Contents
Users Guide 2
iPad User Guide For iOS 4.3 Software Contents 10 12 13 17 18 Chapter 1: At a Glance 23 23 24 24 29 31 33 33 33 35 Chapter 2: Getting Started 36 36 40 42 43 44 45 46 Chapter 3: Basics 47 47 47 50 51 52 Chapter 4: Safari Overview Buttons Micro-SIM Card Tray Home Screen Multi-Touch Screen Onscreen Keyboard What You Need Setting Up iPad Syncing with iTunes Connecting to the Internet Adding Mail, Contacts, and Calendar Accounts Disconnecting iPad from Your Computer Viewing the User Guide on iPad Battery Using and Cleaning iPad Using Apps Printing Searching Using Bluetooth Devices File Sharing Using AirPlay Security Features About Safari Viewing Webpages Searching the Web Bookmarks Web Clips 53 53 53 54 55 58 59 59 Chapter 5: Mail 60 60 61 62 62 62 Chapter 6: Camera 63 63 64 65 65 Chapter 7: FaceTime 66 66 66 67 67 68 Chapter 8: Photo Booth 69 69 69 70 70 73 75 75 75 76 Chapter 9: Photos 77 77 78 78 Chapter 10: Videos About Mail Setting Up Email Accounts Sending Email Checking and Reading Email Searching Email Printing Messages and Attachments Organizing Email About Camera Taking Photos and Recording Videos Viewing and Sharing Photos and Videos Trimming Videos Uploading Photos and Videos to Your Computer About FaceTime Signing In Making a FaceTime Call While Youâre Talking About Photo Booth 5GNGEVKPICP'ĂGEV Taking a Photo Viewing and Sharing Photos Uploading Photos to Your Computer About Photos Syncing Photos and Videos with Your Computer Importing Photos and Videos from iPhone or a Digital Camera Viewing Photos and Videos Sharing Photos Assigning a Photo to a Contact Printing Photos Wallpaper and Lock Screen Photos Using Picture Frame About Videos Playing Videos Controlling Video Playback Contents 4 79 80 80 80 Syncing Videos Watching Rented Movies Watching Videos on a TV Deleting Videos from iPad 81 81 83 84 84 Chapter 11: YouTube 85 85 85 86 86 88 88 89 90 90 Chapter 12: Calendar 91 91 92 92 93 93 94 Chapter 13: Contacts 95 95 96 96 96 Chapter 14: Notes 97 97 97 102 103 103 104 Chapter 15: Maps Finding and Viewing Videos Controlling Video Playback Managing Videos Watching YouTube on a TV About Calendar Syncing Calendars Adding, Editing, and Deleting Calendar Events Viewing Your Calendars Searching Calendars Subscribing to Calendars Responding to Meeting Invitations Importing Calendar Files from Mail Alerts About Contacts Syncing and Adding Contacts Searching Contacts Managing Contacts Using Contact Information 7PK°GF%QPVCEVs Writing and Reading Notes Searching Notes Emailing Notes Syncing Notes About Maps Finding and Viewing Locations Getting Directions 5JQYKPI6TCĂE%QPFKVKQPs Finding and Contacting Businesses Sharing Location Information Contents 105 105 105 109 112 112 Chapter 16: iPod 113 113 113 114 114 115 116 117 117 118 118 118 Chapter 17: iTunes Store 119 119 120 120 121 121 122 122 123 123 Chapter 18: App Store 124 124 125 125 126 127 127 128 128 128 128 129 Chapter 19: iBooks Adding Music and More to iPad Playing Music and Other Audio Using Playlists Home Sharing Transferring Content About the iTunes Store Transferring Content Finding Music, Videos, and More Following Artists and Friends Purchasing Music or Audiobooks Purchasing or Renting Videos Listening to or Watching Podcasts Checking Download Status Syncing Content Viewing Apple ID Information Verifying Purchases About the App Store Browsing and Searching Getting More Information Buying Apps Using Apps Updating Apps Writing Reviews Deleting Apps Syncing Purchases About iBooks Syncing Books and PDFs Using the iBookstore Reading Books Reading PDFs Changing a Bookâs Appearance Searching Books and PDFs .QQMKPIWRVJG&G°PKVKQPQHC9QTd Having a Book Read to You Printing or Emailing a PDF Organizing the Bookshelf Contents 6 130 130 130 132 134 135 136 Chapter 20: Game Center 137 137 138 148 149 149 149 149 150 150 Chapter 21: Accessibility 151 151 151 152 152 153 153 154 154 154 155 155 163 166 168 168 169 169 170 170 Chapter 22: Settings 171 171 171 Appendix A: iPad in the Enterprise About Game Center Setting Up Game Center Games Friends Your Status and Account Information Parental Controls Universal Access Features VoiceOver Zoom Large Text White on Black Mono Audio Speak Auto-Text Triple-Click Home Closed Captioning and Other Helpful Features About Settings Airplane Mode VPN Wi-Fi 0QVK°ECVKQPs Location Services Carrier Cellular Data Brightness & Wallpaper Picture Frame General Mail, Contacts, Calendars Safari iPod Video Photos FaceTime Notes Store iPad at Work 7UKPI%QP°IWTCVKQP2TQ°NGs Contents 172 Setting Up Microsoft Exchange Accounts 172 VPN Access 173 LDAP and CardDAV Accounts 174 174 174 175 177 177 177 178 Appendix B: International Keyboards 179 179 180 181 182 184 185 187 188 188 188 188 189 189 Appendix C: Tips and Troubleshooting 190 Index Adding Keyboards Switching Keyboards Chinese Japanese Korean Vietnamese Creating Dictionaries Tips and Troubleshooting iTunes and Syncing Backing Up iPad Updating and Restoring iPad Software Safari, Mail, and Contacts Sound, Music, and Video FaceTime iTunes Store and App Store Restarting and Resetting iPad iPad Still Doesnât Respond After Reset Safety, Service, and Support Information Disposal and Recycling Information Apple and the Environment Contents 1 At a Glance Read this chapter to learn about iPad features, how to use the controls, and more. Overview -YVU[ JHTLYH :[H[\ZIHY (WWPJVUZ 4\S[P;V\JO ZJYLLU /VTL :SLLW>HRL 4PJYVWOVUL )HJR JHTLYH /LHKWOVUL QHJR 4PJYV:04[YH` VUZVTLTVKLSZ :PKL:^P[JO =VS\TL I\[[VUZ :WLHRLY +VJRJVUULJ[VY Accessories ><:)7V^LY(KHW[LY +VJR*VUULJ[VY[V<:)*HISL Item What you can do with it 10W USB power adapter Use the 10W USB power adapter to provide power to iPad and charge the battery. Dock Connector to USB Cable Use this cable to connect iPad to your computer to sync, or to the 10W USB power adapter to charge. Use the cable with the optional iPad Dock, or plug it directly into iPad. Buttons #HGYUKORNGDWVVQPUOCMGKVGCU[VQVWTPK2CFQPCPFQĂCPFCFLWUVVJGXQNWOG Sleep/Wake Button You can lock iPad by putting it to sleep when youâre not using it. When you lock iPad, nothing happens if you touch the screen, but music continues playing and you can use the volume buttons. :SLLW>HRL I\[[VU Lock iPad Press the Sleep/Wake button. Unlock iPad Press the Home button or the Sleep/Wake button, then drag the slider. 6WTPK2CFQĂ Press and hold the Sleep/Wake button for a few seconds until the red slider appears, then drag the slider. Turn iPad on Press and hold the Sleep/Wake button until the Apple logo appears. If you donât touch the screen for a minute or two, iPad locks automatically. To change this, see âAuto-Lockâ on page 157. If you want to require a passcode to unlock iPad, see âPasscode Lockâ on page 157. 10 Chapter 1 At a Glance You can use the iPad Smart Cover, available separately, to automatically unlock iPad 2 when you open the cover and lock iPad 2 when you close it. See âiPad Cover Lock/Unlockâ on page 158. Volume Buttons 7UGVJGXQNWOGDWVVQPUVQCFLWUVVJGCWFKQXQNWOGQHUQPIUCPFQVJGTOGFKCCPFQH CNGTVUCPFUQWPFGĂGEVU :PKL :^P[JO =VS\TL I\[[VUZ Increase the volume Press the Volume Up button. To set a volume limit for music and other media, in Settings, choose iPod > Volume Limit. Decrease the volume Press the Volume Down button. Mute the sound Press and hold the Volume Down button to mute audio or video playback. 5WRRTGUUPQVK°ECVKQPUCPF UQWPFGĂGEVU 5NKFGVJG5KFG5YKVEJFQYPVQOWVGPQVK°ECVKQPUCPF UQWPFGĂGEVU6JKUUYKVEJFQGUP¨VOWVGCWFKQQTXKFGQ playback. See âSoundsâ on page 156. You can also use the Side Switch to lock the screen rotation. In Settings, choose General > Use Side SwitchâŚ, then tap Lock Rotation. See âSide Switchâ on page 160. WARNING: For important information about avoiding hearing loss, see the iPad Important Product Information Guide at support.apple.com/manuals/ipad. Chapter 1 At a Glance 11 Micro-SIM Card Tray The micro-SIM card in some iPad Wi-Fi + 3G models is used for cellular data. Itâs also known as a third form factor (or 3FF) SIM. If your micro-SIM card wasnât preinstalled or if you change cellular data carriers, you may need to install or replace the micro-SIM card. :04LQLJ[ [VVS :04 [YH` 4PJYV:04 JHYK Open the SIM tray: 1 +PUGTVVJGVKRQHVJG5+/GLGEVVQQNKPVQVJGJQNGQPVJG5+/VTC[ 2TGUU°TON[CPFRWUJVJGVQQNUVTCKIJVKPWPVKNVJGVTC[RQRUQWV+H[QWFQP¨VJCXGC 5+/GLGEVVQQN[QWECPWUGVJGGPFQHCRCRGTENKR 2 Pull out the SIM tray to install or replace the micro-SIM card. For more information, see âJoining a Cellular Data Network â on page 30. 12 Chapter 1 At a Glance Home Screen Press the Home button at any time to go to the Home screen, which contains your iPad apps. Tap any icon to open the app. Status Icons The icons in the status bar at the top of the screen give information about iPad: Status icon What it means Airplane mode Shows that airplane mode is onâyou canât access the Internet, or use BluetoothÂŽ devices. Non-wireless features are available. See âAirplane Modeâ on page 151. 3G Shows that your carrierâs 3G network (iPad Wi-Fi + 3G) is available, and you can connect to the Internet over 3G. See âConnecting to the Internetâ on page 29. EDGE Shows that your carrierâs EDGE network (some iPad Wi-Fi + 3G models) is available, and you can connect to the Internet over EDGE. See âConnecting to the Internetâ on page 29. GPRS Shows that your carrierâs GPRS network (some iPad Wi-Fi + 3G models) is available, and you can connect to the Internet over GPRS. See âConnecting to the Internetâ on page 29. Wi-Fi Shows that iPad has a Wi-Fi Internet connection. The more bars, the stronger the connection. See âConnecting to the Internetâ on page 29. Activity Shows network and other activity. Some third-party apps may also use this icon to indicate an active process. VPN Shows that youâre connected to a network using VPN. See âVPNâ on page 152. Lock Shows that iPad is locked. See âSleep/Wake Buttonâ on page 10. Screen orientation lock Shows that the screen orientation is locked. See âViewing in Portrait or Landscapeâ on page 16. Play Shows that a song, audiobook, or podcast is playing. See âPlaying Songsâ on page 105. Bluetooth White icon: Bluetooth is on and a device, such as a headset or keyboard, is connected. Gray icon: Bluetooth is on, but no device is connected. No icon: $NWGVQQVJKUVWTPGFQĂ Battery Shows the battery level or charging status. See âCharging the Batteryâ on page 33. Chapter 1 At a Glance 13 iPad Apps The following apps are included with iPad: Safari Mail Photos iPod Calendar Contacts Notes Maps Videos YouTube 14 Browse websites on the Internet. Rotate iPad sideways for widescreen viewing. DoubleVCRVQ\QQOKPQTQWV¤5CHCTKCWVQOCVKECNN[°VUVJGYGDRCIGEQNWOPVQVJGUETGGP Open multiple pages. Sync bookmarks with Safari or Microsoft Internet Explorer on your computer. Add Safari web clips to the Home screen for fast access to favorite websites. Save images from websites to your Photo Library. Print webpages using AirPrint. See Chapter 4, âSafari,â on page 47. Send and receive mail using many of the most popular email services, Microsoft Exchange, or most industry-standard POP3 and IMAP mail services. Send and save RJQVQU8KGY2&(°NGUCPFQVJGTCVVCEJOGPVUQTQRGPVJGOKPQVJGTCRRU2TKPV messages and attachments using AirPrint. See Chapter 5, âMail,â on page 53. Organize your favorite photos and videos into albums. Watch a slideshow. Zoom in for a closer look. Share photos and videos using mail or MobileMe (sold separately), or print photos using AirPrint. See Chapter 9, âPhotos,â on page 69. Sync with your iTunes library and listen to your songs, audiobooks, and podcasts on iPad. Create and manage playlists, or use Genius to create playlists for you. Listen to Genius Mixes of songs from your library. Use Home Sharing to play music from your computer. Stream your music or videos wirelessly to an Apple TV or compatible audio system using AirPlay. See Chapter 16, âiPod,â on page 105. Keep your calendar current on iPad, or sync it with your Mac OS X or Windows calendar. Subscribe to othersâ calendars. Sync over the Internet with Microsoft Exchange or CalDAV servers. See Chapter 12, âCalendar,â on page 85. Organize your address book and keep it up to date on iPad, or sync it with your Mac OS X or Windows address book. Sync wirelessly with MobileMe (sold separately), Google Contacts, Yahoo! Address Book, and Microsoft Exchange. See Chapter 13, âContacts,â on page 91. Jot notes on the goâreminders, grocery lists, brilliant ideas. Send them in email. Sync notes to Mail or Microsoft Outlook or Outlook Express. See Chapter 14, âNotes,â on page 95. See a classic, satellite, hybrid, or terrain view of locations around the world. Zoom in for a closer look, or check out Google Street View. Find your current location. Get detailed FTKXKPIRWDNKEVTCPUKVQTYCNMKPIFKTGEVKQPUCPFUGGEWTTGPVJKIJYC[VTCĂEEQPFKVKQPU Find businesses in the area. See Chapter 15, âMaps,â on page 97. Play movies, TV shows, podcasts, videos from your iTunes library or your movie collection. Buy or rent movies on iPad using the iTunes Store. Download video podcasts. See Chapter 10, âVideos,â on page 77. Play videos from YouTubeâs online collection. Search for any video, or browse featured, most viewed, most recently updated, and top-rated videos. Set up and log in to your YouTube accountâthen rate videos, sync your favorites, show subscriptions, and more. See Chapter 11, âYouTube,â on page 81. Chapter 1 At a Glance iTunes App Store Game Center Search the iTunes Store for music, audiobooks, TV shows, music videos, and movies. Browse, preview, purchase, and download new releases, top items, and more. Buy or rent movies and TV shows to view on iPad. Download podcasts. Read reviews, or write your own reviews for your favorite store items. See Chapter 17, âiTunes Store,â on page 113. Search the App Store for apps you can purchase or download. Read reviews, or write your own reviews for your favorite apps. Download and install the apps on your Home screen. See Chapter 18, âApp Store,â on page 119. Discover new games and share your game experiences with friends. Invite a friend, or request a match with an opponent. Check player rankings on the leaderboards. Gain achievements for extra points. See Chapter 20, âGame Center,â on page 130. Make video calls to other FaceTime users over Wi-Fi. Use the front camera to talk face to face, or the back camera to share what you see. See Chapter 7, âFaceTime,â on page 63. FaceTime Camera Photo Booth Settings Take photos and record videos. View them on iPad, email them, or upload them to your computer or the Internet. Tap to set the exposure. Trim and save video clips. Upload videos directly to YouTube or MobileMe. See Chapter 6, âCamera,â on page 60. 7UGVJGHTQPVQTDCEMECOGTCVQVCMGCUPCRUJQV#FFCURGEKCNGĂGEVUWEJCUVYKTNQT stretch, before you take a snapshot. Snapshots are saved in an album in the Photo app. See Chapter 8, âPhoto Booth,â on page 66. Personalize your iPad settings in one convenient placeânetwork, mail, web, music, video, photos, and more. Set up Picture Frame, mail accounts, contacts, and calendars. Manage your cellular data account (iPad Wi-Fi + 3G). Set auto-lock and a passcode for security. See Chapter 22, âSettings,â on page 151. Additionally, you can get the following apps from the App Store on iPad: iBooks Pages Numbers Keynote Download the free iBooks app from the App Store. Tap the store button and browse tens of thousands of ePub and PDF booksâmany of them free. Print PDFs using AirPrint. Use bookmarks and highlights to save your place and note your favorite passages. See Chapter 19, âiBooks,â on page 124. Use Multi-Touch gestures to create and share documents on iPad. Develop letters, Âą[GTUDTQEJWTGUTGRQTVUCPFOQTG$GIKPCFQEWOGPVQPK2CFCPF°PKUJKVQP[QWT computer. You can purchase the Pages app from the App Store. Develop spreadsheets with tables, charts, photos, and text. With a few taps, you can QTICPK\GFCVCRGTHQTOECNEWNCVKQPUCPFOCPCIGNKUVU0WODGTUQĂGTUOCP[VGORNCVGU or you can choose the Blank template to create a unique spreadsheet. You can purchase the Numbers app from the App Store. Choose from Keynote themes to create a presentation. Add photos and videos from the Photos app; organize data with tables and charts; and when your presentation is ready, use full-screen view to play it on iPad. Import Keynote presentations you create on your computer. You can purchase the Keynote app from the App Store. Chapter 1 At a Glance 15 Note: App functionality and availability may vary depending on where you purchase and use iPad. Viewing in Portrait or Landscape You can view iPadâs built-in apps in either portrait or landscape orientation. Rotate iPad CPFVJGUETGGPTQVCVGUVQQCFLWUVKPICWVQOCVKECNN[VQ°VVJGPGYQTKGPVCVKQP You may prefer landscape orientation for viewing webpages in Safari, for example, or when entering text. Webpages automatically scale to the wider screen, making the text and images larger. The onscreen keyboard also becomes larger, which may help increase your typing speed and accuracy. Lock the screen orientation if you want to keep the screen from rotating. Lock the screen in portrait or landscape orientation: Double-click the Home DWVVQPVQXKGYVJG/WNVKVCUMKPIUVCVWUDCTVJGPÂąKEMHTQONGHVVQTKIJV6CR to lock the screen orientation. You can also set the Side Switch to lock the screen orientation instead of silencing UQWPFGĂGEVUCPFPQVK°ECVKQPU)QVQ5GVVKPIU )GPGTCN 16 Chapter 1 At a Glance Multi-Touch Screen The controls on the Multi-Touch screen change dynamically, depending on the task [QW¨TGRGTHQTOKPI6QEQPVTQNK2CFWUG[QWT°PIGTUVQVCRFQWDNGVCRCPFUYKRG Adjusting Brightness 6QCFLWUVVJGUETGGP¨UDTKIJVPGUUFQWDNGENKEMVJG*QOG button to view the Multitasking status bar. Flick from left to right, then drag the brightness slider. )YPNO[ULZZ ;QWECPWUG#WVQ$TKIJVPGUUVQCWVQOCVKECNN[CFLWUVVJGUETGGP¨UDTKIJVPGUU +P5GVVKPIUEJQQUG$TKIJVPGUU9CNNRCRGTVJGPVWTP#WVQ$TKIJVPGUUQPQTQĂ See âBrightness & Wallpaperâ on page 154. Using Lists Some lists have an index along the side to help you navigate quickly. 0UKL_ Find items in an indexed list: 6CRCNGVVGTVQLWORVQKVGOUUVCTVKPIYKVJVJCVNGVVGT &TCI[QWT°PIGTCNQPIVJGKPFGZVQUETQNNSWKEMN[VJTQWIJVJGNKUV Choose an item: Tap an item in the list. &GRGPFKPIQPVJGNKUVVCRRKPICPKVGOECPFQFKĂGTGPVVJKPIU¤HQTGZCORNGKVOC[ open a new list, play a song, open an email message, or show someoneâs contact information. Return to a previous list: Tap the back button in the upper-left corner. Chapter 1 At a Glance 17 Zooming In or Out When viewing photos, webpages, email, or maps, you can zoom in and out. Pinch your °PIGTUVQIGVJGTQTCRCTV(QTRJQVQUCPFYGDRCIGU[QWECPFQWDNGVCR VCRVYKEG quickly) to zoom in, then double-tap again to zoom out. For maps, double-tap to zoom KPCPFVCRQPEGYKVJVYQ°PIGTUVQ\QQOQWV Zoom is also an accessibility feature that lets you magnify the entire screen of any app youâre using and helps you see whatâs on the display. See âZoomâ on page 148. Onscreen Keyboard The onscreen keyboard appears automatically anytime you need to type. Use the keyboard to enter text, such as contact information, email, and web addresses. The keyboard corrects misspellings, predicts what youâre typing, and learns as you use it. You can also use an Apple Wireless Keyboard to type. When you use an external keyboard, the onscreen keyboard doesnât appear. See âUsing an Apple Wireless Keyboardâ on page 20. Typing Depending on the app youâre using, the intelligent keyboard may automatically suggest corrections as you type, to help prevent mistyped words. Enter text: 1 6CRCVGZV°GNFUWEJCUKPCPQVGQTPGYEQPVCEVVQDTKPIWRVJGMG[DQCTF 2 Tap keys on the keyboard. 18 Chapter 1 At a Glance +H[QWVQWEJVJGYTQPIMG[[QWECPUNKFG[QWT°PIGTVQVJGEQTTGEVMG[6JGNGVVGTKUP¨V GPVGTGFWPVKN[QWTGNGCUG[QWT°PIGTHTQOVJGMG[ Backspace to delete the previous character Tap Quickly type a period and space Double-tap the space bar. ;QWECPVWTPVJKUHGCVWTGQPQTQĂKP5GVVKPIU )GPGTCN Keyboard. Type uppercase Tap the Shift key before tapping a letter. Or touch and hold the Shift key, then slide to a letter. Turn caps lock on Double-tap the Shift key. The Shift key turns blue, and all letters you type are uppercase. Tap the Shift key to turn ECRUNQEMQĂ ;QWECPVWTPVJKUHGCVWTGQPQTQĂKP5GVVKPIU )GPGTCN Keyboard. Show numbers, punctuation, or symbols key. Tap the Symbol Tap the Number additional punctuation and symbols. Use an international keyboard Touch and hold the Next Keyboard key to display a menu of languages, then tap the language. See Appendix B, âInternational Keyboards,â on page 174. You can add or remove international keyboards in Settings > General > Keyboard. Type letters or symbols that arenât on the keyboard Touch and hold the related letter or symbol, then slide to choose a variation. Hide the onscreen keyboard Tap the Keyboard Chapter 1 At a Glance key to see key to hide the onscreen keyboard. 19 Using an Apple Wireless Keyboard For ease of typing, you can use an Apple Wireless Keyboard with iPad. The Apple Wireless Keyboard connects using Bluetooth, so you must pair the keyboard with iPad. See âPairing Bluetooth Devicesâ on page 43. Once the keyboard is paired with iPad, it connects whenever the keyboard is within range (up to 33 feet or 10 meters). You can tell that the keyboard is connected if the QPUETGGPMG[DQCTFFQGUP¨VCRRGCTYJGP[QWVCRKPCVGZV°GNF Switch the language when using a hardware keyboard: Hold down the Command key and tap the space bar to display a list of available languages. Tap the space bar again to choose a language. Disconnect a wireless keyboard from iPad: Hold down the power button on the MG[DQCTFWPVKNVJGITGGPNKIJVIQGUQĂ iPad disconnects the keyboard when itâs out of range. Unpair a wireless keyboard from iPad: In Settings, choose General > Bluetooth, tap next to the keyboard name, then tap âForget this Device.â ;QWECPCRRN[FKĂGTGPVNC[QWVUVQCYKTGNGUUMG[DQCTF5GG#RRGPFKZB, âInternational Keyboards,â on page 174 and âKeyboard Layoutsâ on page 22. Dictionary For many languages, iPad has dictionaries to help you type. The appropriate dictionary is activated automatically when you select a supported keyboard. To see a list of supported languages, from Settings, choose General > International > Keyboards. iPad uses the active dictionary to suggest corrections or complete the word youâre typing. You donât need to interrupt your typing to accept the suggested word. 20 Chapter 1 At a Glance Accept or reject dictionary suggestions: B To reject the suggested word, °PKUJV[RKPIVJGYQTFCU[QWYCPVKVVJGPVCRVJG UWIIGUVKQPVQFKUOKUUKVDGHQTGV[RKPICP[VJKPIGNUG'CEJVKOG[QWTGLGEVCUWIIGUVKQP for the same word, iPad becomes more likely to accept your word. B To use the suggested word, type a space, punctuation mark, or return character. Reset dictionary suggestions: In Settings, choose General > Reset > Reset Keyboard Dictionary. This resets all the suggestions youâve made to the dictionary. 6WTP#WVQ%QTTGEVKQPQPQTQĂIn Settings, choose General > Keyboard, then turn #WVQ%QTTGEVKQPQPQTQĂ#WVQ%QTTGEVKQPKUPQTOCNN[QP 6WTP5RGCM#WVQVGZVQPQTQĂIn Settings, choose General > Accessibility, then turn 5RGCM#WVQVGZVQPQTQĂ5RGCM#WVQVGZVURGCMUVJGVGZVUWIIGUVKQPU Note: If youâre entering Chinese or Japanese characters, tap one of the alternatives the dictionary suggests. EditingâCut, Copy, and Paste The Multi-Touch screen makes it easy to make changes to text youâve entered. An onscreen magnifying glass helps you position the insertion point precisely where you need it. Grab points on selected text let you quickly select more or less text. You can also cut, copy, and paste text and photos within apps, or across multiple apps. Position the insertion point: Touch and hold to bring up the magnifying glass, then drag to position the insertion point. Select text: Tap the insertion point to display the selection buttons. Tap Select to UGNGEVVJGCFLCEGPVYQTFQTVCR5GNGEV#NNVQUGNGEVCNNVGZV;QWECPCNUQFQWDNGVCRC word to select it. In read-only documents such as webpages, touch and hold a word to select it. Drag the grab points to select more or less text. Cut or copy text: Select text, then tap Cut or Copy. Chapter 1 At a Glance 21 Paste text: Tap the insertion point, then tap Paste to insert the last text that you cut or copied. Or, select text, then tap Paste to replace the text. Undo the last edit: Shake iPad, or tap undo on the keyboard. Keyboard Layouts You can use Settings to set the layouts for the onscreen software keyboard and for any hardware keyboards. Available layouts depend on the keyboard language. Select a keyboard layout: In Settings, choose General > Keyboard > International Keyboards, then select a keyboard. For each language, you can make separate selections for both the onscreen software keyboard and any external hardware keyboards. The software keyboard layout determines the layout of the keyboard on the iPad screen. The hardware keyboard layout determines the layout of an Apple Wireless Keyboard connected to iPad. 22 Chapter 1 At a Glance Getting Started Connect iPad to your computer and use iTunes to set up, register, and sync content. What You Need  WARNING: 6QCXQKFKPLWT[TGCFCNNQRGTCVKPIKPUVTWEVKQPUKPVJKUIWKFG and safety information in the iPad Important Product Information Guide at support.apple.com/manuals/ipad before using iPad. To use iPad, you need:  A Mac or a PC with a USB 2.0 port and one of the following operating systems:  Mac OS X version 10.5.8 or later  Windows 7, Windows Vista, or Windows XP Home or Professional with Service Pack 3 or later  iTunes 10.2 or later, available at www.itunes.com/download  An Apple ID  Broadband Internet access 23 Setting Up iPad Before you can use iPad, you must use iTunes to set it up. You can also register iPad and create an Apple ID (not available in some countries) if you donât already have one. Set up iPad: 1 Download and install the latest version of iTunes from www.itunes.com/download. 2 Connect iPad to a USB 2.0 port on your Mac or PC using the cable that came with iPad. 3 Follow the onscreen instructions in iTunes to register iPad and sync iPad with music, video, and other content from your iTunes library, and with your contacts, calendars, and bookmarks on your computer. In the Set Up Your iPad screen, select âAutomatically sync contacts, calendars and bookmarksâ to have those items sync automatically when you connect iPad to your computer. Syncing with iTunes Use iTunes to sync your music, videos, downloaded apps, and other iTunes library content from your computer. You can also sync your contacts, calendars, and your browser bookmarks. iTunes lets you choose the content and information that you want to sync with iPad. By default, iTunes syncs automatically whenever you connect iPad to your computer. When you sync, you can also transfer information you create or purchase on iPad to your computer. Setting Up Syncing You can set iTunes to sync the following:  Music  Movies  TV Shows  Games and apps downloaded from the App Store  Music videos  Podcasts 24 Chapter 2 Getting Started  Books and audiobooks  iTunes U collections  Photos and videos (in your computerâs photo app or folder)  Contactsânames, phone numbers, addresses, email addresses, and more  Calendarsâappointments and events  Notes  Email account settings  Webpage bookmarks ;QWECPCFLWUVU[PEUGVVKPIUYJGPGXGT[QWEQPPGEVK2CFVQ[QWTEQORWVGT Sync your music, audiobooks, podcasts, iTunes U collections, videos, books, and apps from your iTunes library. If you donât already have content in iTunes, go to the iTunes Store (available in some countries) to preview and download content to iTunes. You can also add music to your iTunes library from your CDs. To learn about iTunes and the iTunes Store, open iTunes and choose Help > iTunes Help. Contacts, calendars, notes, and webpage bookmarks are synced with applications on your computer. New entries or changes you make on iPad are synced to your computer, and vice versa. iTunes also lets you sync photos and videos, either from an application or from a folder. Email account settings are synced only one direction, from your computerâs email app VQK2CF6JKUCNNQYU[QWVQEWUVQOK\G[QWTGOCKNCEEQWPVUQPK2CFYKVJQWVCĂGEVKPI email account settings on your computer. Note: You can also set up email accounts directly on iPad. See âAdding Mail, Contacts, and Calendar Accountsâ on page 31. iTunes Store and App Store purchases you make on iPad are synced with the iTunes library on your computer when you connect. You can also purchase or download content and apps from the iTunes Store on your computer, and then sync them to iPad. Chapter 2 Getting Started 25 You can set iPad to sync only a portion of whatâs on your computer. For example, you might want to sync only certain music playlists, or only unwatched video podcasts. Important: You should log in to your own user account on your computer before connecting iPad. Set up iTunes syncing: 1 Connect iPad to your computer, and open iTunes (if it doesnât open automatically). 2 In iTunes, select iPad in the sidebar. 3 %QP°IWTGVJGU[PEUGVVKPIUKPGCEJQHVJGUGVVKPIURCPGU See the following section for a description of each pane. 4 Click Apply in the lower-right corner of the screen. By default, âOpen iTunes when this iPad is connectedâ is selected. 26 Chapter 2 Getting Started iPad Settings Panes in iTunes The following sections provide an overview of each of the iPad settings panes. For more information, open iTunes and choose Help > iTunes Help. Summary Pane Select âOpen iTunes when this iPad is attachedâ to have iTunes open and sync iPad automatically whenever you connect it to your computer. Deselect this option if you want to sync only by clicking the Sync button in iTunes. For more information about preventing automatic syncing, see âPreventing Automatic Syncingâ on page 29. Select âSync only checked songs and videosâ if you want iTunes to skip unchecked items in your iTunes library when syncing. 5GNGEVÂĽ/CPWCNN[OCPCIGOWUKECPFXKFGQUÂŚVQVWTPQĂCWVQOCVKEU[PEKPIKPVJG/WUKE and Video settings panes. Select âEncrypt iPad backupâ if you want to encrypt the information stored on your computer when iTunes makes a backup. Encrypted backups are shown with a lock icon, and require a password to restore the information to iPad. See âUpdating and Restoring iPad Softwareâ on page 182. 6QVWTPQPCEEGUUKDKNKV[HGCVWTGUENKEM%QP°IWTG7PKXGTUCN#EEGUU(QTOQTGKPHQTOCVKQP see âUniversal Access Featuresâ on page 137. Info Pane 6JG+PHQRCPGNGVU[QWEQP°IWTGVJGU[PEUGVVKPIUHQT[QWTEQPVCEVUECNGPFCTUGOCKN accounts, and web browser.  Contacts You can sync contacts with applications such as Mac OS X Address Book, Yahoo! Address Book, and Google Contacts on a Mac, or with Yahoo! Address Book, Google Contacts, Windows Address Book (Microsoft Outlook Express), Windows Vista Contacts, or Microsoft Outlook 2003, 2007, or 2010 on a PC. (On a Mac, you can sync contacts with multiple applications. On a PC, you can sync contacts with only one application at a time.) +H[QWU[PEYKVJ;CJQQ#FFTGUU$QQM[QWQPN[PGGFVQENKEM%QP°IWTGVQGPVGT[QWT new login information when you change your Yahoo! ID or password after youâve set up syncing.  Calendars You can sync calendars from applications such as iCal on a Mac, or from Microsoft Outlook 2003, 2007, or 2010 on a PC. (On a Mac, you can sync calendars with multiple applications. On a PC, you can sync calendars with only one application at a time.) Chapter 2 Getting Started 27  Mail Accounts You can sync email account settings from Mail on a Mac, and from Microsoft Outlook 2003, 2007, or 2010 or Microsoft Outlook Express on a PC. Account settings are only transferred from your computer to iPad. Changes you make to an email CEEQWPVQPK2CFFQP¨VCĂGEVVJGCEEQWPVQP[QWTEQORWVGT Note: The password for your Yahoo! email account isnât saved on your computer, so it canât be synced and must be entered on iPad. In Settings, choose âMail, Contacts, Calendars,â tap your Yahoo! account, and enter the password.  Other Sync bookmarks from Safari on a Mac, or from Safari or Microsoft Internet Explorer on a PC. Sync notes in the Notes app on iPad with notes in Mail on a Mac or with Microsoft Outlook 2003 or 2007 on a PC.  Advanced Select one or more of these options if your want to replace the information on iPad with the information on your computer during the next sync. Apps Pane Use the Apps pane to sync App Store apps, arrange apps on the iPad Home screen, or copy documents between iPad and your computer. Select âAutomatically sync new appsâ to sync new apps to iPad that you downloaded or synced from another device. If you delete an app on iPad, you can reinstall it from the Apps pane if it was previously synced. You can create documents on iPad, and then copy them to your computer. You can also copy documents from your computer to iPad, and use them with apps that UWRRQTV°NGUJCTKPI#RRUVJCVUWRRQTV°NGUJCTKPICTGUJQYPKPVJG(KNG5JCTKPI#RRU NKUV(QTOQTGKPHQTOCVKQPCDQWV°NGUJCTKPIUGGÂĽFile Sharingâ on page 44. Music, Movies, TV Shows, Podcasts, and iTunes U Panes Use these panes to specify the media you want to sync. You can sync all music, movies, TV shows, podcasts, and iTunes U collections, or select the content you want on iPad. To watch rented movies in your iTunes library on iPad, transfer them to iPad using the Movies pane. Books Pane You can sync books youâve downloaded from the iBookstore, and many free ePub books from other sources. You can also sync audiobooks, and if the book has more VJCPQPGRCTVLWUVVJGRQTVKQPU[QWYCPV 28 Chapter 2 Getting Started Photos Pane You can sync photos and videos with iPhoto 6.0.6 or later, or Aperture 3.0.2 or later on a Mac; or with Adobe Photoshop Elements 8.0 or later on a PC. You can also sync photos and videos in any folder on your computer that contains images or videos. Preventing Automatic Syncing You can prevent iPad from syncing automatically when you connect iPad to a FKĂGTGPVEQORWVGT Prevent automatic syncing for all iPads: In iTunes choose iTunes > Preferences (on a Mac) or Edit > Preferences (on a PC), click Devices, then select âPrevent iPods, iPhones, and iPads from syncing automatically.â If this checkbox is selected, iPad wonât sync automatically, even if âOpen iTunes when this iPad is connectedâ is selected in the Summary pane. Prevent automatic syncing one time, without changing settings: Open iTunes, connect iPad to your computer, then press and hold Command-Option (on a Mac) or Shift-Control (on a PC) until iPad appears in the sidebar. Sync manually: In iTunes, select iPad in the sidebar, then click Sync in the lower-right corner of the window. Or, if youâve changed any sync settings, click Apply. Connecting to the Internet K2CFECPLQKP#KT2QTVCPFQVJGT9K(KPGVYQTMUCVJQOGCVYQTMQTCV9K(KJQVURQVU CTQWPFVJGYQTNF9JGPLQKPGFVQC9K(KPGVYQTMVJCV¨UEQPPGEVGFVQVJG+PVGTPGV iPad connects to the Internet automatically whenever you use Mail, Safari, YouTube, the App Store, or the iTunes Store. iPad connects to the Internet using a Wi-Fi network. iPad Wi-Fi + 3G can also connect to the Internet using a cellular data network. Data service is sold separately. Joining a Wi-Fi Network 7UG9K(KUGVVKPIUVQVWTPQP9K(KCPFLQKP9K(KPGVYQTMU Turn on Wi-Fi: Choose Settings > Wi-Fi and turn Wi-Fi on. Join a Wi-Fi network: Choose Settings > Wi-Fi, wait a moment as iPad detects PGVYQTMUKPTCPIGVJGPUGNGEVCPGVYQTM HGGUOC[CRRN[VQLQKPUQOG9K(KPGVYQTMU If necessary, enter a password and tap Join (networks that require a password appear with a lock icon). 1PEG[QWLQKPC9K(KPGVYQTMK2CFCWVQOCVKECNN[EQPPGEVUVQKVYJGPGXGTVJGPGVYQTM KUKPTCPIG+HOQTGVJCPQPGRTGXKQWUN[WUGFPGVYQTMKUKPTCPIGK2CFLQKPUVJGQPG last used. When iPad has a Wi-Fi connection, the Wi-Fi icon in the status bar shows the connection strength. The more bars you see, the stronger the connection. (QTKPHQTOCVKQPCDQWVEQP°IWTKPI9K(KUGVVKPIUUGGÂĽWi-Fiâ on page 152. Chapter 2 Getting Started 29 Joining a Cellular Data Network $GHQTG[QWECPLQKPCEGNNWNCTFCVCPGVYQTMQPK2CF9K(K )[QWOWUVUKIPWRHQTC cellular data plan with an iPad service carrier in your area. With some carriers, you can choose a data plan, track your data usage, and change or cancel your plan on iPad. On some models, 3G, EDGE, and GPRS provide Internet connectivity over the cellular network available through your carrierâs wireless service. Check the carrierâs network coverage in your area for availability. If iPad is connected to the Internet using the cellular data network, you see the 3G ( ), EDGE ( ), or GPRS ( ) icon in the status bar. Turn Data Roaming on: If youâre outside your carrierâs network, you may be able to use a cellular data network from another carrier. In Settings, choose Cellular Data and turn Data Roaming on. Important: Roaming charges may apply. To avoid data roaming charges, make sure &CVC4QCOKPIKUVWTPGFQĂ Monitor your cellular data network usage: In Settings, choose Cellular Data > View Account. Set up a cellular data plan on iPad: From the iPad Home screen, tap Settings and choose Cellular Data. Tap View Account, then follow the onscreen instructions. Cellular data settings may vary depending on the carrier. iPad is unlocked, so you can choose your preferred carrier. Cellular data settings vary, depending on the carrier. If your iPad Wi-Fi + 3G didnât come with a micro-SIM card, contact your carrier to set up an account and obtain a compatible micro-SIM card. 0QVCNNECTTKGTUQĂGT)FCVCRNCPU Internet Access on an Airplane #KTRNCPGOQFGQPK2CF9K(K )VWTPUQĂVJGK2CFTCFKQVTCPUOKVVGTUVQEQORN[ with airline regulations. In some regions, where allowed by the aircraft operator and applicable laws and regulations, you can turn on Wi-Fi while airplane mode is on, to:  Send and receive email  Browse the Internet  Sync your contacts and calendars over the air  Stream YouTube videos  Purchase music and apps For more information, see âAirplane Modeâ on page 151. 30 Chapter 2 Getting Started Adding Mail, Contacts, and Calendar Accounts iPad works with MobileMe, Microsoft Exchange, and many of the most popular Internet-based email, contacts, and calendar service providers. If you donât already have an email account, you can get a free account online at www.yahoo.com, www.google.com, or www.aol.com. To try a free MobileMe trial, go to www.apple.com/mobileme. For information about setting up a Microsoft Exchange account in a corporate environment, see âSetting Up Microsoft Exchange Accountsâ on page 172. Setting Up MobileMe Accounts To use MobileMe on iPad, you can set up a MobileMe Free Account or a MobileMe Paid Subscription. A MobileMe Free Account lets you use Find My iPadâa feature that helps you locate iPad if itâs been lost or stolen, and protect the information on it (not available in all countries or regions). See âSecurity Featuresâ on page 46. A MobileMe Free Account is available to any customer who has an iPad with iOS 4.2 or later. If youâve already created an Apple ID for the App Store or Game Center, you can use the same Apple ID to set up your MobileMe account. Create a new account if you donât already have one. Set up a MobileMe Free Account: 1 In Settings, tap âMail, Contacts, Calendars.â 2 Tap Add Account, then tap MobileMe. 3 Enter your Apple ID and password, or tap Create Free Apple ID. 4 Follow the onscreen instructions. Verify your email address if required. 5 %QP°TOVJCV(KPF/[K2CFKUVWTPGFQP Set up a MobileMe Paid Subscription: 1 In Settings, tap âMail, Contacts, Calendars.â 2 Tap Add Account, then tap MobileMe. 3 Enter your Apple ID and password, or chose to create a new account. 4 Turn on the services you want to use on iPad. A MobileMe Paid Subscription lets you use Find My iPad, plus the following features:  Mail account at me.com  Over-the-air contacts, calendars, bookmarks, and notes syncing  MobileMe Gallery for sharing photos and videos  /QDKNG/GK&KUMHQTUVQTKPICPFUJCTKPI°NGU Chapter 2 Getting Started 31 You can try out these features with a 60-day free trial at www.apple.com/mobileme. Services you turn on are synced automatically over the air without having to connect iPad to your computer. See âSyncing with iTunesâ on page 24. You can set up multiple MobileMe accounts; however, only one MobileMe account at a time can be used for Find My iPad and for syncing contacts, calendars, bookmarks, and notes. To use Gallery, iDisk, and Find My iPad on iPad, download the free MobileMe Gallery, MobileMe iDisk, and Find My iPhone apps from the App Store. Setting Up Google, Yahoo!, and AOL Accounts For many popular accounts (Google, Yahoo!, AOL), iPad enters most of the settings for you. When setting up the account, you can choose which account services you want to use with iPad. Services you turn on are synced automatically over the air. See âSyncing with iTunesâ on page 24. Set up an account: 1 In Settings, tap âMail, Contacts, Calendars.â 2 Tap Add Account, then tap Google, Yahoo!, or AOL. 3 Enter your name, email address, password, and a description. 4 Tap the items you want to use on iPad. Available items depend on the service provider. Setting Up Other Accounts Choose Other Accounts to set up other accounts for mail (such as POP), contacts (such as LDAP or CardDAV), or calendars (such as CalDAV). Contact your service provider or system administrator to get the account settings you need. Set up an account: 1 In Settings, tap âMail, Contacts, Calendars.â 2 Tap Add Account, then tap Other. 3 Choose the account type you want to add (Mail, Contacts, or Calendars). 4 Enter your account information and tap Save. 32 Chapter 2 Getting Started Disconnecting iPad from Your Computer Unless iPad is syncing with your computer, you can disconnect it at any time. When iPad is syncing with your computer, the iPad Home screen shows âSync in RTQITGUUÂŚ+H[QWFKUEQPPGEVK2CFDGHQTGKV°PKUJGUU[PEKPIUQOGFCVCOKIJVPQV VTCPUHGT9JGPK2CF°PKUJGUU[PEKPIK6WPGUUJQYUÂĽK2CFU[PEKUEQORNGVGÂŚ Cancel a sync: Drag the slider on iPad. Viewing the User Guide on iPad The iPad User Guide can be viewed on iPad in Safari, or by installing the free iBooks app and downloading the guide from the iBookstore. View the user guide in Safari: In Safari, tap Or go to http://help.apple.com/ipad. , then tap the iPad User Guide bookmark. Add an icon for the user guide to the Home screen: Tap Home Screen.â , then tap âAdd to View the user guide in iBooks 1 If you havenât installed iBooks, open App Store, search for âiBooks,â then tap it in the results list. Tap Free, then tap Install. 2 Open iBooks and tap Store. 3 Search for âiPad User Guideâ and tap the user guide in the results list. 4 Tap Free, then tap Get Book. For more information about iBooks, see Chapter 19, âiBooks,â on page 124. Battery iPad has an internal rechargeable battery. The battery isnât user accessible and should only be replaced by an Apple Authorized Service Provider. For more information about iPad batteries, go to www.apple.com/batteries/ipad.html. Charging the Battery WARNING: For important safety information about charging iPad, see the iPad Important Product Information Guide at support.apple.com/manuals/ipad. The battery icon in the upper-right corner of the status bar shows the battery level or charging status. *OHYNPUN *OHYNLK Chapter 2 Getting Started 33 Charge the battery: The best way to charge the iPad battery is to connect iPad to a power outlet using the included Dock Connector to USB Cable and 10W USB power adapter. When you connect iPad to a USB 2.0 port on a Mac with the Dock Connector to USB Cable, iPad may charge slowly while syncing. Important: The iPad battery may drain instead of charge if iPad is connected to a PC, VQCEQORWVGTVJCV¨UVWTPGFQĂQTKUKPUNGGRQTUVCPFD[OQFGVQC75$JWDQTVQVJG USB port on a keyboard. If your Mac or PC doesnât provide enough power to charge iPad, a Not Charging message appears in the status bar. To charge iPad, disconnect it from your computer and connect it to a power outlet using the included Dock Connector to USB Cable and 10W USB Power Adapter. Important: If iPad is very low on power, it may display one of the following images, indicating that iPad needs to charge for up to ten minutes before you can use it. If iPad is extremely low on power, the display may be blank for up to two minutes before one of the low-battery images appears. VY Maximizing Battery Life iPad uses a lithium-ion battery. For information about maximizing the battery life of iPad, go to www.apple.com/batteries/ipad.html. Replacing the Battery Rechargeable batteries have a limited number of charge cycles and may eventually need to be replaced. The iPad battery isnât user replaceable; it can be replaced only by an Apple Authorized Service Provider (AASP). AASPs also recycle iPad batteries according to local laws and regulations. For information, go to www.apple.com/batteries/replacements.html. 34 Chapter 2 Getting Started Using and Cleaning iPad Handle iPad with care to maintain its appearance. If youâre concerned about scratching or abrasion of the screen, you can use a case or a cover, sold separately. Using iPad Comfortably +V¨UKORQTVCPVVQ°PFCEQOHQTVCDNGRQUVWTGYJGPWUKPIK2CFCPFVQVCMGHTGSWGPV breaks. Use your lap, or a table, case, or dock accessory, to support iPad during use. Cleaning iPad 6QENGCPK2CFWPRNWICNNECDNGUCPFVWTPQĂK2CF RTGUUCPFJQNFVJG5NGGR9CMG button, then slide the onscreen slider). Use a soft, slightly damp, lint-free cloth. Avoid getting moisture in openings. Donât use window cleaners, household cleaners, aerosol sprays, solvents, alcohol, ammonia, or abrasives to clean iPad. The iPad screen has an oleophobic coating; simply wipe the screen with a soft, lint-free cloth to remove oil left by your hands. The ability of this coating to repel oil will diminish over time with normal usage, and rubbing the screen with an abrasive material will further diminish KVUGĂGEVCPFOC[UETCVEJ[QWTUETGGP For more information about handling iPad, see the iPad Important Product Information Guide at support.apple.com/manuals/ipad. Chapter 2 Getting Started 35 Basics 4GCFVJKUEJCRVGTVQNGCTPJQYVQWUGCRRUQPK2CFCPFVQUGCTEJRTKPVUJCTG°NGU and more. Using Apps 6JGJKIJTGUQNWVKQP/WNVK6QWEJUETGGPCPFUKORNG°PIGTIGUVWTGUOCMGKVGCU[VQWUG iPad apps. Open an app by tapping its icon. You can switch between apps, rearrange apps, and organize them into folders. Opening and Switching Apps Open an app: Tap its icon on the Home screen. Return to the Home screen: Press the Home button. Multitasking allows certain apps to run in the background, so you can quickly switch between the apps youâre using. View the most recently used apps: Double-click the Home button. The most recently used apps appear in the recents list at the bottom of the screen. Flick left to see more apps. 36 Remove an app from the recents list: Touch and hold the app icon until it begins to LKIINGVJGPVCR . The app is added to the recents list again the next time you open it. Lock the screen orientation or use the iPod controls: Double-click the Home button, VJGPÂąKEMVJGDQVVQOQHVJGUETGGPHTQONGHVVQTKIJV The screen orientation lock, brightness slider, and iPod controls appear. )YPNO[ULZZ :JYLLU VYPLU[H[PVUSVJR P7VK JVU[YVSZ Delete an app from the Home screen: 6QWEJCPFJQNFVJGKEQPWPVKNKVLKIINGUCPF an appears. Tap to delete the app. Important: Deleting an app from iPad also deletes the documents and data created by the app. Scrolling Drag up or down to scroll. You can also scroll sideways in apps such as Safari, Photos, and Maps. &TCIIKPI[QWT°PIGTVQUETQNNFQGUP¨VEJQQUGQTCEVKXCVGCP[VJKPIQPVJGUETGGP Chapter 3 Basics 37 Swipe to scroll quickly. You can wait for the scrolling to come to a stop, or touch anywhere on the screen to stop it immediately. Touching the screen to stop scrolling doesnât choose or activate anything on the screen. To quickly scroll to the top of a list, webpage, or email message, tap the status bar at the top of the screen. Rearranging App Icons You can customize the layout of app icons on the Home screenâincluding the icons in the Dock along the bottom of the screen. If you want, arrange them over multiple Home screens. Rearrange icons: 1 6QWEJCPFJQNFCP[KEQPWPVKNVJGKEQPULKIING 2 Arrange the icons by dragging them. 3 Press the Home button to save your arrangement. You can also rearrange the icons on the Home screen, as well as the order of the screens, when you connect iPad to your computer. Select iPad in the iTunes sidebar, then click the Apps tab. 38 Chapter 3 Basics Create additional Home screens: While arranging icons, drag an icon to the right edge of the screen until a new screen appears. You can return to a previous screen and drag more icons to the new screen. You can have up to 11 screens. The dots above the Dock show the number of screens you have, and which screen youâre viewing. )QVQCFKĂGTGPV*QOGUETGGPFlick left or right, or tap to the left or right of the row of dots. )QVQVJG°TUV*QOGUETGGPPress the Home button. Reset the Home screen to its original layout: Choose Settings > General > Reset, then tap Reset Home Screen Layout. Organizing with Folders Folders let you organize icons on the Home screen. You can put up to 20 icons in a folder. iPad automatically names a folder when you create it, based on the icons you use to create the folder, but you can change the name. Rearrange folders by dragging them on the Home screen or by moving them to a new Home screen or to the Dock. Create a folder: 6QWEJCPFJQNFCPKEQPWPVKNVJG*QOGUETGGPKEQPUDGIKPVQLKIING then drag the icon onto another icon. iPad creates a new folder that includes the two icons, and shows the folderâs name. ;QWECPVCRVJGPCOG°GNFVQGPVGTCFKĂGTGPVPCOG You can also create iPad folders using iTunes. Create a folder using iTunes: With iPad connected to your computer, select iPad in the Devices list in iTunes. Click Apps at the top of the screen, and on the Home screen near the top of the window, drag an app onto another. Chapter 3 Basics 39 Add an icon to a folder While arranging icons, drag the icon onto the folder. Remove an icon from a folder While arranging icons, tap to open the folder, then drag the icon out of the folder. Open a folder Tap the folder. You can then tap an app icon to open that app. Close a folder Tap outside the folder, or press the Home button. Delete a folder Remove all icons from the folder. The folder is deleted automatically when empty. Rename a folder While arranging icons, tap to open the folder, then tap the name at the top and use the keyboard to enter a new name. Press the Home button to save your changes. 9JGP[QW°PKUJQTICPK\KPI[QWT*QOGUETGGPRTGUUVJG*QOG your changes. button to save Many apps, such as Mail and the App Store, display a badge on their Home screen icon with a number (to indicate incoming items) or an exclamation mark (to indicate a problem). If the app is in a folder, the badge appears on the folder as well. A numbered badge shows the total number of items you havenât attended to, such as incoming email messages and updated apps to download. An alert badge indicates a problem with the app. Printing AirPrint lets you print wirelessly to AirPrint-enabled printers. You can print from the following iPad apps:  Mailâemail messages and viewable attachments  Photosâphotos  5CHCTK¤YGDRCIGU2&(°NGUCPFXKGYCDNGCVVCEJOGPVU  K$QQMU¤2&(°NGU Other apps available from the App Store may also support AirPrint. #KT2TKPVGPCDNGFRTKPVGTUFQP¨VTGSWKTGRTKPVGTUQHVYCTGVJG[LWUVPGGFVQDG connected to the same Wi-Fi network as iPad. If youâre not sure whether your printer is AirPrint-enabled, refer to its documentation. For more information, go to support.apple.com/kb/HT4356. 40 Chapter 3 Basics Printing a Document #KT2TKPVWUGU[QWT9K(KPGVYQTMVQUGPFRTKPVLQDUYKTGNGUUN[VQ[QWTRTKPVGTK2CFOWUV be connected to the same wireless network as the AirPrint printer. Print a document: 1 Tap or (depending on the app youâre using), then tap Print. 2 Tap Select Printer to select a printer. 3 Set printer options, such as number of copies and double-sided output (if the printer supports it). Some apps also let you set a range of pages to print. 4 Tap Print. If you double-click the Home button while a document is printing, the Print Center app appears as the most recent app. A badge on the icon shows how many documents are ready to print, including the currently printing document. Chapter 3 Basics 41 Get the status of a print job: Double-click the Home button, tap the Print Center icon, VJGPUGNGEVCRTKPVLQD Cancel a print job: Double-click the Home button, tap the Print Center icon, select the RTKPVLQDVJGPVCR%CPEGN2TKPVKPI Searching You can search iPadâs built-in apps, including Mail, Calendar, iPod, Video, Notes, and Contacts. Search an individual app, or search all the apps at once using Spotlight. 42 Chapter 3 Basics Go to Spotlight: 1PVJGOCKPRCIGQHVJG*QOGUETGGPÂąKEMTKIJVQTRTGUUVJG*QOG button. On the Spotlight page, you can press the Home button to return to the main Home screen. Search iPad: 1PVJG5RQVNKIJVRCIGGPVGTVGZVKPVJG5GCTEJ°GNF5GCTEJTGUWNVU appear automatically as you type. Tap Search to dismiss the keyboard and see more of the results. Tap an item in the results list to open it. Icons to the left of the search results let you know which app the results are from. At the top of the list, iPad shows your top hits based on previous searches. At the bottom of the list, the search results also include options to search the web or search Wikipedia. App Whatâs searched Contacts First, last, and company names Mail 6Q(TQOCPF5WDLGEV°GNFUQHCNNCEEQWPVU VJGVGZVQH messages isnât searched) Calendar Event titles, invitees, and locations iPod Music (names of songs, artists, and albums) and the titles of podcasts and audiobooks Notes Text of notes Spotlight also searches the names of built-in and installed apps on iPad. If you have a lot of apps, you can use Spotlight to locate and open them. Open an app from Spotlight: Enter the app name, then tap to open the app. You can choose which apps are searched and the order in which theyâre searched. In Settings, choose General > Spotlight Search. Using Bluetooth Devices You can use iPad with the Apple Wireless Keyboard and other Bluetooth devices, UWEJCU$NWGVQQVJJGCFRJQPGU(QTUWRRQTVGF$NWGVQQVJRTQ°NGUIQVQ support.apple.com/kb/HT3647. Pairing Bluetooth Devices ;QWOWUV°TUVRCKT$NWGVQQVJFGXKEGU UWEJCUCMG[DQCTFQTJGCFRJQPGU YKVJK2CF before you can use them. Pair a Bluetooth device with iPad: 1 Follow the instructions that came with the device to make it discoverable. 2 In Settings, choose General > Bluetooth, and turn Bluetooth on. Chapter 3 Basics 43 3 Select the device and, if prompted, enter the passkey or PIN number. See the instructions about the passkey or PIN that came with the device. Note: Before you pair an Apple Wireless Keyboard, press the power button to turn the keyboard on. You can pair only one Apple Wireless Keyboard with iPad at a time. To RCKTCFKĂGTGPVMG[DQCTF[QWOWUV°TUVWPRCKTVJGEWTTGPVQPG After you pair the keyboard with iPad, the product name and a Bluetooth appear on the screen. icon After you pair headphones with iPad, the product name and a Bluetooth audio icon appear on the screen when youâre viewing audio or video playback controls. Tap to UYKVEJVQCFKĂGTGPVCWFKQQWVRWVUWEJCUVJGKPVGTPCNURGCMGT 6QWUGVJGQPUETGGPMG[DQCTFCICKPVWTPQĂ$NWGVQQVJ 5GVVKPIU )GPGTCN $NWGVQQVJ QTRTGUUVJG'LGEVMG[QPVJG$NWGVQQVJMG[DQCTF Bluetooth Status The Bluetooth icon appears in the iPad status bar at the top of the screen:  (white): Bluetooth is on and a device is connected to iPad.  (gray): Bluetooth is on but no device is connected. If youâve paired a device with K2CFKVOC[DGQWVQHTCPIGQTVWTPGFQĂ Â No Bluetooth icon: $NWGVQQVJKUVWTPGFQĂ Unpairing a Bluetooth Device from iPad +H[QWRCKTK2CFYKVJQPG$NWGVQQVJFGXKEGCPFVJGPYCPVVQWUGCFKĂGTGPVFGXKEGQH VJGUCOGV[RGKPUVGCF[QWOWUVWPRCKTVJG°TUVFGXKEG Unpair a Bluetooth device: 1 In Settings, choose General > Bluetooth, then turn Bluetooth on. 2 Choose the device, then tap âForget this Device.â File Sharing (KNG5JCTKPINGVU[QWVTCPUHGT°NGUDGVYGGPK2CFCPF[QWTEQORWVGT;QWECPUJCTG°NGU created with a compatible app and saved in a supported format. #RRUVJCVUWRRQTV°NGUJCTKPICRRGCTKPVJG(KNG5JCTKPI#RRUNKUVKPK6WPGU(QTGCEJ app, the Files list shows the documents that are on iPad. See the appâs documentation HQTJQYKVUJCTGU°NGUPQVCNNCRRUUWRRQTVVJKUHGCVWTG 44 Chapter 3 Basics 6TCPUHGTC°NGHTQOK2CFVQ[QWTEQORWVGT 1 Connect iPad to your computer. 2 In iTunes, select iPad in the Devices list, then click Apps at the top of the screen. 3 In the File Sharing section, select an app from the list on the left. 4 1PVJGTKIJVUGNGEVVJG°NG[QWYCPVVQVTCPUHGTVJGPENKEMÂĽ5CXGVQÂŚCPFEJQQUGC destination on your computer. 6TCPUHGTC°NGHTQO[QWTEQORWVGTVQK2CF 1 Connect iPad to your computer. 2 In iTunes, select iPad in the Devices list, then click Apps at the top of the screen. 3 In the File Sharing section, click Add. 4 5GNGEVC°NGVJGPENKEM%JQQUG /CE QT1- 2% 6JG°NGKUVTCPUHGTTGFVQ[QWTFGXKEGCPFECPDGQRGPGFWUKPICPCRRVJCVUWRRQTVU VJCV°NGV[RG6QVTCPUHGTOQTGVJCPQPG°NGUGNGEVGCEJCFFKVKQPCN°NG &GNGVGC°NGHTQOK2CF5GNGEVVJG°NGKPVJG(KNGUNKUVVJGPVCR&GNGVG Using AirPlay You can wirelessly stream music, photos, and video to your HDTV and speakers using AirPlay and Apple TV. You can also use AirPlay to stream audio to an Airport Express or AirPort Extreme base station. Other AirPlay-enabled receivers are available from third-parties, see the Apple Store for details. Start streaming to an AirPlay-enabled device: 1 Make sure iPad and the device (such as an Apple TV) are connected to the same Wi-Fi network. 2 Start the video, slideshow, or music, then tap and choose the AirPlay device you want to use. Some devices may ask for a passcode. Once streaming starts, you can exit the app. Stop steaming to an AirPlay-enabled device: 1 Open the app (such as Videos) that youâre streaming from. 2 Tap and choose iPad from the list. For troubleshooting help, see âNo Video or Sound when Using AirPlayâ on page 186. Chapter 3 Basics 45 Security Features Security features help protect the information on iPad from being accessed by others. Passcodes and Data Protection For security, you can set up a passcode that you must enter each time you turn on or wake up iPad. Set a passcode: Choose Settings > General > Passcode Lock > Turn Passcode On. Enter a 4-digit passcode, then enter it again to verify it. iPad will require you to enter the passcode to unlock it, or to display the passcode lock settings. Setting a passcode turns on data protection, which uses the passcode as the key for encrypting mail messages and attachments stored on iPad. (Data protection may also be used by some apps available in the App Store.) A notice at the bottom of the Passcode Lock screen in Settings shows that data protection is enabled. 6QKPETGCUGUGEWTKV[VWTPQĂ5KORNG2CUUEQFG CHQWTFKIKVPWODGT CPFWUGCOQTG robust passcode that has a combination of numbers, letters, punctuation, and special characters. For more information, see âPasscode Lockâ on page 157. Find My iPad Find My iPad may help you locate a lost or misplaced iPad using another iPhone, iPad, or iPod touch with the free Find My iPhone app, or a Mac or PC with a web browser. Find My iPad includes:  Find: Locates your iPad on a full-screen map on your computer  Display a Message or Play a Sound: Lets you specify a message to display or a sound to play on your iPad  Remote Passcode Lock: Lets you remotely lock your iPad and create a 4-digit passcode, if you havenât set one previously  Remote Wipe: Erases all the information and media on your iPad and restores iPad to its original factory settings Use Find My iPad: Turn on Find My iPad in your MobileMe account settings. See âSetting Up MobileMe Accountsâ on page 31. Locate your missing iPad: Download and use the free Find My iPhone app from the #RR5VQTGQPCFKĂGTGPVK15FGXKEGQTUKIPKPVQme.com in a web browser on a Mac or PC. Note: Find My iPad requires a MobileMe account. MobileMe is an online service that provides Find My iPad free to iPad, iPhone, and iPod touch 4th generation customers. MobileMe provides additional features with a paid subscription. MobileMe may not be available in all countries or regions. For more information, go to www.apple.com/mobileme. 46 Chapter 3 Basics Safari About Safari Use Safari on iPad to browse the web and visit your favorite sites. Use AirPrint to print webpages and PDFs. Open multiple pages and add web clips to the Home screen for quick access. Create bookmarks on iPad and sync them with your computer. To use Safari, iPad must have an Internet connection. See âConnecting to the Internetâ on page 29. Viewing Webpages You can view webpages in portrait or landscape orientation. Rotate iPad and the YGDRCIGTQVCVGUCWVQOCVKECNN[CFLWUVKPIVQ°VVJGRCIG 47 Opening Webpages Open a webpage: 6CRVJGCFFTGUU°GNF KPVJGVKVNGDCT VQDTKPIWRVJGQPUETGGP MG[DQCTFV[RGVJGYGDCFFTGUUVJGPVCR)Q+HVJGCFFTGUU°GNFKUP¨VXKUKDNGVCRVJG UVCVWUDCTCVVJGVQRQHVJGUETGGPVQSWKEMN[UETQNNWRVQVJGCFFTGUU°GNF As you type, web addresses that start with those letters appear. These are bookmarked pages or recent pages youâve opened. Tap an address to go to that page. Keep typing if you want to enter a web address thatâs not in the list. 'TCUGVJGVGZVKPVJGCFFTGUU°GNF6CRVJGCFFTGUU°GNFVJGPVCR . Zooming and Scrolling Zoom in or out: Double-tap a column on a webpage to expand the column. Double-tap again to zoom out. You can also pinch to zoom in or out. 48 Scroll around a webpage Drag up, down, or sideways. When scrolling, you can touch and drag anywhere on the page without activating any links. Scroll within a frame on a webpage 7UGVYQ°PIGTUVQUETQNNYKVJKPCHTCOGQP CYGDRCIG7UGQPG°PIGTVQUETQNNVJG entire webpage. Scroll quickly to the top of a webpage Tap the status bar at the top of the iPad screen. Chapter 4 Safari Navigating Webpages .KPMUQPYGDRCIGUV[RKECNN[VCMG[QWVQCFKĂGTGPVRNCEGQPVJGYGD Follow a link on a webpage: Tap the link. Links on iPad can also display a location in Maps or create a preaddressed Mail message. To return to Safari after a link opens another app, double-click the Home button and tap Safari. See a linkâs destination address Touch and hold the link. The address appears in CYKPFQYPGZVVQ[QWT°PIGT;QWECPQRGPVJG link in the active page, open it in a new page, or copy the address. Stop a webpage from loading Tap Reload a webpage Tap Return to the previous or next page Tap or Bookmark a page Tap and tap Bookmark. Add a web clip of a page to the Home screen Tap and tap âAdd to Home Screen.â Return to a recently viewed page Tap and tap History. To clear the history list, tap Clear. Send a webpage address in email Tap Save an image or photo to your Photo Library Touch and hold the image, then tap Save Image. at the top of the screen. and tap âMail Link to this Page.â Opening Multiple Pages You can open up to nine pages at a time. Some links automatically open a new page instead of replacing the current one. Open a new page: Tap , then tap New Page. )QVQCFKĂGTGPVRCIGTap Close a page: Tap Chapter 4 Safari and tap , then tap the page you want to view. 49 Entering Text and Filling Out Forms 5QOGYGDRCIGUJCXGVGZV°GNFUCPFHQTOUVQ°NNQWV;QWECPUGV5CHCTKVQTGOGODGT PCOGUCPFRCUUYQTFUQHYGDUKVGU[QWXKUKVCPF°NNQWVVGZV°GNFUCWVQOCVKECNN[YKVJ information from Contacts. Bring up the keyboard 6CRKPUKFGCVGZV°GNF /QXGVQCPQVJGTVGZV°GNF 6CRCPQVJGTVGZV°GNFQTVCRVJG0GZVQT2TGXKQWU buttons above the onscreen keyboard. Submit a form #HVGT°NNKPIQWVCHQTOVCR)QQT5GCTEJ/QUV pages also have a link you can tap to submit the form. Close the keyboard without submitting the form Tap the Keyboard keyboard. key to hide the onscreen 'PCDNG#WVQ(KNNVQJGNR[QW°NNQWVYGDHQTOUIn Settings, choose Safari > AutoFill, then do one of the following:  To use information from contacts, turn Use Contact Info on, then choose My Info and select the contact you want to use. 5CHCTKWUGUKPHQTOCVKQPHTQO%QPVCEVUVQ°NNKPEQPVCEV°GNFUQPYGDHQTOU  To use information from names and passwords, turn Names & Passwords on. When this feature is on, Safari remembers names and passwords of websites you XKUKVCPFCWVQOCVKECNN[°NNUKPVJGKPHQTOCVKQPYJGP[QWTGXKUKVVJGYGDUKVG  To remove all AutoFill information, tap Clear All. 2TKPVKPI9GDRCIGUCPF2&(°NGU Use AirPrint to print webpages and PDFs from Safari. Print a webpage or PDF: Tap at the top of the screen, then tap Print. Tap Select Printer to select a printer and set the printer options. Then tap Print. For more information about printing from iPad, see âPrintingâ on page 40. Searching the Web 'PVGTYQTFUQTRJTCUGUKPVJGUGCTEJ°GNFVQUGCTEJVJGYGDCPFVJGEWTTGPVYGDRCIG As you type, suggested and recent searches appear. Search the web: 1 6CRVJGUGCTEJ°GNF QPVJGTKIJVUKFGQHVJGVKVNGDCT 2 Type a word or phrase that describes what youâre looking for, and then tap Search. 3 Tap a link in the list of search results to open a webpage. 50 Chapter 4 Safari For tips about searching the Internet, visit www.google.com/help/features.html or help.yahoo.com/us/yahoo/search/basics. Find the search word or phrase on the current webpage: At the bottom of the TGUWNVUNKUVVCRVJGGPVT[DGNQY1P6JKU2CIGVQ°PFVJG°TUVQEEWTTGPEGQHCYQTFQT RJTCUG6Q°PFUWDUGSWGPVQEEWTTGPEGUVCR0GZVCVVJGDQVVQOQHVJGUETGGP $[FGHCWNV5CHCTKUGCTEJGUWUKPI)QQING6QEJCPIGVJGFGHCWNVVQCFKĂGTGPVUGCTEJ engine, in Settings, choose Safari > Search Engine, and choose a search engine. Bookmarks You can bookmark a webpage you want to return to later. Bookmark a webpage: Open the page and tap . Then tap Add Bookmark. When you save a bookmark, you can edit its title. By default, bookmarks are saved at VJGVQRNGXGNQH$QQMOCTMU6CR$QQMOCTMUVQEJQQUGCFKĂGTGPVHQNFGT If you use Safari on a Mac, or Safari or Microsoft Internet Explorer on a PC, you can sync bookmarks with the web browser on your computer. Sync bookmarks with your computer: 1 Connect iPad to your computer. 2 In iTunes, select iPad in the sidebar. 3 Click the Info tab, select âSync Safari bookmarksâ under Other, then click Apply. For more information, see âSyncing with iTunesâ on page 24. Sync bookmarks with MobileMe: In Settings on iPad, select Bookmarks in your MobileMe account. See âSetting Up MobileMe Accountsâ on page 31. Open a bookmarked webpage: Tap see the bookmarks inside. , then choose a bookmark or tap a folder to Edit a bookmark or bookmark folder: Tap , choose the folder that has the bookmark or folder you want to edit, then tap Edit. Then do one of the following:  To make a new folder, tap New Folder.  To delete a bookmark or folder, tap , then tap Delete.  To reposition a bookmark or folder, drag  6QGFKVVJGPCOGQTCFFTGUUQTVQRWVKVKPCFKĂGTGPVHQNFGTtap the bookmark or folder. 9JGP[QW°PKUJVCR&QPG Chapter 4 Safari 51 Web Clips Add web clips to the Home screen for fast access to your favorite webpages. Web clips appear as icons on the Home screen, and you can arrange them along with the app icons. See âRearranging App Iconsâ on page 38. Add a web clip: Open the webpage and tap . Then tap âAdd to Home Screen.â When you open a web clip, Safari automatically zooms and scrolls to the area of the webpage that was displayed when you saved the web clip. The displayed area is also used to create the icon for the web clip on your Home screen, unless the webpage comes with its own custom icon. When you add a web clip, you can edit its name. If the name is too long (more than about 10 characters), it may appear abbreviated on the Home screen. Web clips arenât synced by MobileMe or iTunes, but they are backed up by iTunes. Delete a web clip: 1 6QWEJCPFJQNFCP[KEQPQPVJG*QOGUETGGPWPVKNVJGKEQPUUVCTVVQLKIING 2 Tap in the corner of the web clip you want to delete. 3 Tap Delete, then press the Home 52 Chapter 4 Safari button to save your arrangement. Mail About Mail Read this chapter to learn how to use Mail to read your email messages and compose new messages. You can view messages from all your email accounts at once, and Mail displays message threads so itâs easy to follow a conversation. You can send or receive embedded photos and graphics, and view PDFs and other attachments. Use AirPrint to print messages and their attachments. Mail works with MobileMe, Microsoft Exchange, and many of the most popular email servicesâincluding Yahoo! Mail, Google email, and AOLâas well as other industry-standard POP3 and IMAP email services. To send or receive messages in Mail, iPad must have an Internet connection. See âConnecting to the Internetâ on page 29. Setting Up Email Accounts You can set up email accounts on iPad in either of the following ways:  Set up an account directly on iPad. See âAdding Mail, Contacts, and Calendar Accountsâ on page 31.  In iTunes, use the iPad settings panes to sync email accounts settings from your computer. See âSyncing with iTunesâ on page 24. 53 Sending Email You can send an email message to anyone who has an email address. Compose and send a message: 1 Tap at the top of the screen. 2 6[RGCPCOGQTGOCKNCFFTGUUKPVJG6Q°GNFQTVCR to add a name from your contacts. As you type an email address, matching email addresses from your contacts list appear. Tap an address to add it. To add more names, tap . Note: If youâre composing a message from your Microsoft Exchange account and have access to your enterprise Global Address List (GAL), matching addresses from the EQPVCEVUQPK2CFCRRGCT°TUVHQNNQYGFD[OCVEJKPI)#.CFFTGUUGU 3 Tap Cc/Bcc/From if you want to copy or blind copy the message to others, or change the account you send the message from. If you have more than one email account, [QWECPVCRVJG(TQO°GNFVQEJCPIGVJGCEEQWPV[QW¨TGUGPFKPIHTQO 4 'PVGTCUWDLGEVVJGP[QWTOGUUCIG ;QWECPVCR4GVWTPVQOQXGHTQOVJG5WDLGEV°GNFVQVJGOGUUCIG°GNF 5 Tap Send. 54 Send a photo in an email message In Photos, choose a photo, tap , then tap Email Photo. To send multiple photos in the same message, tap when viewing thumbnails in an album. You can also copy and paste photos. The photo is sent using your default email account. To change your default sending account, see âMail, Contacts, Calendarsâ on page 163. Save a draft of a message to complete later Tap Cancel, then tap Save. The message is saved in the Drafts mailbox. To quickly open the most recently saved draft, touch and hold . Reply to a message Open a message and tap . Tap Reply to reply only to the sender or Reply All to reply to the sender and all recipients. Type your return message, then tap Send. Files or images attached to the initial message arenât sent back. Forward a message Open a message and tap , then tap Forward. Add one or more email addresses, type your message, and then tap Send. 9JGP[QWHQTYCTFCOGUUCIG[QWECPKPENWFGVJG°NGUQT images attached to the original message. Share contact information In Contacts, choose a contact, then tap Share. Add one or more email addresses, type your message, then tap Send. Chapter 5 Mail Checking and Reading Email The Mail icon shows the total number of unread messages in all your inboxes. You may have other unread messages in other mailboxes. 5\TILYVM\UYLHK TLZZHNLZPU`V\Y PUIV_LZ Check for new messages: Choose a mailbox, tap Inbox, or tap . On each account screen, you can see the number of unread messages in each mailbox. Tap a mailbox to see its messages. Unread messages have a blue dot next to them. If you have more than one mail account, tap Mailboxes to switch between accounts. 6QXKGYCNNQH[QWTOGUUCIGUKPCWPK°GFKPDQZVCR#NN+PDQZGU 5\TILYVM \UYLHKTLZZHNLZFaceTime, then tap Add Another Email. Sign out: ;QWFQP¨VPQTOCNN[PGGFVQUKIPQWVQH(CEG6KOG¤LWUVUKIPKPQPEG and open FaceTime later without being asked to sign in again. You canât receive FaceTime calls while youâre signed out. But if you do need to sign out, choose Settings > FaceTime, then tap Account. 6WTPQĂ(CEG6KOGIf you donât want to receive FaceTime calls, choose Settings > (CEG6KOGCPFVWTPQĂ(CEG6KOG 64 Chapter 7 FaceTime Making a FaceTime Call To make a FaceTime call, open the FaceTime app, then choose someone from your contacts, favorites, or list of recent calls. Call a contact: Tap Contacts, choose a name, then tap the email address or phone number they use with FaceTime. Add a contact: Tap Contacts, tap , then enter the personâs name and their email address or phone number. For a contact outside your region, be sure to enter the complete number, including country code and area codeâfor example, +1 (408) 555-1234 in the United States. Restart a recent call: Tap Recents, then choose a name or number. Call a favorite: Tap Favorites, then tap a name in the list. While Youâre Talking While talking to someone in FaceTime, you can switch cameras, change camera orientation, mute your microphone, move your picture-in-picture display, open CPQVJGTCRRNKECVKQPCPF°PCNN[GPF[QWTECNN Switch between the front and back cameras: Tap Change camera orientation: Rotate iPad. The image your friend sees changes to match. To avoid rotating the screen as you move the camera around, turn on the orientation lock. See âViewing in Portrait or Landscapeâ on page 16. Mute your microphone: Tap hear your friend. . Your friend can still see you, and you can still see and Move your picture-in-picture display: Drag the small window to any corner. Use another application during a call: Press the Home button, then tap an application icon. You can still talk with your friend, but you canât see each other. To return to the video, tap the green bar at the top of the screen. End the call: Tap Chapter 7 FaceTime 65 Photo Booth About Photo Booth Itâs easy to take a photo using Photo Booth. Make your photo more interesting by CRRN[KPICPGĂGEVYJGP[QWVCMGKV2JQVQ$QQVJYQTMUYKVJDQVJVJGHTQPVCPF back cameras. 5GNGEVKPICP'ĂGEV $GHQTG[QWVCMGCRKEVWTG[QWECPUGNGEVCPGĂGEVVQCRRN[VQVJGRKEVWTG 5GNGEVCPGĂGEVTap VJGPVCRVJGGĂGEV[QWYCPVVQWUG Distort an image: +H[QWUGNGEVCFKUVQTVKQPGĂGEVFTCI[QWT°PIGTCETQUUVJGUETGGP to change the distortion. You can also pinch, swipe, or rotate the image to change the distortion. 66 Taking a Photo To take a Photo Booth photo, simply aim iPad and tap. Take a photo: Aim iPad and tap When you take a photo, iPad makes a shutter sound. You can use the volume buttons on the side of the iPad to control the volume of the shutter sound. You wonât hear a sound if you set the Side Switch to silent. See âButtonsâ on page 10 Note: +PUQOGTGIKQPUVJGUQWPFGĂGEVUCTGRNC[GFGXGPKHVJG5KFG5YKVEJKUUGV to silent. Switch between the front and back cameras: Tap at the bottom of the screen. Review the photo youâve just taken: Tap the thumbnail of your last shot. Swipe left or right to view more thumbnails. If you donât see the controls, tap the screen to display them. Delete a photo: Select a thumbnail, then tap Manage photos: Tap the thumbnail of the photoâyou can select more than one. Tap , then tap Email, Copy, or Delete. Viewing and Sharing Photos The photos you take with Photo Booth are saved in the Camera Roll album on iPad. You can view the Camera Roll album in the Photos app. View photos in the Camera Roll album: +P2JQVQUVCRVJG%COGTC4QNNCNDWO6QÂąKR through the photos, tap the left or right button, or swipe left or right. You can use Mail to send a Photo Booth photo in an email message. Send a photo: Tap a thumbnail to select the photo, or tap again to select more than one photo. Tap , then tap the Email button at the bottom of the screen. Mail opens and creates a new message with the photo attached. Chapter 8 Photo Booth 67 Uploading Photos to Your Computer Upload the photos you take with Photo Booth to photo applications on your computer, such as iPhoto on a Mac. Upload photos to your computer: Connect iPad to your computer.  Mac: Select the photos to upload, then click the Import or Download button in iPhoto or other supported photo application on your computer.  PC: Follow the instructions that came with your photo application. If you delete the photos from iPad when you upload them to your computer, theyâre removed from the Camera Roll album. You can use the Photos settings pane in iTunes to sync photos to the Photos app on iPad. 68 Chapter 8 Photo Booth Photos About Photos K2CFNGVU[QWECTT[RJQVQUCPFXKFGQUYKVJ[QWUQ[QWECPGPLQ[VJGOYJGTGXGT[QW are. You can easily share them with family and friends, either directly on iPad, or on an HDTV using AirPlay and Apple TV. You can even print photos from iPad using AirPrint. If your iPad has a camera, you can view photos and videos as you take them. You can sync photos and videos from your computer, import them from a digital camera or iPhone, or save them from email or the web. Use them in apps, send them in email messages, or upload them to your MobileMe Gallery. You can use iPad as a photo frame that displays an animated slideshow of your images. Syncing Photos and Videos with Your Computer iPad supports standard photo formats such as JPEG, TIFF, GIF, and PNG. You use iTunes to sync photos to iPad. When syncing photos to iPad, iTunes automatically creates a size optimized for iPad, if necessary. See âSetting Up Syncingâ on page 24. iPad supports H.264 and MPEG-4 video formats, with AAC audio. You use iTunes to sync videos taken with a digital camera, iPhone, or iPod touch (4th generation) to iPad. 69 Importing Photos and Videos from iPhone or a Digital Camera With the iPad Camera Connection Kit (sold separately), you can import photos and videos directly from a digital camera or iPhone, or from an SD memory card. Import photos: 1 Insert the SD Card Reader or Camera Connector, included in the iPad Camera Connection Kit, into the iPad dock connector.  To connect a camera or iPhone, use the USB cable that came with the camera or iPhone, and connect it to the USB port on the Camera Connector. If youâre using iPhone, make sure itâs turned on and unlocked. To connect a camera, make the sure the camera is turned on and in transfer mode. For help, see the documentation that came with the camera.  To use an SD memory card, insert it in the slot on the SD Card Reader. Donât force VJGECTFKPVQVJGUNQVKV°VUQPN[QPGYC[ For more information about the connectors, see the iPad Camera Connection Kit documentation. 2 Unlock iPad. 3 The Photos app opens and displays the photos and videos that are available for importing. 4 Select the photos and videos you want to import.  To import all of the items, tap Import All.  6QKORQTVLWUVUQOGQHVJGKVGOUVCRVJGQPGU[QWYCPVVQKPENWFG CEJGEMOCTM appears on each), then tap Import, and select Import Selected. 5 After the photos are imported, you can choose to keep or delete the photos and videos on the card, camera, or iPhone. 6 Disconnect the SD Card Reader or Camera Connector. To view the photos, look in the Last Import album. A new Event contains all the photos that were selected for import. To transfer the photos to your computer, connect iPad to your computer and import the images with a photo application such as iPhoto or Adobe Elements. Viewing Photos and Videos Photos lets you view photos synced from your computerâs photo application, imported from a digital camera or iPhone, or saved from an email message or webpage. Photos organizes collections by Albums, Events, Faces, and Places. Places uses the location information encoded in photos, but not all photos may have this informationâit requires a camera that supports geotagging. Events and Faces must °TUVDGEQP°IWTGFKPK2JQVQQT#RGTVWTGQPC/CEVJGPU[PEGFVQK2CF 70 Chapter 9 Photos View photos: 1 In Photos, tap Photo, Albums, Events, Faces, or Places. To open a collection, tap it. Or, pinch the collection to spread out a preview of the photos it contains, then let go to open it. Photos are sorted by creation date. When youâre viewing Places, tap a pin on the map to display the location, then pinch to zoom and show all photos taken at this location. 2 Tap a thumbnail to view a photo in full screen. You can also pinch to zoom in on the photo. Chapter 9 Photos 71 Show or hide the controls: Tap the photo to show the controls. Tap again to hide the controls. View a photo in landscape orientation: Rotate iPad sideways. The photo or video TGUK\GUCWVQOCVKECNN[VQ°VVJGUETGGP Zoom in on part of a photo: Double-tap where you want to zoom in. Double-tap again to zoom out. You can also pinch to zoom in or out. Pan a photo: Drag the photo. See the next or previous photo: Flick left or right. Or tap the screen to show the VJWODPCKNUCETQUUVJGDQVVQOVJGPVCRQTFTCIVQXKGYCFKĂGTGPVRJQVQ Delete a photo: You can delete photos from the Saved Photos album, which contains photos you save from email or the web. For photos synced from your computer, you need to delete the photo from the album on your computer, then sync iPad again. 72 Chapter 9 Photos Rotate a photo: Tap . To rotate it more, tap again. View photos or videos on a TV using AirPlay and Apple TV: Make sure iPad is on the same wireless network as Apple TV, then tap and choose Apple TV from the list. 9JGP[QWÂąKEMVJTQWIJRJQVQUQPK2CFVJGXKFGQQPVJG68WRFCVGUCU[QWRCWUG See âUsing AirPlayâ on page 45 for more information. Sharing Photos You can share your photos as slideshows, complete with music and transitions. With AirPlay and Apple TV, you can wirelessly stream your photos to a TV. You can send photos and videos in email messages, and add photos to your MobileMe Gallery. You can also copy and paste photos, save photos from email messages to Photos, and save images from webpages to a photo album. Slideshows You can create and view a slideshow that shows your photos with transitions and music. You can view a slideshow on iPad, or stream it wirelessly to an Apple TV. You can CNUQWUGK2CFVQXKGYCUNKFGUJQYQPCPGZVGTPCNFKURNC[UWEJCUCRTQLGEVQT View a slideshow: 1 Tap an album to open it. You can select an album that contains photos, videos, or both. If your iPad has a camera, photos and videos youâve shot appear in the Camera Roll album. 2 Tap the Slideshow button and, in the list that appears, select slideshow options. You can:  Select a song from your music library to play music during the slideshow.  5GNGEVCVTCPUKVKQPGĂGEVVJCVRNC[UDGVYGGPRJQVQU To set how long each photo is displayed, go to General > Settings > Photos. You can also set whether the slideshow repeats, or plays in a random sequence. Available transitions are determined by how you view the slideshow. If youâre connected to an Apple TV, choose one of the available transitions. If iPad is connected VQC68QTRTQLGEVQTWUKPICXKFGQECDNGEJQQUGVJG&KUUQNXGVTCPUKVKQP(QTKPHQTOCVKQP about connecting to an external display, see Chapter 10, âVideos,â on page 77. 3 Tap Start Slideshow. To stop the slideshow, tap the screen. and select the If youâre using AirPlay to stream the photos to an Apple TV, tap Apple TV from the list. See âUsing AirPlayâ on page 45 for more information. Sending a Photo or Video in an Email Message Send a photo or video: Tap a photo or video, tap , then tap Email Photo. If you donât see , tap the screen to show the controls. Chapter 9 Photos 73 Send multiple photos or videos: Tap an album, then tap . Tap each of the photos or videos you want to send (a checkmark appears on each thumbnail), then tap Email. If the Email button is unavailable, select fewer items. Copy a photo or video: 1 Tap . 2 Tap to select the photo or video you want to copy. 3 Tap Copy. Paste a photo or video: Tap to place the insertion point where you want to paste the photo or video, then tap the insertion point and tap Paste. Adding a Photo or Video to a MobileMe Gallery If youâre a MobileMe subscriber, you can add photos and videos from iPad to your MobileMe Gallery. You can also add items to someone elseâs MobileMe Gallery if they allow email contributions. Before you can add photos to a gallery in your MobileMe account, you must:  Set up your MobileMe account on iPad. If you donât have a MobileMe account, go to www.apple.com/mobileme/setup/ipad.html.  Publish a MobileMe Gallery and allow adding photos from email or iPad. Add a photo or video to your gallery: Choose a photo or video and tap , then tap âSend to MobileMe.â Enter a title and description if you like, select the album to add the photo to, then tap Publish. If you donât see , tap the screen to show the controls. iPad tells you when the photo has been published, and gives you options to view it on MobileMe or email a link to a friend. Add a photo to someone elseâs gallery: Choose a photo and tap Photo.â Enter the albumâs email address, then click Send. , then tap âEmail Saving Photos from Email Messages or Webpages Save a photo from an email message to your Saved Photos album: Tap the photo, VJGPVCR5CXG+OCIG+HVJGRJQVQJCUP¨VDGGPFQYPNQCFGFVCRVJGFQYPNQCFKEQP°TUV Save a photo from a webpage to your Saved Photos album: Touch and hold the photo, then tap Save Image. Copy photos from the Saved Photos album to your computer: Connect iPad to your computerâs USB port, then use a photo application, such as iPhoto on a Mac, to copy the images. 74 Chapter 9 Photos Assigning a Photo to a Contact You can assign a photo to a contact. Assign a photo to a contact: 1 Choose a photo on iPad, then tap 2 Tap âAssign to Contact,â then choose a contact. 3 Drag the photo to pan, and pinch to zoom in or out, until the photo looks the way you want. 4 Tap Set Photo. In Contacts, you can assign a photo to a contact by tapping Edit and then tapping the picture icon. Printing Photos You can use AirPrint to print photos from iPad. Print a photo: Tap , then tap Print. Tap Select Printer to select a printer and set printer options such as the number of copies, then tap Print. If your printer has a tray for photo paper, it may automatically switch to that tray when you print a photo. For more information, see âPrintingâ on page 40. Wallpaper and Lock Screen Photos You can display a photo in the wallpaper background of the Lock screen and Home screen. You can choose from several wallpaper pictures included with iPad, or you can use a photo of your own. Set a photo as screen wallpaper: 1 Choose any photo and tap , then tap Use As Wallpaper. 2 Drag to pan the photo, or pinch the photo to zoom in or out, until it looks the way you YCPV#RJQVQVJCV¨UCVNGCUVZRKZGNU°NNUVJGUETGGPYJGPK2CFKUTQVCVGF 3 Tap Set Wallpaper. Then tap to use the image as wallpaper for the Home screen, on the Lock screen, or both. To choose from several wallpaper pictures included with iPad, go to Settings > Brightness & Wallpaper. Chapter 9 Photos 75 Using Picture Frame 9JGPK2CFKUNQEMGF[QWECPFKURNC[CPCNDWOQHRJQVQU6JKUKUCITGCVYC[VQGPLQ[ iPad while charging it in an iPad Dock. To change Picture Frame settings, go to Settings > Picture Frame, then set any of the following options:  The transition you select is played between photos. The duration of the slideshow canât be changed.  Picture Frame can zoom the image to focus on faces in the image. It can also randomly select one of the faces as the center of focus, if more than one face is RTGUGPVKPVJGKOCIG2KEVWTG(TCOGWUGUVJGHCEGKFGPVK°ECVKQPKPHQTOCVKQPKP photos imported from iPhoto or Aperture on a Mac. Zooming in on faces isnât an option with the Origami transition.  2KEVWTG(TCOGECPFKURNC[CNNRJQVQUQTLWUVVJQUGKPCP#NDWO(CEGUQT'XGPV ECVGIQT[5GNGEVCPQRVKQPVJGPTG°PG[QWTUGNGEVKQPKPVJGNKUVVJCVCRRGCTU6JG Faces, Albums, and Event selections are the same as those in the Photos app. Start or stop Picture Frame: 1 Press the Sleep/Wake button to lock iPad. 2 On the Lock screen, tap 3 Tap the screen to pause the slideshow, then tap or slide the slider to unlock iPad. to return to the Lock screen, 6QVWTPQĂ2KEVWTG(TCOGIQVQ5GVVKPIU )GPGTCN 2CUUEQFG.QEM 76 Chapter 9 Photos Videos 10 About Videos You can use iPad to view movies, music videos, video podcasts, and, if theyâre available in your area, TV shows. iPad also supports special features such as chapters, subtitles, alternate audio, and closed captioning. You can rent or purchase videos from the iTunes Store, and you can use a video CFCRVGTECDNGVQYCVEJXKFGQUQPC68QTRTQLGEVQT+H[QWJCXGCP#RRNG68[QWECP use AirPlay to watch the videos wirelessly on a TV. 77 Playing Videos Play a video: Tap Videos, then tap a category of videos, such as Movies. Tap the video [QWYCPVVQYCVEJ+HVJGXKFGQJCUEJCRVGTUVCRCEJCRVGTVKVNGQTLWUVVCR . Display playback controls: While a video is playing, tap the screen to show the controls. Tap again to hide them. Controlling Video Playback Rotate iPad to play videos in widescreen orientation and take full advantage of the display. &TCIVJGRNC[JGCFCNQPIVJGUETWDDGTDCTVQUMKRVQCP[RQKPVKPVJGXKFGQ6QCFLWUV VJGUETWDTCVGHTQOHCUVVQUNQYUNKFG[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCFCNQPI the scrubber bar. 78 Chapter 10 Videos Pause a video Tap or press the center button (or equivalent button) on a compatible headset. Resume playback Tap or press the center button (or equivalent button) on a compatible headset. Raise or lower the volume Drag the volume slider, or use the iPad volume buttons or the buttons on a compatible headset. Start a video over Drag the playhead on the scrubber bar all the if the video doesnât way to the left, or tap contain chapters. Skip to the next chapter (if available) or press the center button (or equivalent Tap button) on a compatible headset twice quickly. Go to the previous chapter (if available) or press the center button (or equivalent Tap button) on a compatible headset three times quickly. 5VCTVRNC[KPICVCURGEK°EEJCRVGT KHCXCKNCDNG Tap Rewind or fast-forward Touch and hold Skip to any point in a video Drag the playhead along the scrubber bar. Slide [QWT°PIGTFQYPVQCFLWUVVJGUETWDTCVGHTQO fast to slow. , then choose a chapter from the list. or 5VQRYCVEJKPICXKFGQDGHQTGKV°PKUJGURNC[KPI Tap Done, or press the Home button. 5ECNGCXKFGQVQ°NNVJGUETGGPQT°VVQVJG screen Tap VQOCMGVJGXKFGQ°NNVJGUETGGPQTVCR VQOCMGKV°VVJGUETGGP;QWECPCNUQFQWDNG tap the video to switch views. 9JGP[QWUECNGCXKFGQVQ°NNVJGUETGGPVJG sides or top may be cropped. When you scale it VQ°VVJGUETGGP[QWOC[UGGDNCEMDCTUQPVJG sides or above and below the video. Play a video on Apple TV using AirPlay Tap and choose an Apple TV. See âWatching Videos on a TVâ on page 80. 5GNGEVCFKĂGTGPVCWFKQNCPIWCIG KHCXCKNCDNG Tap list. Show or hide subtitles (if available) Tap VJGPEJQQUGCNCPIWCIGQT1ĂHTQOVJG Subtitles list. Show or hide closed captioning (if available) Tap to show or hide captions, if the movie has them. , then choose a language from the Audio Syncing Videos Use iTunes to sync videos to iPad. When iPad is connected to your computer, use the Movies, TV Shows, Podcasts, and iTunes U panes to select which videos to sync. Chapter 10 Videos 79 Watching Rented Movies ;QWECPTGPVOQXKGUKPUVCPFCTFQTJKIJFG°PKVKQPHQTOCVHTQOVJGK6WPGU5VQTGCPF watch them on iPad. You can download rented movies on iPad, or transfer them from iTunes on your computer to iPad. (Rented movies arenât available in all regions.) A movie must be completely downloaded before you can watch it. You can pause a download and continue it later. Rented movies expire after a certain number of days, CPFQPEG[QWUVCTVCOQXKG[QWJCXGCNKOKVGFCOQWPVQHVKOGVQ°PKUJYCVEJKPIKV Movies are automatically deleted when they expire. Before renting a movie, check the iTunes Store for the expiration time. View a rented movie: Choose Videos, tap the Movies category, then tap the movie [QWYCPVVQYCVEJ5GNGEVCEJCRVGTQTLWUVVCR . Transfer rented movies to iPad: Connect iPad to your computer. Then select iPad in the iTunes sidebar, click Movies, and select the rented movies you want to transfer. Your computer must be connected to the Internet. Movies rented on iPad cannot be transferred to a computer. Watching Videos on a TV To watch videos on a TV, you can connect iPad using AirPlay and Apple TV, or use a cable to connect iPad directly to your TV or AV receiver. For more information about EQPPGEVKPIK2CFVQC68QTRTQLGEVQTUGGÂĽVideoâ on page 168. Connect using AirPlay: Start video playback, then tap and choose your Apple TV from the list of AirPlay devices. See âUsing AirPlayâ on page 45 for more information. While video is playing, you can exit Video and use other apps. To return playback to iPad: Open Videos, then tap and choose iPad from the list. Deleting Videos from iPad To save space, you can delete videos from iPad. Delete a video: In the videos list, tap and hold a movie until the delete button appears, then tap 6CR%CPEGNQT*QOGYJGP[QW°PKUJFGNGVKPIXKFGQU When you delete a video (other than rented movies) from iPad, it isnât deleted from your iTunes library on your computer, and you can sync the video back to iPad later. If you donât want to sync the video back to iPad, set iTunes to not sync the video. See âSyncing with iTunesâ on page 24. Important: If you delete a rented movie from iPad, itâs deleted permanently and canât be transferred back to your computer. 80 Chapter 10 Videos YouTube 11 Finding and Viewing Videos YouTube features short videos submitted by people from around the world. You can watch the latest, most popular videos, search for videos about topics of KPVGTGUVÂąCI[QWTHCXQTKVGUCPFSWKEMN[CEEGUUXKFGQUVJCV[QWWRNQCFVQ;QW6WDG from your computer. To use certain YouTube features on iPad, you need to sign in to a YouTube account when prompted. For information about requirements and how to get a YouTube account, go to www.youtube.com. Note: YouTube isnât available in all languages and locations. To use YouTube, iPad must have an Internet connection. See âConnecting to the Internetâ on page 29. Browse videos: Tap a button in the toolbar to select a category.  Featured: 8KFGQUTGXKGYGFCPFHGCVWTGFD[;QW6WDGUVCĂ Â Top Rated: Videos most highly rated by YouTube viewers. You can rate videos on iPad, if you have a YouTube account.  Most Viewed: Videos most seen by YouTube viewers. Tap All for all-time most viewed videos, or Today or This Week for most-viewed videos of the day or week.  Favorites: Videos you added to Favorites. When you sign in to a YouTube account, account favorites appear.  Most Recent: Videos most recently submitted to YouTube.  Subscriptions: Videos from YouTube accounts you subscribe to. You must be signed in to a YouTube account to use this feature. 81  Playlists: Videos you add to playlists. You must be signed in to a YouTube account to use this feature.  My Videos: Videos that youâve upload to YouTube. You must be signed in to a YouTube account to use this feature.  History: Videos youâve viewed most recently. Search for a video: 1 6CRVJG;QW6WDGUGCTEJ°GNF 2 Type a word or phrase, then tap Search. YouTube shows results based on searching video titles, descriptions, tags, and user names. Each search result shows the title, rating, number of views, length, and the name of the account the video was posted from. Play a video: Tap the video. The video begins downloading to iPad, and a progress bar appears. When enough of the video has downloaded, it begins to play. You can also tap to start the video. 82 Chapter 11 YouTube Controlling Video Playback Rotate iPad to landscape orientation to view the video at its maximum size. When a video is playing, the controls disappear so they donât obscure the video. Show or hide the video controls: Tap the screen. Play or pause a video Tap or . You can also press the center button (or equivalent button) on a compatible headset. Adjust the volume Drag the volume slider, or use the iPad volume buttons or the volume buttons on a compatible headset. Start a video over Tap Skip to the next or previous video in a list Tap Tap Rewind or fast-forward Touch and hold Skip to any point in a video Drag the playhead along the scrubber bar. Stop watching a video Tap Done, or press the Home Toggle between full-screen and standard mode Double-tap the video. You can also tap to OCMGVJGXKFGQ°NNVJGUETGGPQT to make it °VVJGUETGGP Add a video to Favorites Start playing a video, then tap Email a link to the video Start playing a video, then tap Play a video on Apple TV using AirPlay Tap and choose Apple TV. For information, see âUsing AirPlayâ on page 45. View information about a video to exit full-screen mode and view related Tap videos, comments, and more controls. Chapter 11 YouTube twice to skip to the previous video. to skip to the next video. or button. 83 Managing Videos While watching a full-screen video, tap to display the controller, then tap related videos and options for managing videos. to see Rate a video or add a comment Tap the video to display the toolbar, then tap Rate and select a rating. You must be signed in to a YouTube account. See more videos from this YouTube user In the sidebar, tap âMore From.â You must be signed in to a YouTube account. See videos similar to this one In the sidebar, tap âRelated.â Subscribe to videos by this YouTube user On the More Info screen, tap More Videos, then tap âSubscribe to â at the bottom of the video list. You must be signed in to a YouTube account. Add a video to Favorites or a playlist Tap Add, then select Favorites or a playlist. Email a link to a video Tap Share. Flag a video Tap the movie to display the toolbar, then tap Watching YouTube on a TV If you have an Apple TV, you can use AirPlay to watch YouTube videos on a TV. See âControlling Video Playbackâ on page 83. ;QWECPCNUQEQPPGEVK2CFFKTGEVN[VQ[QWT68QTCRTQLGEVQTCPFYCVEJ;QW6WDGQP VJGNCTIGUETGGP(QTOQTGKPHQTOCVKQPCDQWVWUKPIK2CFYKVJC68QTRTQLGEVQTUGG âVideoâ on page 168. 84 Chapter 11 YouTube Calendar 12 About Calendar iPad makes it easy to stay on schedule. You can view calendars individually, or several calendars at once. You can view your events by day, week, or month, or in a list. You can also search events by title, invitee, or location. You can sync iPad with the calendars on your computer. You can also create, edit, or cancel events on iPad, and sync them back to your computer. You can subscribe to Google, Yahoo!, or iCal calendars. You can subscribe to read-only iCalendar (.ics) ECNGPFCTUQTKORQTVKEU°NGUHTQOGOCKN+H[QWJCXGC/KETQUQHV'ZEJCPIGCEEQWPVQTC supported CalDAV account, you can receive and respond to meeting invitations from others, and invite people to events youâve scheduled. Syncing Calendars You can sync your calendars in these ways:  In iTunes, use the iPad settings panes to sync with iCal or Microsoft Entourage on a Mac, or with Microsoft Outlook on a PC, when you connect iPad to your computer. See âSyncing with iTunesâ on page 24.  In Settings on iPad, turn on Calendars in your MobileMe, Google, Yahoo!, or Microsoft Exchange account to sync your calendar information over the air. If your company or organization supports it, you can also set up a CalDAV account. See âAdding Mail, Contacts, and Calendar Accountsâ on page 31. To sync calendars over the air, iPad must be connected to the Internet. 85 Adding, Editing, and Deleting Calendar Events You can create and edit calendar events directly on iPad. If you have a Microsoft Exchange account with calendars enabled, or a supported CalDAV account, you can invite other people to your event or meeting. Add an event: Tap and enter event information, then tap Done. You can enter the following:  Title  Location  Starting and ending times (or turn on All-day, if itâs an all-day event)  Repeat timesânone, or every day, week, two weeks, month, or year  #NGTVVKOG¤HTQO°XGOKPWVGUVQVYQFC[UDGHQTGVJGGXGPV When you set an alert, the option to set a second alert appears. When an alert occurs, iPad displays a message. To set iPad to play a sound, see âAlertsâ on page 90. Important: When you travel, iPad may not alert you at the correct local time. To manually set the correct time, see âDate and Timeâ on page 160. For information CDQWVCFLWUVKPIVJGECNGPFCTVKOG\QPGUGGÂĽViewing Your Calendarsâ on page 86.  Notes If you have more than one calendar, you can select which calendar to add the event to. Read-only calendars donât appear in the list. Edit an event Tap the event, then tap Edit. Delete an event Tap the event, tap Edit, then scroll down and tap Delete Event. Viewing Your Calendars You can view a single calendar, selected calendars, or all calendars at once. This makes it easy to manage work and family calendars at the same time. 8KGYCFKĂGTGPVECNGPFCTTap Calendars, then select the calendars you want to view. 6QXKGY[QWTEQPVCEVU¨DKTVJFC[UCUFG°PGFKP%QPVCEVUUGNGEVVJG$KTVJFC[UECNGPFCT You can view calendar events in a list, or by day, week, or month. The events for all of your selected calendars appear on iPad. Switch views: Tap List, Day, Week, or Month. 86 Chapter 12 Calendar  List view: All your appointments and events appear in a scrollable list, next to the UGNGEVGFFC[6QXKGYCFKĂGTGPVFC[VCR or below the calendar. or select a day from the timeline  Day view: Scroll up or down to see the dayâs events. Tap or to see the previous or next dayâs events, or select a day from the timeline below the calendar.  Week view: Scroll up or down to see the weekâs events. Tap or to see the previous or next week, or select a week from the timeline below the calendar.  Month view: Tap a day to see its events. Tap or to see the previous or next month, or select a month from the timeline below the calendar. See the details of an event: Tap the event. Chapter 12 Calendar 87 See events adjusted for a time zone: In Settings, go to âMail, Contacts, Calendars.â Under Calendars, tap Time Zone Support. Turn on Time Zone Support and select a OCLQTEKV[HQTVJGVKOG\QPG[QWYCPVVQWUG9JGP6KOG Sounds, then turn Calendar Alerts QP+H%CNGPFCT#NGTVUKUQĂYJGPCPGXGPVQEEWTUK2CFFKURNC[UCOGUUCIGDWVOCMGU no sound. Sound alerts for invitations: In Settings, choose âMail, Contacts, Calendar.â Under Calendars, tap New Invitation Alert to turn it on. 90 Chapter 12 Calendar Contacts 13 About Contacts iPad lets you easily access and edit your contact lists from personal, business, and organizational accounts. You can search across all of your groups, and the information in Contacts is automatically accessed to make addressing emails quick and easy. You can add contacts directly on iPad, or sync contacts from applications on your computer. If you have a MobileMe or Microsoft Exchange account with Contacts enabled, or a supported CardDAV account, you can sync your contacts over the air without connecting iPad to your computer. 91 Syncing and Adding Contacts You can add contacts to iPad in these ways:  Enter contacts on iPad  In iTunes, sync contacts from Google or Yahoo!, or sync with applications on your computer (see âSyncing with iTunesâ on page 24)  Set up a MobileMe or Microsoft Exchange account on iPad with Contacts enabled (see âAdding Mail, Contacts, and Calendar Accountsâ on page 31)  +PUVCNNCRTQ°NGVJCVUGVUWRCP'ZEJCPIGCEEQWPVYKVJ%QPVCEVUGPCDNGF UGG âSetting Up Microsoft Exchange Accountsâ on page 172)  Set up an LDAP or CardDAV account on iPad to access business or school directories (see âLDAP and CardDAV Accountsâ on page 173) Searching Contacts ;QWECPUGCTEJ°TUVNCUVCPFEQORCP[PCOGUKP[QWTEQPVCEVUQPK2CF+H[QWJCXGC Microsoft Exchange account on iPad, you may also be able to search your enterprise Global Address List (GAL) for contacts in your organization. If you have an LDAP account on iPad, you can search contacts on your organizationâs LDAP server. If you have a CardDAV account, you can search contacts synced to iPad, or searchable contacts on a supported CardDAV server. When you enter search information, contacts with matching information appear as you type. Search contacts: +P%QPVCEVUVCRVJGUGCTEJ°GNFCVVJGVQRQHVJGUETGGPCPFGPVGTC °TUVNCUVQTEQORCP[PCOG6QUETQNNSWKEMN[VQVJGVQRQHVJGNKUVVCRVJGUVCVWUDCT Search a GAL: 6CR)TQWRUVCRVJG'ZEJCPIGUGTXGTPCOGVJGPGPVGTC°TUVNCUVQT company name. You canât edit GAL contacts or save them to iPad. Search an LDAP server: 6CR)TQWRUVCRVJG.UGTXGTPCOGVJGPGPVGTC°TUVNCUV or company name. You canât edit LDAP contacts or save them to iPad. Search a CardDAV server: Tap Groups, tap the searchable CardDAV group at the bottom of the list, then enter your search. You canât edit searchable CardDAV contacts from the server, but you can edit synced CardDAV contacts on iPad. 92 Chapter 13 Contacts Managing Contacts You can edit your contacts and mark as favorites the ones you use frequently with FaceTime. Add a contact on iPad: Tap Contacts, then tap . Delete a contact In Contacts, choose a contact, then tap Edit. Scroll down, then tap Delete Contact. Add a contact to FaceTime Favorites In Contacts, choose a contact, then tap Favorites. Edit FaceTime Favorites In FaceTime, tap Favorites, then tap Edit. To delete an item, tap . Edit contact information In Contacts, choose a contact, then tap Edit. To add an item, tap . To delete an item, tap . Assign a photo to a contact: 1 Tap Contacts, then choose a contact. 2 Tap Edit and tap Add Photo, or tap the existing photo. 3 Tap an album, then tap a photo. 4 Drag and scale the photo. 5 Tap Choose. Using Contact Information You can use the information on a contactâs Info screen to:  Create an email message in Mail, addressed to the contact  Open the contactâs home page in Safari  Find the location of the contactâs address in Maps, and get directions  Share the contact information with others  Call a contact using FaceTime Use a contactâs info screen: Tap Contacts and choose a contact, then tap an item. Placing a FaceTime call: Tap Contacts and choose a contact, then tap FaceTime and choose an email address or phone number to use for the call. If you donât see the FaceTime button, turn on FaceTime in Settings > FaceTime. Chapter 13 Contacts 93 7PK°GF%QPVCEVU When you sync contacts with multiple accounts, you might have entries for the same person in more than one account. To keep redundant contacts from appearing in the #NN%QPVCEVUNKUV[QWECPNKPMEQPVCEVUVJCVJCXGVJGUCOG°TUVCPFNCUVPCOG DWVPQV CFKĂGTGPVRTG°ZUWĂZQTOKFFNGPCOG CPFFKURNC[VJGOCUCUKPINGWPK°GFEQPVCEV. 9JGP[QWXKGYCWPK°GFEQPVCEVVJGVKVNG7PK°GF+PHQCRRGCTUCVVJGDQVVQOQHVJG EQPVCEV¨UGPVT[7PK°GFEQPVCEVUCRRGCTQPN[YJGP[QWXKGYVJG#NN%QPVCEVUNKUV Link contacts: (KPFVJG°TUVEQPVCEVVJCV[QWYCPVVQNKPMVJGPVCR'FKV6CR select the other contact, then tap Link. and When a contact is linked, tap the silhouette icon to view, add, or delete linked entries. .KPMGFEQPVCEVUCTGP¨VOGTIGF7PNGUU[QWGFKVCWPK°GFEQPVCEVVJGEQPVCEVKPGCEJ UQWTEGCEEQWPVTGOCKPUUGRCTCVG+H[QWEJCPIGKPHQTOCVKQPKPCWPK°GFEQPVCEVVJG changes are copied to each source account that information already exists in. If you CFFKPHQTOCVKQPVQCWPK°GFEQPVCEVVJCVKPHQTOCVKQPKUCFFGFVQVJGEQPVCEVKPGCEJ source account. 94 Chapter 13 Contacts 14 Notes Writing and Reading Notes 9KVJKVUNCTIGFKURNC[CPFQPUETGGPMG[DQCTFK2CFOCMGULQVVKPIPQVGUGCU[ You can view notes in landscape or portrait orientation. In portrait orientation, tap Notes to view a list of your notes. In landscape orientation, the list of notes appears on the left, and the current note is circled in red. 0QVGUCTGNKUVGFD[NCUVOQFK°GFFCVGYKVJVJGOQUVTGEGPVPQVGCVVJGVQR6JGNKUV UJQYUVJG°TUVHGYYQTFUQHGCEJPQVG6CRCPQVGKPVJGNKUVVQXKGYQTGFKVKV Add a note: Tap , type the note, then tap Done. Read a note: Tap the note. Tap or to see the next or previous note. Edit a note: Tap anywhere on the note to bring up the keyboard. Edit the note, then tap Done. Delete a note: Tap the note, then tap . Change the font used to display notes: In Settings, choose Notes and select a font from the list. 95 Searching Notes ;QWECPUGCTEJVJGVGZVQHPQVGUVQ°PFCRCTVKEWNCTPQVG Search for notes: 'PVGTVGZVKPVJGUGCTEJ°GNFVJCVCRRGCTUCVVJGVQRQHVJGPQVGUNKUV (In portrait orientation, tap Notes to display the notes list.) Search results appear automatically as you type. Tap the keyboard button to dismiss the keyboard and see more results. To view a note, tap it in the search results list. Emailing Notes Email a note: Tap the note, then tap . To email a note, iPad must be set up for email. See âSetting Up Email Accountsâ on page 53. Syncing Notes You can set iTunes to automatically sync your notes with some email applications. See âSetting Up Syncingâ on page 24. You can also sync notes over the air, when iPad has an Internet connection. Go to Settings > Notes, then select the default mail account for syncing notes. New notes you create on iPad will be stored in the account you select. To view notes stored in a URGEK°ECEEQWPVQRGP0QVGUCPFVCR#EEQWPVU 96 Chapter 14 Notes Maps 15 About Maps Maps provides classic, satellite, hybrid, and terrain views of locations in many countries. Search for a location, then get detailed driving, public transit, or walking directions, as YGNNCUVTCĂEKPHQTOCVKQP WARNING: For important information about driving and navigating safely, see the Important Product Information Guide at support.apple.com/manuals/ipad. To use Maps, iPad must have an Internet connection. See âConnecting to the Internetâ on page 29. Important: Maps, directions, and location-based apps provided by Apple depend QPFCVCUGTXKEGURTQXKFGFD[VJKTFRCTVKGU6JGUGFCVCUGTXKEGUCTGUWDLGEVVQEJCPIG and may not be available in all geographic areas, resulting in maps, directions, or location-based information that may be unavailable, inaccurate, or incomplete. Compare the information provided on iPad to your surroundings, and defer to posted signs to resolve any discrepancies. To provide your location, data is collected which doesnât identify you personally. If you donât want this data collected, donât use the HGCVWTG0QVWUKPIVJKUHGCVWTGFQGUP¨VCĂGEVVJGPQPÂŁNQECVKQPDCUGFHWPEVKQPCNKV[QH your iPad. +HNQECVKQPUGTXKEGUKUVWTPGFQĂYJGP[QWQRGP/CRU[QWOC[DGCUMGFVQVWTPKV on. You can use Maps without turning on location services. See âLocation Servicesâ on page 153. Finding and Viewing Locations ;QWECPUGCTEJHQTNQECVKQPU°PF[QWTEWTTGPVNQECVKQPFTQRCRKPVQOCTMCNQECVKQP CPFIGVFKĂGTGPVOCRXKGYUKPENWFKPI)QQING5VTGGV8KGYU 97 Searching for Locations You can search for locations in many waysâby address, intersection, area, landmark, bookmark, contact, or zip code. Find a location and see a map: 1 6CRVJGUGCTEJ°GNFVQDTKPIWRVJGMG[DQCTF 2 Type an address or other search information. 3 Tap Search. A pin marks the location. ;HW[VNL[ PUMVYTH[PVUHIV\[ [OLSVJH[PVUNL[ KPYLJ[PVUZHKK[OL SVJH[PVU[V`V\Y IVVRTHYRZVY JVU[HJ[ZSPZ[VY LTHPSHSPUR[V .VVNSL4HWZ A location can include places of interest added by Google My Maps users (âUsercreated contentâ), and sponsored links that appear as special icons (for example, ). Zoom in 2KPEJVJGOCRYKVJVYQ°PIGTU1TFQWDNGVCRVJGRCTV you want to zoom in on. Double-tap again to zoom in even closer. Zoom out 2KPEJ[QWT°PIGTUCRCTVQPVJGOCR1TVCRVJGOCRYKVJ VYQ°PIGTU6CRYKVJVYQ°PIGTUCICKPVQ\QQOQWVHWTVJGT Pan or scroll &TCIWRFQYPNGHVQTTKIJVVQXKGYCFKĂGTGPVRCTVQH the map. See the location of an entry in your Contacts list: Tap choose a contact. at the top of the screen and The contact must include at least one address. If the contact has more than one address, EJQQUGVJGQPGVQNQECVG;QWECPCNUQVCRCPCFFTGUUKP%QPVCEVUVQ°PFCNQECVKQP 98 Chapter 15 Maps Finding Your Current Location #SWKEMVCR°PFU[QWTEWTTGPVNQECVKQP6JGQPUETGGPFKIKVCNEQORCUUUJQYUYJKEJ direction youâre facing. Find your current location: Tap in the status bar at the top of the screen. A blue marker shows your current location. If Maps canât determine your exact location, a blue circle appears around the marker. The size of the circle depends on how precisely your location can be determinedâthe smaller the circle, the greater the precision. If you drag the map, then tap location. again, iPad centers the map back to your current Use the digital compass: Tap a second time. changes to and a small digital compass CRRGCTUQPUETGGP7UGVJGFKIKVCNEQORCUUVQ°PFYJKEJFKTGEVKQP youâre heading. Note: ;QWPGGFVQECNKDTCVGVJGEQORCUUVJG°TUVVKOG[QWWUGKVCPF[QWOC[PGGFVQ calibrate it occasionally after that. Calibrate the compass: When the calibrate U[ODQNCRRGCTUYCXGK2CFKPC°IWTG eight. You may be asked to move away from a source of interference. See which way youâre facing: Hold iPad level to the ground. The compass rotates to point north. Return to map view: Tap to go back to the map view. iPad uses Location Services to determine your location. Location Services uses available information from local Wi-Fi networks if you have Wi-Fi turned on. This feature isnât available in all areas. ;QWTEWTTGPVNQECVKQPECP¨VDGHQWPFKH.QECVKQP5GTXKEGUKUVWTPGFQĂUQ[QWOC[DG prompted to turn it on. See âLocation Servicesâ on page 153. 9JGP[QW¨TGPQVWUKPI.QECVKQP5GTXKEGU[QWECPVWTPKVQĂVQEQPUGTXGDCVVGT[RQYGT In Settings, choose General > Location Services. Get information about your current location: Tap the blue marker, then tap . iPad displays the address of your current location, if available. You can use this information to:  Get directions to or from this location  Add the location to contacts  Send the address in email  Bookmark the location  See a street view (when available) Chapter 15 Maps 99 Marking a Location with a Drop Pin A drop pin lets you mark a location by hand. Drop a pin: Touch and hold any location on the map. Or, you can drag or tap the lower-right corner of the screen, then tap Drop Pin. A pin drops on the map. Touch and hold the pin, then drag it to any location you choose. Bookmarking Locations ;QWECPDQQMOCTMCP[NQECVKQPVJCV[QWYCPVVQ°PFNCVGT Bookmark a location: Find a location, tap the pin, tap description, then tap âAdd to Bookmarks.â See a bookmarked or recently viewed location: Tap tap Bookmarks or Recents. Clear the list of recents: Tap Clear. Rearrange or delete a bookmark: Tap Edit. 100 Chapter 15 Maps next to the name or at the top of the screen, then Map Views You can choose classic, satellite, hybrid, or terrain view. You can also see a location in street view, when available. Change the view: Tap or drag the bottom-right corner of the screen, then tap Classic, Satellite, Hybrid, or Terrain. See a street view: Tap a drop pin, then tap ;QWECPÂąKEMWRQTFQYPQTNGHVQT right, to pan through the 360° panoramic view. The inset in the lower-right corner shows your current view. Tap an arrow to move down the street. Street view isnât available in all areas. To return to map view, tap the inset. ;HW[VYL[\YU[VTHW]PL^ Chapter 15 Maps 101 Getting Directions You can get step-by-step driving, public transit, or walking directions. Get directions: 1 Tap Directions. 2 6CRVJG°GNFUCVVJGVQRQHVJGUETGGPVQGPVGT[QWTUVCTVKPICPFGPFKPINQECVKQPU Normally, iPad starts with your current location (if available). If an address is in your contacts list, tap To Here or Directions From Here. Tap , choose the contact, and tap Directions to reverse the directions. 3 Select directions for driving ( ), public transit ( ), or walking ( ) at the bottom of the screen. The available travel options depend on the route. 4 Do one of the following:  To view directions one step at a time, tap Start, and then tap the trip. Tap to see the next leg of to go back.  To view the directions in a list, tap Start, and then tap . Tap any item in the list to see a map showing that leg of the trip. Tap Route Overview to return to the overview screen. ;QWECPCNUQIGVFKTGEVKQPUD[°PFKPICNQECVKQPQPVJGOCRVCRRKPIVJGRKPVJCV points to it, tapping , then tapping Directions To Here or Directions From Here. Get reverse directions: Tap to switch the start and end points. See recently viewed directions: Tap See driving or walking directions: Tap KPVJGUGCTEJ°GNFVJGPVCR4GEGPVU or . If youâre driving or walking, the approximate distance and travel time appear onscreen. +HVTCĂEFCVCKUCXCKNCDNGVJGFTKXKPIVKOGCFLWUVUCEEQTFKPIN[ See public transit directions: Tap .  Tap to set your departure or arrival time, and to choose a schedule for the trip.  Tap Start, then tap to see the Route Overview screen. From there, you see the estimated arrival time, total fare, information about each leg of the trip, and the mode of transportationâincluding where you need to walk. 102 Chapter 15 Maps 5JQYKPI6TCĂE%QPFKVKQPU 9JGPCXCKNCDNG[QWECPUJQYVTCĂEEQPFKVKQPUHQTOCLQTUVTGGVUCPFJKIJYC[UQP the map. 5JQYQTJKFGVTCĂEEQPFKVKQPUTap or drag the bottom-right corner of the screen, VJGPVWTP6TCĂEQPQTQĂ .YLLU$WVZ[LK ZWLLKSPTP[ @LSSV^$ZSV^LY [OHU[OLWVZ[LK ZWLLKSPTP[ 9LK$Z[VWHUKNV 5VTGGVUCPFJKIJYC[UCTGEQNQTEQFGFCEEQTFKPIVQVJGÂąQYQHVTCĂE+HCUVTGGVQT JKIJYC[KUITC[VTCĂEFCVCKUP¨VCXCKNCDNG +H[QWFQP¨VUGGVTCĂEEQPFKVKQPU\QQOQWVVQUGGOCLQTTQCFU6TCĂEEQPFKVKQPUCTG not available in all areas. Finding and Contacting Businesses Find businesses in an area: 1 Find a locationâfor example, a city or a street addressâor scroll to a location on the map. 2 6[RGVJGMKPFQHDWUKPGUUKPVJG5GCTEJ°GNFCPFVCR5GCTEJQPVJGMG[DQCTF Pins appear for matching locations in the area. For example, if you locate your city and then type âmoviesâ and tap Search, pins mark movie theaters in your city. Tap the pin that marks a business to see its name or description. (KPFDWUKPGUUGUYKVJQWV°TUV°PFKPIVJGNQECVKQPType things like:  restaurants san francisco ca  apple inc new york Chapter 15 Maps 103 Contact a business or get directions: Tap the pin that marks a business, then tap next to the name. From there, you can do the following:  6CR&KTGEVKQPU6Q*GTGQT&KTGEVKQPU(TQO*GTGVQ°PFFKTGEVKQPU  Tap Home Page to visit the website, or Email to send an email.  Tap âAdd to Contacts,â and then tap âCreate New Contactâ or âAdd to Existing Contact.â  Share the location of the business by email.  Tap to see a street view. See a list of businesses found in the search: Tap KPVJGUGCTEJ°GNF Choose a business from the Results list to see its location. Tap the pin that marks a business, then tap next to the business to see its information. Sharing Location Information You can add a location to your contacts. You can also send links to a map location in email. Add a location to your contacts list: Find a location, tap the pin that points to it, tap next to the name or description, tap âAdd to Contacts,â and then tap âCreate New Contactâ or âAdd to Existing Contact.â Email a link to a map location: Find a location, tap the pin that points to it, tap and then tap Share Location. 104 Chapter 15 Maps iPod 16 Adding Music and More to iPad Browse your music collection by song, artist, album, genre, or composer. Listen to your songs, audiobooks, and podcasts. Create and manage playlists, or use Genius to create playlists for you. Stream your music, podcasts, or audiobooks wirelessly to an Apple TV using AirPlay. There are two ways to get music and other content onto iPad:  Transfer content by syncing it from iTunes on your computer. You can sync all of [QWTOWUKEQT[QWECPUGNGEVURGEK°EUQPIURQFECUVUCPFK6WPGU7EQNNGEVKQPU5GG âSyncing with iTunesâ on page 24.  Use the iTunes Store on iPad to purchase and download songs, albums, TV shows, movies, music videos, and audiobooks. You can also stream and download audio and video podcasts, as well as iTunes U content. After listening to a podcast or watching a TV show, you can tap a link to get more episodes from the iTunes Store. See Chapter 17, âiTunes Store,â on page 113. Playing Music and Other Audio Listen to audio using the built-in speaker. You can also attach wired headphones to the headphones port, or pair wireless Bluetooth headphones. Sound doesnât come out of the speaker when you attach or pair headphones. WARNING: For important information about avoiding hearing loss, see the iPad Important Product Information Guide at support.apple.com/manuals/ipad. Playing Songs Browse your collection: Tap Music, Podcasts, Audiobooks, iTunes U, or Purchased. At the bottom of the screen, tap Songs, Artists, Albums, Genres, or Composers to browse. 105 Browse Genius playlists or Genius Mixes: Tap Genius or Genius Mixes. If Genius doesnât appear, you may need to turn on Genius in iTunes, then sync iPad. See âMaking Genius Playlistsâ on page 110. Play a song: Tap the song. Controlling Song Playback When you play a song, the Now Playing screen appears. Pause a song Tap . Resume playback Tap . Raise or lower the volume Drag the onscreen volume slider or use the iPad volume buttons. Restart a song or a chapter in an audiobook or podcast Tap Skip to the next song or chapter in an audiobook or podcast Tap Go to the previous song or chapter in an audiobook or podcast Tap Rewind or fast-forward Touch and hold or âthe longer you hold the control, the faster the song rewinds or fast-forwards. View album art full-size Tap the album cover when playing a song. twice. You can display playback controls when youâre listening to music and using another appâor even when iPad is locked. 106 Chapter 16 iPod Display audio playback controls from another app or from the Lock screen: Doubleclick the Home DWVVQPVJGPÂąKEMHTQONGHVVQTKIJVCNQPIVJGDQVVQOQHVJGUETGGP After using the controls, tap iPod to go your iPod library or click the Home return to the app you were using. button to If iPad is locked, the controls appear at the top of the screen and then disappear after [QW°PKUJWUKPIVJGO Additional Song Controls From the Now Playing screen, tap the album cover to see the controls. The repeat CPFUJWĂG controls appear along with the scrubber bar. You can see elapsed time, remaining time, and the song number. Drag the playhead along the scrubber bar to skip to any point in the song. You can CFLWUVVJGUETWDTCVGHTQOJKIJURGGFVQ°PGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCI the playhead along the scrubber bar. The scrub rate becomes slower the farther down [QWUNKFG[QWT°PIGT 9LWLH[ 7SH`OLHK :JY\IILYIHY :O\MMSL Set iPad to repeat songs Tap . Tap again to set iPad to repeat only the current song. = iPad is set to repeat all songs in the current album or list. = iPad is set to repeat the current song over and over. = iPad isnât set to repeat songs. Skip to any point in a song Drag the playhead along the scrubber bar. Slide your °PIGTFQYPVQCFLWUVVJGUETWDTCVG6JGUETWDTCVG DGEQOGUUNQYGTVJGHCTVJGTFQYP[QWUNKFG[QWT°PIGT 5GVK2CFVQUJWĂGUQPIU Tap VQUJWĂGUQPIU6CR again to set iPad to play songs in order. K2CFKUUGVVQUJWĂGUQPIU = iPad is set to play songs in order. Chapter 16 iPod 107 5JWĂGVJGVTCEMUKPCP[RNC[NKUV album, or other list of songs From the Now Playing screen, tap the album art to show the song controls onscreen. Tap at the bottom of the UETGGPVJGPVCR5JWĂG at the top of the list of songs. 9JGVJGTQTPQVK2CFKUUGVVQUJWĂGKH[QWVCR5JWĂGCV the top of a list of songs, iPad plays the songs from that list in random order. Play music on an AirPlay sound system or Apple TV Tap and choose a sound system. If doesnât appear or if you donât see the AirPlay system youâre looking for, make sure itâs on the same wireless network. Switch from AirPlay back to iPad Tap and choose iPad from the list. Podcast and Audiobook Controls From the Now Playing screen, tap the podcast or audiobook cover to see the controls. The email control and playback speed control appear along with the scrubber bar. You can see elapsed time, remaining time, and the episode or chapter number. The scrubber bar lets you skip to any point in the podcast or audiobook. ,THPS 7SH`OLHK 7SH`IHJR ZWLLK Send an email link to this podcast: Tap Skip to any point: &TCIVJGRNC[JGCFCNQPIVJGUETWDDGTDCT#FLWUVVJGUETWDTCVG HTQOJKIJURGGFVQ°PGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCFCNQPI VJGUETWDDGTDCT6JGUETWDTCVGDGEQOGUUNQYGTVJGHCTVJGTFQYP[QWUNKFG[QWT°PIGT Change the playback speed: Tap  = Play at normal speed  = Play at double speed  = Play at half speed ZLJVUK YLWLH[ to change the speed. ;YHJRSPZ[ The 30-second repeat control and track list control appear at the bottom of the screen. Play back the last 30 seconds: Tap 108 Chapter 16 iPod See other podcasts in a series or chapters in an audiobook: Tap audiobook thumbnail to return to the Now Playing screen. . Tap the podcast or Viewing All Tracks on an Album See all the tracks on the album that contains the current song: On the Now Playing screen, tap . Tap a track to play it. Tap the album thumbnail to return to the Now Playing screen. In track list view, you can assign ratings to songs. You can use ratings to create smart playlists in iTunes that dynamically update to include, for example, your highest rated songs. Rate a song: &TCI[QWTVJWODCETQUUVJGTCVKPIDCT VJG°XGFQVUWPFGTVJGRNC[JGCF VQIKXGVJGUQPI\GTQVQ°XGUVCTU Searching Music You can search the titles, artists, albums, and composers of songs, podcasts, and other content youâve synced to iPad. Search music, podcasts, audiobooks, or other content in your library: Enter text in the UGCTEJ°GNFCVVJGVQRQHCUQPINKUVRNC[NKUVCTVKUVNKUVQTQVJGTXKGYQH[QWTK2QFEQPVGPV 6CRVJGUVCVWUDCTVQUETQNNSWKEMN[VQVJGVQRQHCNKUVCPFTGXGCNVJGUGCTEJ°GNF Search results appear automatically as you type. Tap Search to dismiss the keyboard and see more of the results. You can also use Spotlight to search for music. See âSpotlight Searchâ on page 157. Using Playlists A playlist is a custom compilation of songs. You might want to create a playlist for a URGEK°EOQQFQTQEECUKQPQTQTICPK\G[QWTOWUKENKDTCT[;QWECPWUGVJTGGMKPFUQH playlists on iPadâstandard playlists, Genius playlists, and Genius Mixes. Creating Playlists You can make playlists from the music, podcasts, or audiobooks in your iPod library. Make a standard playlist: 1 Tap iPod, then tap at the bottom of the screen. 2 Enter a name for the playlist, then tap Save. 3 Tap PGZVVQ[QWTUGNGEVKQPUVJGPVCR&QPGYJGP[QW°PKUJUGNGEVKPI;QWECPCNUQ tap Sources to browse for selections. 4 9JGP[QW°PKUJVCR&QPG Chapter 16 iPod 109 You can also make playlists from other categories in your iPod library, such as podcasts or audiobooks. When you make a playlist on iPad, the playlist is also saved in the iTunes library on your computer the next time you sync. Edit a playlist: Tap the playlist, tap Edit, then do one of the following:  To move a selection higher or lower in the list, drag next to the selection.  To delete a selection, tap next to the selection, then tap Delete. Deleting a song from a playlist doesnât delete it from iPad.  To add more songs, tap Add Songs, tap next to the selection, then tap Done. Clear a playlist: Tap the playlist, tap Edit, then tap Making Genius Playlists )GPKWU°PFUUQPIUKP[QWTK6WPGUNKDTCT[VJCVIQITGCVVQIGVJGT#)GPKWURNC[NKUVKUC collection of songs that are picked for you to go with a song you choose from your library. You can create Genius playlists in iTunes and sync them to iPad. You can also create and save Genius playlists on iPad. 6QWUG)GPKWUQPK2CF°TUVVWTPQP)GPKWUKPK6WPGUVJGPU[PEK2CFYKVJK6WPGU Genius is a free service, but requires an Apple ID. 110 Chapter 16 iPod Make a Genius playlist on iPad: 1 Tap , then tap New. 2 Tap a song in the list. Genius creates a playlist of similar songs. You can also make a Genius playlist of songs that go great with the song youâre playing. From the Now Playing screen, tap the album cover to display additional controls, then tap . Save a Genius playlist: In the playlist, tap Save. The playlist is saved in Genius with the title of the song you picked. You can make and save as many Genius playlists as you want. If you save a Genius playlist created on iPad, it syncs back to iTunes the next time you connect. Refresh a Genius playlist: In the playlist, tap Refresh. 4GHTGUJKPIC)GPKWURNC[NKUVETGCVGUC)GPKWURNC[NKUVQHFKĂGTGPVUQPIUVJCVIQITGCV with the song you picked. You can refresh any Genius playlist, whether it was created in iTunes and synced to iPad, or created on iPad. Create a Genius playlist from a new song: In the playlist, tap New, then pick a new song. Delete a saved Genius playlist: Tap the Genius playlist, then tap Delete. Once a Genius playlist is synced back to iTunes, you wonât be able to delete it directly from iPad. You can use iTunes to edit the playlist name, stop syncing, or delete the playlist. Playing Genius Mixes )GPKWUCWVQOCVKECNN[UGCTEJGU[QWTK2CFNKDTCT[CPF°PFUUQPIUHTQO[QWTNKDTCT[KP that genre or format. Genius Mixes are recreated each time you listen to them, so theyâre always new and fresh. )GPKWU/KZGUETGCVGUFKĂGTGPVOKZGUFGRGPFKPIQPVJGXCTKGV[QHOWUKE[QWJCXGKP your iPad library. For example, you may have Genius Mixes that highlight Classical, Jazz, or Alternative Rock songs. Browse Genius Mixes: On the left side of the iPod window (below Genius), tap Genius Mixes. Play a Genius Mix: Tap the mix. Chapter 16 iPod 111 Home Sharing Home Sharing lets you play music, movies, and TV shows on iPad from the iTunes library on your Mac or PC. Note: Booklets, albums, LPs, and other bonus content canât be shared. iPad and your computer must be on the same Wi-Fi network. iTunes on your computer must be open, with Home Sharing turned on and logged in to the same Apple account as Home Sharing on iPad. Turn on Home Sharing in iTunes: On your computer, open iTunes and choose Advanced > Turn On Home Sharing. Enter your Apple ID and password, then click Create Home Share. Play music or video on iPad from your iTunes library: 1 In Settings, choose iPod then, under Home Sharing, enter the same Apple ID and password you used when turning on Home Sharing in iTunes. 2 In iPod, tap More, then tap Shared and choose your iTunes library. The Playlists, Artists, Songs, and other tabs in iPod now show the content of your iTunes library, instead of your iPad content. Return to the content on your iPad: In iPod, tap More, then tap Shared and choose iPad at the top of the list. Transferring Content You can transfer purchases you make on iPad to a computer thatâs authorized to play content from your Apple ID. To authorize the computer, open iTunes on the computer and choose Store > Authorize This Computer. Transfer purchased content: Connect iPad to your computer. iTunes asks if you want to transfer purchased content. 112 Chapter 16 iPod iTunes Store 17 About the iTunes Store Use the iTunes Store to add content to your iPad. You can browse and purchase music and TV shows, buy and rent movies, or download and play podcasts or iTunes U collections. /CP[OQXKGUCPF68UJQYUCTGCXCKNCDNGKPDQVJUVCPFCTFCPFJKIJFG°PKVKQP6Q access the iTunes Store, iPad must have an Internet connection. See âConnecting to the Internetâ on page 29. Note: The iTunes Store is not available in all regions, and iTunes Store content may vary across regions. Transferring Content You can transfer purchases you make on iPad to a computer authorized to play content from your Apple ID. Authorize a computer: Open iTunes on the computer, then choose Store > Authorize Computer. Transfer purchased content: %QPPGEVK2CFVQ[QWTEQORWVGTK6WPGUXGTK°GUVJCV you want to transfer purchased content. 113 Finding Music, Videos, and More Browse content: At the top of the screen, browse by Genres, Featured, Top Charts, or Genius. At the bottom of the screen, tap Music, Movies, TV Shows, Podcasts, Audiobooks, iTunes U, or Downloads. Search for content: 6CRVJGUGCTEJ°GNFCVVJGVQRQHVJGUETGGPVJGPWUGVJG onscreen keyboard to enter one or more words. Tap Search on the keyboard. Search results are grouped by category, such as Movies, Albums, or Podcasts. Tap an item to see more information. You can read reviews, write your own review, or email a link about the item to a friend. Depending on the item, you can also buy, download, or rent it. Following Artists and Friends Use iTunes Ping to connect with the worldâs music fans. Follow favorite artists to learn about new releases and upcoming concerts and tours, get an insiderâs perspective VJTQWIJVJGKTRJQVQUCPFXKFGQUCPFNGCTPCDQWVVJGKTOWUKECNKPÂąWGPEGU4GCF friendsâ comments about the music theyâre listening to, and see what theyâre buying and which concerts they plan to attend. Express your musical likes and post comments for your own followers. 6QETGCVGCPFGZRNQTGOWUKECNEQPPGEVKQPU[QWPGGFVQETGCVGCRTQ°NG %TGCVG[QWTK6WPGU2KPIRTQ°NGOpen the iTunes application on your Mac or PC, click Ping, and follow the onscreen instructions. 114 Chapter 17 iTunes Store Explore iTunes Ping on your iPad: 1RGPVJGK6WPGUCRRVCR2KPI VCR/QTG°TUV if Ping isnât visible), and then:  Tap Activity to see the latest from the people you follow. Updates include purchases, reviews, likes, comments, and posts.  Tap People to see who youâre following and whoâs following you, and to search for artists or friends.  6CR/[2TQ°NGVQTGXKGY[QWTRTQ°NGKPHQTOCVKQP Follow an artist: 6CR(QNNQYQPVJGCTVKUV¨URTQ°NGRCIG  By searching: 6CR2GQRNGGPVGTVJGCTVKUV¨UPCOGKPVJGUGCTEJ°GNFCVVJGVQRQHVJG page, then tap Search. Tap the artistâs name in the list of results, then tap Follow.  While browsing: 6CR2TQ°NGCVVJGDQVVQOQHCP[CNDWORCIGVJGPVCR(QNNQY Follow a friend: %JQQUG[QWTUVCTVKPIITQWRQHHTKGPFUYJGP[QWUGVWR[QWTRTQ°NG using iTunes on your Mac or PC. After that, you can follow friends using Ping on iPad.  By searching: 6CR2GQRNGGPVGT[QWTHTKGPF¨UPCOGKPVJGUGCTEJ°GNFVJGPVCR Search. Tap your friendâs name in the list of matches, then tap Follow.  While exploring Ping: Tap a personâs name, then tap Follow. 9JGP[QWHQNNQYUQOGQPGVJG[FQP¨VCWVQOCVKECNN[HQNNQY[QW+P[QWTRTQ°NG[QWECP choose to approve or decline follow requests as they arrive, or simply accept all new followers without review. Share your thoughts: As you browse albums and songs, tap Post to comment on a RKGEGQHOWUKEQTVCR.KMGLWUVVQUC[[QWNKMGKV;QWTHTKGPFUYKNNUGG[QWTVJQWIJVUKP their iTunes Ping Activity feed. Share concert plans: 6CR%QPEGTVUQP[QWTRTQ°NGRCIGVQUGGWREQOKPI performances by the artists you follow, and to see which of your friends are going to a show. Tap Tickets to buy your own ticket, or tap Iâm Going to let others know youâll be there too. (Not available in all countries or regions.) Purchasing Music or Audiobooks 9JGP[QW°PFCUQPICNDWOQTCWFKQDQQM[QWNKMGKPVJGK6WPGU5VQTG[QWECP purchase and download it to iPad. You can also preview it to make sure itâs what you want. To make purchases or write reviews, you need an Apple ID. iPad gets your account settings from iTunes when you sync. If you donât have an Apple ID, or if you want to OCMGRWTEJCUGUHTQOCFKĂGTGPV#RRNG+&IQVQ5GVVKPIU 5VQTG You donât need an Apple ID to play or download podcasts or iTunes U classes. Preview a song: Tap the number in the column, then tap . Preview an audiobook: Tap the item. Chapter 17 iTunes Store 115 Purchase and download a song, album, or audiobook: 1 Tap the price and tap Buy. 2 Sign in using your Apple ID if requested, then tap OK. If you donât have an Apple ID, tap Create New Apple ID to set one up. Purchases are charged to your Apple ID. If you make additional purchases within °HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP An alert appears if you previously purchased one or more songs from an album. Tap Buy if you want to purchase the entire album including the songs you already purchased, or tap Cancel if you want to purchase any remaining songs individually. Once you purchase an item, it begins downloading. See âChecking Download Statusâ on page 117. Purchased songs are added to the Purchased playlist on iPad (iPod > Purchased). If you delete the Purchased playlist, iTunes creates a new one when you buy an item from the iTunes Store. ;QWECPWUGK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ make purchases. When you sign in to your account, your remaining store credit appears with your account information at the bottom of most iTunes Store screens. Enter a redemption code: Tap Music, scroll to the bottom of the screen, tap Redeem, and follow the onscreen instructions. Purchasing or Renting Videos 9JGP[QW°PFCOQXKG68UJQYQTOWUKEXKFGQ[QWNKMGKPVJGK6WPGU5VQTG[QWECP purchase and download it to iPad. You can purchase movies and TV shows in standard R QTJKIJFG°PKVKQP R HQTOCV+H[QWRWTEJCUGCJKIJFG°PKVKQPXGTUKQP[QW CNUQTGEGKXGVJGUVCPFCTFFG°PKVKQPXGTUKQP Preview a video: Tap Preview. Purchase or rent a video: 1 Tap Buy or Rent. 2 Sign in using your Apple ID if requested, then tap OK. If you donât have an Apple ID, tap Create New Apple ID to set one up. Your purchase is charged to your Apple ID. For additional purchases made within the PGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP Once you purchase an item it begins downloading. Rented movies wonât begin playing until the download completes. See âChecking Download Statusâ on page 117. Purchased videos are added to the Purchased playlist on iPad (iPod > Purchased). If you delete the Purchased playlist, iTunes creates a new one the next time you buy an item from the iTunes Store. Purchased videos also appear in the Video app. 116 Chapter 17 iTunes Store ;QWECPWUGK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQOCMG purchases. When youâre signed in using your Apple ID, your remaining store credit appears with your account information at the bottom of most iTunes Store screens. Enter a redemption code: Tap Music, then tap Redeem at the bottom of the screen and follow the onscreen instructions. Listening to or Watching Podcasts You can listen to audio podcasts or watch video podcasts on iPad. You can also download podcasts to iPad, and sync them to the iTunes library on your computer when you connect. Tap Podcasts at the bottom of the iTunes Store screen. Browse by Featured or Top Charts. To see a list of episodes, tap a podcast. The icon indicates video podcasts. Listen to a podcast: Tap the podcast title. Download a podcast: Tap the Free button, then tap Get Episode. Downloaded podcasts appear in the Podcasts list in iPod. Listen to or watch a podcast you downloaded: In iPod, tap Podcasts, then tap the podcast. Video podcasts also appear in the Video app. Get more episodes of the podcast you downloaded: In the Podcasts list in iPod, tap the podcast, then tap Get More Episodes. Delete a podcast: In the Podcasts list in iPod, swipe left or right on the podcast, then tap Delete. Checking Download Status You can check the Downloads screen to see the status of in-progress and scheduled downloads, including purchases youâve pre-ordered. See the status of items being downloaded: Tap Downloads. To pause a download, tap . If a download is paused or interrupted, iPad starts the download again the next time it connects to the Internet. Or, if you open iTunes on your computer, iTunes completes the download to your iTunes library (if your computer has an Internet connection and is signed in using the same Apple ID). See the status of pre-ordered items: Tap Downloads. Pre-ordered items appear in a list until the date the item is released. Tap the item for release date information. Once the item is available for download, a download icon appears next to the download. Download a pre-ordered item: Tap the item, then tap Chapter 17 iTunes Store 117 Pre-ordered items arenât downloaded automatically when theyâre released. Return to the Downloads screen to begin the download. Some albums include bonus content, which is downloaded to your iTunes library on your computer. Not all bonus content is downloaded directly to iPad. Download bonus content: Sign in using your Apple ID. In iTunes, choose Store > âCheck for Available Downloads,â then click Check. Syncing Content iTunes automatically syncs everything you download or purchase on iPad to your iTunes library when you connect iPad to your computer. This lets you access the downloads on your computer and provides a backup if you delete purchased content from iPad. Purchased content is synced to the âPurchased on â playlist. iTunes creates the playlist if it doesnât exist. iTunes also syncs your purchases to the Purchased playlist that iTunes uses for purchases you make on your computer, if that playlist exists and is set to sync with iPad. Podcasts you download sync to the Podcast list in your iTunes library. Viewing Apple ID Information To view iTunes Store information for your Apple ID on iPad, scroll to the bottom of the screen and tap Sign In. If youâre already signed in, tap Account. Or, go to Settings > Store and tap View Apple ID. You must be signed in to view your account information. Verifying Purchases You can use iTunes on your computer to verify that all the music, videos, apps, and other items you bought from the iTunes Store or App Store are in your iTunes library. You might want to do this if a download was interrupted. Verify your purchases: 1 Make sure your computer has an Internet connection. 2 In iTunes, choose Store > Check for Available Downloads. 3 Enter your Apple ID and password, then click Check. Purchases not yet on your computer are downloaded. The Purchased playlist displays your purchases. However, because you can add or remove items in this list, it might not be accurate. To see all of your purchases, sign in to your account, choose Store > View My Account, then click Purchase History. 118 Chapter 17 iTunes Store App Store 18 About the App Store Use the App Store to add apps to iPad. Browse, purchase, and download apps URGEK°ECNN[FGUKIPGFHQTK2CFQTHQTK2JQPGCPFK2QFVQWEJ Apps you download from the App Store and install on iPad are backed up to your iTunes library the next time you sync. When you sync, you can also install apps on iPad that you purchase through iTunes on your computer. iPad works with most iPhone and iPod touch apps, so if you already have apps for your iPhone or iPod touch, you can sync them to iPad from your Mac or PC. Use them at their original size, or tap in the lower-right corner of the screen to expand them. Note: The App Store and some apps are not available in all areas. App availability and RTKEKPICTGUWDLGEVVQEJCPIG To use the App Store, iPad must have an Internet connection. See âConnecting to the Internetâ on page 29. You also need an Apple ID (not available in some countries) to download apps. iPad gets your Apple ID settings from iTunes. If you donât have an #RRNG+&QTKH[QWYCPVVQOCMGRWTEJCUGUWUKPICFKĂGTGPV#RRNG+&IQVQ5GVVKPIU Store. See âStoreâ on page 170. 119 Browsing and Searching Browse Featured to see new, notable, or recommended apps, or browse Top Charts to UGGVJGOQUVRQRWNCTCRRNKECVKQPU+H[QW¨TGNQQMKPIHQTCURGEK°ECRRWUG5GCTEJ Browse apps: Tap Featured, Top Charts, or Categories at the bottom of the screen. Browse using Genius: Tap Genius to see a list of recommended apps, based on whatâs already in your app collection. To turn Genius on, follow the onscreen instructions. Genius is a free service, but it requires an Apple ID. Search for apps: 6CRVJGUGCTEJ°GNFCVVJGVQRQHVJGUETGGPCPFGPVGTQPGQTOQTG words. Choose from the list of suggestions, or tap Search on the keyboard. Getting More Information Tap any app in a list to see the Info screen, which shows the appâs price, screenshots, and ratings. Email a link to the appâs Info page: Tap âTell a Friendâ at the top of the screen. Report a problem: Tap âReport a Problemâ at the top of the Info screen. Select a problem from the list or type your comments, then tap Report. View screenshots: 5ETQNNFQYPVQVJGUETGGPUJQVUVJGPÂąKEMNGHVQTTKIJVVQUGG additional screenshots. Get ratings and read reviews: Scroll down to âCustomer Ratings and Reviews.â 120 Chapter 18 App Store Buying Apps 9JGP[QW°PFCPCRR[QWYCPVKPVJG#RR5VQTG[QWECPRWTEJCUGCPFFQYPNQCFKV to iPad. If the app is free, you can download it without charge. Once you download an app, itâs immediately installed on iPad. Purchase and download an app: 1 Tap the price, then tap Buy App (or tap Free, then tap Install App). 2 Sign in using your Apple ID if requested, then tap OK. If you donât have an Apple ID, tap Create New Apple ID to set one up. Purchases are charged to your Apple ID. If you make additional purchases within °HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP ;QWECPWUGK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ make purchases. When you sign in using your Apple ID, your remaining store credit appears with your account information at the bottom of most App Store screens. Enter a redemption code: Tap Featured or Top Charts, scroll to the bottom of the screen, tap Redeem, then follow the onscreen instructions. See the status of app downloads: After you begin downloading an app, its icon appears on the Home screen with a progress indicator. If a download is interrupted, iPad starts the download again the next time it connects to the Internet. Or, if you open iTunes on your computer, iTunes completes the download to your iTunes library (if your computer is connected to the Internet and signed in using the same Apple ID). Using Apps Apps designed for iPad work in any orientationâportrait or landscape. When you use CPCRRKPNCPFUECRGQTKGPVCVKQPKV°NNUVJGUETGGP On iPad, you can use apps designed for iPhone or iPod touch at their original size, or expand them. Expand an app: Tap in the lower-right corner. Return an app to its original size: Tap in the lower-right corner. Some apps let you make purchases within the app. You can restrict in-app purchases in Settings. See âRestrictionsâ on page 158. Chapter 18 App Store 121 5QOGCRRUWUGRWUJPQVK°ECVKQPUVQCNGTV[QWQHPGYKPHQTOCVKQPGXGPYJGPVJG CRRKUP¨VTWPPKPI0QVK°ECVKQPUXCT[D[CRRDWVOC[KPENWFGVGZVQTUQWPFCNGTVUQTC number on the app icon on the Home screen. Updating Apps The App Store checks for updates to apps you install. The App Store icon shows the total number of app updates available. If an update is available when you access the App Store, the Updates screen appears immediately. App updates are downloaded and installed when you choose to update them. Note: App upgrades are new releases, which you can purchase or download. Update an app: 1 At the bottom of the screen, tap Updates. 2 Tap an app to see more information about the update. 3 Tap Update. Update all apps: At the bottom of the screen, tap Updates, then tap Update All. +H[QWVT[VQWRFCVGCPCRRRWTEJCUGFYKVJCFKĂGTGPV#RRNG+&[QW¨TGRTQORVGFHQT that Apple ID and password. Writing Reviews You can write and submit app reviews on iPad. Write a review: 1 On the Info screen, scroll down to âCustomer Ratings and Reviews.â 2 Tap âWrite a Review.â 3 5GVVJGTCVKPI ÂŁUVCTU GPVGTCVKVNGHQTVJGTGXKGYCPFCFFQRVKQPCNTGXKGY comments. 4 Tap Submit. Before submitting a review, you must be signed in with your Apple ID and have purchased or downloaded the app. 122 Chapter 18 App Store Deleting Apps You can delete iPad apps that youâve installed from the App Store. You canât delete built-in iPad apps. When you sync, iTunes automatically backs up any apps you download to iPad. If you delete an app on iPad, you can reinstall it if it was previously synced. Important: If you delete an app, the documents associated with the app are deleted from iPad, unless you reinstall the app and restore its data from a backup using iTunes. Delete an App Store app: 1 6QWEJCPFJQNFCP[CRRKEQPQPVJG*QOGUETGGPWPVKNVJGKEQPUUVCTVVQLKIING 2 Tap in the corner of the app you want to delete. 3 Tap Delete. Press the Home button to cancel. When you delete an app, its data is no longer accessible, but it isnât erased from iPad. For information about erasing all content and settings, see âResetting iPadâ on page 162. Syncing Purchases When you connect iPad to your computer, iTunes automatically syncs apps you download or purchase on iPad to your iTunes library. This lets you access the downloaded apps on your computer and provides a backup if you delete apps from iPad. Downloaded apps are backed up the next time you sync with iTunes. Afterwards, only app data is backed up when you sync with iTunes. Apps are synced to the Apps list in your iTunes library. Chapter 18 App Store 123 iBooks 19 About iBooks iBooks is a great way to read and buy books. Download the free iBooks app from the App Store, and then get everything from classics to best sellers from the built-in iBookstore. Once you download a book, itâs displayed on your bookshelf. Add ePub books and PDFs to your bookshelf using iTunes. Then tap a book to start TGCFKPIK$QQMUTGOGODGTU[QWTNQECVKQPUQ[QWECPGCUKN[TGVWTPVQYJGTG[QWNGHVQĂ A wide range of display options makes the books easy to read. iBooks and the iBookstore arenât available in all languages and locations. (]HPSHISLVU[OLP)VVRZ[VYL;P[SLH]HPSHIPSP[`PZZ\IQLJ[[VJOHUNL 124 To download the iBooks app and use the iBookstore, you need an Internet connection and an Apple account. If you donât have an Apple account, or if you want to make RWTEJCUGUWUKPICFKĂGTGPV#RRNG+&IQVQ5GVVKPIU 5VQTG Syncing Books and PDFs You can download or purchase from the iBookstore. You can also add DRM-free ePub DQQMUCPF2&(UVQ[QWTK6WPGUNKDTCT[6JGTGCTGUGXGTCNYGDUKVGUVJCVQĂGTDQQMUKP ePub and PDF format. Use iTunes to sync your books and PDFs between iPad and your computer. When iPad is connected to your computer, the Books pane lets you select which items to sync. Sync an ePub book or PDF to iPad: Download the book or PDF using your computer. 6JGPKPK6WPGUEJQQUG(KNG #FFVQ.KDTCT[CPFUGNGEVVJG°NG%QPPGEVK2CFVQ[QWT computer, select the book or PDF in the Books pane in iTunes, and then sync iPad. If a PDF doesnât appear in the Books pane, you need to change its type in iTunes. 5GCTEJ[QWTK6WPGUNKDTCT[VQ°PFVJG2&(°NGUGNGEVKVVJGPEJQQUG(KNG )GV+PHQ+P VJG1RVKQPUUGEVKQPQHVJG°NGKPHQTOCVKQPYKPFQYEJQQUG$QQMHTQOVJG/GFKC-KPF pop-up menu, then click OK. Using the iBookstore In the iBooks app, tap Store to open the iBookstore. From there, you can browse HGCVWTGFDQQMUQTDGUVUGNNGTUCPFDTQYUGHQTDQQMUD[CWVJQTQTVQRKE9JGP[QW°PF a book you like, you can purchase and download it. Note: Some features of the iBookstore may not be available in all locations. Get more information: In the iBookstore, you can read a summary of the book, read or write a review, and download a sample of the book before buying it. Purchase a book: Find a book you want, tap the price, then tap Buy Now. Sign in using your Apple ID, then tap OK. Some books may be free for downloading. The purchase is charged to your Apple account. If you make additional purchases YKVJKPVJGPGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP If youâve already purchased a book and want to download it again, tap Purchases in VJGK$QQMUVQTGCPF°PFVJGDQQMKPVJGNKUV6JGPVCR4GFQYPNQCF Books that you purchase are synced to your iTunes library the next time you sync iPad with your computer. This provides a backup in case you delete the book from iPad. Chapter 19 iBooks 125 Reading Books Reading a book is easy. Go to the bookshelf and tap the book you want to read. If you donât see the book youâre looking for, tap Collections to view other groups of books. Turn pages: 6CRPGCTVJGTKIJVQTNGHVOCTIKPQHCRCIGQTÂąKEMNGHVQTTKIJV6QEJCPIG the direction the page turns when you tap the left margin, go to Settings > iBooks. )QVQCURGEK°ERCIGTap near the center of the current page to show the controls. Drag the page navigation control at the bottom of the screen to the desired page, then let go. Go to the table of contents: Tap near the center of the current page to show the controls, then tap 6CRCPGPVT[VQLWORVQVJCVNQECVKQPQTVCR4GUWOGVQTGVWTPVQ the current page. Add or remove a bookmark: Tap the ribbon button to set a bookmark. You can have multiple bookmarks. To remove a bookmark, tap it. You donât need to add a bookmark YJGP[QWENQUGCDQQMDGECWUGK$QQMUTGOGODGTUYJGTG[QWNGHVQĂCPFTGVWTPU there when you open the book again. Add, remove, or edit a highlight: Touch and hold any word until itâs selected. Use the ITCDRQKPVUVQCFLWUVVJGUGNGEVKQPVJGPVCR*KIJNKIJV6QTGOQXGCJKIJNKIJVVCRVJG highlighted text, then tap Remove Highlight. To change the color of a highlight, tap the highlighted text, then tap Colors and select a color from the menu. Add, view, or remove a note: Touch and hold any word until itâs selected. Use the grab RQKPVUVQCFLWUVVJGUGNGEVKQPVJGPVCR0QVG6[RGUQOGVGZVVJGPVCR&QPG6QXKGYC note, tap the indicator in the margin near the highlighted text. To remove a note, tap the highlighted text, then choose Delete Note. To change the color of a note, tap the highlighted text, then tap Colors and select a color from the menu. 126 Chapter 19 iBooks See all your bookmarks, highlights and notes: To see the bookmarks, highlights, and notes youâve added, tap , then tap Bookmarks. To view a note, tap its indicator. Enlarge an image: Double-tap an image. To read a book while lying down, use the screen rotation lock to prevent iPad from rotating the display when you tilt iPad. For information, see âViewing in Portrait or Landscapeâ on page 16. Reading PDFs You can use iBooks to read PDFs. Go to the bookshelf and tap Collections, select a collection, then tap the PDF you want to read. Turn pages: Flick left or right. Enlarge a page: Pinch to zoom in on the page, then scroll to see the portion you want. )QVQCURGEK°ERCIGTap near the center of the current page to show the controls. Then, in the page navigation controls at the bottom of the page, drag until the desired RCIGPWODGTCRRGCTUQTVCRCVJWODPCKNVQLWORVQVJCVRCIG Add or remove a bookmark: To add a bookmark, tap the ribbon button. You can have multiple bookmarks. To remove a bookmark, tap it. You donât need to set a bookmark YJGP[QWENQUGC2&(DGECWUGK$QQMUTGOGODGTUYJGTG[QWNGHVQĂCPFTGVWTPUVJGTG when you open the PDF again. Go to the table of contents: Tap near the center of the current page to show the controls, then tap 6CRCPGPVT[VQLWORVQVJCVNQECVKQPQTVCR4GUWOGVQTGVWTPVQ VJGEWTTGPVRCIG+HVJGCWVJQTJCUP¨VFG°PGFCVCDNGQHEQPVGPVU[QWECPVCRCRCIG icon instead. Changing a Bookâs Appearance To change the appearance of a book, access the controls by tapping near the center of a page. Change the font or type size: Tap , then in the list that appears, tap or to reduce or enlarge the type size. To change the font, tap Fonts, then select one from the list. Changing the font and size also changes text formatting. Change the brightness: Tap VJGPCFLWUVVJGDTKIJVPGUU Change the page and type color: Tap , then turn the Sepia option on to change the color of the page and type. This setting applies to all books. ;QWECPEJCPIGVJGYC[VJCVK$QQMULWUVK°GUVJGVGZVQHRCTCITCRJUKP5GVVKPIU K$QQMU Chapter 19 iBooks 127 Searching Books and PDFs You can search for the title or author of a book to quickly locate it on the bookshelf. ;QWECPCNUQUGCTEJVJGEQPVGPVUQHCDQQMVQ°PFCNNVJGTGHGTGPEGUVQCYQTFQT RJTCUG[QW¨TGKPVGTGUVGFKP;QWECPCNUQUGPFCUGCTEJVQ9KMKRGFKCQT)QQINGVQ°PF other related resources. Search for a book: Go to the bookshelf. Tap the status bar to scroll to the top of the screen, then tap the magnifying glass. Enter a word thatâs in the title of a book, or the authorâs name, then tap Search. Matching books appear on the bookshelf. Search in a book: Open a book and tap near the center of the page to show the controls. Tap the magnifying glass, then enter a search phrase and tap Search. Tap a search result to go to that page in the book. To send your search to Google or Wikipedia, tap Search Google or Search Wikipedia. Safari opens and displays the result. To quickly search for a word in a book, touch and hold the word, then tap Search. .QQMKPIWRVJG&G°PKVKQPQHC9QTF ;QWECPNQQMWRVJGFG°PKVKQPQHCYQTFWUKPIVJGFKEVKQPCT[ Look up a word: Select a word in a book, then tap Dictionary in the menu that appears. Dictionaries may not be available for all languages. Having a Book Read to You If you have a visual impairment, you can use VoiceOver to read a book aloud. See âVoiceOverâ on page 138. Some books may not be compatible with VoiceOver. Printing or Emailing a PDF You can use iBooks to send a copy of a PDF via email, or to print all or a portion of the PDF to a supported printer. Email a PDF: Open the PDF, then tap and choose Email Document. A new message CRRGCTUYKVJVJG2&(CVVCEJGF6CR5GPFYJGP[QW°PKUJCFFTGUUKPICPFYTKVKPI[QWT message. Print a PDF: Open the PDF, then tap and choose Print. Select a printer and the page range and number of copies, then tap Print. For information about supported printers, see âPrintingâ on page 40. You can only email or print PDFs. These options arenât available for ePub books. 128 Chapter 19 iBooks Organizing the Bookshelf Use the bookshelf to browse your books and PDFs. You can also organize items into collections. Sort the bookshelf: Go to the bookshelf and tap the choices at the bottom of the screen. , then select a sort method from Rearrange items: Touch and hold a book or PDF, then drag it to a new location on the bookshelf. Delete an item from the bookshelf: Go to the bookshelf and tap Edit. Tap each book or PDF that you want to delete so that a checkmark appears, then tap Delete. When [QW°PKUJFGNGVKPIVCR&QPG+H[QWFGNGVGCDQQM[QWRWTEJCUGF[QWECPFQYPNQCFKV again from Purchases in iBookstore. If youâve synced your device with your computer, the book also remains in your iTunes Library. Create, rename, or delete a collection: Tap Collections to display the collections list. Tap New to add a new collection. To delete a collection tap Edit, then tap and tap Delete. You canât edit or remove the built-in Books and PDFs collections. To edit the PCOGQHCEQNNGEVKQPVCRKVUPCOG9JGP[QW°PKUJVCR&QPG Move a book or PDF to a collection: Go to the bookshelf and tap Edit. Tap each book or PDF that you want to move so that a checkmark appears, then tap Move and select a collection. An item can be in only one collection at a time. When you add a book or PDF to your bookshelf, itâs put in the Books or PDF collection. From there, you can OQXGKVVQCFKĂGTGPVEQNNGEVKQP;QWOKIJVYCPVVQETGCVGEQNNGEVKQPUHQTYQTMCPF school, for example, or for reference and leisure reading. View a collection: Tap Collections, then tap an item in the list that appears. Chapter 19 iBooks 129 Game Center 20 About Game Center You can discover new games and share your game experiences with friends around the world in Game Center. +PXKVG[QWTHTKGPFUVQRNC[QTWUGCWVQOCVEJVQ°PFQVJGTGSWCNN[OCVEJGF opponents. Check leaderboards to see who the best players are. Earn bonus points by CEJKGXKPIURGEK°ECEEQORNKUJOGPVUKPCICOG Note: Game Center may not be available in all countries or regions, and the available games may vary by country or region. To use Game Center, you need an Internet connection and an Apple ID. If you already have an iTunes Store, MobileMe, or other Apple account, you can use that Apple ID with Game Center. If you donât already have an Apple ID, you can create one in Game Center, as described below. Setting Up Game Center 9JGP[QW°TUVQRGP)COG%GPVGT[QW¨TGCUMGFKH[QWYCPVVQCNNQYRWUJPQVK°ECVKQPU 0QVK°ECVKQPUKPENWFGCNGTVUUQWPFUCPFKEQPDCFIGUVJCVNGV[QWMPQYCDQWV)COG Center events, even if youâre not using Game Center. For example, you might receive an alert that a friend has invited you to play a game. #NNQYPQVK°ECVKQPUTap OK. +H[QWVCR&QP¨V#NNQY[QWYQP¨VTGEGKXGPQVK°ECVKQPUHQT)COG%GPVGT;QWECP VWTPPQVK°ECVKQPUQPCVCNCVGTVKOGKH[QWYCPVCPF[QWECPURGEKH[YJCVMKPFUQH PQVK°ECVKQPU[QWYCPVVQIGV 130 6WTPPQVK°ECVKQPUQPQTQĂ+P5GVVKPIUEJQQUG0QVK°ECVKQPU6WTPKPIQĂ0QVK°ECVKQPU FKUCDNGUCNNPQVK°ECVKQPUHQTCNNCRRU;QWECPCNUQUKNGPEGPQVK°ECVKQPUWUKPIVJG5KFG Switch (see âSide Switchâ on page 160). 5RGEKH[YJKEJPQVK°ECVKQPU[QWYCPVHQT)COG%GPVGTIn Settings, choose 0QVK°ECVKQPU )COG%GPVGTVJGPEQP°IWTGVJG5QWPFU#NGTVUCPF$CFIGUUGVVKPIU +H)COG%GPVGTFQGUP¨VCRRGCTVWTPQP0QVK°ECVKQPU Set up Game Center information for your Apple ID: 1 Enter your Apple ID and password, then tap Sign In. You may be asked to provide additional information. If you donât have an Apple ID, you can create one by tapping Create New Account. 2 Tap Agree to accept the Game Center Terms & Conditions. 3 Enter a nicknameâthe name others will see and know you by. 4 %QP°IWTG[QWT)COG%GPVGTUGVVKPIU  To allow other users to invite you to play a game, leave Allow Game Invites turned QP1VJGTYKUGVCRVQVWTPKVQĂ Â 6QCNNQYQVJGTWUGTUVQ°PF[QWD[[QWTGOCKNCFFTGUUNGCXG(KPF/G$['OCKN VWTPGFQP1VJGTYKUGVCRVQVWTPKVQĂ Â 8GTKH[[QWTCEEQWPVGOCKN;QWECPGPVGTCFKĂGTGPVCFFTGUUKH[QWFQP¨VYCPVVQWUG VJGQPGHQTVJG#RRNG+&[QWWUGFVQUKIPKP6QEQP°TOVJKUCFFTGUUCU[QWTU[QW need to respond to the email that will be sent to that address.  To add other email addresses that people can use to contact you in Game Center, tap Add Another Email. 5 6CR0GZVYJGP[QWTCEEQWPVKUEQP°IWTGF Change Game Center settings for your Apple ID: 1 Tap Me, then tap your account banner. 2 Tap View Account. 3 Make your changes, then tap Done. 5KIPKPWUKPICFKĂGTGPV#RRNG+& 1 Tap Me, then tap the account banner. 2 Tap Sign Out. 3 Enter the new Apple ID and password, then tap Sign In. Chapter 20 Game Center 131 Games Purchasing and Downloading Games Games for the Game Center are available from the App Store. If you havenât entered credit card information for your Apple ID, youâll be prompted to enter that information before you can purchase and download games. Purchase and download games: Tap Games, then tap Find Game Center Games. The Game Center section of App Store displays games that work with Game Center. You can browse this section, and purchase and download games from it. See Chapter 18, âApp Store,â on page 119. If you want to purchase a game that a friend has, tap the game on your friendâs info screen to go directly to that game in the App Store. Playing Games The Games screen displays the games you download from the App Store. For each of the games, your number of achievements and your ranking among all the gameâs players are displayed. Get information about a game: Tap Games, then tap a game. If available, you can FKURNC[VJGICOG¨UNGCFGTDQCTFUUGG[QWTCEJKGXGOGPVUHQTVJGICOGCPF°PFQWV whoâs recently played the game. Play a game: Tap Games, choose a game, then tap Play. Depending on the game, the home screen may provide instructions or other information, and let you view leaderboards and achievements, set game options, and start a single or multiplayer game. To play against others, you can either invite a friend QTWUGCWVQOCVEJVQJCXG)COG%GPVGT°PFQVJGTRNC[GTUHQT[QW(QTKPHQTOCVKQP about making friends in Game Center, see âFriendsâ on page 134. For multiplayer games, you can also send a game invitation from the Friends screen. Invite a friend to a multiplayer game from the Friends screen: 1 Tap Friends at the bottom of the screen. 2 Choose a friend. 3 Choose a game and tap Play. If the game allows or requires additional players, you can choose players to invite, then tap Next. 4 Enter and send your invitation, then wait for the others to accept. 5 Start the game. If a friend isnât available or doesnât respond to your invitation, you can tap Auto-Match VQJCXG)COG%GPVGT°PFCPQVJGTRNC[GTHQT[QWQTVCR+PXKVG(TKGPFVQVT[KPXKVKPI some other friend. 132 Chapter 20 Game Center Other players may invite you to play the game. Respond to an invitation to play a game: Tap Accept or Decline in the alert that appears. You can disable multiplayer games in Restrictions. See âRestrictionsâ on page 158. ;QWECPRTGXGPVQVJGTRNC[GTUHTQOKPXKVKPI[QWVQRNC[ICOGUD[VWTPKPIQĂ#NNQY Game Invites in Game Center settings. See âYour Status and Account Informationâ on page 135. Return to Game Center: Press the Home button, then tap Game Center on the Home screen. You can also press the Home button twice quickly and choose Game Center from your recent apps. Leaderboards Some games provide one or more leaderboards to show the ranking of the gameâs players, with their scores, times, or other measures of the playersâ success. See a gameâs leaderboard: Tap Games, then choose the game and tap Leaderboard. You may also be able to view leaderboards from within a game. If a game has variations (such as Easy, Normal, and Hard), the Categories screen lets you choose the leaderboard for the game in general, or for one of the variations. The leaderboard shows the ranking of your friends, and of all players. You may be able VQXKGYNGCFGTDQCTFUVCVUHQTCURGEK°EVKOGRGTKQFUWEJCUVQFC[VJKUYGGMQTCNNVKOG Rotate iPad to see a leaderboard in landscape orientation. Start playing a game from the leaderboard: Tap Play in the upper-right corner. Chapter 20 Game Center 133 Achievements 5QOGICOGUTGYCTF[QWYKVJDQPWURQKPVUHQTURGEK°ECEJKGXGOGPVU See the possible achievements for a game: Tap Games, choose a game, then tap Achievements. For each achievement, Game Center shows how many bonus points are awarded, and whether youâve completed the achievement. The total points awarded for your CEJKGXGOGPVUCRRGCTCVVJGVQR;QWECPIGVDQPWURQKPVUHQTCURGEK°ECEJKGXGOGPV only once. You may also be able to view achievements from within a game. Recently Played Some games let you see which of your friends have recently played the game. See whoâs recently played a game: Tap Games, tap a game, then tap Recently Played. Get information about a player: Tap a playerâs name in the list. Friends Game Center puts you in contact with players around the world. You add friends to Game Center by making a request, or by accepting a request from another player. Add a friend to Game Center: 1 Tap Friends or Requests. 2 Tap , then enter a friendâs email address or Game Center nickname. Matching addresses and names from your contacts appear as you type. Tap a contact to include that person in your request. Tap to browse your contacts. To add several friends at once, enter additional contacts. 3 Enter a message for your request, then tap Send. To become a friend, a person must accept your request. Other players might send you a request. If you receive an alert, you can accept the request from there, or close it and respond to the request later from the Request screen. A badge on the Requests button displays the number of outstanding friend requests. Respond to a friend request: Tap Requests, tap the name of the person making the request, then tap Accept, Ignore, or Report a Problem. When a player accepts another playerâs request, they each become the otherâs friend. Friendsâ names appear on the Friends screen. Get information about a friend: Tap the friendâs name. 134 Chapter 20 Game Center Search for a friend: Tap the status bar to scroll to the top of the screen, then tap the UGCTEJ°GNFCPFUVCTVV[RKPI(TKGPFUYJQOCVEJ[QWTUGCTEJCRRGCTCU[QWV[RG A friendâs info page shows how many friends (including you) the person has, the PWODGTQHFKĂGTGPVICOGU[QWTHTKGPFJCURNC[GFCPFJQYOCP[CEJKGXGOGPVU[QWT friend has completed. The info screen may also show:  The games youâve played together  The games you have in common  Other games your friend has You can tap a game in any of the lists to see your position and your friendâs position on the overall leaderboard, and your respective accomplishments for the game. Invite a friend to play a game: Tap Friends, tap the friendâs name, tap a game, then tap Play. See âPlaying Gamesâ on page 132. Remove a friend: Tap Friends, tap a name, then tap Unfriend and tap Remove. +HCRNC[GTKUQĂGPUKXGQTGZJKDKVUKPCRRTQRTKCVGDGJCXKQT[QWECPTGRQTVVJGRTQDNGO Report a problem with a friend: Tap Friends, tap the friendâs name, then tap âReport a Problem.â Describe the problem, then tap Report to send the report. +H[QWVWTPQĂ/WNVKRNC[GT)COGUKP5GVVKPIU[QWECP¨VUGPFQTTGEGKXGCKPXKVCVKQPUVQ play games. See âRestrictionsâ on page 158. Your Status and Account Information The Me screen summarizes information about your friends, your games, and your achievements. 6JGVGZV°GNFKPVJGEGPVGTQHVJGUETGGPNGVU[QWGPVGT[QWTEWTTGPVUVCVWUOGUUCIG Your status appears along with your nickname in other playersâ Friends screens. Change your status: 6CRVJGUVCVWU°GNFVQGPVGTQTWRFCVG[QWTUVCVWU View your account information: Tap the account banner, then tap View Account. You can change or update the following settings:  Nickname  Allow game invites  Find Me By Email  Your email address for Game Center  Additional email addresses 9JGP[QW°PKUJVCR&QPG Chapter 20 Game Center 135 ;QWECPCNUQUKIPQWVCPFUKIPKPVQCFKĂGTGPVCEEQWPVQTETGCVGCPGYCEEQWPV Sign out: Tap the account banner, then tap Sign Out. 5KIPKPVQCFKĂGTGPVCEEQWPVEnter the username and password, then tap Sign In. Create a new account: Tap Create New Account and follow the onscreen instructions. Parental Controls ;QWECPWUGRCTGPVCNEQPVTQNUVQOCPCIGVJGYC[[QWTHCOKN[CFFUHTKGPFUCPFLQKPU multiplayer games in Game Center. Set up Game Center parental controls: Choose Settings > General > Restrictions, then tap Enable Restrictions. Enter a four-digit passcode, then reenter the passcode. You can enable restrictions for the following settings:  Multiplayer games  Adding friends For more information, see âRestrictionsâ on page 158. 136 Chapter 20 Game Center Accessibility 21 In addition to the many features that make iPad easy to use for everyone, iPad includes universal access features. Universal Access Features Universal access features make iPad easy to use for people who have a vision impairment, are deaf or hard of hearing, or have a physical or learning disability. The accessibility features on iPad include:  Support for playback of closed-captioned content  VoiceOver screen reader  Accessibility > 8QKEG1XGTVJGPVCRVJG8QKEG1XGT1P1ĂUYKVEJ 6WTP8QKEG1XGTQPQTQĂKPK6WPGUSelect iPad in the iTunes sidebar. In the Options UGEVKQPQHVJG5WOOCT[RCPGENKEM%QP°IWTG7PKXGTUCN#EEGUU5GNGEV8QKEG1XGTVJGP click OK. ;QWECPCNUQUGV6TKRNGENKEM*QOGVQVWTP8QKEG1XGTQPQTQĂ5GGÂĽTriple-Click Homeâ on page 150. Note: You cannot use VoiceOver and Full-screen Zoom at the same time. VoiceOver Settings You can set VoiceOver to give spoken hints, increase or decrease the speaking rate, or give typing feedback. 6WTPURQMGPJKPVUQPQTQĂIn Settings, choose General > Accessibility > VoiceOver, VJGPVCRVJG5RGCM*KPVU1P1ĂUYKVEJ5RQMGPJKPVUCTGVWTPGFQPD[FGHCWNV Set the VoiceOver speaking rate: In Settings, choose General > Accessibility > 8QKEG1XGTVJGPCFLWUVVJG5RGCMKPI4CVGUNKFGT You can choose what kind of feedback you get when you type. You can set VoiceOver to speak characters, words, both, or nothing. If you choose to hear both characters and words, VoiceOver speaks each character as you type it, then speaks the whole word when you enter a space or punctuation. Choose typing feedback: In Settings, choose General > Accessibility > VoiceOver > Typing Feedback. You can choose Characters, Words, Characters and Words, or Nothing for software keyboards and for Apple Wireless Keyboards. Use phonetics In Settings, choose General > Accessibility > VoiceOver, then tap the Use Phonetics switch to turn it on. Use this feature when you type or read character-by-character, to help make clear which characters were spoken. When Use 2JQPGVKEUKUVWTPGFQP8QKEGQXGT°TUVURGCMUVJGEJCTCEVGTVJGP speaks a word beginning with the character. For example, if you type the character âf,â VoiceOver speaks âf,â and then a moment later, âfoxtrot.â Use pitch change In Settings, choose General > Accessibility > VoiceOver, then tap the Use Pitch Change switch to turn it on. VoiceOver uses a higher pitch when entering a letter, and a lower pitch when deleting a letter. VoiceOver also uses a higher pitch YJGPURGCMKPIVJG°TUVKVGOQHCITQWR UWEJCUCNKUVQTVCDNG and a lower pitch when speaking the last item of a group. Chapter 21 Accessibility 139 $[FGHCWNV8QKEG1XGTWUGUVJGNCPIWCIGVJCV¨UUGVHQTK2CF;QWECPUGVCFKĂGTGPV language for VoiceOver. Change the language spoken by VoiceOver: In Settings, choose General > International > Language, then select a language and tap OK. 5QOGNCPIWCIGUOC[DGKPÂąWGPEGFD[VJG4GIKQP.QECNUGVVKPI+P5GVVKPIUEJQQUG General > International > Region Format, then select the format. Set the rotor options for web browsing: In Settings, choose General > Accessibility > VoiceOver > Web Rotor. Tap to select or deselect options. To change the position of an item in the list, touch next to the item, then drag up or down. Select the languages available in the Language rotor: In Settings, choose General > Accessibility > VoiceOver > Language Rotor and tap to select the language or languages you want to appear in the Language rotor. To change the position of a language in the list, touch next to the language and drag up or down. The Language rotor is always available when youâve selected more than one language. VoiceOver Gestures When VoiceOver is turned on, it changes the gestures you use to control iPad, so that you can hear descriptions without activating buttons. These VoiceOver gestures let you move around the screen and control the individual elements that you select. Some 8QKEG1XGTIGUVWTGUWUGVYQVJTGGQTHQWT°PIGTUVQVCRQTÂąKEM(QTDGUVTGUWNVUYJGP WUKPIOQTGVJCPQPG°PIGTTGNCZCPFNGV[QWT°PIGTUVQWEJVJGUETGGPYKVJUQOG space between them. 6JGTGCTGOCP[YC[UVQGPVGT8QKEG1XGTIGUVWTGU(QTGZCORNG[QWECPVYQ°PIGTVCR D[WUKPIGKVJGTVYQ°PIGTUQPQPGJCPFQTQPG°PIGTQPGCEJJCPF;QWECPCNUQWUG [QWTVJWODU6T[FKĂGTGPVVGEJPKSWGUVQFKUEQXGTYJCVYQTMUDGUVHQT[QW If your gestures donât work, try quicker movements, especially for double-tapping and ÂąKEMKPIIGUVWTGU6QÂąKEMVT[SWKEMN[DTWUJKPIVJGUETGGPYKVJ[QWT°PIGTQT°PIGTU Practice gestures: In Settings, choose General > Accessibility > VoiceOver > Practice Gestures, then tap the Practice VoiceOver Gestures button. Practice the gestures described in âVoiceOver SettingsÂŚDGNQY9JGP[QW°PKUJRTCEVKEKPIVCR&QPG /CMGUKPING°PIGTÂąKEMKPIIGUVWTGUSWKEMN[VQFKUVKPIWKUJVJGOHTQOFTCIIKPIIGUVWTGU 140 Chapter 21 Accessibility Hereâs a summary of VoiceOver gestures: Navigate and Read  Tap: Speak item.  Flick right or left: Select the next or previous item.  Flick up or down:6JGGĂGEVXCTKGUFGRGPFKPIQPVJG4QVQT%QPVTQNUGVVKPI5GG âUsing VoiceOverâ on page 143.  6YQ°PIGTVCR Stop speaking the current item.  6YQ°PIGTÂąKEMWR Read all, from the top of the screen.  6YQ°PIGTÂąKEMFQYP Read all, from the current position.  6JTGG°PIGTÂąKEMWRQTFQYP Scroll one page at a time.  6JTGG°PIGTÂąKEMTKIJVQTNGHV Go to the next or previous page (for example, on the Home screen or in Safari).  6JTGG°PIGTVCR Speak the scroll status (which page or rows are visible).  (QWT°PIGTÂąKEMWRQTFQYP)QVQVJG°TUVQTNCUVGNGOGPVQPCRCIG  (QWT°PIGTÂąKEMTKIJVQTNGHV Go to the next or previous section (for example, on a webpage). Select and Activate  Double-tap: Activate selected item.  6QWEJCPKVGOYKVJQPG°PIGTVCRVJGUETGGPYKVJCPQVJGT°PIGT ÂĽURNKVVCRRKPIÂŚ Activate item.  Double-tap and hold (1 second) + standard gesture: Use a standard gesture. The double-tap and hold gesture tells iPad to interpret the subsequent gesture as standard. For example, you can double-tap and hold, and then without lifting your °PIGTFTCI[QWT°PIGTVQUNKFGCUYKVEJ You can use standard gestures when VoiceOver is turned on, by double-tapping CPFJQNFKPI[QWT°PIGTQPVJGUETGGP#UGTKGUQHVQPGUKPFKECVGUVJCVPQTOCN IGUVWTGUCTGKPHQTEG6JG[TGOCKPKPGĂGEVWPVKN[QWNKHV[QWT°PIGTVJGP8QKEG1XGT gestures resume.  6YQ°PIGTFQWDNGVCR Play or pause in iPod, YouTube, or Photos. Start or stop the stopwatch.  6JTGG°PIGTFQWDNGVCR Mute or unmute VoiceOver.  6JTGG°PIGTVTKRNGVCR6WTPVJGFKURNC[QPQTQĂ Chapter 21 Accessibility 141 Rotor Control The rotor is a virtual control that acts like a physical dial when VoiceOver is turned on. Use the rotor to change VoiceOver settings and to access additional commands and features. Operate the rotor: 4QVCVGVYQ°PIGTUQPVJGK2CFUETGGPVQÂĽVWTPÂŚVJGFKCNCPFEJQQUG items on the rotor. Flick up and down to use the selected item. 6JGGĂGEVQHVJGTQVQTFGRGPFUQPYJCV[QW¨TGFQKPI(QTGZCORNGKH[QW¨TGTGCFKPI text in an email, you can use the rotor to switch between hearing text spoken wordD[YQTFEJCTCEVGTD[EJCTCEVGTQTNKPGD[NKPGYJGP[QWÂąKEMWRQTFQYP9JGP[QW browse a webpage, use the rotor to choose whether you hear text word-by-word or EJCTCEVGTD[EJCTCEVGTJGCTLWUVVJGJGCFGTUJGCTLWUVVJGNKPMU CNNQHVJGOXKUKVGF links, or links not yet visited), hear form elements, or hear descriptions of images. You ECPWUGVJGTQVQTUGVVKPIVQJGCTCNNQHVJGVGZVQTVQLWORHTQOQPGGNGOGPVQHC certain type (such as headers or links) to another. Reading text Select and hear text by:  Character  Word  Line Browsing a webpage Select and hear text by:  Character  Word  Line  Heading  Link  Visited link  Non-visited link  In-page link  Form control  Table  Row (when navigating a table)  List  Landmark  Image  Static text Zoom in or out 142 Chapter 21 Accessibility Entering text Move insertion point and hear text by:  Character  Word  Line Select edit function Select language Using a control Select and hear values by:  Character  Word  Line #FLWUVVJGXCNWGQHVJGEQPVTQNQDLGEV Using VoiceOver Unlock iPad: Select the Unlock button, then double-tap the screen. Select items on the screen: &TCI[QWT°PIGTCETQUUVJGUETGGP8QKEG1XGTKFGPVK°GU each element as you touch it. You can also move systematically from one element VQVJGPGZVD[ÂąKEMKPINGHVQTTKIJVYKVJQPG°PIGT'NGOGPVUCTGUGNGEVGFHTQONGHV VQTKIJVVQRVQDQVVQO(NKEMTKIJVVQIQVQVJGPGZVGNGOGPVQTÂąKEMNGHVVQIQVQVJG previous element. âTapâ a selected item when VoiceOver is turned on: Double-tap anywhere on the screen. Speak the text of an element, character-by-character, word-by-word, or line-by-line: 9KVJVJGGNGOGPVUGNGEVGFÂąKEMWRQTFQYPYKVJQPG°PIGT(NKEMFQYPVQTGCFVJG PGZVEJCTCEVGTQTÂąKEMWRVQTGCFVJGRTGXKQWUEJCTCEVGT6YKUVVJGTQVQTEQPVTQNVQTGCF word-by-word or line-by-line. Adjust a slider: 9KVJQPG°PIGTÂąKEMWRVQKPETGCUGVJGUGVVKPIQTFQYPVQFGETGCUG VJGUGVVKPI8QKEG1XGTURGCMUVJGUGVVKPICU[QWCFLWUVKV Scroll a list or area of the screen: (NKEMWRQTFQYPYKVJVJTGG°PIGTU(NKEMFQYPVQ RCIGFQYPQTÂąKEMWRVQRCIGWR9JGPRCIKPIVJTQWIJCNKUV8QKEG1XGTURGCMUVJG range of items displayed (for example, âshowing rows 5 through 10â). Scroll continuously through a list: Double-tap and hold. When you hear a series of VQPGU[QWECPOQXG[QWT°PIGTWRQTFQYPVQUETQNNVJGNKUV%QPVKPWQWUUETQNNKPI UVQRUYJGP[QWNKHV[QWT°PIGT Chapter 21 Accessibility 143 Use an index: Some lists have an alphabetical index along the right side. The index ECP¨VDGUGNGEVGFD[ÂąKEMKPIDGVYGGPGNGOGPVU[QWOWUVVCRVJGKPFGZVQUGNGEV KV9KVJVJGKPFGZUGNGEVGFÂąKEMWRQTFQYPVQOQXGCNQPIVJGKPFGZ;QWECPCNUQ FQWDNGVCRVJGPUNKFG[QWT°PIGTWRQTFQYP Rearrange the Home screen: On the Home screen, select the icon you want to move. Double-tap and hold, then drag the icon. VoiceOver speaks the row and column position as your drag the icon. Release the icon when itâs in the location you want. You can drag additional icons. Drag an item to the left or right edge of the screen to move KVVQCFKĂGTGPVRCIGQHVJG*QOGUETGGP9JGP[QW°PKUJTGCTTCPIKPIVJGKEQPURTGUU the Home button. ;QWECPVWTPURGCMKPIQĂUVQRURGCMKPICPKVGOVWTPVJGFKURNC[QĂQTJCXG VoiceOver speak the entire screen. Mute VoiceOver &QWDNGVCRYKVJVJTGG°PIGTU&QWDNGVCRYKVJVJTGG °PIGTUCICKPVQVWTPURGCMKPIDCEMQP6QOWVGQPN[ VoiceOver sounds, set the Side Switch to silent. Stop speaking an item 6CRQPEGYKVJVYQ°PIGTU6CRCICKPYKVJVYQ°PIGTUVQ resume speaking. Speaking automatically resumes when you select another item. 6WTPQĂVJGFKURNC[YJKNG[QWWUG VoiceOver 6TKRNGVCRYKVJVJTGG°PIGTU4GRGCVVQVWTPVJGFKURNC[ on again. Speak the entire screen from the top (NKEMWRYKVJVYQ°PIGTU Speak from the current item to the bottom of screen (NKEMFQYPYKVJVYQ°PIGTU You can hear iPad status information by tapping the status bar at the top of the screen. This includes the time, battery life, Wi-Fi signal strength, and more. Entering and Editing Text 9JGP[QWUGNGEVCVGZV°GNFYKVJ8QKEG1XGT[QWECPWUGVJGQPUETGGPMG[DQCTFVQ GPVGTVGZV;QWECPWUGVJGGFKVKPIHGCVWTGUQHK2CFVQEWVEQR[QTRCUVGKPVJGVGZV°GNF Note: Safari doesnât support copying webpage content. The editing features work only KPGFKVCDNGVGZV°GNFU Enter text: 1 7UG8QKEG1XGTVQUGNGEVCPGFKVCDNGVGZV°GNFVJGPFQWDNGVCRVQFKURNC[VJGKPUGTVKQP RQKPVCPFDTKPIWRVJGQPUETGGPMG[DQCTF+HVJG°GNFCNTGCF[EQPVCKPUVGZVVJG insertion point is placed at the beginning or at the end of the text. Double-tap again to place the insertion point at the opposite end. VoiceOver tells you the position of the insertion point. 144 Chapter 21 Accessibility The insertion point and onscreen keyboard may appear automatically when you UGNGEVCVGZV°GNF8QKEG1XGTCPPQWPEGUYJGP[QW¨TGKPGFKVKPIOQFG¤DCUGFQPVJG rotor setting. 2 To type, do one of the following:  ¼6QWEJV[RGÂŚD[FTCIIKPI[QWT°PIGTVQUGNGEVCMG[VJGPNKHVKPI[QWT°PIGTVQGPVGT the character.  ¼5VCPFCTFV[RGÂŚD[ÂąKEMKPINGHVQTTKIJVVQUGNGEVCMG[QPVJGMG[DQCTFVJGPFQWDNG tapping to enter the character.  'PVGTCEJCTCEVGTD[FTCIIKPI[QWT°PIGTCTQWPFVJGMG[DQCTFVQUGNGEVCMG[CPF YJKNGJQNFKPIVJGMG[YKVJQPG°PIGTVCRRKPIVJGUETGGPYKVJCPQVJGT°PIGT VoiceOver speaks the key when itâs selected, and again when itâs entered. Enter an accented character: Double-tap and hold, until you hear a sound indicating that the alternate characters have appeared, then drag left or right to select and hear VJGEJQKEGU4GNGCUG[QWT°PIGTVQGPVGTVJGEWTTGPVUGNGEVKQP Move the insertion point: Flick up or down to move the insertion point forward or backward in the text. VoiceOver makes a sound when the insertion point moves, and speaks the character that the insertion point moved across. Use the rotor to choose whether you want to move the insertion point by characters, words, or lines. Select text: Use the rotor to choose edit. Flick up or down to choose between the Select and Select All functions, then double-tap. If you chose Select, the word closest to the insertion point is selected when you double-tap. If you chose Select All, all the text is selected. Pinch to increase or decrease the selection. Cut, copy, or paste: /CMGUWTGVJGTQVQTKUUGVVQGFKV9KVJVGZVUGNGEVGFÂąKEMWRQT down to choose Cut, Copy, or Paste, then double-tap. Undo: 5JCMGK2CFQTÂąKEMNGHVQTTKIJVVQEJQQUGVJGCEVKQPVQWPFQVJGPFQWDNGVCR Change the pitch: In Settings, choose General > Accessibility > VoiceOver, then tap the Use Pitch Change button. Then, when you delete a letter, itâs spoken with a lower pitch. Speak keys phonetically: In Settings, choose General > Accessibility > VoiceOver, then tap the Use Phonetics button. Then, when you pause on a key, VoiceOver speaks the letter of that key phonetically (for example, alpha for a, bravo for b, charlie for c, and so on). Chapter 21 Accessibility 145 Controlling VoiceOver Using an Apple Wireless Keyboard You can control VoiceOver using an Apple Wireless Keyboard paired with iPad. See âUsing Bluetooth Devicesâ on page 43. The VoiceOver keyboard commands let you navigate the screen, select items, read UETGGPEQPVGPVUCFLWUVVJGTQVQTCPFRGTHQTOQVJGT8QKEG1XGTCEVKQPU#NNVJGMG[DQCTF commands (except one) include Control-Option, abbreviated in the table below as âVO.â VoiceOver Help speaks keys or keyboard commands as you type them. You can use VoiceOver Help to learn the keyboard layout and the actions associated with key combinations. VoiceOver Keyboard Commands VO = Control-Option Read all, starting from the current position 81ÂŁ# Read from the top 81ÂŁ$ Move to the status bar 81ÂŁ/ Press the Home button 81ÂŁ* Select the next or previous item 81ÂŁ4KIJV#TTQYQT81ÂŁ.GHV#TTQY Tap an item 81ÂŁ5RCEGDCT &QWDNGVCRYKVJVYQ°PIGTU 81ÂŁÂŚÂŚ Choose the next or previous rotor item 81ÂŁ7R#TTQYQT81ÂŁ&QYP#TTQY Choose the next or previous speech rotor item 81ÂŁ%QOOCPFÂŁ.GHV#TTQYQT81ÂŁ%QOOCPFÂŁ Right Arrow Adjust speech rotor item 81ÂŁ%QOOCPFÂŁ7R#TTQYQT81ÂŁ%QOOCPFÂŁ Down Arrow Mute or unmute VoiceOver 81ÂŁ5 6WTPVJGUETGGPEWTVCKPQPQTQĂ 81ÂŁ5JKHV5 Turn on VoiceOver help 81ÂŁ- 4GVWTPVQVJGRTGXKQWUUETGGPQTVWTPQĂ VoiceOver help Escape Quick Nav 6WTPQP3WKEM0CXVQEQPVTQN8QKEG1XGTWUKPIVJGCTTQYMG[U3WKEM0CXKUQĂD[FGHCWNV 146 6WTP3WKEM0CXQPQTQĂ .GHV#TTQYÂŁ4KIJV#TTQY Select the next or previous item Right Arrow or Left Arrow 5GNGEVVJGPGZVQTRTGXKQWUKVGOURGEK°GF by the rotor setting Up Arrow or Down Arrow Chapter 21 Accessibility 5GNGEVVJG°TUVQTNCUVKVGO %QPVTQNÂŁ7R#TTQYQT%QPVTQNÂŁ&QYP#TTQY âTapâ an item 7R#TTQYÂŁ&QYP#TTQY Scroll up, down, left, or right 1RVKQPÂŁ7R#TTQY1RVKQPÂŁ&QYP#TTQY 1RVKQPÂŁ.GHV#TTQYQT1RVKQPÂŁ4KIJV#TTQY Change the rotor 7R#TTQYÂŁ.GHV#TTQYQT7R#TTQYÂŁ4KIJV#TTQY Using Maps Use VoiceOver to zoom in or out, select pins, and get information about locations. Zoom in or out: 7UGVJGTQVQTVQEJQQUG\QQOOQFGVJGPÂąKEMWRQTFQYPVQ\QQO in or out. Select a pin: 6QWEJCRKPQTÂąKEMNGHVQTTKIJVVQOQXGHTQOQPGKVGOVQCPQVJGT Get information about a location: With a pin selected, double-tap to display the KPHQTOCVKQPÂąCI(NKEMNGHVQTTKIJVVQUGNGEVVJGÂąCIVJGPFQWDNGVCRVQFKURNC[VJG information page. Using a Braille Display with VoiceOver Setting Up a Braille Display You can use a refreshable Bluetooth braille display to read VoiceOver output in braille. In addition, braille displays with input keys and other controls can be used to control iPad when VoiceOver is turned on. iPad works with many of the most popular wireless braille displays. For a list of supported braille displays, see www.apple.com/accessibility/voiceover/devicesupport. Set up a braille display: 1 Turn on the braille display. 2 On iPad, turn on Bluetooth. In Settings, choose General > Bluetooth, then tap the Bluetooth switch. 3 In Settings, choose General > Accessibility > VoiceOver > Braille, then choose the braille display. 6WTPEQPVTCEVGFDTCKNNGQPQTQĂIn Settings, choose General > Accessibility > VoiceOver > Braille, then tap the Contracted Braille switch. Choosing a Language The braille display uses the language thatâs set for Voice Control. By default, this is the language thatâs set for iPad in Settings > International > Language. You can use the 8QKEG1XGTNCPIWCIGUGVVKPIVQUGVCFKĂGTGPVNCPIWCIGHQT8QKEG1XGTCPFDTCKNNGFKURNC[U Set the language for VoiceOver: In Settings, choose General > International > Voice Control, then choose the language. If you change the language for iPad, you may need to reset the language for VoiceOver and your braille display. Chapter 21 Accessibility 147 Controlling VoiceOver with Your Braille Display You can set the leftmost or rightmost cell of your braille display to provide system status and other information:  Announcement History contains an unread message  The current Announcement History message has not been read  VoiceOver speech is muted  The iPad battery is low (less than 20% charge)  iPad is in landscape orientation  6JGUETGGPFKURNC[KUVWTPGFQĂ Â The current line contains additional text to the left  The current line contains additional text to the right Set the leftmost or rightmost cell to display status information: In Settings, choose General > Accessibility > VoiceOver > Braille > Status Cell, then tap Left or Right. See an expanded description of the status cell: On your braille display, press the status cellâs router button. Zoom The Zoom accessibility feature lets you magnify the entire screen to help you see whatâs on the display. 6WTP Accessibility > Zoom, then tap the Accessibility, tap Large Text, then tap the text size you want. White on Black Use White on Black to invert the colors on the iPad display, which may make it easier to read the screen. When White on Black is turned on, the screen looks like a photographic negative. Invert the screenâs colors: In Settings, choose General > Accessibility, then tap âWhite on Black.â Mono Audio Mono Audio combines the sound of the left and right channels into a mono signal played on both sides. This lets users with hearing impairment in one ear hear the entire sound signal with the other ear. 6WTP/QPQ#WFKQQPQTQĂIn Settings, choose General > Accessibility, then tap the Mono Audio button. Speak Auto-Text Speak Auto-text speaks the text corrections and suggestions iPad makes when you type. 6WTP5RGCM#WVQVGZVQPQTQĂIn Settings, choose General > Accessibility, then tap the Speak Auto-text button. Speak Auto-text also works with VoiceOver or Zoom. Chapter 21 Accessibility 149 Triple-Click Home 6TKRNGENKEM*QOGKUCPGCU[YC[VQVWTPUQOGCEEGUUKDKNKV[HGCVWTGUQPQTQĂD[ quickly pressing the Home button three times. You can set Triple-click Home to turn 8QKEG1XGTQPQTQĂVWTP9JKVGQP$NCEMQPQTQĂQTCUMKH[QWYQWNFNKMGVQVTKRNGENKEM the Home button to:  6WTP8QKEG1XGTQPQTQĂ Â 6WTP9JKVGQP$NCEMQPQTQĂ Â 6WTP Accessibility > Triple-click Home, then choose the function you want. Closed Captioning and Other Helpful Features Many standard features available on iPad also help make it accessible to all users, including those with disabilities. Widescreen Keyboards All the built-in iPad apps show a larger onscreen keyboard when you rotate iPad to landscape view. You can also type using an Apple Wireless Keyboard. Minimum Font Size for Mail Messages To increase readability, set the minimum font size for Mail message text to Large, Extra Large, or Giant. See âMailâ on page 164. Universal Access in Mac OS X Take advantage of the Universal Access features in Mac OS X when you use iTunes to sync information and content from your iTunes library to iPad. In the Finder, choose Help > Mac Help, then search for âuniversal access.â For more information about iPad and Mac OS X accessibility features, go to www.apple.com/accessibility. Closed Captioning You can turn on closed captioning for videos in Video settings. See âVideoâ on page 168. 150 Chapter 21 Accessibility Settings 22 About Settings 7UG5GVVKPIUVQRGTUQPCNK\GK2CFCRRUUGVVJGFCVGCPFVKOGEQP°IWTG[QWTPGVYQTM connection, and change other iPad settings. Airplane Mode Airplane Mode disables the wireless features of iPad to comply with airline regulations. 6WTP#KTRNCPG/QFGQPQTQĂ6CR5GVVKPIUCPFVWTP#KTRNCPG/QFGQPQTQĂ When airplane mode is on, a small appears in the status bar at the top of the UETGGP9K(KCPF$NWGVQQVJUKIPCNUCTGP¨VGOKVVGFCPF)25TGEGRVKQPKUVWTPGFQĂ disabling many iPad features. You wonât be able to:  Send or receive email  Browse the Internet  Sync your contacts, calendars, or bookmarks  Stream YouTube videos  Get weather reports  Get map locations  Use the iTunes Store, iBookstore, or the App Store  Use Game Center If allowed by the aircraft operator and applicable laws and regulations, you can continue to use iPad to:  Listen to music or watch videos  Check your calendar  View photos 151  Take notes  Read email messages stored on iPad Where allowed by the aircraft operator and applicable laws and regulations, you can turn Wi-Fi back on, so you can:  Send and receive email  Browse the Internet  Sync your contacts, calendars, and bookmarks  Stream YouTube videos  Use the iTunes Store, iBookstore, or the App Store  Use Game Center You may also be allowed to turn on Bluetooth and use Bluetooth devices with iPad. VPN 6JKUUGVVKPICRRGCTUYJGP[QWEQP°IWTGC8KTVWCN2TKXCVG0GVYQTM 820 5GGÂĽVPN Accessâ on page 172. 6WTP820QPQTQĂ6CR820VQVWTPKVQPQTQĂ 5GVWRC820EQP°IWTCVKQPChoose General > Network > VPN. Wi-Fi Wi-Fi settings determine whether iPad uses local Wi-Fi networks to connect to the +PVGTPGV+HC9K(KPGVYQTMKUP¨VCXCKNCDNGQTKH[QWVWTP9K(KQĂVJGPK2CFEQPPGEVUVQ the Internet over your cellular data network (iPad Wi-Fi + 3G). 6WTP9K(KQPQTQĂ%JQQUG9K(KVJGPVWTP9K(KQPQTQĂ Join a Wi-Fi network: Choose Wi-Fi, wait a moment as iPad detects networks in range, then select a network. If necessary, enter a password and tap Join. (Networks that require a password appear with a lock icon.) 1PEG[QWLQKPC9K(KPGVYQTMK2CFCWVQOCVKECNN[LQKPUKVYJGPGXGTVJGPGVYQTMKU KPTCPIG+HOQTGVJCPQPGRTGXKQWUPGVYQTMKUKPTCPIGK2CFLQKPUVJGQPGOQUV recently used. 9JGPK2CFLQKPUC9K(KPGVYQTMVJG9K(K icon in the status bar at the top of the screen shows signal strength. The more bars you see, the stronger the signal. Set iPad to ask if you want to join a new network: Choose Wi-Fi, then turn âAsk to ,QKP0GVYQTMUÂŚQPQTQĂ 152 Chapter 22 Settings When you try to access the Internetâby using Safari or Mail for exampleâand you arenât in range of a Wi-Fi network youâve previously used, this option tells iPad to look for another network. iPad displays a list of available Wi-Fi networks that you can choose from. Networks that require a password show a lock icon. If âAsk to ,QKP0GVYQTMUÂŚKUVWTPGFQĂCPFCRTGXKQWUN[WUGF9K(KQTEGNNWNCTFCVCPGVYQTMKUP¨V CXCKNCDNG[QWOWUVOCPWCNN[LQKPCPGVYQTMVQEQPPGEVVQVJG+PVGTPGV Forget a network, so iPad doesnât join it automatically: Choose Wi-Fi, then tap PGZVVQCPGVYQTM[QW¨XGLQKPGFDGHQTG6JGPVCRÂĽ(QTIGVVJKU0GVYQTMÂŚ Join a closed Wi-Fi network: 6QLQKPC9K(KPGVYQTMVJCVKUP¨VUJQYPKPVJGNKUV of networks, choose Wi-Fi > Other, then enter the network name. If the network requires a password, tap Security, tap the type of security the network uses, and enter the password. To connect to a closed network, you must know the network name, password, and security type. Some Wi-Fi networks may require you to provide additional information, such as a client ID or static IP address. Ask your network administrator what settings to use. Adjust settings to connect to a Wi-Fi network: Choose Wi-Fi, then tap a network. next to 0QVK°ECVKQPU This setting appears when you open an app, such as Game Center, that uses the Apple 2WUJ0QVK°ECVKQPUGTXKEG2WUJPQVK°ECVKQPUCNGTV[QWVQPGYKPHQTOCVKQPGXGPYJGP VJGCRRKUP¨VTWPPKPI0QVK°ECVKQPUXCT[D[CRRDWVOC[KPENWFGVGZVQTUQWPFCNGTVU CPFCPWODGTGFDCFIGQPVJGCRRKEQPQPVJG*QOGUETGGP6WTPPQVK°ECVKQPUQĂKH [QWFQP¨VYCPVVQDGPQVK°GFQTVQEQPUGTXGDCVVGT[NKHG5GGÂĽSide Switchâ on page 160. 6WTPCNNPQVK°ECVKQPUQPQTQĂ6CR0QVK°ECVKQPUVJGPVWTP0QVK°ECVKQPUQPQTQĂ 6WTPUQWPFUCNGTVUQTDCFIGUQPQTQĂHQTCPCRR6CR0QVK°ECVKQPUEJQQUGCPCRR HTQOVJGNKUVVJGPEJQQUGVJGV[RGUQHPQVK°ECVKQPU[QWYCPVVQVWTPQPQTQĂ Location Services Location Services allows apps such as Maps to gather and use data based on your location. Location Services doesnât connect the data it collects with your personally KFGPVK°CDNGKPHQTOCVKQP+H[QWJCXG9K(KVWTPGFQP[QWTCRRTQZKOCVGNQECVKQPKU determined using available information from local Wi-Fi networks. iPad Wi-Fi + 3G also uses cellular networks and GPS to determine your location. When an app is using location services, Chapter 22 Settings appears in the status bar. 153 Every app that uses location services appears on the Location Services settings screen, UJQYKPIYJGVJGTNQECVKQPUGTXKEGUKUVWTPGFQPQTQĂHQTVJCVCRR appears for each app that has requested your location within the last 24 hours. If you donât want to use VJKUHGCVWTG[QWECPVWTPNQECVKQPUGTXKEGUQĂHQTUQOGCRRUQTHQTCNNCRRU+H[QWVWTP NQECVKQPUGTXKEGUQĂ[QW¨TGRTQORVGFVQVWTPKVQPCICKPVJGPGZVVKOGCPCRRVTKGUVQ use the feature. 6WTPNQECVKQPUGTXKEGUQPQTQĂHQTCNNCRRUChoose General > Location Services, VJGPVWTPNQECVKQPUGTXKEGUQPQTQĂ 6WTPNQECVKQPUGTXKEGUQPQTQĂHQTUQOGCRRUChoose General > Location Services, EJQQUGCPCRRVJGPVWTPNQECVKQPUGTXKEGUQPQTQĂHQTVJCVCRR 6QEQPUGTXGDCVVGT[NKHGVWTPNQECVKQPUGTXKEGUQĂYJGP[QW¨TGPQVWUKPIKV Carrier This setting appears on iPad Wi-Fi + 3G when youâre outside of your carrierâs network and other local carrier data networks are available to use for cellular network Internet connections. Select a carrier: Choose Carrier and select the network you want to use. Cellular Data 7UG%GNNWNCT&CVCUGVVKPIU K2CF9K(K ) VQVWTP&CVC4QCOKPIQPQTQĂXKGYQT EJCPIG[QWTCEEQWPVKPHQTOCVKQPQTCFFC2GTUQPCN+FGPVK°ECVKQP0WODGT 2+0 VQ lock the micro-SIM card (on some models). 6WTPVJGEGNNWNCTFCVCPGVYQTMQPQTQĂChoose Cellular Data, then turn cellular data QPQTQĂ 6WTPFCVCTQCOKPIQPQTQĂ%JQQUG&CVC4QCOKPIVJGPVWTPFCVCTQCOKPIQPQTQĂ View your account information: Tap View Account to view or change your account information. Add a SIM PIN (on some models): Tap SIM PIN and add a PIN to lock your micro-SIM card. Brightness & Wallpaper 7UG$TKIJVPGUUUGVVKPIUVQCFLWUVVJGUETGGPDTKIJVPGUUVQCEQOHQTVCDNGNGXGN7UG Wallpaper settings to personalize iPad. Adjust the screen brightness: Choose Brightness, then drag the slider. 154 Chapter 22 Settings Set whether iPad adjusts the screen brightness automatically: Choose Brightness, VJGPVWTP#WVQ$TKIJVPGUUQPQTQĂ+H#WVQ$TKIJVPGUUKUQPK2CFCFLWUVUVJGUETGGP brightness for current light conditions using the built-in ambient light sensor. To OCPWCNN[CFLWUVVJGUETGGPDTKIJVPGUUUGGÂĽ#FLWUVKPI$TKIJVPGUUâ on page 17. A wallpaper background picture is displayed on the Lock screen and on the Home screen. You can choose one of the images that came with iPad, an image youâve saved to iPad, or a photo in your Photo Library. An image thatâs at least 1024 x 1024 pixels °NNUVJGUETGGPYJGPK2CFKUTQVCVGF Set wallpaper: Choose Wallpaper, then choose an image and then do one of the following:  To use the image as the background for the Lock screen, tap Set Lock Screen.  To use the image as the background for the Home screen, tap Set Home Screen.  To use the image as the background for both the Lock screen and Home screen, tap Set Both. Picture Frame Picture Frame mode turns iPad into an animated picture frame. Choose which transitions and photos to display. Choose whether to zoom in on faces and whether to UJWĂGRJQVQU Activate Picture Frame: Tap on the Lock screen. General )GPGTCNUGVVKPIUKPENWFGFCVGCPFVKOGUGEWTKV[PGVYQTMCPFQVJGTUGVVKPIUVJCVCĂGEV OQTGVJCPQPGCRR6JKUKUCNUQYJGTG[QWECP°PFKPHQTOCVKQPCDQWV[QWTK2CFQT reset iPad to its original state. About Choose General > About to get information about iPad, including:  Number of songs, videos, photos, and apps  Total storage capacity  Space available  Software version  Model and serial numbers  Cellular data number (iPad Wi-Fi + 3G), and Wi-Fi and Bluetooth addresses  /QFGO°TOYCTGXGTUKQPQHVJGEGNNWNCTVTCPUOKVVGT K2CF9K(K )  IMEI (International Mobile Equipment Identity) and ICCID (Integrated Circuit Card +FGPVK°GTQT5OCTV%CTF PWODGTU K2CF9K(K )  Legal and Regulatory information Chapter 22 Settings 155 Usage Show battery percentage: Turn Battery Percentage on to display the percentage of battery charge next to the battery icon in the upper-right corner. See cellular network data: On iPad Wi-Fi + 3G, see the amount of data sent and received using a cellular data network. Reset your usage statistics: Tap Reset Statistics to clear accumulated data and statistics. Sounds Adjust the ringer and alert volume: Choose General > Sounds and drag the slider. If âChange with Buttonsâ is turned on, use the volume buttons on the side of iPad. The volume buttons donât change the ringer and alert volume if a song or video is playing. Use the volume buttons to adjust the ringer and alert volume: Choose General > Sounds, then tap âChange with Buttons.â Set the ringtone: Choose General > Sounds > Ringtone, then choose a ringtone. 5GVCNGTVCPFGĂGEVUUQWPFU%JQQUG)GPGTCN 5QWPFUVJGPVWTPKVGOUQPQTQĂ 9JGPÂĽ%JCPIGYKVJ$WVVQPUÂŚKUQPK2CFRNC[UUQWPFUHQTCNGTVUCPFGĂGEVUVJCVCTG turned on. You can set iPad to play a sound whenever you:  Get a new email message  Send an email message  Have an Calendar event that youâve set to alert you  Lock iPad  Type using the onscreen keyboard Network 7UG0GVYQTMUGVVKPIUVQEQP°IWTGC820 XKTVWCNRTKXCVGPGVYQTM EQPPGEVKQPQT access your Wi-Fi settings. #FFCPGY820EQP°IWTCVKQPChoose General > Network > VPN > Add VPN %QP°IWTCVKQP VPNs used within organizations allow you to communicate private information UGEWTGN[QXGTCPQPRTKXCVGPGVYQTM;QWOC[PGGFVQEQP°IWTG820HQTGZCORNG to access your work email on iPad. iPad can connect to any VPN that uses the L2TP, PPTP, or Cisco IPSec protocol. VPN works over both Wi-Fi and cellular data network (iPad Wi-Fi + 3G) connections. Ask your network administrator which settings to use. In most cases, if youâve set up VPN on your computer, you can use the same VPN settings for iPad. Once you enter VPN settings, a VPN switch appears in the Settings menu, which you ECPWUGVQVWTP820QPQTQĂ 156 Chapter 22 Settings 820OC[CNUQDGCWVQOCVKECNN[UGVWRD[CEQP°IWTCVKQPRTQ°NG5GGÂĽUsing %QP°IWTCVKQP2TQ°NGUâ on page 171. %JCPIGC820EQP°IWTCVKQPChoose General > Network > VPN and tap the EQP°IWTCVKQP[QWYCPVVQWRFCVG 6WTP820QPQTQĂ6CR5GVVKPIUVJGPVWTP820QPQTQĂ9JGP820KUQP[QWUGGVJG icon in the status bar at the top of the screen. &GNGVGC820EQP°IWTCVKQPChoose General > Network > VPN, tap the blue arrow VQVJGTKIJVQHVJGEQP°IWTCVKQPPCOGVJGPVCR&GNGVG820CVVJGDQVVQOQHVJG EQP°IWTCVKQPUETGGP Bluetooth iPad can connect wirelessly to an Apple Wireless Keyboard for wireless typing or to Bluetooth headphones for wireless listening. See âUsing Bluetooth Devicesâ on page 43. 6WTP$NWGVQQVJQPQTQĂ%JQQUG)GPGTCN $NWGVQQVJCPFVWTP$NWGVQQVJQPQTQĂ When Bluetooth is on, you see the Bluetooth icon in the status bar at the top of the screen. Spotlight Search You can specify the content areas you want to search on iPad using Spotlight. Set the content areas Spotlight searches: Choose General > Spotlight Search and tap an item to select or deselect it. Set the search result order: Choose General > Spotlight Search, touch item, and drag it up or down to rearrange the search order. next to an Auto-Lock 5GV#WVQ.QEMVQVWTPQĂVJGFKURNC[CPFRTGXGPVWPKPVGPFGFQRGTCVKQPQH[QWTK2CF Set the amount of time before iPad locks: Choose General > Auto-Lock and choose a time. Passcode Lock Initially, iPad doesnât require you to enter a passcode to unlock it. For security, you can create a passcode. Set a passcode: Choose General > Passcode Lock > Turn Passcode On. Enter a 4-digit passcode, then enter the passcode again to verify it. iPad then requires you to enter the passcode to unlock it or to display the passcode lock settings. Set how long before your passcode is required: Choose General > Passcode Lock, then enter your passcode. Tap Require Passcode and select how long iPad can be idle before you need to enter a passcode to unlock it. 6WTPVJGRCUUEQFGQĂ%JQQUG)GPGTCN 2CUUEQFG.QEM 6WTP2CUUEQFG1ĂVJGP enter your passcode. Chapter 22 Settings 157 Change the passcode: Choose General > Passcode Lock, enter your passcode, then tap Change Passcode. Enter your passcode again, then enter and reenter your new passcode. If you forget your passcode, you must restore the iPad software. See âRemoving a Backupâ on page 182. 6WTP5KORNG2CUUEQFGQPQTQĂChoose General > Passcode Lock, then turn Simple 2CUUEQFGQPQTQĂ #UKORNGRCUUEQFGKUCHQWTFKIKVPWODGT6QKPETGCUGUGEWTKV[VWTPQĂ5KORNG2CUUEQFG and use a longer passcode that has a combination of numbers, letters, punctuation, and special characters. 6WTP2KEVWTG(TCOGQPQTQĂChoose General > Passcode Lock and turn Picture Frame QPQTQĂ When Picture Frame is on, iPad displays your photos from the locked screen. See âPicture Frameâ on page 155. Erase all data after ten failed passcode attempts: Choose General > Passcode Lock, enter your passcode, and tap Erase Data to turn it on. After ten failed passcode attempts, your settings are reset to their original values, all your information and media are erased, and the encryption key is removed. iPad Cover Lock/Unlock You can automatically lock or unlock iPad 2 when you use it with the iPad Smart Cover (available separately). Use the cover to lock or unlock iPad: Choose General > iPad Cover Lock/Unlock, then tap On. iPad automatically locks and goes to sleep when you close the cover, and then wakes and unlocks when you open the cover. If you have a passcode set, you have to enter it when you open the cover to wake iPad. Restrictions You can set restrictions for the use of some apps and for iPod content on iPad. For GZCORNGRCTGPVUECPTGUVTKEVCEEGUUVQGZRNKEKVEQPVGPVQTVWTPQĂ;QW6WDGCEEGUU Turn on restrictions: 1 Choose General > Restrictions, then tap Enable Restrictions. 2 Enter a four-digit passcode. 3 Reenter the passcode. 6WTPQĂTGUVTKEVKQPUChoose General > Restrictions, then enter the passcode. Tap Disable Restrictions, then reenter the passcode. If you forget your passcode, you must restore the iPad software using iTunes. See âRemoving a Backupâ on page 182. 158 Chapter 22 Settings Set app restrictions: Set the restrictions you want by tapping individual controls on or QĂ+PKVKCNN[CNNEQPVTQNUCTGQP WPTGUVTKEVGF 6CRCPKVGOVQVWTPKVQĂCPFTGUVTKEVKVUWUG Safari Safari is disabled and its icon is removed from the Home screen. You cannot use Safari to browse the web or access web clips. Other third-party apps may allow web browsing even if Safari is disabled. YouTube is disabled and its icon is removed from the Home screen. YouTube The Camera app is disabled and its icon is removed from the Home screen. You cannot take photos or videos with iPad. Camera You cannot make or receive FaceTime video chats. FaceTime The iTunes Store is disabled and its icon is removed from the Home screen. You cannot preview, purchase, or download content. iTunes Ping is disabled. You cannot follow artists or other people. Ping Installing apps is disabled and the App Store icon is removed from the Home screen. Installing Apps Deleting apps from iPad is disabled. customize the Home screen. doesnât appear on app icons when you Deleting Apps Location Services settings cannot be changed. Location Mail account settings cannot be changed. Accounts Restrict purchases within apps: 6WTPQĂ+P#RR2WTEJCUGU9JGPGPCDNGFVJKUHGCVWTG allows you to purchase additional content or features within apps downloaded from the App Store. Chapter 22 Settings 159 Set content restrictions: Tap Ratings For, then select a country in the list. You can set restrictions using that countryâs ratings system for the following categories of content:  Music & Podcasts  Movies  TV Shows  Apps In the United States, for example, to allow only movies rated PG or below, tap Movies, then select PG from the list. Note: Not all countries or regions have a rating system. Restrict multiplayer games: 6WTPQĂ/WNVKRNC[GT)COGU 9JGP/WNVKRNC[GT)COGUKUVWTPGFQĂ[QWECP¨VTGSWGUVCOCVEJQTUGPFQTTGEGKXG invitations to play games or add friends in Game Center. Restrict adding friends: 6WTPQĂ#FFKPI(TKGPFU 9JGP#FFKPI(TKGPFUKUVWTPGFQĂ[QWECP¨VOCMGQTTGEGKXGHTKGPFTGSWGUVUKP)COG Center. You can continue to play with existing friends if Multiplayer Games is turned on. Side Switch ;QWECPWUGVJG5KFG5YKVEJVQNQEMUETGGPQTKGPVCVKQPQTVQUKNGPEGPQVK°ECVKQPUCPF UQWPFGĂGEVU Lock the screen in portrait or landscape orientation: Choose General > Use the Side SwitchâŚ, then tap Lock Rotation. /WVGPQVK°ECVKQPUCPFQVJGTUQWPFGĂGEVUChoose General > Use the Side SwitchâŚ, then tap Mute. The Side Switch doesnât mute audio or video playback. Date and Time These settings apply to the time shown in the status bar at the top of the screen, and in world clocks and calendars. Set whether iPad shows 24-hour time or 12-hour time: Choose General > Date 6KOGCPFVWTP*QWT6KOGQPQTQĂ *QWT6KOGOC[PQVDGCXCKNCDNGKPCNN countries or regions.) Set whether iPad updates the date and time automatically: Choose General > &CVG6KOGVJGPVWTP5GV#WVQOCVKECNN[QPQTQĂ Set the date and time manually: Choose General > Date & Time, then turn Set #WVQOCVKECNN[QĂ6CR6KOG Keyboard, then turn Auto%CRKVCNK\CVKQPQPQTQĂ Normally, iPad automatically capitalizes words after you type sentence-ending punctuation or a return character. 6WTP#WVQ%QTTGEVKQPQPQTQĂChoose General > Keyboard and turn Auto-Correction QPQTQĂ Normally, if the default keyboard for the language you select has a dictionary, iPad automatically suggests corrections or completed words as you type. Check spelling as you type: Choose General > Keyboard and turn Check Spelling QPQTQĂ Enable caps lock: %JQQUG)GPGTCN -G[DQCTFCPFVWTP'PCDNG%CRU.QEMQPQTQĂ If caps lock is enabled and you double-tap the Shift key on the onscreen keyboard, all letters you type are uppercase. The Shift key turns blue when caps lock is on. 6WTPVJGÂĽÂŚUJQTVEWVQPQTQĂ%JQQUG)GPGTCN -G[DQCTFCPFVWTPÂĽÂŚ5JQTVEWVQPQTQĂ The â.â shortcut lets you double-tap the space bar to enter a period followed by a space when youâre typing. Itâs initially on. Add international keyboards: Choose General > Keyboards > International Keyboards > Add New Keyboard, and tap the keyboards you want to add. Change a keyboard layout: Choose General > Keyboards > International Keyboards and select a keyboard. For some languages, you can change the both the onscreen keyboard layout and the external hardware keyboard layout. International 7UG+PVGTPCVKQPCNUGVVKPIUVQUGVVJGNCPIWCIGHQTK2CFCFFMG[DQCTFUHQTFKĂGTGPV languages, and set the date, time, and telephone number formats for your region. You can also choose a calendar format. Set the language for iPad: Choose General > International > Language, choose the language you want to use, and tap Done. 6WTPKPVGTPCVKQPCNMG[DQCTFUQPQTQĂChoose General > International > Keyboards, and add the keyboards you want to use. If more than one keyboard is turned on, press and hold on the keyboard to see a menu of keyboards. See Appendix B, âInternational Keyboards,â on page 174. Set date, time, and telephone number formats: Choose General > International > Region Format, and choose your region. The Region Format also determines the language used for the days and months that appear in built-in iPad apps. Set a calendar format: Choose General > International > Calendar and select the calendar format you want to useâfor example Gregorian, Japanese, or Buddhist. Chapter 22 Settings 161 Accessibility To turn on accessibility features, go to Accessibility settings and choose the features you want. See Chapter 21, âAccessibility,â on page 137. Resetting iPad Reset all settings: Choose General > Reset > Reset All Settings. Enter your passcode if you have one. All your settings are reset. Information (such as your contacts and calendars) and media (such as your songs and videos) arenât deleted. Erase all content and settings: Choose General > Reset > Erase All Content and Settings. Enter your passcode if you have one. This resets all iPad settings to their original values and erases all your information and media. Reset network settings: Choose General > Reset > Reset Network Settings. Enter your passcode if you have one. When you reset network settings, your list of RTGXKQWUN[WUGFPGVYQTMUCPF820UGVVKPIUPQVKPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGCTG TGOQXGF9K(KKUVWTPGFQĂCPFVJGPDCEMQPFKUEQPPGEVKPI[QWHTQOCP[PGVYQTM youâre on. The Wi-Fi and âAsk to Join Networksâ settings remain turned on. 6QTGOQXG820UGVVKPIUKPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGEJQQUG5GVVKPIU )GPGTCN 2TQ°NGVJGPUGNGEVVJGRTQ°NGCPFVCR4GOQXG Reset the keyboard dictionary: Choose General > Reset > Reset Keyboard Dictionary. Enter your passcode if you have one. You add words to the keyboard dictionary by TGLGEVKPIYQTFUK2CFUWIIGUVUCU[QWV[RG6CRCYQTFVQTGLGEVVJGEQTTGEVKQPCPF add the word to the keyboard dictionary. Resetting the keyboard dictionary erases all words youâve added. Reset the Home screen layout: Choose General > Reset > Reset Home Screen Layout to reset your Home screen to its original settings. Reset the location warnings: Choose General > Reset > Reset Location Warnings, and enter your passcode if you have one. Location warnings are the requests made by an app (such as Maps) to use Location Services with that app. iPad stops presenting the warning for an app the second time you tap OK. Tap Reset Location Warnings to resume the warnings. 162 Chapter 22 Settings Mail, Contacts, Calendars Use Mail, Contacts, Calendars settings to set up and customize accounts for iPad:  Microsoft Exchange  MobileMe  Google email  Yahoo! Mail  AOL  Other POP and IMAP mail systems  LDAP accounts for Contacts  CalDAV or iCalendar (.ics) accounts for Calendars Accounts 6JG#EEQWPVUUGEVKQPNGVU[QWUGVWRCEEQWPVUQPK2CF6JGURGEK°EUGVVKPIUVJCV appear depend on the type of account youâre setting up. Your service provider or system administrator should be able to provide the information you need to enter. For more information, see:  âAdding Mail, Contacts, and Calendar Accountsâ on page 31  âSyncing and Adding Contactsâ on page 92  âSubscribing to Calendarsâ on page 88 Change an accountâs settings: Choose âMail, Contacts, Calendars,â choose an account, then make the changes you want. Changes you make to an accountâs settings on iPad are not synced to your computer, UQ[QWECPEQP°IWTG[QWTCEEQWPVUVQYQTMYKVJK2CFYKVJQWVCĂGEVKPIVJGCEEQWPV settings on your computer. Stop using an account: Choose âMail, Contacts, Calendars,â choose an account, then VWTP#EEQWPVQĂ +HCPCEEQWPVKUQĂK2CFFQGUP¨VFKURNC[VJGCEEQWPVCPFFQGUP¨VUGPFQTEJGEMGOCKN from or sync other information with that account, until you turn it back on. Adjust advanced settings: Choose âMail, Contacts, Calendars,â choose an account, tap Advanced, then do one of the following:  To set whether drafts and deleted messages are stored on iPad or remotely on your email server (IMAP accounts only), tap Drafts Mailbox or Deleted Mailbox. If you store messages on iPad, you can see them even when iPad isnât connected to the Internet.  To adjust SSL and password settings, tap Advanced. Ask your network administrator or Internet service provider for the correct settings. Chapter 22 Settings 163 Delete an account from iPad: Choose âMail, Contacts, Calendars,â choose an account, then scroll down and tap Delete Account. Deleting an account means you can no longer access the account on iPad. All email and the contacts, calendar, and bookmark information synced with the account are removed from iPad. However, deleting an account doesnât remove the account or its associated information from your computer. Fetch New Data 6JKUUGVVKPINGVU[QWVWTP2WUJQPQTQĂHQT/QDKNG/G/KETQUQHV'ZEJCPIG;CJQQ Mail, and any other push accounts on iPad. Push accounts automatically deliver new information to iPad when new information appears on the server (delays may occur). 6QHGVEJQTU[PERWUJGFFCVCK2CFOWUVJCXGCP+PVGTPGVEQPPGEVKQP6WTP2WUJQĂVQ suspend delivery of email and other information, or to conserve battery life. 9JGP2WUJKUQĂCPFYKVJCEEQWPVUVJCVFQP¨VUWRRQTVRWUJK2CFECPUVKNNEJGEM the server to see if new information is available. Use the Fetch New Data setting to determine how often data is requested. For optimal battery life, donât fetch too frequently. Turn Push on: Choose âMail, Contacts, Calendarsâ > Fetch New Data, then tap to turn Push on. Set how often to fetch data: Choose âMail, Contacts, Calendarsâ > Fetch New Data, then choose how often you want to fetch data. To conserve battery life, fetch less frequently. Setting Push to OFF or setting Fetch to Manually in the Fetch New Data screen overrides individual account settings. Note: When Push is set to OFF, Find My iPad doesnât work. Mail The Mail settings, except where noted, apply to all accounts youâve set up on iPad. 6QVWTPCNGTVUUQWPFUHQTPGYQTUGPVOCKNQPQTQĂWUGVJG)GPGTCN 5QWPFUUGVVKPIU Set the number of messages shown on iPad: Choose âMail, Contacts, Calendarsâ > Show, then choose a setting. Choose to see the most recent 25, 50, 75, 100, or 200 messages. To download additional messages when youâre in Mail, scroll to the bottom of your inbox and tap Load More Messages. Note: For Microsoft Exchange accounts, choose âMail, Contacts, Calendars,â then choose the Exchange account. Tap âMail days to syncâ and choose the number of days of mail you want to sync with the server. Set how many lines of each message are previewed in the message list: Choose âMail, Contacts, Calendarsâ > Preview, then choose a setting. 164 Chapter 22 Settings ;QWECPEJQQUGVQUGGWRVQ°XGNKPGUQHGCEJOGUUCIG6JCVYC[[QWECPUECPCNKUVQH messages in a mailbox and get an idea of what each message is about. Set a minimum font size for messages: Choose âMail, Contacts, Calendarsâ > Minimum Font Size, then choose Small, Medium, Large, Extra Large, or Giant. Set whether iPad shows To and Cc labels in message lists: Choose âMail, Contacts, %CNGPFCTUÂŚVJGPVWTP5JQY6Q%E.CDGNQPQTQĂ If Show To/Cc Label is on, or Cc next to each message in a list indicates whether the message was sent directly to you or you received a copy. 5GVYJGVJGTK2CFEQP°TOUVJCV[QWYCPVVQFGNGVGCOGUUCIGChoose âMail, %QPVCEVU%CNGPFCTUÂŚVJGPKP/CKNUGVVKPIUVWTP#UM$GHQTG&GNGVKPIQPQTQĂ Set whether iPad automatically loads remote images: Choose âMail, Contacts, %CNGPFCTUÂŚVJGPVWTP.QCF4GOQVG+OCIGUQPQTQĂ +H.QCF4GOQVG+OCIGUKUQĂ[QWECPNQCFKOCIGUOCPWCNN[YJGPTGCFKPICOGUUCIG Set whether iPad sends you a copy of every message you send: Choose âMail, %QPVCEVU%CNGPFCTUÂŚVJGPVWTP#NYC[U$EE/[UGNHQPQTQĂ Add a signature to your messages: Choose âMail, Contacts, Calendarsâ > Signature, then type a signature. You can set iPad to add a signatureâyour favorite quote, or your name, title, and phone number, for exampleâto the bottom of every message you send. Set the default email account: Choose âMail, Contacts, Calendarsâ > Default Account, then choose an account. This setting determines which of your accounts a message is sent from when you create a message from another iPad appâfor example, by sending a photo from Photos or tapping the email address of a business in Maps. To send the message from CFKĂGTGPVCEEQWPVVCRVJG(TQO°GNFKPVJGOGUUCIGCPFEJQQUGVJGCEEQWPV Contacts Set how contacts are sorted: Choose âMail, Contacts, Calendars,â then under Contacts tap Sort Order and do one of the following:  6QUQTVD[°TUVPCOG°TUVtap First, Last.  6QUQTVD[NCUVPCOG°TUVtap Last, First. Set how contacts are displayed: Choose âMail, Contacts, Calendars,â then under Contacts tap Display Order and do one of the following:  6QUJQY°TUVPCOG°TUVtap First, Last.  6QUJQYNCUVPCOG°TUVtap Last, First. Chapter 22 Settings 165 Calendars Set alerts to sound when you receive meeting invitations: Choose âMail, Contacts, Calendars,â then under Calendar tap âNew Invitation Alertsâ to turn it on. Set how far back in the past to show your calendar events on iPad: Choose âMail, Contacts, Calendarsâ > Sync, then choose a period of time. Turn on Calendar time zone support: Choose âMail, Contacts, Calendarsâ > Time Zone Support, then turn Time Zone Support on. Select a time zone for calendars by tapping 6KOG Search Engine and select the search engine you want to use. ;QWECPUGV5CHCTKVQCWVQOCVKECNN[°NNQWVYGDHQTOUWUKPIEQPVCEVKPHQTOCVKQPPCOGU and passwords you previously entered, or both. Enable AutoFill: Choose Safari > AutoFill, then do one of the following:  To use information from contacts, turn Use Contact Info on, choose My Info, and select the contact you want to use. 9JGPVJKUHGCVWTGKUQP5CHCTKWUGUKPHQTOCVKQPHTQO%QPVCEVUVQ°NNKPEQPVCEV°GNFU on web forms.  To use information from names and passwords, turn Names and Passwords on. When this feature is on, Safari remembers names and passwords of websites you XKUKVCPFCWVQOCVKECNN[°NNUKPVJGKPHQTOCVKQPYJGP[QWTGXKUKVVJGYGDUKVG  To remove all AutoFill information, tap Clear All. 166 Chapter 22 Settings Security By default, Safari is set to show features of the web, such as some movies, animation, and web apps. You may wish to change security settings to help protect iPad from possible security risks on the Internet. Change security settings: Choose Safari, then do one of the following:  To set whether youâre warned when visiting potentially fraudulent websites, turn Fraud 9CTPKPIQPQTQĂ Fraud warning protects you from potentially fraudulent Internet sites. When you visit a suspicious site, Safari warns you about its suspect nature and doesnât load the page.  To enable or disable JavaScript, VWTP,CXC5ETKRVQPQTQĂ JavaScript lets web programmers control elements of the pageâfor example, a page that uses JavaScript might display the current date and time or cause a linked page to appear in a new pop-up page.  To block or allow pop-ups, VWTP$NQEM2QRWRUQPQTQĂ$NQEMKPIRQRWRUUVQRUQPN[ pop-ups that appear when you close a page or open a page by typing its address. It doesnât block pop-ups that open when you tap a link.  To set whether Safari accepts cookies, tap Accept Cookies and choose Never, âFrom visited,â or Always. A cookie is a piece of information that a website puts on iPad so the website can remember you when you visit again. This way, webpages can be customized for you based on information you may have provided. Some webpages wonât work correctly unless iPad accepts cookies.  To clear the history of webpages youâve visited, tap Clear History.  To clear all cookies from Safari, tap Clear Cookies.  To clear the browser cache, tap Clear Cache. The browser cache stores the content of pages so the pages open faster the next time you visit them. If a page you open doesnât show new content, clearing the cache may help. Developer The debug console can help you resolve webpage errors. If this feature is turned on, the console appears whenever a webpage error occurs. 6WTPVJGFGDWIEQPUQNGQPQTQĂChoose Safari > Developer, then turn Debug %QPUQNGQPQTQĂ Chapter 22 Settings 167 iPod 7UGK2QF5GVVKPIUVQCFLWUVVJGCWFKQRNC[DCEMUGVVKPIUKPVJGK2QFCRRQPK2CF Set iTunes to play songs at the same sound level: In iTunes, choose iTunes > Preferences if youâre using a Mac, or Edit > Preferences if youâre using a PC. Then click Playback and select Sound Check. Set iPad to use the iTunes volume settings (Sound Check): Choose iPod and turn 5QWPF%JGEMQPQTQĂ Use EQ to customize the sound: Choose iPod, tap EQ, and choose an equalizer setting. Set a volume limit: %JQQUGK2QFVCR8QNWOG.KOKVCPFFTCIVJGUNKFGTVQCFLWUVVJG maximum volume. Tap Lock Volume Limit to assign a code to prevent the setting from being changed. Get song lyrics and information about podcasts: Choose iPod and turn Lyrics & 2QFECUV+PHQQPQTQĂ Share your iTunes library: Enter your Apple ID and password, then use Home Sharing to KORQTVKVGOUHTQOWRVQ°XGK6WPGUNKDTCTKGUQPQVJGTEQORWVGTUKP[QWTJQOGPGVYQTM WARNING: For important information about avoiding hearing loss, see the iPad Important Product Information Guide at support.apple.com/manuals/ipad. Video Video settings apply to video content, including rented movies and TV shows. You can set where to resume playing videos that you previously started, turn closed captioning QPQTQĂCPFUGVWRK2CFVQRNC[XKFGQUQP[QWT68 Set where to resume playing: Choose Video > Start Playing, then select whether you want videos that you previously started watching to resume playing from the DGIKPPKPIQTYJGTG[QWNGHVQĂ 6WTPENQUGFECRVKQPKPIQPQTQĂ%JQQUG8KFGQCPFVWTP%NQUGF%CRVKQPKPIQPQTQĂ 6WTPYKFGUETGGPQPQTQĂ%JQQUG8KFGQCPFVWTP9KFGUETGGPQPQTQĂ+HVJGXKFGQ youâre playing is in widescreen format, turning this on preserves the widescreen aspect ratio. Set the TV signal to NTSC or PAL: Choose Video > TV Signal and select NTSC or PAL. 065%CPF2#.CTG68DTQCFECUVUVCPFCTFUWUGFKPFKĂGTGPVTGIKQPU+H[QW¨TGKPVJG Americas, NTSC is probably the correct choice. Elsewhere, try PAL. If youâre not sure, EJGEMVJGFQEWOGPVCVKQPVJCVECOGYKVJ[QWT68QTRTQLGEVQT Use TV Out settings to set up how iPad plays videos on your TV. 168 Chapter 22 Settings 7UGQPGQHVJGUGVQEQPPGEVK2CFVQC68QTRTQLGEVQT  Apple Digital AV Adapter and an HDMI cable  Apple Component AV Cable  Apple Composite AV Cable  Apple VGA Adapter If you use the Apple Digital AV Adapter or the Apple Component AV Cable, highresolution videos are shown in HD quality. Apple cables are available for purchase in many countries. Go to www.apple.com/store. 9KVJK2CFYJGPVJGECDNGKUEQPPGEVGFVQC68QTRTQLGEVQTVJGK2CFUETGGPKU automatically mirrored on the external display in up to 1080p resolution, and videos play at a maximum resolution of 720p. Some apps such as Keynote may use the external display as a second video monitor. With previous iPad models, only certain applications (including YouTube, Videos, and Photos) use the external display. Photos Use Photos settings to specify how slideshows display your photos. Set the length of time each slide is shown: Choose Photos > Play Each Slide For, and select the length of time. Set whether to repeat slideshows: %JQQUG2JQVQUCPFVWTP4GRGCVQPQTQĂ Set photos to appear randomly or in order: %JQQUG2JQVQUCPFVWTP5JWĂGQPQTQĂ FaceTime Use FaceTime settings to turn on FaceTime or change your address. Enter your Apple ID and password to enable FaceTime. If you donât have an Apple ID, tap Create New Account and follow the onscreen instructions. The email address you specify when creating the account will be your FaceTime address. 6WTP(CEG6KOGQPQTQĂ9JGP(CEG6KOGKUQĂ[QWECPPQVRNCEGQTTGEGKXG FaceTime calls. Specify additional FaceTime addresses: To add an email address so that others can use it to call you with FaceTime, tap Add Another Email. Chapter 22 Settings 169 Notes Use Notes settings to choose the font used to display your notes. Choose a font: Choose Notes and select a font. Store Use Store settings to create or change an Apple ID. By default, the Apple ID youâre signed in to when you sync iPad with your computer appears in Store settings. You can EJCPIGCEEQWPVUQPK2CFVQRWTEJCUGOWUKEQTCRRUHTQOCFKĂGTGPVCEEQWPV+H[QW donât have an Apple ID, you can create one in Store settings. Create a new account: Choose Store and tap Create New Account, then follow the onscreen instructions. Sign in to an account: Choose Store and tap Sign in, then enter your Apple ID and password. View your Apple ID information: Choose Store, sign in using your Apple ID, and tap View Apple ID. 5KIPKPVQCFKĂGTGPVCEEQWPVChoose Store and tap Sign out, then tap Sign in and enter your username and password. 170 Chapter 22 Settings A Appendix iPad in the Enterprise iPad at Work With support for secure access to corporate networks, directories, and Microsoft Exchange, iPad is ready to go to work. For detailed information about using iPad in business go to www.apple.com/ipad/business. 7UKPI%QP°IWTCVKQP2TQ°NGU If youâre in an enterprise environment, you may be able to set up accounts and other KVGOUQPK2CFD[KPUVCNNKPICEQP°IWTCVKQPRTQ°NG%QP°IWTCVKQPRTQ°NGUNGV[QWT administrator set up your iPad to use the information systems at your company, school, QTQTICPK\CVKQP(QTGZCORNGCEQP°IWTCVKQPRTQ°NGOKIJVUGVWR[QWTK2CFVQCEEGUU the Microsoft Exchange servers at work, so iPad can access your Exchange email, calendars, and contacts. #UKORNGEQP°IWTCVKQPRTQ°NGECPEQP°IWTGOCP[FKĂGTGPVUGVVKPIUQPK2CF(QT GZCORNGCEQP°IWTCVKQPRTQ°NGECPUGVWR[QWT/KETQUQHV'ZEJCPIGCEEQWPV820 CEEQWPVCPFEGTVK°ECVGUHQTUGEWTGCEEGUUVQ[QWTEQORCP[¨UPGVYQTMCPFKPHQTOCVKQP #EQP°IWTCVKQPRTQ°NGOC[CNUQVWTPQP2CUUEQFG.QEMYJKEJTGSWKTGU[QWVQETGCVG and enter a passcode for using iPad. ;QWTCFOKPKUVTCVQTOC[FKUVTKDWVGEQP°IWTCVKQPRTQ°NGUGKVJGTD[GOCKND[RWVVKPIVJGO on a secure webpage, or by installing them directly on iPad for you. Your administrator OC[JCXG[QWKPUVCNNCRTQ°NGVJCVVKGU[QWTK2CFVQCOQDKNGFGXKEGOCPCIGOGPVUGTXGT YJKEJCNNQYU[QWTCFOKPKUVTCVQTVQEQP°IWTG[QWTUGVVKPIUTGOQVGN[ +PUVCNNKPIEQP°IWTCVKQPRTQ°NGU 1 1PK2CFQRGPVJGGOCKNOGUUCIGQTFQYPNQCFVJGEQP°IWTCVKQPRTQ°NGUHTQOVJG website your administrator provides. 2 (QTGCEJEQP°IWTCVKQPRTQ°NGVCRVJGRTQ°NGVJGPVCR+PUVCNN 3 Enter passwords and other information thatâs requested. Important: ;QWOC[DGCUMGFYJGVJGTCEQP°IWTCVKQPRTQ°NGKUVTWUVGF+HKPFQWDV CUM[QWTCFOKPKUVTCVQTDGHQTGKPUVCNNKPIVJGEQP°IWTCVKQPRTQ°NG 171 ;QWECP¨VEJCPIGVJGUGVVKPIUKPCEQP°IWTCVKQPRTQ°NG+H[QWYCPVVQEJCPIGUGVVKPIU [QWOWUV°TUVTGOQXGVJGEQP°IWTCVKQPRTQ°NGQTKPUVCNNCPGYEQP°IWTCVKQPRTQ°NG with the new settings. 4GOQXGCRTQ°NG+P5GVVKPIUEJQQUG)GPGTCN 2TQ°NGVJGPUGNGEVVJGEQP°IWTCVKQP RTQ°NGCPFVCR4GOQXG 4GOQXKPICEQP°IWTCVKQPRTQ°NGFGNGVGUVJGUGVVKPIUCPFCNNQVJGTKPHQTOCVKQP KPUVCNNGFD[VJGRTQ°NG Setting Up Microsoft Exchange Accounts Microsoft Exchange provides email, contact, and calendar information that you can automatically sync wirelessly to iPad. You can set up an Exchange account directly on iPad. Set up an Exchange account on iPad: 1 On the iPad Home screen, tap Settings. 2 Tap âMail, Contacts, Calendars,â then tap Add Account. 3 Tap Microsoft Exchange. 4 Enter your account information, then tap Save. Your service provider or administrator can provide the account settings you need. Exchange accounts: Enter your email address, domain (optional), user name, password, and a description. iPad supports Microsoftâs Autodiscovery service, which uses your user name and password to determine the address of the Exchange server. If the server address canât be determined, youâre asked to enter it. Once you connect to the Exchange server, you may be prompted to change your passcode to meet server requirements. 5 When setting up a Microsoft Exchange account, tap the items you want to use on iPadâmail, contacts, and calendars. VPN Access VPN (virtual private network) provides secure access over the Internet to private networks, such as the network at your company or school. Use Network settings on iPad VQEQP°IWTGCPFVWTPQP820#UM[QWTCFOKPKUVTCVQTYJCVUGVVKPIU[QWUJQWNFWUG 820ECPCNUQDGUGVWRCWVQOCVKECNN[D[CEQP°IWTCVKQPRTQ°NG9JGP820KUUGVWR D[CEQP°IWTCVKQPRTQ°NGK2CFOC[VWTP820QPCWVQOCVKECNN[YJGPGXGTKV¨UPGGFGF For more information, see â7UKPI%QP°IWTCVKQP2TQ°NGUâ on page 171 or contact your administrator. 172 Appendix A iPad in the Enterprise LDAP and CardDAV Accounts When you set up an LDAP account, you can view and search for contacts on your company or organizationâs LDAP server. The server appears as a new group in Contacts. Because LDAP contacts arenât downloaded to iPad, you must have an Internet connection to view them. Check with your administrator for account settings and other requirements (such as VPN). When you set up a CardDAV account, your account contacts are synced with iPad over the air. You may also be able to search for contacts on your company or organizationâs CardDAV server. Set up an LDAP or CardDAV account: 1 In Settings, tap âMail Contacts, Calendars,â then tap Add Account. 2 Tap Other, then tap Add LDAP Account or Add CardDAV Account. 3 Enter your LDAP account information, then tap Next to verify the account. 4 Tap Save. Appendix A iPad in the Enterprise 173 B +PVGTPCVKQPCNMG[DQCTFUCNNQY[QWVQGPVGTVGZVKPOCP[FKĂGTGPVNCPIWCIGUKPENWFKPI Asian languages and languages written from right to left. Adding Keyboards 6QGPVGTVGZVKPFKĂGTGPVNCPIWCIGUQPK2CF[QWWUGFKĂGTGPVMG[DQCTFU$[FGHCWNV only the keyboard for the language youâve set is available. To make keyboards for other languages available, use Keyboard settings. Add a keyboard: 1 In Settings, choose General > Keyboard > International Keyboards. The number before the arrow indicates the number of keyboards currently enabled. 2 Tap Add New Keyboard, then choose a keyboard from the list. Repeat to add more keyboards. Some languages have multiple keyboards available. For a list of keyboards supported by iPad, go to www.apple.com/ipad/specs. Edit your keyboard list: Choose General > Keyboard > International Keyboards, then tap Edit and do one of the following:  To delete a keyboard, tap  To reorder the list, drag , then tap Delete. next to a keyboard to a new place in the list. Switching Keyboards 6QGPVGTVGZVKPCFKĂGTGPVNCPIWCIGUYKVEJMG[DQCTFU Switch keyboards when youâre typing: Tap . When you tap the symbol, the name of VJGPGYN[CEVKXCVGFMG[DQCTFCRRGCTUDTKGÂą[ You can also touch and hold to display a list of available keyboards. To choose a MG[DQCTFHTQOVJGNKUVUNKFG[QWT°PIGTVQVJGPCOGQHVJGMG[DQCTFVJGPTGNGCUG Many keyboards provide letters, numbers, and symbols not visible on the keyboard. 174 Appendix International Keyboards Type letters, numbers, or symbols that arenât on the keyboard: Touch and hold the TGNCVGFNGVVGTPWODGTQTU[ODQNVJGPUNKFG[QWT°PIGTVQEJQQUGCXCTKCVKQP1PVJG Thai keyboard, for example, you can choose native numbers by touching and holding the related Arabic number. Chinese ;QWECPWUGMG[DQCTFUVQGPVGT%JKPGUGKPUGXGTCNFKĂGTGPVYC[UKPENWFKPI2KP[KP %CPILKG9WDK*WCCPF Keyboard > Edit User Dictionary. Tap VCRVJG9QTF°GNFCPFGPVGTVJGYQTFVJGPVCRVJG;QOK2KP[KP QT Preferences.  Windows: Choose Edit > Preferences. 2 Click Devices (iPad does not need to be connected). 3 Select the backup you want to remove, then click Delete Backup. 4 %NKEM&GNGVG$CEMWRVQEQP°TO[QWYKUJVQTGOQXGVJGUGNGEVGFDCEMWR 5 Click OK. Updating and Restoring iPad Software About Updating and Restoring Software You can use iTunes to update or restore iPad software.  If you update, the iPad software is updated. Your downloaded apps, settings, and FCVCCTGP¨VCĂGEVGF Note: In some cases, an update may also include restoring iPad.  If you restore, the latest version of iPad software is reinstalled, settings are restored to their default, and all data stored on iPad is deleted, including downloaded apps, songs, videos, contacts, photos, calendar information, and any other data. If youâve backed up iPad with iTunes on your computer, you can restore data from the backup at the end of the restore process. Deleted data is no longer accessible through the iPad user interface, but it isnât erased from iPad. For information about erasing all content and settings, see âResetting iPadâ on page 162. If you use a Bluetooth headset or keyboard with iPad and you restore settings, you must pair the Bluetooth device with iPad again to use it. For more information about updating and restoring iPad software, go to support.apple.com/kb/HT1414. Updating iPad Make sure your computer has an Internet connection and that youâve installed the latest version of iTunes from www.apple.com/itunes. Update iPad: 1 Connect iPad to your computer. 182 Appendix C Tips and Troubleshooting 2 Select iPad in the iTunes sidebar, then click the Summary tab. 3 Click âCheck for Update.â iTunes tells you if thereâs a new version of the iPad software available. 4 Click Update to install the latest version of the software. Restoring iPad Make sure your computer has an Internet connection and that youâve installed the latest version of iTunes from www.apple.com/itunes. Restore iPad: 1 Connect iPad to your computer. 2 Select iPad in the iTunes sidebar, then click the Summary tab. 3 Click âCheck for Update.â iTunes tells you if thereâs a new version of the iPad software available. 4 Click Restore. Follow the onscreen instructions to complete the restore process. When restoring, it is recommended that you back up iPad when prompted. When the iPad software has been restored, you can choose to set up iPad as a new iPad, or restore your music, video, app data, and other content from a backup. After restoring from a backup, previous data is no longer accessible through the iPad user interface, but it isnât erased from iPad. For information about erasing all content and settings, see âResetting iPadâ on page 162. Restoring from a Backup You can restore the settings, app data, and other information from a backup, or use this feature to copy these items to another iPad. Make sure your computer has an Internet connection and that youâve installed the latest version of iTunes from www.apple.com/itunes. Important: Restoring from a backup is not the same as restoring iPad from the Summary pane in iTunes. Restoring from a backup doesnât fully restore iPad software. Also, restoring iPad from a backup restores all data in the backup, including data for apps. If you choose an old backup, restoring it could replace the app data with data that isnât current. For more information, see âResetting iPadâ on page 162. Restore iPad from a backup: 1 Connect iPad to the computer you normally sync with. 2 In iTunes, Control-click iPad in the sidebar, then choose âRestore from Backupâ from the menu that appears. 3 Choose the backup that you want to restore from the pop-up menu, then click Restore. If the backup is encrypted, youâll need to enter your password. Appendix C Tips and Troubleshooting 183 After restoring from a backup, previous data is no longer accessible through the iPad user interface, but it isnât erased from iPad. For information about erasing all content and settings, see âResetting iPadâ on page 162. Safari, Mail, and Contacts Canât Send Email If iPad is unable to send email, try the following:  In Settings, choose âMail, Contacts, Calendars,â then select the account youâre trying to use. Tap Account Info, then tap SMTP under Outgoing Mail Server. You can set up additional SMTP servers, or select one from another mail account on iPad. Contact [QWT+PVGTPGVUGTXKEGRTQXKFGTHQTEQP°IWTCVKQPKPHQTOCVKQP  Set up your email account directly on iPad instead of syncing it from iTunes. In Settings, choose âMail, Contacts, Calendars,â tap Add Account and enter your account information. If iPad is unable to locate your service providerâs settings when you enter your email address, go to support.apple.com/kb/HT1277 for help setting up your account.  6WTPK2CFQĂCPFVJGPQPCICKP2TGUUCPFJQNFVJG5NGGR9CMGDWVVQPHQTCHGY seconds until a red slider appears, then drag the slider. Then press and hold the Sleep/Wake button until the Apple logo appears. For additional troubleshooting information, go to www.apple.com/support/ipad. If you still canât send email, you can use Express Lane (not available in all countries). Go to expresslane.apple.com. Canât Receive Email If iPad canât receive email, try the following:  If you use one or more computers to check the same email account, it may create a lock-out. For more information, go to support.apple.com/kb/TS2621.  Set up your email account directly on iPad instead of syncing it from iTunes. In Settings, choose âMail, Contacts, Calendars,â tap Add Account, then enter your account information. If iPad is unable to locate your service providerâs settings when you enter your email address, go to support.apple.com/kb/HT1277 for help setting up your account.  6WTPK2CFQĂCPFVJGPQPCICKP2TGUUCPFJQNFVJG5NGGR9CMGDWVVQPHQTCHGY seconds until a red slider appears, then drag the slider. Then press and hold the Sleep/Wake button until the Apple logo appears.  +H[QWTK2CF9K(K )WUGUCEGNNWNCTFCVCPGVYQTMVWTPQĂ9K(KUQK2CFEQPPGEVU to the Internet through the cellular data network. In Settings, choose Wi-Fi and turn QĂ9K(K 184 Appendix C Tips and Troubleshooting For additional troubleshooting information, go to www.apple.com/support/ipad. If you still canât send email, you can use Express Lane (not available in all countries). Go to expresslane.apple.com. Email Attachment Wonât Open K2CFOC[PQVUWRRQTVVJGCVVCEJOGPV°NGV[RGK2CFUWRRQTVUVJGHQNNQYKPIV[RGUQH email attachments: .doc Microsoft Word .docx Microsoft Word (XML) .htm webpage .html webpage .ics Calendar item .key Keynote .numbers Numbers .pages Pages .pdf Preview, Adobe Acrobat .ppt Microsoft PowerPoint .pptx Microsoft PowerPoint (XML) .rtf Rich Text Format .txt text .vcf contact information .xls Microsoft Excel .xlsx Microsoft Excel (XML) Sound, Music, and Video No Sound  Make sure the iPad speaker isnât covered.  Make sure the Side Switch isnât set to silent. See â Volume Buttonsâ on page 11.  If youâre using a headset, unplug it, then plug it in again. Make sure you push the plug all the way in.  Make sure the volume isnât turned all the way down.  Music on iPad might be paused. If youâre using a headset with a play button, try pressing the play button to resume playback. Or from the Home screen, tap iPod, then tap . Appendix C Tips and Troubleshooting 185  Check to see if a volume limit is set. From the Home screen, choose Settings > iPod > Volume Limit. For more information, see âiPodâ on page 168.  If youâre using the line out port on the optional iPad Dock, make sure that you turn on the external speakers or stereo, and that theyâre plugged in correctly and working properly. Use the volume controls on the the external speakers or stereo, not on iPad.  If you're using an app that works with AirPlay, check to see if the AirPlay device you're sending the sound to is turned on and the volume is turned up. If you want to hear sound through iPad's speaker, tap and select it from the list. A Song, Video, or Other Item Wonât Play The song, video, audiobook, or podcast may be encoded in a format that iPad doesnât UWRRQTV(QTKPHQTOCVKQPCDQWVVJGCWFKQCPFXKFGQ°NGHQTOCVUK2CFUWRRQTVUIQVQ www.apple.com/ipad/specs. If a song or video in your iTunes library isnât supported by iPad, you may be able to convert it to a format iPad supports. For example, you can use iTunes for Windows VQEQPXGTVPQPRTQVGEVGF9/#°NGUVQCHQTOCVK2CFUWRRQTVU(QTOQTGKPHQTOCVKQP open iTunes and choose Help > iTunes Help. No Video or Sound when Using AirPlay To send video or audio to an AirPlay device such as an Apple TV, iPad and the AirPlay device must be connected to the same wireless network. If you don't see the button, iPad isnât connected to the same Wi-Fi network as an AirPlay device, or the app youâre using doesnât support AirPlay.  When sound or video is being sent to an AirPlay device, iPad doesnât display video or play audio. To direct the content to iPad and disconnect iPad from the AirPlay device, tap and select iPad in the list.  Some applications play only audio over AirPlay. If video isn't working, make sure that the app you're using supports both audio and video.  If the Apple TV has been set up to require a passcode, you must enter it on iPad when asked, in order to use AirPlay.  Make sure the speakers on the AirPlay device are turned on and turned up. If youâre using an Apple TV, make sure the TVâs input source is set to Apple TV. Make sure the volume control on iPad is turned up.  When iPad is streaming with AirPlay, it must remain connected to the Wi-Fi network. If you take iPad out of range, playback stops.  Depending on the speed of your network, it may take 30 seconds or more for playback to begin when using AirPlay. For more information about AirPlay, go to support.apple.com/kb/HT4437. 186 Appendix C Tips and Troubleshooting No Image on TV or Projector Connected to iPad 9JGP[QWEQPPGEVK2CFVQC68QTRTQLGEVQTVJGCVVCEJGFFKURNC[CWVQOCVKECNN[OKTTQTU the iPad screen. Some apps may support using the attached display as a second monitor. Check the appâs settings and documentation.  Go to Settings > Video and make sure the settings are correct for your TV or RTQLGEVQT6QXKGY*&XKFGQUKPJKIJTGUQNWVKQP[QWOWUVWUGCEQORQPGPVXKFGQ cable or the Apple Digital AV Adapter.  /CMGUWTGVJGXKFGQECDNGKU°TON[EQPPGEVGFCVDQVJGPFUCPFVJCVKV¨UC supported cable. If iPad is connected to an A/V switchbox or receiver, try connecting KVFKTGEVN[VQVJG68QTRTQLGEVQTKPUVGCF  Make sure that your TV has the proper video input selected, such as HDMI or component video.  If no video appears, press the Home button, disconnect and reconnect the cable, and try again. FaceTime Canât make or receive FaceTime calls 6QWUG(CEG6KOG[QWOWUV°TUVCEVKXCVGKVYKVJ[QWT#RRNG+&5GG%JCRVGT7, âFaceTime,â on page 63.  Make sure the person calling you is using an email address thatâs associated with FaceTime. This is normally your Apple ID, but you can add other email addresses too. See âSign in to FaceTime:â on page 64.  To use FaceTime, iPad must be connected to the Internet via Wi-Fi.  When you make a FaceTime call, allow enough time for the connection to be established, which may take many rings. Improving FaceTime quality For best results with FaceTime, try these tips:  +HVJGXKFGQUGGOULGTM[QTUNQYOCMGUWTGDQVJ[QWCPFVJGRGTUQP[QW¨TGECNNKPI are connected to the fastest Wi-Fi network available.  If your image is grainy, the camera needs more light. If the incoming image is grainy, CUMVJGECNNGTVQCFLWUVVJGKTNKIJVKPI  ;QWTKOCIGYQP¨V°NNVJGYJQNGUETGGPKH[QWJQNFK2CFKPNCPFUECRGQTKGPVCVKQP The person youâre talking with might also need to rotate their device to send you a bigger image. Appendix C Tips and Troubleshooting 187 iTunes Store and App Store iTunes or App Store Isnât Available To use the iTunes Store or the App Store, iPad must have an Internet connection. See âConnecting to the Internetâ on page 29. To purchase content from the iTunes Store or the App Store, you need an Apple ID. You can set up an Apple ID on iPad. From the Home screen, choose Settings > Store > Create New Apple ID. See âStoreâ on page 170. You can also set up an account on your computer by opening iTunes and choosing Store > Create Account. Note: The iTunes Store and the App Store arenât available in some countries. Restarting and Resetting iPad If something isnât working right, try restarting iPad, force quitting an app, or resetting iPad. Restart iPad: Press and hold the Sleep/Wake button until the red slider appears. 5NKFG[QWT°PIGTCETQUUVJGUNKFGTVQVWTPQĂK2CF6QVWTPK2CFDCEMQPRTGUUCPF hold the Sleep/Wake until the Apple logo appears. Force quit an app: Press and hold the Sleep/Wake button on top of iPad for a few seconds until a red slider appears, then press and hold the Home button until the app quits. +H[QWECP¨VVWTPQĂK2CFQTKHVJGRTQDNGOEQPVKPWGU[QWOC[PGGFVQTGUGVK2CF6JKU UJQWNFDGFQPGQPN[KHVWTPKPIK2CFQĂCPFQPFQGUP¨VTGUQNXGVJGRTQDNGO Reset iPad: Press and hold the Sleep/Wake button and the Home button at the same time for at least ten seconds, until the Apple logo appears. iPad Still Doesnât Respond After Reset  Reset iPad settings. From the Home screen choose Settings > General > Reset > Reset All Settings. All your settings are reset, but your data and media arenât deleted.  If that doesnât work, erase all content on iPad. See âResetting iPadâ on page 162.  If that doesnât work, restore the iPad software. See âRemoving a Backupâ on page 182. Safety, Service, and Support Information The following table describes where to get more iPad-related safety, software, and service information. 188 Appendix C Tips and Troubleshooting To learn about Do this Using iPad safely See the iPad Important Product Information Guide at support.apple.com/manuals/ipad for the latest safety and regulatory information. iPad service and support, tips, forums, and Apple software downloads Go to www.apple.com/support/ipad. The latest information about iPad Go to www.apple.com/ipad. Managing your Apple ID account Go to appleid.apple.com. Using iTunes Open iTunes and choose Help > iTunes Help. For an online iTunes tutorial (not available in some areas), go to www.apple.com/support/itunes. MobileMe Go to www.apple.com/mobileme. Using iPhoto on Mac OS X Open iPhoto and choose Help > iPhoto Help. Using Address Book on Mac OS X Open Address Book and choose Help > Address Book Help. Using iCal on Mac OS X Open iCal and choose Help > iCal Help. Microsoft Outlook, Windows Address Book, Adobe Photoshop Album, and Adobe Photoshop Elements See the documentation that came with those apps. Obtaining warranty service First follow the advice in this guide. Then go to www.apple.com/support/ipad or see the iPad Important Product Information Guide at support.apple.com/manuals/ipad. Battery replacement service Go to www.apple.com/batteries/replacements.html. Using iPad in an enterprise environment Go to www.apple.com/ipad/business. Disposal and Recycling Information Your iPad must be disposed of properly according to local laws and regulations. Because it contains a battery, iPad must be disposed of separately from household waste. When your iPad reaches its end of life, contact Apple or your local authorities to learn about recycling options. For information about Appleâs recycling program, go to www.apple.com/recycling. Apple and the Environment At Apple, we recognize our responsibility to minimize the environmental impacts of our operations and products. For more information, go to www.apple.com/environment. Appendix C Tips and Troubleshooting 189 3G 13 10W USB power adapter 10 12-hour time 160 24-hour time 160 accessibility features 137 Large Text 149 Mono Audio 149 settings 162 Speak Auto-text 149 Triple-click Home 150 VoiceOver 138 White on Black 149 Zoom 148 accounts 163, 172 âpushâ 164 CFLWUVKPIDTKIJVPGUU17, 154, 155 Adobe Photoshop Elements 28, 29 airplane mode status icon 13 AirPlay about 45 music playback 108 Photos 73 troubleshooting 186 videos from the camera roll 73 Videos 80 AirPrint 14 about 40 printers 40 See also printing album tracks 109 alerts CFLWUVKPIXQNWOG11, 156 calendar 90 alternate audio language 79 anti-phishing. See Safari fraud warning App Store about 119 browsing 120 deleting apps 123 190 Index Index Genius 120 store account 119, 170 syncing 24, 25 syncing purchased content 123 updating apps 122 verifying purchases 118 Apple Component AV Cable 168 Apple Composite AV Cable 168 Apple Digital AV Adapter 168 Apple ID 23 Apple VGA Adapter 168 Apple Wireless Keyboard 20 apps 14 deleting 123 attachments email 57 audio alternate language 79 Mono Audio 149 audiobooks, syncing 25 Auto-Brightness 155 AutoFill 50, 166 backups backing up iPad 27 removing 182 restoring from 180, 183 badge, numbered 40 battery charging 33 low on power 34, 179 maximizing life 34 replacing 34, 189 status icon 13 Bluetooth °PFKPICFFTGUU155 headphones 43 headset 79, 83, 182, 185 pairing headphones 43 status icon 13 VWTPKPIQPQTQĂ157 unpairing device 44 bookmarking iBooks 126 map locations 100 webpages 51 YouTube videos 83, 84 bookmarks, syncing 25, 28, 51 books accessibility 128 annotating 126 brightness 127 FG°PKPIYQTFU128 deleting, rearranging 129 °PFKPI125 iBooks 124 purchasing 125 reading 126, 127 searching 128 syncing 25, 125 syncing books 25 text size 127 braille, using displays with VoiceOver 147 brightness CFLWUVKPI154, 155 iBooks 127 DTKIJVPGUUCFLWUVKPI17 browser cache, clearing 167 browsing App Store 120 iTunes Store 114 button sleep/wake 10 cable, Dock Connector to USB 10, 24 cache, clearing browser 167 CalDAV 88 Calendar about 85 KEU°NGU88 KORQTVKPIKEU°NGUHTQOGOCKN90 searching 88 syncing calendars 25, 27, 85 views 86 See also events Camera Connection Kit 70 Camera back camera 61 deleting photos 61 exposure 61 front camera 61 seeing photos and videos youâve taken 61, 62 taking photos 61 upload photos to your computer 62 %CPILKG175 caps lock, enabling 161 Cc 165 Index cellular data VWTPKPIQPQTQĂ154 cellular data plan 30 cellular network 30 charging battery 33 Chinese keyboard 175, 178 cleaning iPad 35 ENQUGFECRVKQPKPIVWTPKPIQPQTQĂ168 computer requirements 23 EQP°IWTCVKQPRTQ°NGU171 connecting to Internet 29 Contacts about 91 adding and editing 93 adding from Maps 104 assigning photo to 75 display order 165 GAL (Global Address List) 54, 92 LDAP (Lightweight Directory Access Protocol) 92 photos 93 seeing location of 98 send info by email 54 sort order 165 syncing 25, 27, 92 Yahoo! Address Book 27 controls, using 17, 36 EQPXGTVKPIWPRTQVGEVGF9/#°NGU186 cookies 167 copying, text 21 cover 11 current location 102 cutting and pasting text 21 data plan 30 data protection 46 Data Roaming 30 VWTPKPIQPQTQĂ154 data, erasing 31, 46, 158, 162 date and time, setting 160 date format 161 debug console, Safari 167 deleting all content and settings 162 apps from the App Store 123 contacts 93 email account 164 email messages 59 notes 95 photos 61, 67 playlists 110 removing 182 songs from a playlist 110 videos 80 developer settings, Safari 167 dictionary 178 191 directions, getting 102 directories (LDAP) 173 disconnecting iPad from computer 33 display freezes 188 Dock Connector to USB cable 10, 24 downloading apps 121 podcasts 117 editing videos 62 editing text 21 email accounts, syncing 25 enterprise, using iPad 189 ePub books 125 equalizer 168 erasing data 31, 46, 158, 162 events, calendar 86 Exchange. See Microsoft Exchange exposure 61 external keyboards 20 FaceTime 63 making a call 65 phone number format 65 signing in 64 using other apps while talking 65 Fetch New Data 164 Fifty Key 177 °NGHQTOCVU57, 185, 186 °NGUJCTKPI28, 44 Find My iPad 31, 46 force quitting an app 188 format, date and time 161 forwarding messages 54 GAL (Global Address List) 54, 92 Game Center about 130 account information 135 achievements 134 downloading games 132 friends 134 inviting friends 132 leaderboards 133 parental controls 136 playing games 132 recently played games 134 restricting friend requests 160 restricting multiplayer games 160 restrictions 136 setting up 130 status information 135 192 Index Genius Mixes 106, 111 Genius playlists 110 Genius, App Store 120 gestures, VoiceOver 140 getting help 188 getting started 23 Google contacts 27 search engine 166 searching the web 51 grab points 21 hardware keyboards 20 headset, center button 79, 83, 185 help, getting 188 Home screen 13, 36, 37 adding web clips 52 customizing 38 Home Sharing 112, 168 hybrid view 101 iBooks 124 iBookstore 25, 124 iCal 27, 189 ICCID number 155 icons app 14 status 13 IMAP accounts 53 searching email 58 IMEI number 155 installing apps 121 EQP°IWTCVKQPRTQ°NGU171 international keyboards 161, 174 Internet, connecting to 29 iPad Smart Cover 11, 158 iPhoto 28, 29, 189 iPod controls 37 iPod Genius Mixes 111 Genius playlists 110 playlists 110 TGRGCVKPIQTUJWĂKPIUQPIU107 searching 109 transferring content 112 iTunes Store about 113 account 115, 116, 119, 170 browsing 114 checking download status 117 purchasing songs and albums 115 streaming or downloading podcasts 117 syncing purchased content 118 verifying purchases 118 iTunes U syncing 25, 28 iTunes getting help 189 Home Sharing 112 iPad doesnât appear in 180 settings panes 27 Japanese keyboard 177, 178 keyboards Apple Wireless Keyboard 20 hardware 20 international 161, 174 layouts 22 switching 174 switching languages 20 typing on 18 Korea keyboard 177 landscape orientation 16 languages, switching keyboard 20 Large Text 149 LDAP (Lightweight Directory Access Protocol) 92, 173 links in email 57 on webpages 49 location. See Maps location services using with Camera 60 Location Services 153 location warnings 162 locking iPad 10, 13 Mac system requirements 23 Mail account setup 53, 163 attachments 57, 185 Cc 165 checking for new messages 55, 59 deleting email account 164 deleting messages 59 forwarding messages 54 links 57 load additional messages 56 marking messages as unread 57 organizing email 59 password settings 163 Index printing messages and attachments 59 problems opening an attachment 185 reading messages 56 replying to messages 54 resizing text column 57 saving drafts 54 searching 58 seeing recipients 57 sending messages 54 sending notes 96 sending photos 54 sending webpage addresses 49 sending YouTube video links 83, 84 settings 155, 163 share contact information 54 signatures 165 storing email on iPad or server 155, 163 syncing email account settings 25 zooming in a message 57 managing photos 67 Maps adding location to a contact 104 bookmarking location 100 classic view 101 current location 99, 102 dropped pin 100 °PFKPIDWUKPGUUGU103 °PFKPINQECVKQP98 getting directions 102 hybrid view 101 satellite view 101 seeing location of a contact 98 share location 104 street view 101 terrain view 101 VTCĂEEQPFKVKQPU103 zooming 98 Microsoft Exchange 14, 31, 54, 92, 171, 172 meeting invitations 89 searching email 58 setting up account 172 syncing 85, 172 Microsoft Internet Explorer 28, 51 Microsoft Outlook 27, 85 mirroring video 169 MobileMe 14, 31, 92 getting help 189 searching email 58 security features 31, 46 sending photos to a gallery 74 syncing 51, 85 model number 155 Mono Audio 149 193 movies rented 28, 80 syncing 24, 25 multitasking 37 music managing manually 27 previewing 115 purchasing 115 searching 109 settings 168 syncing 24, 25, 28 See also iPod music videos syncing 24 mute audio and video playback 11 UQWPFGĂGEVU11 VoiceOver 141, 144 navigating. See panning, scrolling Network activity status icon 13 networks 152 Notes 95 emailing 96 searching 96 syncing 25 PQVK°ECVKQPU153 numbered badge 40 onscreen keyboard 18 orientation, changing 47 Outlook Express. See Windows Address Book Outlook. See Microsoft Outlook overview, iPad apps 14 pairing Bluetooth headphones 43 Bluetooth keyboard 43 removing 43 panning maps 98 webpages 48 parental controls. See Restrictions passcode 157 pasting text 21 PC system requirements 23 PDF books 125 Photo Booth back camera 67 front camera 67 194 Index seeing photos youâve taken 67 taking photos 66, 67 upload photos to your computer 68 photos 69 albums 71 assigning photos to contacts 75 contact photos 93 emailing multiple photos 74 emailing photos 73 events 71 faces 71 geo-tagged 71 importing from camera or iPhone 70 picture frame 76 places 71 printing 75 saving from web or email 74 sending in email messages 54 settings 169 slideshow 73 syncing 25, 28, 29 taking 61, 66, 67 upload to computer 74 using photos as wallpaper 75 zooming photos 72 Photos streaming with AirPlay 73 Picture Frame 76 pictures. See Camera, Photos Pinyin 175, 178 playlists 110 creating 109 Genius 110 Genius Mixes 111 podcasts downloading 117 streaming 117 syncing 24, 25, 28 pop-ups 167 portrait orientation 16 power adapter, 10W USB 10 power, low 34 previewing, music and videos 115, 116 print AirPrint printers 40 Print Center 42 printing cancelling 42 email messages and attachments 59 overview 40 photos 75 setting up 40 status 42 problems. See troubleshooting purchased content syncing 118, 123 purchasing apps 119 music 113, 115 videos 116 push accounts 164 Quick Nav 146 rate a song 109 reading email 56 rechargeable batteries 34 removing backups 182 renting movies 28, 80 videos 116 repeating 107 replacing battery 34, 189 replying to messages 54 requirements for using iPad 23 reset iPad 188 resizing webpage columns 48 restarting 188 restoring iPad software 182 restoring settings and information 180, 183 restrictions, setting 158 4QOCLK177, 178 rotor control 142 Safari AutoFill 50, 166 bookmarking webpages 51 clearing cache 167 cookies 167 debug console 167 Debug Console 167 developer settings 167 fraud warning 167 Home screen web clips 52 navigating 49 opening webpages 47, 49, 50 pop-ups 167 reloading webpages 49 TGUK\KPIEQNWOPUVQ°VUETGGP48 saving images to your Photo Library 49 searching 50 searching the web 51 security 167 sending webpage addresses in email 49 settings 166 stopping webpages from loading 49 syncing bookmarks 25, 28 V[RKPIKPVGZV°GNFU50 zooming webpages 48 Index satellite view 101 screen 154, 155 brightness 17 UGVVKPIVQCFLWUVCWVQOCVKECNN[155 using 17, 36 screen orientation 16. See Side Switch lock 16, 37 lock icon 16 lock status icon 13, 16 screenshot, taking a 61 scrolling about 37 maps 98 webpages 48 SD Card Reader 70 search engine 166 searching App Store 120 calendars 88 global 42 iTunes Store 114 Mail messages 58 music 109 notes 96 the web 51 using Spotlight 43 webpage text 50 Wikipedia 43 YouTube videos 82 security erase data after ten failed passcode attempts 158 features 46 Find My iPad 46 setting passcode 157 web 167 selecting text 21 sending email 54 photos from Photos 73 UGTKCNPWODGT°PFKPI155 service and support information 189 set up iPad 24 settings accessibility 162 accounts 163 alerts 90 auto-capitalization 161 auto-correction 21, 161 Bluetooth 157 brightness 154 Calendar 90 date and time 160 developer 167 email server 155 Fetch New Data 164 international 161 195 iPad cover lock 158 language 161 location services 153 Mail, Contacts, Calendars 163 Mail 163 music 168 passcode lock 157 Photos 169 Picture Frame 155 resetting 162 restrictions 158 Safari 166 screen brightness 154 security 167 sound 90 Store 170 usage statistics 156 video 168 VoiceOver 137 VPN 156 wallpaper 75, 155 Wi-Fi 152 sharing photos in email messages 54 UJWĂKPIUQPIU107 Side Switch 11 signatures, email 165 SIM PIN VWTPKPIQPQTQĂ154 5KORNK°GF%JKPGUG176 sleep/wake button 10 slideshows settings 169 smart cover 11 software getting help 189 updating and restoring 182 version 155 sound CFLWUVKPICNGTVUXQNWOG156 CFLWUVKPICNGTVXQNWOG156 CFLWUVKPIXQNWOG11 no sound 185 setting limit 168 Sound Check 168 UQWPFGĂGEVU11 sounds calendar alert 90 Speak Auto-text 149 SSL 163 status icons 13 storage capacity 155 Store, settings 170 subscribing, calendars 88 subtitles 79 UWT°PIVJGYGD47 196 Index switching between cameras 61, 67 syncing calendars 85 Google Contacts 27 iTunes library contents 24, 25 Microsoft Exchange 85, 172 MobileMe 31, 85 preventing 29 purchased songs 118 âSync in progressâ message 33 webpage bookmarks 51 system requirements 23 taking photos 61, 66, 67 telephone number format 161 Ten Key 178 text cutting or copying 21 increasing size 149 pasting 21 typing 18 typing in webpages 50 time format 161 time zone support 88, 166 time, setting 160 touchscreen, using 17, 36 Traditional Chinese 176 VTCĂEEQPFKVKQPUEJGEMKPI103 transfer settings and information 181 transferring purchased content 112, 113, 118, 123 transferring settings and information 180, 183 trimming videos 62 Triple-click Home 150 troubleshooting backing up 181 canât open an attachment 185 canât purchase music or apps 188 display freezes 179 iPad doesnât appear in iTunes 180 iPad doesnât respond 179 iPad doesnât turn on 179 no sound 185 problems playing songs or other content 186 restarting 188 software update and restore 182 VWTPKPIK2CFQPQTQĂ10 TV shows syncing 24, 25, 28 typing international keyboards 174 keyboard 18 KPYGDRCIGVGZV°GNFU50 word substitution 178 U undoing edits 22 unlocking iPad 10 unpairing Bluetooth device 44 unread messages, marking 57 updating iPad software 182 usage statistics battery percentage 156 resetting 156 seeing 156 USB cable 10, 24 port 24 user dictionary 178 waking iPad 10 wallpaper settings 75 using photo as 75 warranty service 189 watching videos on a TV 80, 84 web. See Safari web clips, adding to Home screen 52 webpages bookmarking 51 syncing 25, 28 White on Black 149 Wi-Fi addresses 155 forgetting a network 153 LQKPKPIPGVYQTMU29, 152 settings 152 status icon 13 VWTPKPIQPQTQĂ151, 152 Wikipedia, searching 43 Windows Address Book 27 Windows XP 23 9/#°NGUEQPXGTVKPI186 Wubi Hua 175 VGA connector 84 video settings 168 videos 77 alternate audio language 79 deleting 80 editing 62 playback controls 78 playing 78 previewing 116 purchasing 116 rented 80 subtitles 79 syncing 28 trimming 62 watching on a TV 80, 84 YouTube 81 See also iPod, Music, YouTube Vietnamese keyboard 177 View Account changing account information 154 virtual private network. See VPN VoiceOver about 138 braille displays 147 entering and editing text 144 gestures 140 keyboard control 144 Quick Nav 146 rotor control 142 volume CFLWUVKPI11 CFLWUVKPIHQTCNGTVU156 setting limit 168 VPN accessing networks using 172 EQP°IWTKPI156 UGVWRD[EQP°IWTCVKQPRTQ°NG171 VWTPKPIQPQTQĂ157 Index Yahoo! Address Book 27 search engine 166 searching using 51 Yomi 178 YouTube bookmarking videos 83, 84 emailing video links 83, 84 ÂąCIIKPICXKFGQ84 playing videos 83 rating videos 84 searching for videos 82 subscribing to videos 84 Zhuyin 175, 178 Zoom (Accessibility feature) 148 zooming camera 61 email messages 57 maps 98 photos 72 webpages 48 197 % Apple Inc. Š 2011 Apple Inc. All rights reserved. Apple, the Apple logo, AirPlay, AirPort, AirPort Express, AirPort Extreme, Aperture, Apple TV, FaceTime, Finder, iBooks, iCal, iPhone, iPhoto, iPod, iPod touch, iTunes, Keynote, Mac, Macintosh, Mac OS, Numbers, Pages, Photo Booth, Safari, and Spotlight are trademarks of Apple Inc., registered in the U.S. and other countries. #KT2TKPVK2CF/WNVK6QWEJCPF5JWĂGCTGVTCFGOCTMU of Apple Inc. Apple, Apple Store, iDisk, and iTunes Store are service marks of Apple Inc., registered in the U.S. and other countries. App Store, iBookstore, and MobileMe are service marks of Apple Inc. Adobe and Photoshop are trademarks or registered trademarks of Adobe Systems Incorporated in the U.S. and/or other countries. The BluetoothÂŽ word mark and logos are registered trademarks owned by Bluetooth SIG, Inc. and any use of such marks by Apple Inc. is under license. IOS is a trademark or registered trademark of Cisco in the U.S. and other countries and is used under license. Ping is a registered trademark of Karsten Manufacturing Corporation and is used in the U.S. under license. Š 2011 Google. Map data Š 2011 Google, Tele Atlas, INEGI, Transnavicom, ZENRIN, MapLink/Tele Atlas, Europa Technologies. Š Google. Map data Š 2011 Tele Atlas. Š 2011 Google. Map data Š 2011 Google. Š 2011 Google. #XCKNCDNGQPK6WPGU6KVNGCXCKNCDKNKV[KUUWDLGEVVQ change. Airplane! Š 1992 Paramount Pictures. All rights reserved. Back to the Future Š 1985 Universal Studios. All rights reserved. Dear John Š 2010 Dear John, LLC. All rights reserved. Eat Pray Love Š 2010 Columbia Pictures Industries, Inc. All rights reserved. Iron Man 2, the movie, Š 2010 MVL Film Finance LLC. Iron Man, the character, TM and Š 2010 Marvel Entertainment, LLC and subs. All rights reserved. The Karate Kid Š 2010 Columbia Pictures Industries, Inc. All rights reserved. Salt Š 2010 Columbia Pictures Industries, Inc. and Beverly Blvd. LLC. All rights reserved. Tangled will be available on iTunes beginning March 29, 2011. Tangled Š 2010 Disney. Toy Story 3 Š Disney/Pixar. Other company and product names mentioned herein may be trademarks of their respective companies. Mention of third-party products is for informational purposes only and constitutes neither an endorsement nor a recommendation. Apple assumes no responsibility with regard to the performance or use of these products. All understandings, agreements, or warranties, if any, take place directly between the vendors and the RTQURGEVKXGWUGTU'XGT[GĂQTVJCUDGGPOCFGVQGPUWTG that the information in this manual is accurate. Apple is not responsible for printing or clerical errors. 019-2019/2011-03-07 
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf Linearized : No Page Count : 198 PDF Version : 1.4 Title : iPad User Guide Author : Apple Inc. Producer : Mac OS X 10.6.6 Quartz PDFContext Creator : Adobe InDesign CS3 (5.0.4) Create Date : 2011:03:01 00:11:18Z Modify Date : 2011:03:01 00:11:18ZEXIF Metadata provided by EXIF.tools