRQGULYH´$µ
5HFRYHU:LQGRZV;3BBBBBWRÀUVWSDUWLWLRQRQO\
7KLVRSWLRQZLOOGHOHWHRQO\WKHÀUVWSDUWLWLRQDOORZLQJ\RXWRNHHSRWKHUSDUWLWLRQVDQGFUHDWHDQHZ
system partition as drive “C”.
3. Recover Windows XP _____ to entire HD.
This option will delete all partitions from your hard disk drive and create a new system partition as
drive “C”.
4. Recover Windows XP _____ to entire HD with 2 partition.
This option will delete all partitions from your hard disk drive and create two new partitions “C”
DQG´'µ
6. Follow the on-screen instructions to complete the recovery process. You will be asked for Recovery
&'DIWHUDIHZPLQXWHVDQG$686'ULYHUDQG8WLOLW\&'DIWHUDIHZPRUHPLQXWHV
5HPRYHWKH5HFRYHU\&'DQGUHVWDUW\RXU1RWHERRN3&WRFRQÀJXUH:LQGRZV
8. Follow the on-screen wizards to complete Windows setup.
WARNING: Do not remove the Recovery CD (unless instructed to do so) during the
recovery process or else your partitions will be unusable.
NOTE: Please visit www.asus.com for updated drivers and utilities.
![](/img.php?id=824849&img=bge.png)
Appendix A
NTFS Converter (Windows XP only)
NOTE: If your local disk is already in NTFS
format, “...is already NTFS” will be shown for
the relevant hard disk drive.
3. Restart your system and check the details of
your local disk to see if conversion is suc-
cessful. Open My Computer and click the
disk drive for details. (Click the expand icon
if necessary.)
(This drive has not been converted.)
(This drive has been converted to NTFS.)
'LVPRXQWLVQHFHVVDU\IRUWKHFRQYHUVLRQ3UHVV
Y to continue.
'RXEOHFOLFNWKH17)6LFRQRQWKHGHVNWRS7KH
conversion command will be executed once for
each partition on your Notebook PC so you will
have to answer additional questions.
![](/img.php?id=824849&img=bgf.png)
A Appendix
Glossary
$&3,$GYDQFHG&RQÀJXUDWLRQDQG3RZHU0DQDJHPHQW,QWHUIDFH
Modern standard for reducing power usage in computers.
APM (Advanced Power Management)
Modern standard for reducing power usage in computers.
AWG (American Wire Gauge)
NOTE: This table is for general reference only and should not be used as a source of
the American Wire Gauge standard as this table may not be current or complete.
Gauge Diam Area R I@3A/mm2
AWG (mm) (mm2) (ohm/km) (mA)
33 0.18 0.026 676 75
0.19 0.028 605 85
32 0.20 0.031 547 93
30 0.25 0.049 351 147
29 0.30 0.071 243 212
27 0.35 0.096 178 288
26 0.40 0.13 137 378
25 0.45 0.16 108 477
Gauge Diam Area R I@3A/mm2
AWG (mm) (mm2) (ohm/km) (mA)
24 0.50 0.20 87.5 588
0.55 0.24 72.3 715
0.60 0.28 60.7 850
22 0.65 0.33 51.7 1.0 A
0.70 0.39 44.6 1.16 A
0.75 0.44 38.9 1.32 A
20 0.80 0.50 34.1 1.51 A
0.85 0.57 30.2 1.70 A
BIOS (Basic Input/Output System)
BIOS is a set of routines that affect how the computer transfers data between computer components, such
as memory, disks, and the display adapter. The BIOS instructions are built into the computer’s read-only
PHPRU\%,26SDUDPHWHUVFDQEHFRQÀJXUHGE\WKHXVHUWKURXJKWKH%,266HWXSSURJUDP7KH%,26
FDQEHXSGDWHGXVLQJWKHSURYLGHGXWLOLW\WRFRS\DQHZ%,26ÀOHLQWRWKH((3520
Bit (Binary Digit)
Represents the smallest unit of data used by the computer. A bit can have one of two values: 0 or 1.
Boot
Boot means to start the computer operating system by loading it into system memory. When the manual
instructs you to “boot” your system (or computer), it means to turn ON your computer. “Reboot” means
WRUHVWDUW\RXUFRPSXWHU:KHQXVLQJ:LQGRZVRUODWHUVHOHFWLQJ´5HVWDUWµIURP´6WDUW_6KXW'RZQµ
will reboot your computer.
Byte (Binary Term)
One byte is a group of eight contiguous bits. A byte is used to represent a single alphanumeric character,
punctuation mark, or other symbol.
Clock Throttling
Chipset function which allows the processor’s clock to be stopped and started at a known duty cycle.
Clock throttling is used for power savings, thermal management, and reducing processing speed.
![](/img.php?id=824849&img=bg10.png)
Appendix A
CPU (Central Processing Unit)
The CPU, sometimes called “Processor,” actually functions as the “brain” of the computer. It interprets
and executes program commands and processes data stored in memory.
Device Driver
A device driver is a special set of instructions that allows the computer’s operating system to communicate
with devices such as VGA, audio, Ethernet, printer, or modem.
DVD
'9'LVHVVHQWLDOO\DELJJHUIDVWHU&'WKDWFDQKROGYLGHRDVZHOODVDXGLRDQGFRPSXWHUGDWD:LWK
WKHVHFDSDFLWLHVDQGDFFHVVUDWHV'9'GLVFVFDQSURYLGH\RXZLWKGUDPDWLFDOO\HQKDQFHGKLJKFRORU
IXOOPRWLRQYLGHRVEHWWHUJUDSKLFVVKDUSHUSLFWXUHVDQGGLJLWDODXGLRIRUDWKHDWHUOLNHH[SHULHQFH'9'
aims to encompass home entertainment, computers, and business information with a single digital format,
HYHQWXDOO\UHSODFLQJDXGLR&'YLGHRWDSHODVHUGLVF&'520DQGYLGHRJDPHFDUWULGJHV
ExpressCard
ExpressCard slot is 26 pins and support one ExpressCard/34mm or one ExpressCard/54mm expansion
card. This new interface is faster by using a serial bus supporting USB 2.0 and PCI Express instead of
the slower parallel bus used in the PC card slot. (Not compatible with previous PCMCIA cards.)
Hardware
Hardware is a general term referring to the physical components of a computer system, including pe-
ripherals such as printers, modems, and pointing devices.
IDE (Integrated Drive Electronics)
,'(GHYLFHVLQWHJUDWHWKHGULYHFRQWUROFLUFXLWU\GLUHFWO\RQWKHGULYHLWVHOIHOLPLQDWLQJWKHQHHGIRUD
VHSDUDWHDGDSWHUFDUGLQWKHFDVHIRU6&6,GHYLFHV8OWUD'0$RU,'(GHYLFHVFDQDFKLHYHXS
to 33MB/Sec transfer.
IEEE1394 (1394)
Also known as iLINK (Sony) or FireWire (Apple). 1394 is a high speed serial bus like SCSI but has
simple connections and hot-plugging capabilities like USB. The popular 1394a interface has a bandwidth
of 400Mbits/sec and can handle up to 63 units on the same bus. The newer 1394b interface can support
twice the speed and will appear in future models when peripherals support higher speeds. It is very likely
WKDWWRJHWKHUZLWK86%ZLOOUHSODFH3DUDOOHO,'(6&6,DQG(,'(SRUWVLVDOVRXVHGLQ
KLJKHQGGLJLWDOHTXLSPHQWDQGVKRXOGEHPDUNHG´'9µIRU'LJLWDO9LGHRSRUW
Infrared Port (IrDA) (on selected models)
7KHLQIUDUHG,U'$FRPPXQLFDWLRQSRUWDOORZVFRQYHQLHQWZLUHOHVVGDWDFRPPXQLFDWLRQZLWKLQIUD-
red-equipped devices or computers up to 4Mbits/sec. This allows easy wireless synchronization with
3'$VRUPRELOHSKRQHVDQGHYHQZLUHOHVVSULQWLQJWRSULQWHUV6PDOORIÀFHVFDQXVH,U'$WHFKQRORJ\WR
VKDUHDSULQWHUEHWZHHQVHYHUDOFORVHO\SODFHG1RWHERRN3&VDQGHYHQVHQGÀOHVWRHDFKRWKHUZLWKRXW
a network.
Glossary (Cont.)
![](/img.php?id=824849&img=bg11.png)
A Appendix
Glossary (Cont.)
Kensington® Locks
Kensington® locks (or compatible) allow the Notebook PC to be secured usually using a metal cable and
ORFNWKDWSUHYHQWWKH1RWHERRN3&WREHUHPRYHGIURPDÀ[HGREMHFW6RPHVHFXULW\SURGXFWVPD\DOVR
include a motion detector to sound an alarm when moved.
/DVHU&ODVVLÀFDWLRQV
As lasers became more numerous and more widely used, the need to warn users of laser hazards became
DSSDUHQW7RPHHWWKLVQHHGODVHUFODVVLÀFDWLRQVZHUHHVWDEOLVKHG&XUUHQWFODVVLÀFDWLRQOHYHOVYDU\IURP
optically safe, requiring no controls (Class 1) to very hazardous, requiring strict controls (Class 4).
CLASS 1: A Class 1 laser or laser system emits levels of optical energy that are eye-safe and consequently
require no controls. An example of this class of laser system is the checkout scanning device found
in most grocery stores or lasers used in optical drives.
CLASS 2 & CLASS 3A: Class 2 and Class 3A lasers emit visible, continuous-wave (CW) optical ra-
diation levels slightly above the maximum permissible exposure (MPE) level. Although these lasers
can cause eye damage, their brightness usually causes observers to look away or blink before eye
damage occurs. These lasers have strict administrative controls requiring placement of signs warning
personnel not to stare directly into the beam. Class 3A lasers must not be viewed with optically-aided
devices.
CLASS 3B: Class 3B lasers, and Class 3A lasers with outputs of 2.5mW, are hazardous to personnel
ZKRDUHZLWKLQWKHEHDPSDWKDQGORRNDWWKHEHDPVRXUFHGLUHFWO\RUE\VSHFXODUUHÁHFWLRQ7KHVH
ODVHUVFDQQRWSURGXFHKD]DUGRXVGLIIXVHUHÁHFWLRQV3HUVRQQHOZRUNLQJZLWKWKHVHODVHUVVKRXOGZHDU
appropriate protective eye wear during any operation of the laser. Class 3B lasers have both admin-
istrative and physical controls to protect personnel. Physical controls include limited access work
areas. Administrative controls include special warning signs posted outside the entrances to the laser
work spaces and lights outside the entrances that warn personnel when the lasers are in use.
CLASS 4: Class 4 lasers are high-power lasers that will cause damage to unprotected eyes and skin
WKURXJKLQWUDEHDPYLHZLQJDQGVSHFXODURUGLIIXVHUHÁHFWLRQV&RQVHTXHQWO\QRSHUVRQQHOVKRXOG
be in a room where a Class 4 laser is operating without proper eye protection.
PCI Bus (Peripheral Component Interconnect Local Bus)
3&,EXVLVDVSHFLÀFDWLRQWKDWGHÀQHVDELWGDWDEXVLQWHUIDFH3&,LVDVWDQGDUGZLGHO\XVHGE\H[-
pansion card manufacturers.
POST (Power On Self Test)
:KHQ\RXWXUQRQWKHFRPSXWHULWZLOOÀUVWUXQWKURXJKWKH3267DVHULHVRIVRIWZDUHFRQWUROOHGGLDJ-
nostic tests. The POST checks system memory, the motherboard circuitry, the display, the keyboard, the
diskette drive, and other I/O devices.
![](/img.php?id=824849&img=bg12.png)
Appendix A
Glossary (Cont.)
RAM (Random Access Memory)
RAM (usually just called memory) is the place in a computer where the operating system, applica-
tion programs, and data in current use are temporarily kept so that they can be quickly reached by the
computer’s processor instead of having to read from and write to slower storage such as the hard disk
or optical disc.
Suspend Mode
,Q6DYHWR5$0675DQG6DYHWR'LVN67'WKH&38FORFNLVVWRSSHGDQGPRVWRIWKH1RWHERRN3&
devices are put in their lowest active state. The Notebook PC enters Suspend when the system remains
LGOHIRUDVSHFLÀHGDPRXQWRIWLPHRUPDQXDOO\XVLQJWKHIXQFWLRQNH\V7KHWLPHRXWVHWWLQJRIERWK
+DUG'LVNDQG9LGHRFDQEHVHWE\WKH%,266HWXS7KH3RZHU/('EOLQNVZKHQWKH1RWHERRN3&LV
LQ675PRGH,Q67'PRGHWKH1RWHERRN3&ZLOODSSHDUWREHSRZHUHG2))
System Disk
$V\VWHPGLVNFRQWDLQVWKHFRUHÀOHRIDQRSHUDWLQJV\VWHPDQGLVXVHGWRERRWXSWKHRSHUDWLQJV\VWHP
TPM (Trusted Platform Module) (on selected models)
The TPM is a security hardware device on the system board that will hold computer-generated keys for
encryption. It is a hardware-based solution that can help avoid attacks by hackers looking to capture
passwords and encryption keys to sensitive data. The TPM provides the ability to the PC or Notebook
PC to run applications more secure and to make transactions and communication more trustworthy.
Twisted-Pair Cable
The cable used to connect the Ethernet card to a host (generally a Hub or Switch) is called a straight-
through Twisted Pair Ethernet (TPE). The end connectors are called RJ-45 connectors, which are not
compatible with RJ-11 telephone connectors. If connecting two computers together without a hub in
between, a crossover twisted-pair is required.
UltraDMA/66 or 100
8OWUD'0$RUDUHQHZVSHFLÀFDWLRQVWRLPSURYH,'(WUDQVIHUUDWHV8QOLNHWUDGLWLRQDO3,2PRGH
ZKLFKRQO\XVHVWKHULVLQJHGJHRI,'(FRPPDQGVLJQDOWRWUDQVIHUGDWD8OWUD'0$RUXVHVERWK
rising edge and falling edge.
USB (Universal Serial Bus)
A new 4-pin serial peripheral bus that allows plug and play computer peripherals such as keyboard,
PRXVHMR\VWLFNVFDQQHUSULQWHUDQGPRGHP,6'1WREHDXWRPDWLFDOO\FRQÀJXUHGZKHQWKH\DUHDW-
tached physically without having to install drivers or reboot. With USB, the traditional complex cables
from back panel of your PC can be eliminated.
![](/img.php?id=824849&img=bg13.png)
A Appendix
Declarations and Safety Statements
DVD-ROM Drive Information
7KH1RWHERRN3&FRPHVZLWKDQRSWLRQDO'9'520GULYHRUD&'520GULYH,QRUGHUWRYLHZ'9'
WLWOHV\RXPXVWLQVWDOO\RXURZQ'9'YLHZHUVRIWZDUH2SWLRQDO'9'YLHZHUVRIWZDUHPD\EHSXUFKDVHG
ZLWKWKLV1RWHERRN3&7KH'9'520GULYHDOORZVWKHXVHRIERWK&'DQG'9'GLVFV
Regional Playback Information
3OD\EDFNRI'9'PRYLHWLWOHVLQYROYHVGHFRGLQJ03(*YLGHRGLJLWDO$&DXGLRDQGGHFU\SWLRQRI&66
protected content. CSS (sometimes called copy guard) is the name given to the content protection scheme
adopted by the motion picture industry to satisfy a need to protect against unlawful content duplication.
Although the design rules imposed on CSS licensors are many, one rule that is most relevant is playback re-
VWULFWLRQVRQUHJLRQDOL]HGFRQWHQW,QRUGHUWRIDFLOLWDWHJHRJUDSKLFDOO\VWDJJHUHGPRYLHUHOHDVHV'9'YLGHR
WLWOHVDUHUHOHDVHGIRUVSHFLÀFJHRJUDSKLFUHJLRQVDVGHÀQHGLQ´5HJLRQ'HÀQLWLRQVµEHORZ&RS\ULJKWODZV
UHTXLUHWKDWDOO'9'PRYLHVEHOLPLWHGWRDSDUWLFXODUUHJLRQXVXDOO\FRGHGWRWKHUHJLRQDWZKLFKLWLVVROG
:KLOH'9'PRYLHFRQWHQWPD\EHUHOHDVHGIRUPXOWLSOHUHJLRQV&66GHVLJQUXOHVUHTXLUHWKDWDQ\V\VWHP
capable of playing CSS encrypted content must only be capable of playing one region.
5HJLRQ'HÀQLWLRQV
Region 1
Canada, US, US Territories
Region 2
Czech, Egypt, Finland, France, Germany, Gulf States, Hungary, Iceland, Iran, Iraq, Ireland, Italy, Japan,
Netherlands, Norway, Poland, Portugal, Saudi Arabia, Scotland, South Africa, Spain, Sweden, Switzer-
land, Syria, Turkey, UK, Greece, Former Yugoslav Republics, Slovakia
Region 3
Burma, Indonesia, South Korea, Malaysia, Philippines, Singapore, Taiwan, Thailand, Vietnam
Region 4
$XVWUDOLD&DULEEHDQ([FHSW867HUULWRULHV&HQWUDO$PHULFD1HZ=HDODQG3DFLÀF,VODQGV6RXWK
America
Region 5
CIS, India, Pakistan, Rest of Africa, Russia, North Korea
Region 6
China
127(7KHUHJLRQVHWWLQJPD\EHFKDQJHGXSWRÀYHWLPHVXVLQJWKHYLHZHUVRIWZDUH
then it can only play DVD movies for the last region setting. Changing the region code
after that will require factory resetting which is not covered by warranty. If resetting is
desired, shipping and resetting costs will be at the expense of the user.
![](/img.php?id=824849&img=bg14.png)
Appendix A
Internal Modem Compliancy
The Notebook PC with internal modem model complies with JATE (Japan), FCC (US, Canada, Korea,
7DLZDQDQG &757KHLQWHUQDO PRGHP KDVEHHQDSSURYHG LQ DFFRUGDQFHZLWK&RXQFLO 'HFLVLRQ
98/482/EC for pan-European single terminal connection to the public switched telephone network
(PSTN). However due to differences between the individual PSTNs provided in different countries, the
approval does not, of itself, give an unconditional assurance of successful operation on every PSTN
network termination point. In the event of problems you should contact your equipment supplier in the
ÀUVWLQVWDQFH
Overview
2QWK$XJXVWWKH(XURSHDQ&RXQFLO'HFLVLRQUHJDUGLQJWKH&75KDVEHHQSXEOLVKHGLQWKH
2IÀFLDO-RXUQDORIWKH(&7KH&75DSSOLHVWRDOOQRQYRLFHWHUPLQDOHTXLSPHQWZLWK'70)GLDOOLQJ
which is intended to be connected to the analogue PSTN (Public Switched Telephone Network).
CTR 21 (Common Technical Regulation) for the attachment requirements for connection to the analogue
public switched telephone networks of terminal equipment (excluding terminal equipment supporting
WKHYRLFHWHOHSKRQ\MXVWLÀHGFDVHVHUYLFHLQZKLFKQHWZRUNDGGUHVVLQJLISURYLGHGLVE\PHDQVRIGXDO
tone multifrequency signalling.
Network Compatibility Declaration
6WDWHPHQWWREHPDGHE\WKHPDQXIDFWXUHUWRWKH1RWLÀHG%RG\DQGWKHYHQGRU´7KLVGHFODUDWLRQZLOO
LQGLFDWHWKHQHWZRUNVZLWKZKLFKWKHHTXLSPHQWLVGHVLJQHGWRZRUNDQGDQ\QRWLÀHGQHWZRUNVZLWK
ZKLFKWKHHTXLSPHQWPD\KDYHLQWHUZRUNLQJGLIÀFXOWLHVµ
Network Compatibility Declaration
Statement to be made by the manufacturer to the user: “This declaration will indicate the networks with
ZKLFKWKHHTXLSPHQWLVGHVLJQHGWRZRUNDQG DQ\QRWLÀHGQHWZRUNVZLWKZKLFKWKHHTXLSPHQWPD\
KDYHLQWHUZRUNLQJGLIÀFXOWLHV7KHPDQXIDFWXUHUVKDOODOVRDVVRFLDWHDVWDWHPHQWWRPDNHLWFOHDUZKHUH
network compatibility is dependent on physical and software switch settings. It will also advise the user
to contact the vendor if it is desired to use the equipment on another network.”
8SWRQRZWKH1RWLÀHG%RG\RI&(7(&20LVVXHGVHYHUDOSDQ(XURSHDQDSSURYDOVXVLQJ&757KH
UHVXOWVDUH(XURSH·VÀUVWPRGHPVZKLFKGRQRWUHTXLUHUHJXODWRU\DSSURYDOVLQHDFKLQGLYLGXDO(XURSHDQ
country.
Non-Voice Equipment
Answering machines and loud-speaking telephones can be eligible as well as modems, fax machines,
auto-dialers and alarm systems. Equipment in which the end-to-end quality of speech is controlled by
regulations (e.g. handset telephones and in some countries also cordless telephones) is excluded.
![](/img.php?id=824849&img=bg15.png)
A Appendix
Internal Modem Compliancy (Cont.)
This table shows the countries currently under the CTR21 standard
.
Country Applied More Testing
Austria1 Yes No
Belgium Yes No
Czech Republic No Not Applicable
'HQPDUN1 Yes Yes
Finland Yes No
France Yes No
Germany Yes No
Greece Yes No
Hungary No Not Applicable
Iceland Yes No
Ireland Yes No
Italy Still Pending Still Pending
Israel No No
Lichtenstein Yes No
Luxemburg Yes No
The Netherlands1Yes Yes
Norway Yes No
Poland No Not Applicable
Portugal No Not Applicable
Spain No Not Applicable
Sweden Yes No
Switzerland Yes No
United Kingdom Yes No
This information was copied from CETECOM and is supplied without liability. For updates to this table,
you may visit http://www.cetecom.de/technologies/ctr_21.html
1 National requirements will apply only if the equipment may use pulse dialling (manufacturers may state
LQWKHXVHUJXLGHWKDWWKHHTXLSPHQWLVRQO\LQWHQGHGWRVXSSRUW'70)VLJQDOOLQJZKLFKZRXOGPDNH
DQ\DGGLWLRQDOWHVWLQJVXSHUÁXRXV
,Q7KH1HWKHUODQGVDGGLWLRQDOWHVWLQJLVUHTXLUHGIRUVHULHVFRQQHFWLRQDQGFDOOHU,'IDFLOLWLHV
![](/img.php?id=824849&img=bg16.png)
Appendix A
Federal Communications Commission Statement
This device complies with FCC Rules Part 15. Operation is subject to the following two conditions:
• This device may not cause harmful interference, and
• This device must accept any interference received, including interference that may cause undesired
operation.
This equipment has been tested and found to comply with the limits for a class B digital device, pursuant
to Part 15 of the Federal Communications Commission (FCC) rules. These limits are designed to provide
reasonable protection against harmful interference in a residential installation. This equipment generates,
uses, and can radiate radio frequency energy and, if not installed and used in accordance with the instructions,
may cause harmful interference to radio communications. However, there is no guarantee that interference
will not occur in a particular installation. If this equipment does cause harmful interference to radio or
television reception, which can be determined by turning the equipment off and on, the user is encouraged
to try to correct the interference by one or more of the following measures:
• Reorient or relocate the receiving antenna.
• Increase the separation between the equipment and receiver.
• Connect the equipment into an outlet on a circuit different from that to which the receiver is
connected.
• Consult the dealer or an experienced radio/TV technician for help.
WARNING! The use of a shielded-type power cord is required in order to meet FCC
emission limits and to prevent interference to the nearby radio and television recep-
tion. It is essential that only the supplied power cord be used. Use only shielded
cables to connect I/O devices to this equipment. You are cautioned that changes or
PRGLÀFDWLRQVQRWH[SUHVVO\DSSURYHGE\WKHSDUW\UHVSRQVLEOHIRUFRPSOLDQFHFRXOG
void your authority to operate the equipment.
5HSULQWHGIURPWKH&RGHRI)HGHUDO5HJXODWLRQVSDUW:DVKLQJWRQ'&2IÀFHRIWKH)HGHUDO
5HJLVWHU1DWLRQDO$UFKLYHVDQG5HFRUGV$GPLQLVWUDWLRQ86*RYHUQPHQW3ULQWLQJ2IÀFH
CE Mark Warning
This is a Class B product, in a domestic environment, this product may cause radio interference, in which
case the user may be required to take adequate measures.
![](/img.php?id=824849&img=bg17.png)
A Appendix
R&TTE Directive (1999/5/EC)
7KHIROORZLQJLWHPVZHUHFRPSOHWHGDQGDUHFRQVLGHUHGUHOHYDQWDQGVXIÀFLHQWIRUWKH577(5DGLR
& Telecommunications Terminal Equipment) directive:
(VVHQWLDOUHTXLUHPHQWVDVLQ>$UWLFOH@
3URWHFWLRQUHTXLUHPHQWVIRUKHDOWKDQGVDIHW\DVLQ>$UWLFOHD@
7HVWLQJIRUHOHFWULFVDIHW\DFFRUGLQJWR>(1@
3URWHFWLRQUHTXLUHPHQWVIRUHOHFWURPDJQHWLFFRPSDWLELOLW\LQ>$UWLFOHE@
7HVWLQJIRUHOHFWURPDJQHWLFFRPSDWLELOLW\LQ>(1@>(1@
7HVWLQJDFFRUGLQJWR>@
(IIHFWLYHXVHRIWKHUDGLRVSHFWUXPDVLQ>$UWLFOH@
5DGLRWHVWVXLWHVDFFRUGLQJWR>(1@
FCC Radio Frequency Interference Requirements
RF exposure warning
This equipment must be installed and operated in accordance with provided instructions
and must not be co-located or operating in conjunction with any other antenna or
transmitter. End-users and installers must be provide with antenna installation instructions
and transmitter operating conditions for satisfying RF exposure compliance.
)&&&DXWLRQ$Q\FKDQJHVRUPRGLÀFDWLRQVQRWH[SUHVVO\DSSURYHGE\WKHSDUW\UH-
sponsible for compliance could void the user’s authority to operate this equipment.
The manufacturer declares that this device is limited to Channels 1 through 11 in the
*+]IUHTXHQF\E\VSHFLÀHGÀUPZDUHFRQWUROOHGLQWKH86$µ
FCC Radio Frequency Interference Requirements
Max. SAR Measurement (1g)
802.11g: 0.949 W/kg
802.11b: 1.406 W/kg
![](/img.php?id=824849&img=bg18.png)
Appendix A
France Restricted Wireless Frequency Bands
Some areas of France have a restricted frequency band. The worst case maximum authorized power
indoors are:
• 10mW for the entire 2.4 GHz band (2400 MHz–2483.5 MHz)
• 100mW for frequencies between 2446.5 MHz and 2483.5 MHz
NOTE: Channels 10 through 13 inclusive operate in the band 2446.6 MHz to 2483.5 MHz.
There are few possibilities for outdoor use: On private property or on the private property of public
SHUVRQVXVHLVVXEMHFWWRDSUHOLPLQDU\DXWKRUL]DWLRQSURFHGXUHE\WKH0LQLVWU\RI'HIHQVHZLWKPD[L-
mum authorized power of 100mW in the 2446.5–2483.5 MHz band. Use outdoors on public property
is not permitted.
In the departments listed below, for the entire 2.4 GHz band:
• Maximum authorized power indoors is 100mW
• Maximum authorized power outdoors is 10mW
'HSDUWPHQWVLQZKLFKWKHXVHRIWKH²0+]EDQGLVSHUPLWWHGZLWKDQ(,53RIOHVVWKDQ
100mW indoors and less than 10mW outdoors:
01 Ain Orientales 02 Aisne 03 Allier 05 Hautes Alpes
08 Ardennes 09 Ariège 11 Aude 12 Aveyron
&KDUHQWH 'RUGRJQH 'RXEV 'U{PH
32 Gers 36 Indre 37
Indre et Loire
41 Loir et Cher
45 Loiret 50 Manche 55 Meuse 58 Nièvre
1RUG 2LVH 2UQH 3X\GX'{PH
64
Pyrénées Atlantique
66 Pyrénées 67 Bas Rhin 68 Haut Rhin
+DXWH6D{QH
6D{QHHW/RLUH
75 Paris 82 Tarn et Garonne
84 Vaucluse 88 Vosges 89 Yonne 90
Territoire de Belfort
94 Val de Marne
This requirement is likely to change over time, allowing you to use your wireless LAN card in more
areas within France. Please check with ART for the latest information (www.art-telecom.fr)
NOTE: Your WLAN Card transmits less than 100mW, but more than 10mW.
Wireless Operation Channel for Different Domains
N. America 2.412-2.462 GHz Ch01 through CH11
Japan 2.412-2.484 GHz Ch01 through Ch14
Europe ETSI 2.412-2.472 GHz Ch01 through Ch13
![](/img.php?id=824849&img=bg19.png)
A Appendix
UL Safety Notices
Required for UL 1459 covering telecommunications (telephone) equipment intended to be electrically
connected to a telecommunication network that has an operating voltage to ground that does not exceed
200V peak, 300V peak-to-peak, and 105V rms, and installed or used in accordance with the National
Electrical Code (NFPA 70).
When using the Notebook PC modem, basic safety precautions should always be followed to reduce the
ULVNRIÀUHHOHFWULFVKRFNDQGLQMXU\WRSHUVRQVLQFOXGLQJWKHIROORZLQJ
•Do not use the Notebook PC near water, for example, near a bath tub, wash bowl, kitchen sink
or laundry tub, in a wet basement or near a swimming pool.
• Do not use the Notebook PC during an electrical storm. There may be a remote risk of electric
shock from lightning.
•Do not use the Notebook PC in the vicinity of a gas leak.
Required for UL 1642 covering primary (non-rechargeable) and secondary (rechargeable) lithium batter-
ies for use as power sources in products. These batteries contain metallic lithium, or a lithium alloy, or
a lithium ion, and may consist of a single electrochemical cell or two or more cells connected in series,
parallel, or both, that convert chemical energy into electrical energy by an irreversible or reversible
chemical reaction.
•Do not GLVSRVHWKH1RWHERRN3&EDWWHU\SDFNLQDÀUHDVWKH\PD\H[SORGH&KHFNZLWKORFDO
codes for possible special disposal instructions to reduce the risk of injury to persons due to
ÀUHRUH[SORVLRQ
•Do not use power adapters or batteries from other devices to reduce the risk of injury to per-
VRQVGXHWRÀUHRUH[SORVLRQ8VHRQO\8/FHUWLÀHGSRZHUDGDSWHUVRUEDWWHULHVVXSSOLHGE\WKH
manufacturer or authorized retailers.
Power Safety Requirement
Products with electrical current ratings up to 6A and weighing more than 3Kg must use approved power
cords greater than or equal to: H05VV-F, 3G, 0.75mm2 or H05VV-F, 2G, 0.75mm2.
![](/img.php?id=824849&img=bg1a.png)
Appendix A
Nordic Lithium Cautions (for lithium-ion batteries)
(Japanese)
CAUTION! 'DQJHURIH[SORVLRQLIEDWWHU\LVLQFRUUHFWO\UHSODFHG5HSODFHRQO\ZLWK
WKHVDPHRUHTXLYDOHQWW\SHUHFRPPHQGHGE\WKHPDQXIDFWXUHU'LVSRVHRIXVHGEDW-
teries according to the manufacturer’s instructions. (English)
ATTENZIONE! Rischio di esplosione della batteria se sostituita in modo errato. Sosti-
tuire la batteria con un una di tipo uguale o equivalente consigliata dalla fabbrica. Non
disperdere le batterie nell’ambiente. (Italian)
VORSICHT! Explosionsgetahr bei unsachgemäßen Austausch der Batterie. Ersatz nur
durch denselben oder einem vom Hersteller empfohlenem ähnlichen Typ. Entsorgung
gebrauchter Batterien nach Angaben des Herstellers. (German)
ADVARSELI! Lithiumbatteri - Eksplosionsfare ved fejlagtig håndtering. Udskiftning
må kun ske med batteri af samme fabrikat og type. Levér det brugte batteri tilbage til
OHYHUDQG¡UHQ'DQLVK
VARNING! Explosionsfara vid felaktigt batteribyte. Använd samma batterityp eller en
ekvivalent typ som rekommenderas av apparattillverkaren. Kassera använt batteri enligt
fabrikantens instruktion. (Swedish)
VAROITUS! Paristo voi räjähtää, jos se on virheellisesti asennettu. Vaihda paristo aino-
astaan laitevalmistajan sousittelemaan tyyppiin. Hävitä käytetty paristo valmistagan ohjeiden
mukaisesti. (Finnish)
ATTENTION! Il y a danger d’explosion s’il y a remplacement incorrect de la bat-
terie. Remplacer uniquement avec une batterie du mêre type ou d’un type équivalent
recommandé par le constructeur. Mettre au rebut les batteries usagées conformément
aux instructions du fabricant. (French)
ADVARSEL! Eksplosjonsfare ved feilaktig skifte av batteri. Benytt samme batteritype
eller en tilsvarende type anbefalt av apparatfabrikanten. Brukte batterier kasseres i
henhold til fabrikantens instruksjoner. (Norwegian)
![](/img.php?id=824849&img=bg1b.png)
A Appendix
Service warning label
:$51,1*0DNLQJDGMXVWPHQWVRUSHUIRUPLQJSURFHGXUHVRWKHUWKDQWKRVHVSHFLÀHG
in the user’s manual may result in hazardous laser exposure. Do not attempt to disas-
semble the optical drive. For your safety, have the optical drive serviced only by an
authorized service provider.
CAUTION: INVISIBLE LASER RADIATION WHEN OPEN. DO NOT STARE INTO BEAM
OR VIEW DIRECTLY WITH OPTICAL INSTRUMENTS.
CDRH Regulations
7KH&HQWHUIRU'HYLFHVDQG5DGLRORJLFDO+HDOWK&'5+RIWKH86)RRGDQG'UXJ$GPLQLVWUDWLRQLPSOH-
mented regulations for laser products on August 2, 1976. These regulations apply to laser products manu-
factured from August 1, 1976. Compliance is mandatory for products marketed in the United States.
WARNING: Use of controls or adjustments or performance of procedures other than
WKRVHVSHFLÀHGKHUHLQRULQWKHODVHUSURGXFWLQVWDOODWLRQJXLGHPD\UHVXOWLQKD]DUG-
ous radiation exposure.
Macrovision Corporation Product Notice
This product incorporates copyright protection technology that is protected by method claims of certain
U.S.A. patents and other intellectual property rights owned by Macrovision Corporation and other rights
owners. Use of this copyright protection technology must be authorized by Macrovision Corporation, and
is intended for home and other limited viewing uses only unless otherwise authorized by Macrovision
Corporation. Reverse engineering or disassembly is prohibited.
Optical Drive Safety Information
Laser Safety Information
,QWHUQDORUH[WHUQDORSWLFDOGULYHVVROGZLWKWKLV1RWHERRN3&FRQWDLQVD&/$66/$6(5352'8&7
/DVHUFODVVLÀFDWLRQVFDQEHIRXQGLQWKHJORVVDU\DWWKHHQGRIWKLVXVHU·VPDQXDO
![](/img.php?id=824849&img=bg1c.png)
Appendix A
CTR 21 Approval (for Notebook PC with built-in Modem)
Danish
Dutch
English
Finnish
French
German
Greek
Italian
Portuguese
Spanish
Swedish
![](/img.php?id=824849&img=bg1d.png)
A Appendix
![](/img.php?id=824849&img=bg1e.png)
Appendix A
Notebook PC Information
This page is provided for recording information concerning your Notebook PC for future reference or
IRUWHFKQLFDOVXSSRUW.HHSWKLV8VHU·V0DQXDOLQDVHFXUHGORFDWLRQLISDVVZRUGVDUHÀOOHGRXW
Owner’s Name: ___________________________ Owner’s Telephone: ______________
Manufacturer:_______________ Model: ___________ Serial Number: ______________
Display Size: ___________ Resolution: _____________Memory Size: ______________
Retailer: _________________Location: ___________ Purchase Date: ______________
Hard Drive Manufacturer: ____________________________ Capacity: ______________
Optical Drive Manufacturer: _____________________________ Type: ______________
BIOS Version:__________________________________________Date: ______________
Accessories: _____________________________________________________________
Accessories: _____________________________________________________________
Software
Operating System:__________Version: ___________ Serial Number: ______________
Software: _________________Version: ___________ Serial Number: ______________
Software: _________________Version: ___________ Serial Number: ______________
Security
Supervisor Name: _______________________ Supervisor Password: ______________
User Name:___________________________________User Password: ______________
Network
User Name:______________Password: _________________ Domain: ______________
User Name:______________Password: _________________ Domain: ______________
Copyright Information
No part of this manual, including the products and software described in it, may be reproduced, trans-
mitted, transcribed, stored in a retrieval system, or translated into any language in any form or by any
means, except documentation kept by the purchaser for backup purposes, without the express written
permission of ASUSTeK COMPUTER INC. (“ASUS”).
$686 3529,'(6 7+,6 0$18$/ ´$6 ,6µ :,7+287:$55$17< 2)$1< .,1' (,7+(5
(;35(6625,03/,(',1&/8',1*%87127/,0,7('727+(,03/,(':$55$17,(625
&21',7,2162)0(5&+$17$%,/,7<25),71(66)25$3$57,&8/$5385326(,112
(9(17 6+$//$686 ,76 ',5(&7256 2)),&(56 (03/2<((6 25$*(176 %( /,$%/(
)25$1<,1',5(&763(&,$/,1&,'(17$/25&216(48(17,$/'$0$*(6,1&/8',1*
'$0$*(6)25/2662)352),76/2662)%86,1(66/2662)86(25'$7$,17(5-
5837,212)%86,1(66$1'7+(/,.((9(1,)$686+$6%((1$'9,6('2)7+(326-
6,%,/,7<2)68&+'$0$*(6$5,6,1*)520$1<'()(&725(5525,17+,60$18$/
25352'8&7
Products and corporate names appearing in this manual may or may not be registered trademarks or
FRS\ULJKWVRIWKHLUUHVSHFWLYHFRPSDQLHVDQGDUHXVHGRQO\IRULGHQWLÀFDWLRQRUH[SODQDWLRQDQGWRWKH
RZQHUV·EHQHÀWZLWKRXWLQWHQWWRLQIULQJH
63(&,),&$7,216$1',1)250$7,21&217$,1(',17+,60$18$/$5()851,6+(')25
,1)250$7,21$/86(21/<$1'$5(68%-(&772&+$1*($7$1<7,0(:,7+28712-
7,&($1'6+28/'127%(&216758('$6$&200,70(17%<$686$686$6680(612
RESPONSIBILITY OR LIABILITY FOR ANY ERRORS OR INACCURACIES THAT MAY APPEAR
,17+,60$18$/,1&/8',1*7+(352'8&76$1'62)7:$5('(6&5,%(',1,7
Copyright © 2007 ASUSTeK COMPUTER INC. All Rights Reserved.
Limitation of Liability
Circumstances may arise where because of a default on ASUS’ part or other liability, you are entitled to
recover damages from ASUS. In each such instance, regardless of the basis on which you are entitled
to claim damages from ASUS, ASUS is liable for no more than damages for bodily injury (including
death) and damage to real property and tangible personal property; or any other actual and direct dam-
ages resulted from omission or failure of performing legal duties under this Warranty Statement, up to
the listed contract price of each product.
ASUS will only be responsible for or indemnify you for loss, damages or claims based in contract, tort
or infringement under this Warranty Statement.
This limit also applies to ASUS’ suppliers and its reseller. It is the maximum for which ASUS, its sup-
pliers, and your reseller are collectively responsible.
81'(512&,5&8067$1&(6,6$686/,$%/()25$1<2)7+()2//2:,1*7+,5'
3$57<&/$,06$*$,167<28)25'$0$*(6/2662)25'$0$*(72<2855(-
&25'625'$7$2563(&,$/,1&,'(17$/25,1',5(&7'$0$*(625)25$1<
(&2120,&&216(48(17,$/'$0$*(6,1&/8',1*/267352),76256$9,1*6(9(1
,)$686,766833/,(5625<2855(6(//(5,6,1)250('2)7+(,53266,%,/,7<
Service and Support
Visit our multi-language web site at http://support.asus.com