D Link CS2332LA1 HD Wirless N Outdoor Network Camera User Manual DCS 2332L A1 Manual v1 00 WW 01 11
D Link Corporation HD Wirless N Outdoor Network Camera DCS 2332L A1 Manual v1 00 WW 01 11
D Link >
User Manual
User Manual
HD Wireless Outdoor Cloud Camera
Version 1.0 | 10/23/2012
DCS-2332L
2D-Link DCS-2332L User Manual
D-Link reserves the right to revise this publication and to make changes in the content hereof without obligation to notify any person or
organization of such revisions or changes. Information in this document may become obsolete as our services and websites develop and
change. Please refer to the www.mydlink.com website for the most current information.
Manual Revisions
Revision Date Description
1.0 October 23, 2012 DCS-2332L Revision A1 with rmware version 1.00
Trademarks
D-Link and the D-Link logo are trademarks or registered trademarks of D-Link Corporation or its subsidiaries in the United States or other
countries. All other company or product names mentioned herein are trademarks or registered trademarks of their respective companies.
Copyright © 2012 D-Link Corporation.
All rights reserved. This publication may not be reproduced, in whole or in part, without prior expressed written permission from D-Link Corporation.
Preface
3D-Link DCS-2332L User Manual
Table of Contents
Product Overview ......................................................................... 4
Package Contents ................................................................. 4
Introduction ............................................................................ 5
System Requirements ......................................................... 5
Features ....................................................................................6
Hardware Overview ............................................................. 7
Front ......................................................................................7
Rear: External ...................................................................... 8
Rear: Internal ......................................................................9
Removing the Top Panel ..................................................10
Replacing the Ethernet Cable ....................................11
Reattaching the Top Panel ...........................................12
Removing the Bottom Panel ..........................................13
Using the Reset Button .................................................13
Installing an SD Memory Card ...................................14
Reattaching the Bottom Panel ...................................14
Installation ....................................................................................16
Zero Conguration Setup ................................................16
Camera Installation Wizard .............................................19
Windows Users ....................................................................19
Mac Users...............................................................................20
Manual Hardware Installation ........................................21
SD Memory Card Installation .........................................22
mydlink ...........................................................................................23
Conguration ...............................................................................24
Using the Conguration Interface ................................24
Live Video ..............................................................................25
Setup .......................................................................................27
Setup Wizard ....................................................................27
Network Setup .................................................................33
Wireless Setup ..................................................................36
Dynamic DNS ...................................................................37
Image Setup .....................................................................38
Audio and Video ..............................................................40
Preset ................................................................................... 42
Motion Detection ...........................................................44
Time and Date ..................................................................45
Event Setup .......................................................................46
SD Card ...............................................................................55
Advanced ...............................................................................56
ICR and IR ...........................................................................56
HTTPS ..................................................................................57
Access List ..........................................................................58
System ................................................................................59
Maintenance .........................................................................60
Device Management .....................................................60
Firmware Upgrade ..........................................................61
Status ......................................................................................62
Device Info ............................................................................62
Logs .....................................................................................63
Help......................................................................................64
Technical Specications ...........................................................65
4D-Link DCS-2332L User Manual
Section 1: Product Overview
Product Overview
Package Contents
If any of the above items are missing, please contact your reseller.
Note: Using a power supply with a dierent voltage than the one included with your
product will cause damage and void the warranty for this product.
DCS-2332L HD Wireless Outdoor Cloud Camera
CAT5 Ethernet cable (Pre-Attached)
Power adapter (Pre-Attached)
CD-ROM with User Manual and software
Quick Installation Guide
Antenna
5D-Link DCS-2332L User Manual
Section 1: Product Overview
Introduction
Congratulations on your purchase of the DCS-2332L HD Wireless Outdoor Cloud Camera. The DCS-2332L is a versatile and
unique solution for your small oce or home. Unlike a standard webcam, the DCS-2332L is a complete system with a built-in
CPU and web server that transmits high quality video images for security and outdoor surveillance. The DCS-2332L can be
accessed remotely, and controlled from any PC/Notebook over your local network or through the Internet via a web browser.
The simple installation and intuitive web-based interface oer easy integration with your Ethernet/Fast Ethernet or 802.11n/g
wireless network. The DCS-2332L also comes with remote monitoring and motion detection features for a complete and cost-
eective home security solution.
• Computer with Microsoft Windows ® 8/7/Vista/XP, or Mac with OS X 10.6 or higher
• PC with 1.3GHz or above and at least 128MB RAM
• Internet Explorer 7, Firefox 12, Safari 4, or Chrome 20 or higher version with Java installed and enabled
• Existing 10/100 Ethernet-based network or 802.11g/n wireless network
System Requirements
6D-Link DCS-2332L User Manual
Section 1: Product Overview
Simple to Use
The DCS-2332L is a stand-alone system with a built-in CPU, requiring no special hardware or software. The DCS-2332L supports both ActiveX mode
for Internet Explorer and Java mode for other browsers such as Firefox® and Safari®.
Supports a Variety of Platforms
Supporting TCP/IP networking, HTTP, and other Internet related protocols. The DCS-2332L can also be integrated easily into other Internet/Intranet
applications because of its standards-based features.
Web Conguration
Using a standard Web browser, administrators can congure and manage the Network Camera directly from its own Web page via Intranet or
Internet. This means you can access your DCS-2332L anytime, anywhere in the world.
Broad Range of Applications
With today’s high-speed Internet services, the Network Camera can provide the ideal solution for delivering live video images over the Intranet and
Internet for remote monitoring. The Network Camera allows remote access using a Web browser for live image viewing, and allows the administrator
to manage and control the Network Camera anytime, anywhere in the world. Many applications exist, including industrial and public monitoring
of homes, oces, banks, hospitals, child-care centers, and amusement parks.
Remote Monitoring Utility
The D-ViewCam application adds enhanced features and functionality for the Network Camera and allows administrators to congure and access
the Network Camera from a remote site via Intranet or Internet. Other features include image monitoring, recording images to a hard drive, viewing
up to 32 cameras on one screen, and taking snapshots.
IR LED for Day and Night Functionality
The built-in infrared LEDs enables night time viewing of up to 16 feet (5 meters).
IP65 Weatherproof Housing
The DCS-2332L uses an IP65 weatherproof housing, allowing you to rest assured that in the toughest of conditions, it will continue to provide
round-the-clock surveillance.
802.11n Wireless or Ethernet/Fast Ethernet Support
The DCS-2332L oers wireless 802.11n and Ethernet/Fast Ethernet connectivity, making the DCS-2332L easy to integrate into your existing
network environment. The DCS-2332L works with a 10Mbps Ethernet based network or 100Mbps Fast Ethernet based network for traditional wired
environments, and works with 802.11n routers or access points for added exibility. The Site Survey feature also allows you to view and connect to
any available wireless networks.
Features
7D-Link DCS-2332L User Manual
Section 1: Product Overview
Front
Hardware Overview
1 Camera Lens Records video of the surrounding area
2 ICR Sensor The IR-Cut Removable sensor measures the lighting conditions and switches
between color and infrared accordingly
3 Microphone Records audio from the surrounding area
4 PIR Passive Infrared sensor for motion detection
5 IR LED Infrared LED illuminates the camera's eld of view at night
6 WPS Status LED Indicates the WPS connection status of the camera
7 Power/Status LED Indicates the camera's current status
8 Antenna Outdoor wireless antenna
4
5
36
2
1
7
8
8D-Link DCS-2332L User Manual
Section 1: Product Overview
Rear: External
1 Weatherproof Cover Weatherproof protective panel
2 Protective Cable Cover Weatherproof cable connection cover
3 Ethernet Cable RJ45 Ethernet cable to connect to your network
4 Speaker Audio output
5 Weatherproof Cover Weatherproof cover for the MicroSD Card slot and reset button
6 Weatherproof Screw Covering Weatherproof protective covering for enclosure screws
7 Power Cable Connected to the included DC 5 V power adapter
8 WPS Button Press this button, then press the WPS button for 5 seconds on your
router to set up a wireless connection automatically
9 Adjustment Ring Tighten or loosen the adjustment ring to adjust the camera's position
1
3
4
5
2
7
6
8
9
6
9D-Link DCS-2332L User Manual
Section 1: Product Overview
Rear: Internal
1 DC Power Connector Connected to the included DC 5 V power adapter
2 RJ45 Ethernet Port RJ45 connector for Ethernet
3 Reset Button Use a paperclip or similar tool to press and hold the recessed button for
10 seconds to reset the camera
4 SD Memory Card Slot Insert a MicroSD card for for storing recorded images and video
1
2
4
3
10D-Link DCS-2332L User Manual
Section 1: Product Overview
Removing the Top Panel
Step 1:
Place the camera face down on a non-slip at surface.
Step 2:
Carefully pry out the two protective rubber screw coverings using a thin at blade.
Step 3:
Undo the two screws using a Philips #00 Screwdriver.
Step 4:
Lift o the protective panel.
Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the rubber seals are secured rmly in place.
2 3 4
11D-Link DCS-2332L User Manual
Section 1: Product Overview
Replacing the Ethernet Cable
Step 1:
Follow the steps outlined in "Removing the Top Panel" on page 10.
Step 2:
Unplug the Ethernet cable from the RJ45 connector.
Step 3:
Carefully remove the weatherproof cable connection cover.
Step 4:
Attach the weatherproof cable connection cover to the new Ethernet cable.
Step 5:
Plug the new Ethernet cable into the RJ45 connector.
Step 6:
Follow the steps outlined in "Reattaching the Top Panel" on page 12.
Note: To avoid damage to the weatherproof aspects of the camera, users are advised not to remove the rear cable connection covering. To use a
longer Ethernet cable install a coupling adaptor.
3 2
12D-Link DCS-2332L User Manual
Section 1: Product Overview
Reattaching the Top Panel
Step 1:
Seat the protective panel, ensuring a tight t with the inlaid rubber seal.
Step 2:
Replace the two screws. Ensure that the screws are tightened rmly.
Step 3:
Firmly replace the protective rubber screw coverings.
Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the rubber seals are secured rmly in place.
23 1
13D-Link DCS-2332L User Manual
Section 1: Product Overview
Removing the Bottom Panel
Step 1:
Place the camera face down on a non-slip at surface.
Step 2:
Carefully pry out the two protective rubber screw coverings using a thin at blade.
Step 3:
Undo the two screws using a Philips #00 Screwdriver.
Step 4:
Lift o the protective panel.
If you need to install an SD Memory Card please skip to "Installing an SD Memory Card" on
page 14.
Using the Reset Button
Step 1:
Follow the steps outlined in "Removing the Bottom Panel" on page 13.
Step 2:
Using a paperclip or similar tool, press and hold the Reset Button for 10 seconds. This will reset
the device to it's factory settings.
Step 3:
Follow the steps outlined in "Reattaching the Bottom Panel" on page 14. 2
2
3
4
If you need to use the Reset Button follow these steps.
14D-Link DCS-2332L User Manual
Section 1: Product Overview
Reattaching the Bottom Panel
Step 1:
Seat the protective panel, ensuring a tight t with the inlaid rubber seal.
Step 2:
Replace the two screws. Ensure that the screws are tightened rmly.
Step 3:
Firmly replace the protective rubber screw coverings.
Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the
rubber seals are secured rmly in place.
Installing an SD Memory Card
Step 1:
Follow the steps outlined in "Removing the Bottom Panel" on page 13.
Step 2:
Insert a MicroSD Memory card into the slot, with the notch facing right.
Step 3:
Follow the steps outlined in "Reattaching the Bottom Panel" on page 14.
2
2
3
4
15D-Link DCS-2332L User Manual
Section 1: Product Overview
To create a WPS connection:
Step 1
Attach the Antenna
Locate the antenna included with your DCS-2332L, and attach it to the antenna
connector located on the side of the DCS-2332L.
Step 2
Press and hold the WPS button for approximately 5-6 seconds. The blue WPS
status LED on the front panel will blink.
Step 3
Within 60 seconds press the WPS button on your router. On some routers, you
may need to log in to the web interface and click on an on-screen button to
activate the WPS feature. If you are not sure where the WPS button is on your
router, please refer to your router’s User Manual.
The DCS-2332L will automatically create a wireless connection to your router.
While connecting, the status LED will ash. When the connection process is
complete, the status LED will turn solid.
Note: If your router does not support WPS, you can still use the wired connection
method on the previous page. After Zero Conguration setup is complete, your
router's wireless settings will be automatically transferred to the camera.
Optional: WPS Wireless Connection
Alternatively, if your router supports WPS, you can use the WPS button on the
camera to easily create a secure wireless connection to your network.
WPS Button
2
1
16D-Link DCS-2332L User Manual
Section 2: Installation
If you have a mydlink-enabled Cloud Router, you can take advantage of Zero Conguration. Zero Conguration automatically
congures your camera's settings for you, and adds it to your mydlink account automatically. This type of setup allows you to
set up your camera by simply plugging it in and connecting it to your router.
Connect your camera to your mydlink-enabled Cloud Router and Zero Conguration will automatically congure your DCS-2332L
and automatically add the camera to your mydlink account. After the short time it takes to do this you can remotely access
your camera from the www.mydlink.com website to manage and monitor your DCS-2332L.
Connect the Ethernet Cable
Using the pre-attached Ethernet cable connect the free end to your network.
Attach the External Power Supply
Attach the external power supply to your wall outlet or power strip.
Installation
Zero Conguration Setup
17D-Link DCS-2332L User Manual
Section 2: Installation
A summary and conrmation notication will appear with the automatically
congured details. Make a note of the details and click Yes to add the camera to
your account.
Check Your mydlink Account
Open a web browser and login to your mydlink account. The mydlink page will
check for new devices and display a New device Found! pop-up notication in
the bottom-left corner. Click the notication to continue.
DCS-2332L
18D-Link DCS-2332L User Manual
Section 2: Installation
Zero Conguration will navigate to the mydlink Live View tab for your camera
where you will see a screen similar to the following.
If you wish to connect your camera to your router wirelessly, you can simply
disconnect the Ethernet cable and move the camera to its intended location; your
router's wireless settings have been automatically transferred to the camera, and
no further conguration is required.
Your camera is now set up, and you can skip to "mydlink" on page 23 to learn more
about the mydlink features of this camera, or to "Conguration" on page 24 for
advanced conguration of your camera.
19D-Link DCS-2332L User Manual
Section 2: Installation
Insert the Installation CD-ROM into your computer’s optical drive to start the autorun program.
Simply click Set up your Cloud Camera to go through the Setup Wizard, which will guide you step-by-step through the installation
process from connecting your hardware to conguring your camera and registering it with your mydlink account.
Camera Installation Wizard
Windows Users
Note: If the autorun program does not open, go to My Computer, browse to your CD drive, and double-click
on the setup.exe le.
20D-Link DCS-2332L User Manual
Section 2: Installation
Insert the Installation CD-ROM into your computer’s CD drive. On the desktop, open your CD drive and
double-click on the SetupWizard le.
Within 20-30 seconds, the Setup Wizard will open, which will guide you step-by-step through the installation process from
connecting your hardware to conguring your camera and registering it with your mydlink account.
Mac Users
Note: mydlink portal requires JavaTM to function correctly.
For more guidelines, please refer to mydlink FAQ pages at https://eu.mydlink.com/faq/mydlink
21D-Link DCS-2332L User Manual
Section 2: Installation
Manual Hardware Installation
If you wish to set up your camera without using the Camera Setup Wizard, please follow these steps.
Note: In order to use the mydlink features of this product, you will need to go through the Camera Setup Wizard.
Connect the Ethernet Cable
Using the pre-attached Ethernet cable connect the free end to your network.
Attach the External Power Supply
Attach the external power supply to your wall outlet or power strip.
22D-Link DCS-2332L User Manual
Section 2: Installation
SD Memory Card Installation
The SD memory card slot is housed behind the lower protective panel on the
rear of the device.
Step 1:
Place the camera face down on a non-slip at surface
Step 2:
Carefully pry out the two lower protective rubber grommets using a thin at blade.
Step 3:
Undo the two screws using a Philips #00 Screwdriver.
Step 4:
Lift o the protective panel.
Step 5:
Insert a MicroSD Memory Card.
Step 6:
Replace the protective panel.
Step 7:
Replace the two screws. Ensure that the screws are tightened rmly.
Step 8:
Firmly replace the protective rubber grommets.
Note: To ensure that the camera stays weatherproof, users are advised to ensure
that all the rubber seals are secured rmly in place.
23D-Link DCS-2332L User Manual
Section 2: Installation
mydlink
After registering your DCS-2332L camera with a mydlink account in the Camera Installation Wizard, you will be able to remotely
access your camera from the www.mydlink.com website. After signing in to your mydlink account, you will see a screen similar
to the following:
DCS-2332L
For more details on using your camera with mydlink, go to the Support section of the mydlink website and check the User
Manual section for your product to nd the latest instruction guide for your camera's mydlink features.
24D-Link DCS-2332L User Manual
Section 3: Conguration
Conguration
Using the Conguration Interface
After completing the Camera Installation Wizard, you are ready to use your camera. The camera’s built-in Web conguration utility is designed to
allow you to easily access and congure your DCS-2332L. At the end of the wizard, enter the IP address of your camera into a web browser, such as
Mozilla Firefox. To log in, use the User name admin and the password you created in the Installation Wizard. If you did not create a password, the
default password is blank. After entering your password, click OK.
25D-Link DCS-2332L User Manual
Section 3: Conguration
Live Video
This section shows your camera’s live video. You may select any of the available icons listed below to operate the camera. You may also select your
language using the drop-down menu on the left side of the screen.
You can zoom in and out on the live video image using your mouse. Right-click to zoom out or left-click to zoom in on the image.
Motion Trigger
Indicator
This indicator will change color when a trigger event occurs.
Note: The video motion feature for your camera must be
enabled.
Recording
Indicator
When a recording is in progress, this indicator will change
color.
Control Pad
This control pad can be used to electronically pan, tilt, and
zoom (ePTZ) within the camera's predened view area, if one
has been dened.
Auto Pan Starts the automatic panning function. The ROI will pan from
back and forth within the FOV
Stop Stops the camera ePTZ motion
Preset Path Starts the camera's motion along the predened path
You may select a value between 0 and 64. 0 is the slowest and 64 is the fastest.ePTZ Speed:
This option displays the status of the SD card. If no SD card has been
inserted, this screen will display the message "Card Invalid."
SD Status:
26D-Link DCS-2332L User Manual
Section 3: Conguration
If any presets have been dened, selecting a preset from this list will
display it.
Go To:
(Preset List)
Video Prole 1
Video Prole 2
Video Prole 3
Full screen mode
Taking a Snapshot
Record a Video Clip
Set a Storage Folder
Listen/Stop Audio In (from microphone)
Start/Stop Audio Out (to speaker)
This window indicates the total eld of view (FOV) of the camera. The
red box indicates the visible region of interest (ROI).
You may select the interface language using this menu.
Global View:
Language:
27D-Link DCS-2332L User Manual
Section 3: Conguration
Setup
Setup Wizard
To congure your Network Camera, click Internet Connection Setup Wizard. Alternatively,
you may click Manual Internet Connection Setup to manually congure your Network
Camera and skip to "Network Setup" on page 33.
To quickly congure your Network Camera’s motion detection settings, click Motion
Detection Setup Wizard. If you want to enter your settings without running the wizard, click
Manual Motion Detection Setup and skip to "Motion Detection" on page 44.
DCS-2332L
28D-Link DCS-2332L User Manual
Section 3: Conguration
Internet Connection Setup Wizard
This wizard will guide you through a step-by-step process to congure your new D-Link
Camera and connect the camera to the internet. Click Next to continue.
Note: Select DHCP if you are unsure of which settings to choose.
Click Next to continue.
29D-Link DCS-2332L User Manual
Section 3: Conguration
If you have a Dynamic DNS account and would like the camera to update your IP address
automatically, Select Enable DDNS and enter your host information. Click Next to continue.
Select Static IP if your Internet Service Provider has provided you with connection settings, or
if you wish to set a static address within your home network. Enter the correct conguration
information and click Next to continue.
If you are using PPPoE, select Enable PPPoE and enter your user name and password,
otherwise click Next to continue.
Enter a name for your camera and click Next to continue.
DCS-2332L
30D-Link DCS-2332L User Manual
Section 3: Conguration
Congure the correct time to ensure that all events will be triggered as scheduled. Click Next
to continue.
If you have selected DHCP, you will see a summary of your settings, including the camera's IP
address. Please write down all of this information as you will need it in order to access your
camera.
Click Apply to save your settings.
DCS-2332L
31D-Link DCS-2332L User Manual
Section 3: Conguration
This wizard will guide you through a step-by-step process to congure your camera's
motion detection functions.
Click Next to continue.
Step 1
This step will allow you to enable or disable motion detection, specify the detection sensitivity,
and adjust the camera’s ability to detect movement.
You may specify whether the camera should capture a snapshot or a video clip when motion
is detected.
Please see "Motion Detection" on page 44 for information about how to congure motion
detection.
Step 2
This step allows you to enable motion detection based on a customized schedule. Specify the
day and hours. You may also choose to always record motion.
Motion Detection Setup Wizard
32D-Link DCS-2332L User Manual
Section 3: Conguration
Step 3
This step allows you to specify how you will receive event notications from your
camera. You may choose not to receive notications, or to receive notications via
e-mail or FTP.
Please enter the relevant information for your e-mail or FTP account.
Click Next to continue.
Step 4
You have completed the Motion Detection Wizard.
Please verify your settings and click Apply to save them.
Please wait a few moments while the camera saves your settings and restarts.
33D-Link DCS-2332L User Manual
Section 3: Conguration
Network Setup
Use this section to congure the network connections for your camera. All relevant information must be entered accurately. After making any
changes, click the Save Settings button to save your changes.
LAN Settings:
DHCP:
Static IP Address:
IP Address:
Subnet Mask:
Default router:
Primary DNS:
Secondary DNS:
This section lets you congure settings for your local
area network.
Select this connection if you have a DHCP server running
on your network and would like your camera to obtain
an IP address automatically.
If you choose DHCP, you do not need to ll out the IP
address settings.
You may obtain a static or xed IP address and other
network information from your network administrator
for your camera. A static IP address may simplify access
to your camera in the future.
Enter the xed IP address in this eld.
This number is used to determine if the destination is in
the same subnet. The default value is 255.255.255.0.
The gateway used to forward frames to destinations in a
dierent subnet. Invalid gateway settings may cause the
failure of transmissions to a dierent subnet.
The primary domain name server translates names to IP
addresses.
The secondary DNS acts as a backup to the primary DNS.
DCS-2332L
34D-Link DCS-2332L User Manual
Section 3: Conguration
Enable UPnP Presentation:
Enable UPnP Port Forwarding:
Enable PPPoE:
User Name / Password:
HTTP Port:
Access Name for Stream 1~3:
HTTPS Port:
Authentication:
RTSP Port:
Access name for stream 1 ~ 3:
Enabling this setting allows your camera to be congured
as a UPnP device on your network.
Enabling this setting allows the camera to add port
forwarding entries into the router automatically on a
UPnP capable network.
Enable this setting if your network uses PPPoE.
Enter the username and password for your PPPoE account.
Re-enter your password in the Conrm Password eld.
You may obtain this information from your ISP.
The default port number is 80.
The default name is video#.mjpg, where # is the number
of the stream.
You may use a PC with a secure browser to connect to
the HTTPS port of the camera. The default port number
is 443.
Depending on your network security requirements, the Network Camera provides three types of security
settings for streaming via RTSP protocol: disable and digest. If digest authentication is selected, user
credentials are encrypted using MD5 algorithm, thus providing better protection against unauthorized
access.
The port number that you use for RTSP streaming to mobile devices, such as mobile phones or PDAs. The
default port number is 554. You may specify the address of a particular stream. For instance, live1.sdp can be
accessed at rtsp://x.x.x.x/video1.sdp where the x.x.x.x represents the ip address of your camera.
This Network Camera supports multiple streams simultaneously. The access name is used to dierentiate the
streaming source (video prole).
35D-Link DCS-2332L User Manual
Section 3: Conguration
COS SETTING:
QOS SETTING:
IPV6:
MULTICAST
Enabling the Class of Service setting implements a
best-eort policy without making any bandwidth
reservations.
Enabling QoS allows you to specify a trac priority
policy to ensure a consistent Quality of Service during
busy periods. If the Network Camera is connected to a
router that itself implements QoS, the router's settings
will override the QoS settings of the camera.
Enable the IPV6 setting to use the IPV6 protocol.
Enabling the option allows you to manually set up
the address, specify an optional IP address, specify an
optional router and an optional primary DNS.
The DCS-2332L allows you to multicast each of the
available streams via group address and specify the TTL
value for each stream. Enter the port and TTL settings
you wish to use if you do not want to use the defaults.
36D-Link DCS-2332L User Manual
Section 3: Conguration
Wireless Setup
This section allows you to set up and congure the wireless settings on your camera. After making any changes, click the Save Settings button to
save your changes.
Site Survey:
SSID:
Wireless Mode:
Channel:
Authentication:
Encryption:
Key:
Click the Rescan button to scan for available wireless
networks. After scanning, you can use the drop-down
box to select an available wireless network. The related
information (SSID, Wireless Mode, Channel, Authentication,
Encryption) will be automatically lled in for you.
Enter the SSID of the wireless access point you wish to
use.
Use the drop-down box to select the mode of the
wireless network you wish to connect to. Infrastructure
is normally used to connect to an access point or router.
Ad-Hoc is usually used to connect directly to another
computer.
If you are using Ad Hoc mode, select the channel of the
wireless network you wish to connect to, or select Auto.
Select the authentication you use on your wireless
network - Open, Shared, WPA-PSK, or WPA2-PSK.
If you use WPA-PSK or WPA2-PSK authentication, you
will need to specify whether your wireless network
uses TKIP or AES encryption. If you use Open or Shared
authentication, WEP encryption should be the setting.
If you use WEP, WPA-PSK, or WPA2-PSK authentication,
enter the Key (also known as password) used for your
wireless network.
DCS-2332L
37D-Link DCS-2332L User Manual
Section 3: Conguration
Dynamic DNS
DDNS (Dynamic Domain Name Server) will hold a DNS host name and synchronize the public IP address of the modem when it has been modied.
A user name and password are required when using the DDNS service. After making any changes, click the Save Settings button to save your
changes.
Enable DDNS:
Server Address:
Host Name:
User Name:
Password:
Timeout:
Status:
Select this checkbox to enable the DDNS function.
Select your Dynamic DNS provider from the pull down
menu or enter the server address manually.
Enter the host name of the DDNS server.
Enter the user name or e-mail used to connect to your
DDNS account.
Enter the password used to connect to your DDNS
server account.
Enter the DNS timeout values you wish to use.
Indicates the connection status, which is automatically
determined by the system.
DCS-2332L
38D-Link DCS-2332L User Manual
Section 3: Conguration
Image Setup
In this section, you may congure the video image settings for your camera. A preview of the image will be shown in Live Video.
Enable Privacy Mask:
Anti Flicker:
Mirror:
Flip:
Power Line:
White Balance:
The Privacy Mask setting allows you to specify up to 3
rectangular areas on the camera's image to be blocked/
excluded from recordings and snapshots.
You may click and drag the mouse cursor over the
camera image to draw a mask area. Right clicking on the
camera image brings up the following menu options:
Disable All: Disables all mask areas
Enable All: Enables all mask areas
Reset All: Clears all mask areas.
If the video ickers, try enabling this setting.
This will mirror the image horizontally.
This will ip the image vertically. When turning Flip on,
you may want to consider turning Mirror on as well.
Select the frequency used by your power lines to avoid
interference or distortion.
Use the drop-down box to change white balance settings
to help balance colors for dierent environments. You
can choose from Auto, Outdoor, Indoor, Fluorescent,
and Push Hold.
DCS-2332L
39D-Link DCS-2332L User Manual
Section 3: Conguration
Exposure Mode:
Denoise:
Brightness:
Contrast:
Saturation:
Sharpness:
Reset Default:
Changes the exposure mode. Use the drop-down
box to set the camera for Indoor, Outdoor, or Night
environments, or to Moving to capture moving objects.
The Low Noise option will focus on creating a high-
quality picture without noise. You can also create 3
dierent custom exposure modes. The Max Gain setting
will allow you to control the maximum amount of gain
to apply to brighten the picture.
This setting controls the amount of noise reduction that
will be applied to the picture.
Adjust this setting to compensate for backlit subjects.
Adjust this setting to alter the color intensity/strength.
This setting controls the amount of coloration, from
grayscale to fully saturated.
Specify a value from 0 to 8 to specify how much
sharpening to apply to the image.
Click this button to reset the image to factory default
settings.
40D-Link DCS-2332L User Manual
Section 3: Conguration
Audio and Video
You may congure up to 3 video proles with dierent settings for your camera. Hence, you may set up dierent proles for your computer and
mobile display. In addition, you may also congure the two-way audio settings for your camera. After making any changes, click the Save Settings
button to save your changes.
Aspect ratio:
Mode:
Frame size / View window area:
Maximum frame rate:
Set the aspect ratio of the video to 4:3 standard or 16:9
widescreen.
Set the video codec to be used to JPEG, MPEG-4, or
H.264.
Frame size determines the total capture resolution, and
View window area determines the Live Video viewing
window size. If the Frame size is larger than the Live
Video size, you can use the ePTZ controls to look around.
16:9 1280 x 800, 1280 x 720, 800 x 450,
640 x 360, 480 x 270, 320 x 176,
176 x 144
4:3 1024 x 768, 800 x 600, 640 x 480,
480 x 360, 320 x 240, 176 x 144
Note: If your View window area is the same as your Frame
size, you will not be able to use the ePTZ function.
A higher frame rate provides smoother motion for
videos, and requires more bandwidth. Lower frame
rates will result in stuttering motion, and requires less
bandwidth.
DCS-2332L
41D-Link DCS-2332L User Manual
Section 3: Conguration
Video Quality:
Constant bit rate:
Fixed quality:
Audio in o:
Audio in gain level:
Audio out o:
Audio out volume level:
This limits the maximum frame rate, which can be
combined with the "Fixed quality" option to optimize
the bandwidth utilization and video quality. If xed
bandwidth utilization is desired regardless of the video
quality, choose "Constant bit rate" and select the desired
bandwidth.
The bps will aect the bit rate of the video recorded
by the camera. Higher bit rates result in higher video
quality.
Select the image quality level for the camera to try to
maintain. High quality levels will result in increased bit
rates.
Selecting this checkbox will mute incoming audio.
This setting controls the amount of gain applied to
incoming audio to increase its volume.
Selecting this checkbox will mute outgoing audio.
This setting controls the amount of gain applied to
outgoing audio to increase its volume.
DCS-2332L
42D-Link DCS-2332L User Manual
Section 3: Conguration
Preset
This screen allows you to set preset points for the ePTZ function of the camera, which allows you to look around the camera's viewable area by
using a zoomed view. Presets allow you to quickly go to and view a specic part of the area your camera is covering, and you can create preset
sequences, which will automatically change the camera's view between the dierent presets according to a dened order and timing you can set.
Note: If your View window area is the same as your Frame size, you will not be able to use the ePTZ function.
Video Prole:
ePTZ Speed:
Arrow Buttons and Home Button:
Input Preset Name:
Preset List:
Preset Sequence:
This selects which video prole to use.
You may select a value between 0 and 64. 0 is the slowest
and 64 is the fastest.
Use these buttons to move to a specic part of the
viewing area, which you can then set as a preset. Click
the Home button to return to the center of the viewing
area.
Enter the name of the preset you want to create, then
click the Add button to make a new preset. If an existing
preset has been selected from the Preset List, you can
change its name by typing in a new name, then clicking
the Rename button.
Click this drop-down box to see a list of all the presets
that have been created. You can select one, then click
the GoTo button to change the displayed camera view
to the preset. Clicking the Remove button will delete
the currently selected preset.
This section allows you to create a preset sequence,
which automatically moves the camera's view between
a set of preset views.
DCS-2332L
43D-Link DCS-2332L User Manual
Section 3: Conguration
Preset List: To add a preset to the sequence, select it from the drop-
down box at the bottom of this window, set the Dwell
time to determine how long the camera view will stay at
that preset, then click the Add button. The preset name
will appear in the list, followed by the dwell time to view
that preset for.
You can rearrange your presets in the sequence by
selecting a preset in the sequence, then clicking the
arrow buttons to move it higher or lower in the current
sequence.
Clicking the trash can button will remove the currently
selected preset from the sequence.
If you want to change the dwell time for a preset, select
it from the list, enter a new dwell time, then click the
Update button.
44D-Link DCS-2332L User Manual
Section 3: Conguration
Motion Detection
Enabling Video Motion will allow your camera to use the motion detection feature. You may draw a nite motion area that will be used for
monitoring. After making any changes, click the Save Settings button to save your changes.
Enable Video Motion:
Sensitivity:
Percentage:
Draw Motion Area:
Erase Motion Area:
Select this box to enable the motion detection feature
of your camera.
Species the measurable dierence between two
sequential images that would indicate motion. Please
enter a value between 0 and 100.
Species the amount of motion in the window being
monitored that is required to initiate an alert. If this is set
to 100%, motion is detected within the whole window
will trigger a snapshot.
Draw the motion detection area by dragging your mouse
in the window (indicated by the red square).
To erase a motion detection area, simply click on the red
square that you wish to remove.
Right clicking on the camera image brings up the
following menu options:
Select All: Draws a motion detection area over the
entire screen.
Clear All: Clears any motion detection areas that have
been drawn.
Restore: Restores the previously specied motion
detection areas.
DCS-2332L
45D-Link DCS-2332L User Manual
Section 3: Conguration
Time and Date
This section allows you to automatically or manually congure, update, and maintain the internal system clock for your camera. After making any
changes, click the Save Settings button to save your changes.
Time Zone:
Enable Daylight Saving:
Auto Daylight Saving:
Set Date and Time Manually:
Oset:
Synchronize with NTP Server:
NTP Server:
Set the Date and Time Manually:
Copy Your Computer's Time
Settings:
Select your time zone from the drop-down menu.
Select this to enable Daylight Saving Time.
Select this option to allow your camera to congure the
Daylight Saving settings automatically.
Selecting this option allows you to congure the Daylight
Saving date and time manually.
Sets the amount of time to be added or removed when
Daylight Saving is enabled.
Enable this feature to obtain time automatically from an
NTP server.
Network Time Protocol (NTP) synchronizes the DCS-
2332L with an Internet time server. Choose the one that
is closest to your location.
This option allows you to set the time and date manually.
This will synchronize the time information from your PC.
DCS-2332L
46D-Link DCS-2332L User Manual
Section 3: Conguration
Event Setup
In a typical application, when motion is detected, the DCS-2332L sends images to a FTP server or via e-mail as notications. As shown in the
illustration below, an event can be triggered by many sources, such as motion detection or external digital input devices. When an event is
triggered, a specied action will be performed. You can congure the Network Camera to send snapshots or videos to your e-mail address or FTP
site.
H[
0RWLRQGHWHFWLRQ
3HULRGLFDOO\'LJLWDOLQSXW
6\VWHPUHERRW
(YHQW&RQGLWLRQ
H[
6QDSVKRW9LGHR&OLSV
H[
(PDLO)73
0HGLD
ZKDWWRVHQG
6HUYHU
ZKHUHWRVHQG
$FWLRQ
To start plotting an event, it is suggested to congure server and media columns rst so that the Network Camera will know what action shall be
performed when a trigger is activated.
47D-Link DCS-2332L User Manual
Section 3: Conguration
The Event Setup page includes 4 dierent sections.
• Event
• Server
• Media
• Recording
1. To add a new item - "event, server or media," click Add. A screen will appear and allow you
to update the elds accordingly.
2. To delete the selected item from the pull-down menu of event, server or media, click Delete.
3. Click on the item name to pop up a window for modifying.
DCS-2332L
48D-Link DCS-2332L User Manual
Section 3: Conguration
Add Server
Server Name:
E-mail:
FTP:
Network Storage:
SD Card:
Enter the unique name of your server.
Enter the conguration for the target e-mail server
account.
Enter the conguration for the target FTP server account.
Specify a network storage device. Only one network
storage device is supported.
Use the camera's onboard SD card storage.
You can congure up to 5 servers to save snapshots and/or video to. After making any
changes, click the Save Settings button to save your changes.
DCS-2332L
49D-Link DCS-2332L User Manual
Section 3: Conguration
Add Media
Media Name:
Snapshot:
Source:
Send pre-event image(s) [0~4]:
Send post-event image(s) [0~7]:
File name prex:
Add date and time sux to le
name:
Enter a unique name for media type you want to create.
Select this option to set the media type to snapshots.
Set the video prole to use as the media source. Refer
to "Audio and Video" on page 40 for more information on
video proles.
Set the number of pre-event images to take. Pre-event
images are images taken before the main event snapshot
is taken.
Set the number of post-event images to take. Post-event
images are images taken after the main event snapshot
is taken. You can set up to 7 post-event images to be
taken.
The prex name will be added on the le name.
Check it to add timing information as le name sux.
There are three types of media, Snapshot, Video Clip, and System Log. After making any
changes, click the Save Settings button to save your changes.
DCS-2332L
50D-Link DCS-2332L User Manual
Section 3: Conguration
Video clip:
Source:
Pre-event recording:
Maximum duration:
Maximum le size:
File name prex:
System log:
Select this option to set the media type to video clips.
Set the video prole to use as the media source. Refer to
"Audio and Video" on page 46 for more information on
video proles.
This sets how many seconds to record before the main
event video clip starts. You can record up to 4 seconds of
pre-event video.
Set the maximum length of video to record for your
video clips.
Set the maximum le size to record for your video clips.
This is the prex that will be added to the lename of
saved video clips.
Select this option to set the media type to system logs.
This will save the event to the camera system log, but
will not record any snapshots or video.
DCS-2332L
51D-Link DCS-2332L User Manual
Section 3: Conguration
Add Event
Create and schedule up to 2 events with their own settings here. After making any changes,
click the Save Settings button to save your changes.
Event name:
Enable this event:
Priority:
Delay:
Trigger:
Video Motion Detection:
Periodic:
System Boot:
Network Lost:
Passive Infrared Sensor:
Enter a name for the event.
Select this box to activate this event.
Set the priority for this event. The event with higher
priority will be executed rst.
Select the delay time before checking the next event. It
is being used for both events of motion detection and
digital input trigger.
Specify the input type that triggers the event.
Motion is detected during live video monitoring. Select
the windows that need to be monitored.
The event is triggered in specied intervals. The trigger
interval unit is in minutes.
Triggers an event when the system boots up.
Triggers an event when the network connection is lost.
Triggers an event when the PIR sensor is activated by
moving infrared objects even in dark environment.
DCS-2332L
52D-Link DCS-2332L User Manual
Section 3: Conguration
Time:
Server:
Select Always or enter the time interval.
Specify the location where the event information should
be saved to.
DCS-2332L
53D-Link DCS-2332L User Manual
Section 3: Conguration
Add Recording
Recording entry name:
Enable this recording:
Priority:
Source:
Recording schedule:
Recording settings:
Destination:
Total cycling recording size:
The unique name of the entry.
Select this to enable the recording function.
Set the priority for this entry. The entry with a higher
priority value will be executed rst.
The source of the stream.
Scheduling the recording entry.
Conguring the setting for the recording.
Select the folder where the recording le will be stored.
Please input a HDD volume between 1MB and 2TB for
recording space. The recording data will replace the
oldest record when the total recording size exceeds this
value. For example, if each recording le is 6MB, and the
total cyclical recording size is 600MB, then the camera
will record 100 les in the specied location (folder) and
then will delete the oldest le and create new le for
cyclical recording.
Please note that if the free HDD space is not enough, the
recording will stop. Before you set up this option please
make sure your HDD has enough space, and it is better to
not save other les in the same folder as recording les.
Here you can congure and schedule the recording settings. After making any changes,
click the Save Settings button to save your changes.
DCS-2332L
54D-Link DCS-2332L User Manual
Section 3: Conguration
Size of each le for recording:
Time of each le for recording:
File Name Prex:
If this is selected, les will be separated based on the le
size you specify.
If this is selected, les will be separated based on the
maximum length you specify.
The prex name will be added on the le name of the
recording le(s).
DCS-2332L
55D-Link DCS-2332L User Manual
Section 3: Conguration
SD Card
Format SD Card:
View Recorded Picture:
Playback Recorded Video:
Refresh:
Click this icon to automatically format the SD card and
create "picture" & "video" folders.
If the picture les are stored on the SD card, click on the
picture folder and choose the picture le you would like
to view.
If video les are stored on the SD card, click on the video
folder and choose the video le you would like to view.
Reloads the le and folder information from the SD card.
Here you may browse and manage the recorded les which are stored on the SD card.
DCS-2332L
56D-Link DCS-2332L User Manual
Section 3: Conguration
Here you can congure the ICR and IR settings. An IR(Infrared) Cut-Removable(ICR) lter can be disengaged for increased sensitivity in low light
environments. Automatic:
Day Mode:
Night Mode:
Schedule Mode:
IR Light Control:
O:
On:
Sync:
Schedule:
The Day/Night mode is set automatically. Generally, the
camera uses Day mode and switches to Night mode
when needed.
Day mode enables the IR Cut Filter.
Night mode disables the IR Cut Filter.
Set up the Day/Night mode using a schedule. The camera
will enter Day mode at the starting time and return to
Night mode at the ending time.
The camera can enable or disable the IR (infrared) light
according to your preferences. This setting provides
additional controls depending on your specic application.
The IR light will always be o.
The IR light will always be on.
The IR light will turn on when the ICR sensor is on.
The IR light will turn on or o according to the schedule
that you specify below.
Advanced
ICR and IR
DCS-2332L
57D-Link DCS-2332L User Manual
Section 3: Conguration
HTTPS
This page allows you to install and activate an HTTPS certicate for secure access to your camera. After making any changes, click the Save Settings
button to save your changes.
Enable HTTPS Secure Connection:
Create Certicate Method:
Status:
Note:
Enable the HTTPS service.
Choose the way the certicate should be created. Three
options are available:
Create a self-signed certicate automatically
Create a self-signed certicate manually
Create a certicate request and install
Displays the status of the certicate.
The certicate cannot be removed while the HTTPS is
still enabled. To remove the certicate, you must rst
uncheck Enable HTTPS secure connection.
DCS-2332L
58D-Link DCS-2332L User Manual
Section 3: Conguration
Access List
Here you can set access permissions for users to view your DCS-2332L.
Allow list:
Start IP address:
End IP address:
Delete allow list:
Deny list:
Delete deny list:
The list of IP addresses that have the access right to the
camera.
The starting IP Address of the devices (such as a computer)
that have permission to access the video of the camera.
Click Add to save the changes made.
Note: A total of seven lists can be congured for both
columns.
The ending IP Address of the devices (such as a computer)
that have permission to access the video of the camera.
Remove the customized setting from the Allow List.
The list of IP addresses that have no access rights to the
camera.
Remove the customized setting from the Delete List.
For example:
When the range of the Allowed List is set from 1.1.1.0
to 192.255.255.255 and the range of the Denied List is
set from 1.1.1.0 to 170.255.255.255. Only users with IPs
located between 171.0.0.0 and 192.255.255.255 can
access the Network Camera.
$ORZHG
/LVW
'HQLHG
/LVW
DCS-2332L
59D-Link DCS-2332L User Manual
Section 3: Conguration
System
In this section, you may backup, restore and reset the camera conguration, or reboot the camera.
Save To Local Hard Drive:
Local From Local Hard Drive:
Restore to Factory Default:
Reboot Device:
You may save your current camera conguration as a le
on your computer.
Locate a pre-saved conguration by clicking Browse and
then restore the pre-dened settings to your camera by
clicking Load Conguration.
You may reset your camera and restore the factory
settings by clicking Restore Factory Defaults.
This will restart your camera.
DCS-2332L
60D-Link DCS-2332L User Manual
Section 3: Conguration
Maintenance
Device Management
You may modify the name and administrator’s password of your camera, as well as add and manage the user accounts for accessing the camera.
You may also use this section to create a unique name and congure the OSD settings for your camera.
Admin Password Setting:
Add User Account:
User Name:
Password:
User List:
Camera Name:
Enable OSD:
Label:
Show Time:
Set a new password for the administrator’s account.
Add new user account.
The user name for the new account.
The password for the new account.
All the existing user accounts will be displayed here. You
may delete accounts included in the list, but you may
want to reserve at least one as a guest account.
Create a unique name for your camera that will be added
to the le name prex when creating a snapshot or a
video clip.
Select this option to enable the On-Screen Display
feature for your camera.
Enter a label for the camera, which will be shown on the
OSD when it is enabled.
Select this option to enable the time-stamp display on
the video screen.
DCS-2332L
61D-Link DCS-2332L User Manual
Section 3: Conguration
Firmware Upgrade
The camera's current rmware version will be displayed on this screen. You may visit the D-Link Support Website to check for the latest available
rmware version.
To upgrade the rmware on your DCS-2332L, please download and save the latest rmware version from the D-Link Support Page to your local
hard drive. Locate the le on your local hard drive by clicking the Browse button. Select the le and click the Upload button to start upgrading the
rmware.
Current Firmware Version:
Current Product Name:
File Path:
Upload:
Displays the detected rmware version.
Displays the camera model name.
Locate the le (upgraded rmware) on your hard drive
by clicking Browse.
Uploads the new rmware to your camera.
DCS-2332L
62D-Link DCS-2332L User Manual
Section 3: Conguration
Status
Device Info
This page displays detailed information about your device and network connection.
DCS-2332L
DCS-2332L
63D-Link DCS-2332L User Manual
Section 3: Conguration
This page displays the log information of your camera. You may download the information by clicking Download. You may also click Clear to delete
the saved log information.
Logs
DCS-2332L
64D-Link DCS-2332L User Manual
Section 3: Conguration
This page provides helpful information regarding camera operation.
Help
DCS-2332L
65D-Link DCS-2332L User Manual
Appendix A: Technical Specications
Technical Specications
Camera Camera Hardware
Prole
1/4” Megapixel progressive CMOS sensor
5 meter IR illumination distance
Minimum illumination: 0 lux with IR LED on
Built-in Infrared-Cut Removable (ICR) Filter module
Built-in PIR sensor (5 meter)
Built-in microphone and speaker
10x digital zoom
Focal length: 3.45 mm
Aperture: F2.0
Angle of view:
(H) 57.8°
(V) 37.8°
(D) 66°
Image Features
Congurable image size, quality, frame rate, and bit rate
Time stamp and text overlays
Congurable motion detection windows
Congurable privacy mask zones
Congurable shutter speed, brightness, saturation, contrast,
and sharpness
Video Compression
Simultaneous H.264/MPEG-4/MJPEG format compression
H.264/MPEG-4 multicast streaming
JPEG for still images
Video Resolution 16:9 - 1280 x 800, 1280 x 720, 800 x 450, 640 x 360, 480 x 270, 320
x 176, 176 x 144
4:3 - 1024 x 768, 800 x 600, 640 x 480, 480 x 360, 320 x 240, 176 x
144
Audio Support G.726, G.711
External Device
Interface
10/100 BASE-TX Fast Ethernet port
IEEE 802.11n 2.4GHz single band wireless
MicroSD/SDHC card slot
Network Network Protocols IEEE 802.11n 2.4GHz single band wireless
IPv6
IPv4
TCP/IP
UDP
ICMP
DHCP client
NTP client (D-Link)
DNS client
DDNS client (D-Link)
SMTP client
FTP client
HTTP / HTTPS
Samba Client
PPPoE
UPnP port forwarding
RTP / RTSP/ RTCP
IP ltering
QoS
CoS
Multicast
IGMP
ONVIF compliant
Security
Administrator and user group protection
Password authentication
HTTP and RTSP digest encryption
66D-Link DCS-2332L User Manual
Appendix A: Technical Specications
System
Management
System
Requirements for
Web Interface
Operating System: Microsoft Windows 7/Vista/XP/2000
Browser: Internet Explorer, Firefox, Chrome, Safari
Event Management
Motion detection
Event notication and uploading of snapshots/video clips via
e-mail or FTP
Supports multiple SMTP and FTP servers
Multiple event notications
Multiple recording methods for easy backup
Remote
Management
Take snapshots/video clips and save to local hard drive or NAS
via web browser
Conguration interface accessible via web browser
Mobile Support Windows 7/Vista/XP system, Pocket PC, or mobile phone mydlink mobile app for iOS and Android mobile devices
D-ViewCam™ System
Requirements
Operating System: Microsoft Windows 7/Vista/XP
Web Browser: Internet Explorer 7 or higher
Protocol: Standard TCP/IP
D-ViewCam™
Software Functions
Remote management/control of up to 32 cameras
Viewing of up to 32 cameras on one screen
Supports all management functions provided in web interface
Scheduled motion triggered, or manual recording options
General Weight 255 g
External Power
Adaptor Input: 100 to 240 V AC, 50/60 Hz Output: 5 V DC, 1.2 A
Power Consumption 5.5 Watts
Temperature Operating: -25 to 50 °C (-13 to 122 °F) Storage: -20 to 70 °C (-4 to 158 °F)
Humidity Operating: 20% to 80% non-condensing Storage: 5% to 95% non-condensing
Certications CE
CE LVD
FCC
C-Tick
IP65
IC
67D-Link DCS-2332L User Manual
Appendix A: Technical Specications
Dimensions
Transmitters shall display the following notice in a conspicuous
location:
Under Industry Canada regulations, this radio transmitter may only
operate using an antenna of a type and maximum (or lesser) gain
approved for the transmitter by Industry Canada. To reduce
potential radio interference to other users, the antenna type and its
gain should be so chosen that the equivalent isotropically radiated
power (e.i.r.p.) is not more than that necessary for successful
communication.
This radio transmitter (identify the device by certification number, or
model number if Category II) has been approved by Industry
Canada to operate with the antenna types listed below with the
maximum permissible gain and required antenna impedance for
each antenna type indicated. Antenna types not included in this list,
having a gain greater than the maximum gain indicated for that type,
are strictly prohibited for use with this device.
)&&1RWLFHV
This device complies with Part 15 of the FCC Rules. Operation is subject to the following
two conditions: (1) this device may not cause harmful interference, and (2) this device
must accept any interference received, including interference that may cause undesired
operation.
CAUTION: Change or modification not expressly approved by the party responsible
for compliance could void the user’s authority to operate this equipment.
This equipment has been tested and found to comply with the limits for a Class B
digital device, pursuant to Part 15 of the FCC Rules. These limits are designed to provide
reasonable protection against harmful interference in a residential installation. This
equipment generates, uses and can radiate radio frequency energy and, if not installed
and used in accordance with the instructions, may cause harmful interference to radio
communications. However, there is no guarantee that interference will not occur in a
particular installation. If this equipment does cause harmful interference to radio or
television reception, which can be determined by turning the equipment off and on, the
user is encouraged to try to correct the interference by one or more of the following
measures:
--Reorient or relocate the receiving antenna.
--Increase the separation between the equipment and receiver.
--Connect the equipment into an outlet on a circuit different from that to which the receiver
is connected.
--Consult the dealer or an experienced radio/TV technician for help.
CAUTION:
Any changes or modifications not expressly approved by the grantee of this device could
void the user's authority to operate the equipment.
RF exposure warning
This equipment must be installed and operated in accordance with provided instructions
and the antenna(s) used for this transmitter must be installed to provide a separation
distance of at least 20 cm from all persons and must not be co-located or operating in
conjunction with any other antenna or transmitter. End-users and installers must be
provide with antenna installation instructions and transmitter operating conditions for
satisfying RF exposure compliance."
Canada Notices
,QGXVWU\&DQDGDUHJXODWRU\LQIRUPDWLRQ
7KLVGHYLFHFRPSOLHVZLWK,QGXVWU\&DQDGDOLFHQFHH[HPSW566VWDQGDUGV
2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQVWKLVGHYLFHPD\QRWFDXVH
LQWHUIHUHQFHDQGWKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHLQFOXGLQJLQWHUIHUHQFH
WKDWPD\FDXVHXQGHVLUHGRSHUDWLRQRIWKHGHYLFH
7KHXVHULVFDXWLRQHGWKDWWKLVGHYLFHVKRXOGEHXVHGRQO\DVVSHFLILHGZLWKLQWKLV
PDQXDOWRPHHW5)H[SRVXUHUHTXLUHPHQWV8VHRIWKLVGHYLFHLQDPDQQHU
LQFRQVLVWHQWZLWKWKLVPDQXDOFRXOGOHDGWRH[FHVVLYH5)H[SRVXUHFRQGLWLRQV
Le présent appareil est conforme aux CNR d'Industrie Canada
applicables aux appareils radio exempts de licence. L'exploitation est
autorisée aux deux conditions suivantes : (1) l'appareil ne doit pas
produire de brouillage, et (2) l'utilisateur de l'appareil doit accepter tout
brouillage radioélectrique subi, même si le brouillage est susceptible
d'en compromettre le fonctionnement.
5)H[SRVXUHZDUQLQJ
7KLVHTXLSPHQWPXVWEHLQVWDOOHGDQGRSHUDWHGLQDFFRUGDQFHZLWK
SURYLGHGLQVWUXFWLRQVDQGWKHDQWHQQDVXVHGIRUWKLVWUDQVPLWWHUPXVW
EHLQVWDOOHGWRSURYLGHDVHSDUDWLRQGLVWDQFHRIDWOHDVWFPIURPDOO
SHUVRQVDQGPXVWQRWEHFRORFDWHGRURSHUDWLQJLQFRQMXQFWLRQZLWKDQ\
RWKHUDQWHQQDRUWUDQVPLWWHU(QGXVHUVDQGLQVWDOOHUVPXVWEHSURYLGH
ZLWKDQWHQQDLQVWDOODWLRQLQVWUXFWLRQVDQGWUDQVPLWWHURSHUDWLQJ
FRQGLWLRQVIRUVDWLVI\LQJ5)H[SRVXUHFRPSOLDQFH
&HWpTXLSHPHQWGRLWrWUHLQVWDOOpHWXWLOLVpFRQIRUPpPHQWDX[
LQVWUXFWLRQVIRXUQLHVHWGHODQWHQQHVXWLOLVpSRXUFHWpPHWWHXUGRLWrWUH
LQVWDOOpSRXUIRXUQLUXQHGLVWDQFHGHVpSDUDWLRQGDXPRLQVFPGH
WRXWHSHUVRQQHHWQHGRLWSDVrWUHFRORFDOLVpVRXIRQFWLRQQDQWHQ
FRQMRQFWLRQDYHFXQHDXWUHDQWHQQHRXWUDQVPHWWHXU/HVXWLOLVDWHXUV
ILQDX[HWLQVWDOODWHXUVGRLYHQWrWUHIRXUQLUGHVLQVWUXFWLRQVGLQVWDOODWLRQ
GHODQWHQQHHWGHVFRQGLWLRQVGHIRQFWLRQQHPHQWGXWUDQVPHWWHXUGHOD
FRQIRUPLWpVXUOH[SRVLWLRQDX[5)