D Link CS2332LA1 HD Wirless N Outdoor Network Camera User Manual DCS 2332L A1 Manual v1 00 WW 01 11

Download:
Mirror Download [FCC.gov]
Document ID	1880571
Application ID	NDvU8PcNH6Xj8VYU9Ajmgg==
Document Description	User Manual
Short Term Confidential	No
Permanent Confidential	No
Supercede	No
Document Type	User Manual
Display Format	Adobe Acrobat PDF - pdf
Filesize	234.1kB (2926196 bits)
Date Submitted	2013-01-16 00:00:00
Date Available	2013-01-16 00:00:00
Creation Date	2013-01-11 19:16:01
Producing Software	Acrobat Distiller 5.0.5 (Windows)
Document Lastmod	2013-01-11 19:16:01
Document Title	DCS-2332L_A1_Manual_v1.00(WW)-01.11.pdf
Document Creator	PScript5.dll Version 5.2
Document Author:	kosame.lin

Version 1.0 | 10/23/2012
User Manual
HD Wireless Outdoor Cloud Camera
DCS-2332L
Preface
D-Link reserves the right to revise this publication and to make changes in the content hereof without obligation to notify any person or
organization of such revisions or changes. Information in this document may become obsolete as our services and websites develop and
change. Please refer to the www.mydlink.com website for the most current information.
Manual Revisions
Revision
Date
1.0
October 23, 2012
Description
DCS-2332L Revision A1 with firmware version 1.00
Trademarks
D-Link and the D-Link logo are trademarks or registered trademarks of D-Link Corporation or its subsidiaries in the United States or other
countries. All other company or product names mentioned herein are trademarks or registered trademarks of their respective companies.
Copyright Š 2012 D-Link Corporation.
All rights reserved. This publication may not be reproduced, in whole or in part, without prior expressed written permission from D-Link Corporation.
D-Link DCS-2332L User Manual
Table of Contents
Product Overview......................................................................... 4
Package Contents ................................................................. 4
Introduction............................................................................ 5
System Requirements ......................................................... 5
Features .................................................................................... 6
Hardware Overview ............................................................. 7
Front ...................................................................................... 7
Rear: External...................................................................... 8
Rear: Internal ...................................................................... 9
Removing the Top Panel ..................................................10
Replacing the Ethernet Cable ....................................11
Reattaching the Top Panel ...........................................12
Removing the Bottom Panel ..........................................13
Using the Reset Button .................................................13
Installing an SD Memory Card ...................................14
Reattaching the Bottom Panel ...................................14
Installation ....................................................................................16
Zero Configuration Setup ................................................16
Camera Installation Wizard .............................................19
Windows Users ....................................................................19
Mac Users...............................................................................20
Manual Hardware Installation ........................................21
SD Memory Card Installation .........................................22
mydlink...........................................................................................23
Configuration ...............................................................................24
Using the Configuration Interface ................................24
D-Link DCS-2332L User Manual
Live Video ..............................................................................25
Setup .......................................................................................27
Setup Wizard ....................................................................27
Network Setup .................................................................33
Wireless Setup..................................................................36
Dynamic DNS ...................................................................37
Image Setup .....................................................................38
Audio and Video ..............................................................40
Preset...................................................................................42
Motion Detection ...........................................................44
Time and Date ..................................................................45
Event Setup .......................................................................46
SD Card ...............................................................................55
Advanced...............................................................................56
ICR and IR ...........................................................................56
HTTPS ..................................................................................57
Access List..........................................................................58
System ................................................................................59
Maintenance.........................................................................60
Device Management .....................................................60
Firmware Upgrade..........................................................61
Status ......................................................................................62
Device Info ............................................................................62
Logs .....................................................................................63
Help......................................................................................64
Technical Specifications ...........................................................65
Section 1: Product Overview
Product Overview
Package Contents
DCS-2332L HD Wireless Outdoor Cloud Camera
CAT5 Ethernet cable (Pre-Attached)
Power adapter (Pre-Attached)
CD-ROM with User Manual and software
Quick Installation Guide
Antenna
If any of the above items are missing, please contact your reseller.
Note: Using a power supply with a different voltage than the one included with your
product will cause damage and void the warranty for this product.
D-Link DCS-2332L User Manual
Section 1: Product Overview
Introduction
Congratulations on your purchase of the DCS-2332L HD Wireless Outdoor Cloud Camera. The DCS-2332L is a versatile and
unique solution for your small office or home. Unlike a standard webcam, the DCS-2332L is a complete system with a built-in
CPU and web server that transmits high quality video images for security and outdoor surveillance. The DCS-2332L can be
accessed remotely, and controlled from any PC/Notebook over your local network or through the Internet via a web browser.
The simple installation and intuitive web-based interface offer easy integration with your Ethernet/Fast Ethernet or 802.11n/g
wireless network. The DCS-2332L also comes with remote monitoring and motion detection features for a complete and costeffective home security solution.
System Requirements
•
•
•
•
Computer with Microsoft Windows ÂŽ 8/7/Vista/XP, or Mac with OS X 10.6 or higher
PC with 1.3GHz or above and at least 128MB RAM
Internet Explorer 7, Firefox 12, Safari 4, or Chrome 20 or higher version with Java installed and enabled
Existing 10/100 Ethernet-based network or 802.11g/n wireless network
D-Link DCS-2332L User Manual
Section 1: Product Overview
Features
Simple to Use
The DCS-2332L is a stand-alone system with a built-in CPU, requiring no special hardware or software. The DCS-2332L supports both ActiveX mode
for Internet Explorer and Java mode for other browsers such as FirefoxÂŽ and SafariÂŽ.
Supports a Variety of Platforms
Supporting TCP/IP networking, HTTP, and other Internet related protocols. The DCS-2332L can also be integrated easily into other Internet/Intranet
applications because of its standards-based features.
Web Configuration
Using a standard Web browser, administrators can configure and manage the Network Camera directly from its own Web page via Intranet or
Internet. This means you can access your DCS-2332L anytime, anywhere in the world.
Broad Range of Applications
With today’s high-speed Internet services, the Network Camera can provide the ideal solution for delivering live video images over the Intranet and
Internet for remote monitoring. The Network Camera allows remote access using a Web browser for live image viewing, and allows the administrator
to manage and control the Network Camera anytime, anywhere in the world. Many applications exist, including industrial and public monitoring
of homes, offices, banks, hospitals, child-care centers, and amusement parks.
Remote Monitoring Utility
The D-ViewCam application adds enhanced features and functionality for the Network Camera and allows administrators to configure and access
the Network Camera from a remote site via Intranet or Internet. Other features include image monitoring, recording images to a hard drive, viewing
up to 32 cameras on one screen, and taking snapshots.
IR LED for Day and Night Functionality
The built-in infrared LEDs enables night time viewing of up to 16 feet (5 meters).
IP65 Weatherproof Housing
The DCS-2332L uses an IP65 weatherproof housing, allowing you to rest assured that in the toughest of conditions, it will continue to provide
round-the-clock surveillance.
802.11n Wireless or Ethernet/Fast Ethernet Support
The DCS-2332L offers wireless 802.11n and Ethernet/Fast Ethernet connectivity, making the DCS-2332L easy to integrate into your existing
network environment. The DCS-2332L works with a 10Mbps Ethernet based network or 100Mbps Fast Ethernet based network for traditional wired
environments, and works with 802.11n routers or access points for added flexibility. The Site Survey feature also allows you to view and connect to
any available wireless networks.
D-Link DCS-2332L User Manual
Section 1: Product Overview
Hardware Overview
Front
Camera Lens
ICR Sensor
Microphone
PIR
IR LED
WPS Status LED
Power/Status LED
Antenna
D-Link DCS-2332L User Manual
Records video of the surrounding area
The IR-Cut Removable sensor measures the lighting conditions and switches
between color and infrared accordingly
Records audio from the surrounding area
Passive Infrared sensor for motion detection
Infrared LED illuminates the camera's field of view at night
Indicates the WPS connection status of the camera
Indicates the camera's current status
Outdoor wireless antenna
Section 1: Product Overview
Rear: External
Weatherproof Cover
Protective Cable Cover
Ethernet Cable
Speaker
Weatherproof Cover
Weatherproof Screw Covering
Power Cable
Connected to the included DC 5 V power adapter
WPS Button
Press this button, then press the WPS button for 5 seconds on your
router to set up a wireless connection automatically
Adjustment Ring
D-Link DCS-2332L User Manual
Weatherproof protective panel
Weatherproof cable connection cover
RJ45 Ethernet cable to connect to your network
Audio output
Weatherproof cover for the MicroSD Card slot and reset button
Weatherproof protective covering for enclosure screws
Tighten or loosen the adjustment ring to adjust the camera's position
Section 1: Product Overview
Rear: Internal
DC Power Connector
RJ45 Ethernet Port
Reset Button
SD Memory Card Slot
D-Link DCS-2332L User Manual
Connected to the included DC 5 V power adapter
RJ45 connector for Ethernet
Use a paperclip or similar tool to press and hold the recessed button for
10 seconds to reset the camera
Insert a MicroSD card for for storing recorded images and video
Section 1: Product Overview
Removing the Top Panel
Step 1:
Place the camera face down on a non-slip flat surface.
Step 2:
Carefully pry out the two protective rubber screw coverings using a thin flat blade.
Step 3:
Undo the two screws using a Philips #00 Screwdriver.
Step 4:
Lift off the protective panel.
Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the rubber seals are secured firmly in place.
D-Link DCS-2332L User Manual
10
Section 1: Product Overview
Replacing the Ethernet Cable
Step 1:
Follow the steps outlined in "Removing the Top Panel" on page 10.
Step 2:
Unplug the Ethernet cable from the RJ45 connector.
Step 3:
Carefully remove the weatherproof cable connection cover.
Step 4:
Attach the weatherproof cable connection cover to the new Ethernet cable.
Step 5:
Plug the new Ethernet cable into the RJ45 connector.
Step 6:
Follow the steps outlined in "Reattaching the Top Panel" on page 12.
Note: To avoid damage to the weatherproof aspects of the camera, users are advised not to remove the rear cable connection covering. To use a
longer Ethernet cable install a coupling adaptor.
D-Link DCS-2332L User Manual
11
Section 1: Product Overview
Reattaching the Top Panel
Step 1:
Seat the protective panel, ensuring a tight fit with the inlaid rubber seal.
Step 2:
Replace the two screws. Ensure that the screws are tightened firmly.
Step 3:
Firmly replace the protective rubber screw coverings.
Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the rubber seals are secured firmly in place.
D-Link DCS-2332L User Manual
12
Section 1: Product Overview
Removing the Bottom Panel
Step 1:
Place the camera face down on a non-slip flat surface.
Step 2:
Carefully pry out the two protective rubber screw coverings using a thin flat blade.
Step 3:
Undo the two screws using a Philips #00 Screwdriver.
Step 4:
Lift off the protective panel.
If you need to install an SD Memory Card please skip to "Installing an SD Memory Card" on
page 14.
Using the Reset Button
If you need to use the Reset Button follow these steps.
Step 1:
Follow the steps outlined in "Removing the Bottom Panel" on page 13.
Step 2:
Using a paperclip or similar tool, press and hold the Reset Button for 10 seconds. This will reset
the device to it's factory settings.
Step 3:
Follow the steps outlined in "Reattaching the Bottom Panel" on page 14.
D-Link DCS-2332L User Manual
13
Section 1: Product Overview
Installing an SD Memory Card
Step 1:
Follow the steps outlined in "Removing the Bottom Panel" on page 13.
Step 2:
Insert a MicroSD Memory card into the slot, with the notch facing right.
Step 3:
Follow the steps outlined in "Reattaching the Bottom Panel" on page 14.
Reattaching the Bottom Panel
Step 1:
Seat the protective panel, ensuring a tight fit with the inlaid rubber seal.
Step 2:
Replace the two screws. Ensure that the screws are tightened firmly.
Step 3:
Firmly replace the protective rubber screw coverings.
Note: To ensure that the camera stays weatherproof, users are advised to ensure that all the
rubber seals are secured firmly in place.
D-Link DCS-2332L User Manual
14
Section 1: Product Overview
Optional: WPS Wireless Connection
Alternatively, if your router supports WPS, you can use the WPS button on the
camera to easily create a secure wireless connection to your network.
To create a WPS connection:
Step 1
Attach the Antenna
Locate the antenna included with your DCS-2332L, and attach it to the antenna
connector located on the side of the DCS-2332L.
Step 2
Press and hold the WPS button for approximately 5-6 seconds. The blue WPS
status LED on the front panel will blink.
Step 3
Within 60 seconds press the WPS button on your router. On some routers, you
may need to log in to the web interface and click on an on-screen button to
activate the WPS feature. If you are not sure where the WPS button is on your
router, please refer to your router’s User Manual.
WPS Button
The DCS-2332L will automatically create a wireless connection to your router.
While connecting, the status LED will flash. When the connection process is
complete, the status LED will turn solid.
Note: If your router does not support WPS, you can still use the wired connection
method on the previous page. After Zero Configuration setup is complete, your
router's wireless settings will be automatically transferred to the camera.
D-Link DCS-2332L User Manual
15
Section 2: Installation
Installation
Zero Configuration Setup
If you have a mydlink-enabled Cloud Router, you can take advantage of Zero Configuration. Zero Configuration automatically
configures your camera's settings for you, and adds it to your mydlink account automatically. This type of setup allows you to
set up your camera by simply plugging it in and connecting it to your router.
Connect your camera to your mydlink-enabled Cloud Router and Zero Configuration will automatically configure your DCS-2332L
and automatically add the camera to your mydlink account. After the short time it takes to do this you can remotely access
your camera from the www.mydlink.com website to manage and monitor your DCS-2332L.
Connect the Ethernet Cable
Using the pre-attached Ethernet cable connect the free end to your network.
Attach the External Power Supply
Attach the external power supply to your wall outlet or power strip.
D-Link DCS-2332L User Manual
16
Section 2: Installation
Check Your mydlink Account
Open a web browser and login to your mydlink account. The mydlink page will
check for new devices and display a New device Found! pop-up notification in
the bottom-left corner. Click the notification to continue.
A summary and confirmation notification will appear with the automatically
configured details. Make a note of the details and click Yes to add the camera to
your account.
DCS-2332L
D-Link DCS-2332L User Manual
17
Section 2: Installation
Zero Configuration will navigate to the mydlink Live View tab for your camera
where you will see a screen similar to the following.
If you wish to connect your camera to your router wirelessly, you can simply
disconnect the Ethernet cable and move the camera to its intended location; your
router's wireless settings have been automatically transferred to the camera, and
no further configuration is required.
Your camera is now set up, and you can skip to "mydlink" on page 23 to learn more
about the mydlink features of this camera, or to "Configuration" on page 24 for
advanced configuration of your camera.
D-Link DCS-2332L User Manual
18
Section 2: Installation
Camera Installation Wizard
Windows Users
Insert the Installation CD-ROM into your computer’s optical drive to start the autorun program.
Simply click Set up your Cloud Camera to go through the Setup Wizard, which will guide you step-by-step through the installation
process from connecting your hardware to configuring your camera and registering it with your mydlink account.
Note: If the autorun program does not open, go to My Computer, browse to your CD drive, and double-click
on the setup.exe file.
D-Link DCS-2332L User Manual
19
Section 2: Installation
Mac Users
Insert the Installation CD-ROM into your computer’s CD drive. On the desktop, open your CD drive and
double-click on the SetupWizard file.


Within 20-30 seconds, the Setup Wizard will open, which will guide you step-by-step through the installation process from
connecting your hardware to configuring your camera and registering it with your mydlink account.
Note: mydlink portal requires JavaTM to function correctly.
For more guidelines, please refer to mydlink FAQ pages at https://eu.mydlink.com/faq/mydlink
D-Link DCS-2332L User Manual
20
Section 2: Installation
Manual Hardware Installation
If you wish to set up your camera without using the Camera Setup Wizard, please follow these steps.
Note: In order to use the mydlink features of this product, you will need to go through the Camera Setup Wizard.
Connect the Ethernet Cable
Using the pre-attached Ethernet cable connect the free end to your network.
Attach the External Power Supply
Attach the external power supply to your wall outlet or power strip.
D-Link DCS-2332L User Manual
21
Section 2: Installation
SD Memory Card Installation
The SD memory card slot is housed behind the lower protective panel on the
rear of the device.
Step 1:
Place the camera face down on a non-slip flat surface
Step 2:
Carefully pry out the two lower protective rubber grommets using a thin flat blade.
Step 3:
Undo the two screws using a Philips #00 Screwdriver.
Step 4:
Lift off the protective panel.
Step 5:
Insert a MicroSD Memory Card.
Step 6:
Replace the protective panel.
Step 7:
Replace the two screws. Ensure that the screws are tightened firmly.
Step 8:
Firmly replace the protective rubber grommets.
Note: To ensure that the camera stays weatherproof, users are advised to ensure
that all the rubber seals are secured firmly in place.
D-Link DCS-2332L User Manual
22
Section 2: Installation
mydlink
After registering your DCS-2332L camera with a mydlink account in the Camera Installation Wizard, you will be able to remotely
access your camera from the www.mydlink.com website. After signing in to your mydlink account, you will see a screen similar
to the following:
DCS-2332L
For more details on using your camera with mydlink, go to the Support section of the mydlink website and check the User
Manual section for your product to find the latest instruction guide for your camera's mydlink features.
D-Link DCS-2332L User Manual
23
Section 3: Configuration
Configuration
Using the Configuration Interface
After completing the Camera Installation Wizard, you are ready to use your camera. The camera’s built-in Web configuration utility is designed to
allow you to easily access and configure your DCS-2332L. At the end of the wizard, enter the IP address of your camera into a web browser, such as
Mozilla Firefox. To log in, use the User name admin and the password you created in the Installation Wizard. If you did not create a password, the
default password is blank. After entering your password, click OK.
D-Link DCS-2332L User Manual
24
Section 3: Configuration
Live Video
This section shows your camera’s live video. You may select any of the available icons listed below to operate the camera. You may also select your
language using the drop-down menu on the left side of the screen.
You can zoom in and out on the live video image using your mouse. Right-click to zoom out or left-click to zoom in on the image.
SD Status: This option displays the status of the SD card. If no SD card has been
inserted, this screen will display the message "Card Invalid."
Motion Trigger
Indicator
This indicator will change color when a trigger event occurs.
Stop
Note: The video motion feature for your camera must be
enabled.
When a recording is in progress, this indicator will change
color.
This control pad can be used to electronically pan, tilt, and
zoom (ePTZ) within the camera's predefined view area, if one
has been defined.
Starts the automatic panning function. The ROI will pan from
back and forth within the FOV
Stops the camera ePTZ motion
Preset Path
Starts the camera's motion along the predefined path
Recording
Indicator
Control Pad
Auto Pan
ePTZ Speed: You may select a value between 0 and 64. 0 is the slowest and 64 is the fastest.
D-Link DCS-2332L User Manual
25
Section 3: Configuration
Global View: This window indicates the total field of view (FOV) of the camera. The
red box indicates the visible region of interest (ROI).
Language: You may select the interface language using this menu.
Video Profile 1
Record a Video Clip
Video Profile 2
Set a Storage Folder
Video Profile 3
Listen/Stop Audio In (from microphone)
Full screen mode
Start/Stop Audio Out (to speaker)
Taking a Snapshot
Go To: If any presets have been defined, selecting a preset from this list will
(Preset List) display it.
D-Link DCS-2332L User Manual
26
Section 3: Configuration
Setup
Setup Wizard
To configure your Network Camera, click Internet Connection Setup Wizard. Alternatively,
you may click Manual Internet Connection Setup to manually configure your Network
Camera and skip to "Network Setup" on page 33.
DCS-2332L
To quickly configure your Network Camera’s motion detection settings, click Motion
Detection Setup Wizard. If you want to enter your settings without running the wizard, click
Manual Motion Detection Setup and skip to "Motion Detection" on page 44.
D-Link DCS-2332L User Manual
27
Section 3: Configuration
Internet Connection Setup Wizard
This wizard will guide you through a step-by-step process to configure your new D-Link
Camera and connect the camera to the internet. Click Next to continue.
Note: Select DHCP if you are unsure of which settings to choose.
Click Next to continue.
D-Link DCS-2332L User Manual
28
Section 3: Configuration
Select Static IP if your Internet Service Provider has provided you with connection settings, or
if you wish to set a static address within your home network. Enter the correct configuration
information and click Next to continue.
If you are using PPPoE, select Enable PPPoE and enter your user name and password,
otherwise click Next to continue.
If you have a Dynamic DNS account and would like the camera to update your IP address
automatically, Select Enable DDNS and enter your host information. Click Next to continue.
Enter a name for your camera and click Next to continue.
DCS-2332L
D-Link DCS-2332L User Manual
29
Section 3: Configuration
Configure the correct time to ensure that all events will be triggered as scheduled. Click Next
to continue.
If you have selected DHCP, you will see a summary of your settings, including the camera's IP
address. Please write down all of this information as you will need it in order to access your
camera.
DCS-2332L
Click Apply to save your settings.
D-Link DCS-2332L User Manual
30
Section 3: Configuration
Motion Detection Setup Wizard
This wizard will guide you through a step-by-step process to configure your camera's
motion detection functions.
Click Next to continue.
Step 1
This step will allow you to enable or disable motion detection, specify the detection sensitivity,
and adjust the camera’s ability to detect movement.
You may specify whether the camera should capture a snapshot or a video clip when motion
is detected.
Please see "Motion Detection" on page 44 for information about how to configure motion
detection.
Step 2
This step allows you to enable motion detection based on a customized schedule. Specify the
day and hours. You may also choose to always record motion.
D-Link DCS-2332L User Manual
31
Section 3: Configuration
Step 3
This step allows you to specify how you will receive event notifications from your
camera. You may choose not to receive notifications, or to receive notifications via
e-mail or FTP.
Please enter the relevant information for your e-mail or FTP account.
Click Next to continue.
Step 4
You have completed the Motion Detection Wizard.
Please verify your settings and click Apply to save them.
Please wait a few moments while the camera saves your settings and restarts.
D-Link DCS-2332L User Manual
32
Section 3: Configuration
Network Setup
Use this section to configure the network connections for your camera. All relevant information must be entered accurately. After making any
changes, click the Save Settings button to save your changes.
LAN Settings: This section lets you configure settings for your local
area network.
DCS-2332L
DHCP: Select this connection if you have a DHCP server running
on your network and would like your camera to obtain
an IP address automatically.
If you choose DHCP, you do not need to fill out the IP
address settings.
Static IP Address: You may obtain a static or fixed IP address and other
network information from your network administrator
for your camera. A static IP address may simplify access
to your camera in the future.
IP Address: Enter the fixed IP address in this field.
Subnet Mask: This number is used to determine if the destination is in
the same subnet. The default value is 255.255.255.0.
Default router: The gateway used to forward frames to destinations in a
different subnet. Invalid gateway settings may cause the
failure of transmissions to a different subnet.
Primary DNS: The primary domain name server translates names to IP
addresses.
Secondary DNS: The secondary DNS acts as a backup to the primary DNS.
D-Link DCS-2332L User Manual
33
Section 3: Configuration
Enable UPnP Presentation: Enabling this setting allows your camera to be configured
as a UPnP device on your network.
Enable UPnP Port Forwarding: Enabling this setting allows the camera to add port
forwarding entries into the router automatically on a
UPnP capable network.
Enable PPPoE: Enable this setting if your network uses PPPoE.
User Name / Password: Enter the username and password for your PPPoE account.
Re-enter your password in the Confirm Password field.
You may obtain this information from your ISP.
HTTP Port: The default port number is 80.
Access Name for Stream 1~3: The default name is video#.mjpg, where # is the number
of the stream.
HTTPS Port: You may use a PC with a secure browser to connect to
the HTTPS port of the camera. The default port number
is 443.
Authentication: Depending on your network security requirements, the Network Camera provides three types of security
settings for streaming via RTSP protocol: disable and digest. If digest authentication is selected, user
credentials are encrypted using MD5 algorithm, thus providing better protection against unauthorized
access.
RTSP Port: The port number that you use for RTSP streaming to mobile devices, such as mobile phones or PDAs. The
default port number is 554. You may specify the address of a particular stream. For instance, live1.sdp can be
accessed at rtsp://x.x.x.x/video1.sdp where the x.x.x.x represents the ip address of your camera.
Access name for stream 1 ~ 3: This Network Camera supports multiple streams simultaneously. The access name is used to differentiate the
streaming source (video profile).
D-Link DCS-2332L User Manual
34
Section 3: Configuration
COS SETTING: Enabling the Class of Service setting implements a
best-effort policy without making any bandwidth
reservations.
QOS SETTING: Enabling QoS allows you to specify a traffic priority
policy to ensure a consistent Quality of Service during
busy periods. If the Network Camera is connected to a
router that itself implements QoS, the router's settings
will override the QoS settings of the camera.
IPV6: Enable the IPV6 setting to use the IPV6 protocol.
Enabling the option allows you to manually set up
the address, specify an optional IP address, specify an
optional router and an optional primary DNS.
MULTICAST The DCS-2332L allows you to multicast each of the
available streams via group address and specify the TTL
value for each stream. Enter the port and TTL settings
you wish to use if you do not want to use the defaults.
D-Link DCS-2332L User Manual
35
Section 3: Configuration
Wireless Setup
This section allows you to set up and configure the wireless settings on your camera. After making any changes, click the Save Settings button to
save your changes.
Site Survey: Click the Rescan button to scan for available wireless
networks. After scanning, you can use the drop-down
box to select an available wireless network. The related
information (SSID, Wireless Mode, Channel, Authentication,
Encryption) will be automatically filled in for you.
DCS-2332L
SSID: Enter the SSID of the wireless access point you wish to
use.
Wireless Mode: Use the drop-down box to select the mode of the
wireless network you wish to connect to. Infrastructure
is normally used to connect to an access point or router.
Ad-Hoc is usually used to connect directly to another
computer.
Channel: If you are using Ad Hoc mode, select the channel of the
wireless network you wish to connect to, or select Auto.
Authentication: Select the authentication you use on your wireless
network - Open, Shared, WPA-PSK, or WPA2-PSK.
Encryption: If you use WPA-PSK or WPA2-PSK authentication, you
will need to specify whether your wireless network
uses TKIP or AES encryption. If you use Open or Shared
authentication, WEP encryption should be the setting.
Key: If you use WEP, WPA-PSK, or WPA2-PSK authentication,
enter the Key (also known as password) used for your
wireless network.
D-Link DCS-2332L User Manual
36
Section 3: Configuration
Dynamic DNS
DDNS (Dynamic Domain Name Server) will hold a DNS host name and synchronize the public IP address of the modem when it has been modified.
A user name and password are required when using the DDNS service. After making any changes, click the Save Settings button to save your
changes.
Enable DDNS: Select this checkbox to enable the DDNS function.
Server Address: Select your Dynamic DNS provider from the pull down
menu or enter the server address manually.
DCS-2332L
Host Name: Enter the host name of the DDNS server.
User Name: Enter the user name or e-mail used to connect to your
DDNS account.
Password: Enter the password used to connect to your DDNS
server account.
Timeout: Enter the DNS timeout values you wish to use.
Status: Indicates the connection status, which is automatically
determined by the system.
D-Link DCS-2332L User Manual
37
Section 3: Configuration
Image Setup
In this section, you may configure the video image settings for your camera. A preview of the image will be shown in Live Video.
Enable Privacy Mask: The Privacy Mask setting allows you to specify up to 3
rectangular areas on the camera's image to be blocked/
excluded from recordings and snapshots.
DCS-2332L
You may click and drag the mouse cursor over the
camera image to draw a mask area. Right clicking on the
camera image brings up the following menu options:
Disable All: Disables all mask areas
Enable All: Enables all mask areas
Reset All: Clears all mask areas.
Anti Flicker: If the video flickers, try enabling this setting.
Mirror: This will mirror the image horizontally.
Flip: This will flip the image vertically. When turning Flip on,
you may want to consider turning Mirror on as well.
Power Line: Select the frequency used by your power lines to avoid
interference or distortion.
White Balance: Use the drop-down box to change white balance settings
to help balance colors for different environments. You
can choose from Auto, Outdoor, Indoor, Fluorescent,
and Push Hold.
D-Link DCS-2332L User Manual
38
Section 3: Configuration
Exposure Mode: Changes the exposure mode. Use the drop-down
box to set the camera for Indoor, Outdoor, or Night
environments, or to Moving to capture moving objects.
The Low Noise option will focus on creating a highquality picture without noise. You can also create 3
different custom exposure modes. The Max Gain setting
will allow you to control the maximum amount of gain
to apply to brighten the picture.
Denoise: This setting controls the amount of noise reduction that
will be applied to the picture.
Brightness: Adjust this setting to compensate for backlit subjects.
Contrast: Adjust this setting to alter the color intensity/strength.
Saturation: This setting controls the amount of coloration, from
grayscale to fully saturated.
Sharpness: Specify a value from 0 to 8 to specify how much
sharpening to apply to the image.
Reset Default: Click this button to reset the image to factory default
settings.
D-Link DCS-2332L User Manual
39
Section 3: Configuration
Audio and Video
You may configure up to 3 video profiles with different settings for your camera. Hence, you may set up different profiles for your computer and
mobile display. In addition, you may also configure the two-way audio settings for your camera. After making any changes, click the Save Settings
button to save your changes.
Aspect ratio: Set the aspect ratio of the video to 4:3 standard or 16:9
widescreen.
DCS-2332L
Mode: Set the video codec to be used to JPEG, MPEG-4, or
H.264.
Frame size / View window area: Frame size determines the total capture resolution, and
View window area determines the Live Video viewing
window size. If the Frame size is larger than the Live
Video size, you can use the ePTZ controls to look around.
16:9
1280 x 800, 1280 x 720, 800 x 450,
640 x 360, 480 x 270, 320 x 176,
176 x 144
4:3
1024 x 768, 800 x 600, 640 x 480,
480 x 360, 320 x 240, 176 x 144
Note: If your View window area is the same as your Frame
size, you will not be able to use the ePTZ function.
Maximum frame rate: A higher frame rate provides smoother motion for
videos, and requires more bandwidth. Lower frame
rates will result in stuttering motion, and requires less
bandwidth.
D-Link DCS-2332L User Manual
40
Section 3: Configuration
Video Quality: This limits the maximum frame rate, which can be
combined with the "Fixed quality" option to optimize
the bandwidth utilization and video quality. If fixed
bandwidth utilization is desired regardless of the video
quality, choose "Constant bit rate" and select the desired
bandwidth.
DCS-2332L
Constant bit rate: The bps will affect the bit rate of the video recorded
by the camera. Higher bit rates result in higher video
quality.
Fixed quality: Select the image quality level for the camera to try to
maintain. High quality levels will result in increased bit
rates.
Audio in off: Selecting this checkbox will mute incoming audio.
Audio in gain level: This setting controls the amount of gain applied to
incoming audio to increase its volume.
Audio out off: Selecting this checkbox will mute outgoing audio.
Audio out volume level: This setting controls the amount of gain applied to
outgoing audio to increase its volume.
D-Link DCS-2332L User Manual
41
Section 3: Configuration
Preset
This screen allows you to set preset points for the ePTZ function of the camera, which allows you to look around the camera's viewable area by
using a zoomed view. Presets allow you to quickly go to and view a specific part of the area your camera is covering, and you can create preset
sequences, which will automatically change the camera's view between the different presets according to a defined order and timing you can set.
Note: If your View window area is the same as your Frame size, you will not be able to use the ePTZ function.
Video Profile: This selects which video profile to use.
ePTZ Speed: You may select a value between 0 and 64. 0 is the slowest
and 64 is the fastest.
DCS-2332L
Arrow Buttons and Home Button: Use these buttons to move to a specific part of the
viewing area, which you can then set as a preset. Click
the Home button to return to the center of the viewing
area.
Input Preset Name: Enter the name of the preset you want to create, then
click the Add button to make a new preset. If an existing
preset has been selected from the Preset List, you can
change its name by typing in a new name, then clicking
the Rename button.
Preset List: Click this drop-down box to see a list of all the presets
that have been created. You can select one, then click
the GoTo button to change the displayed camera view
to the preset. Clicking the Remove button will delete
the currently selected preset.
Preset Sequence: This section allows you to create a preset sequence,
which automatically moves the camera's view between
a set of preset views.
D-Link DCS-2332L User Manual
42
Section 3: Configuration
Preset List: To add a preset to the sequence, select it from the dropdown box at the bottom of this window, set the Dwell
time to determine how long the camera view will stay at
that preset, then click the Add button. The preset name
will appear in the list, followed by the dwell time to view
that preset for.
You can rearrange your presets in the sequence by
selecting a preset in the sequence, then clicking the
arrow buttons to move it higher or lower in the current
sequence.
Clicking the trash can button will remove the currently
selected preset from the sequence.
If you want to change the dwell time for a preset, select
it from the list, enter a new dwell time, then click the
Update button.
D-Link DCS-2332L User Manual
43
Section 3: Configuration
Motion Detection
Enabling Video Motion will allow your camera to use the motion detection feature. You may draw a finite motion area that will be used for
monitoring. After making any changes, click the Save Settings button to save your changes.
Enable Video Motion: Select this box to enable the motion detection feature
of your camera.
DCS-2332L
Sensitivity: Specifies the measurable difference between two
sequential images that would indicate motion. Please
enter a value between 0 and 100.
Percentage: Specifies the amount of motion in the window being
monitored that is required to initiate an alert. If this is set
to 100%, motion is detected within the whole window
will trigger a snapshot.
Draw Motion Area: Draw the motion detection area by dragging your mouse
in the window (indicated by the red square).
Erase Motion Area: To erase a motion detection area, simply click on the red
square that you wish to remove.
Right clicking on the camera image brings up the
following menu options:
Select All: Draws a motion detection area over the
entire screen.
Clear All: Clears any motion detection areas that have
been drawn.
Restore: Restores the previously specified motion
detection areas.
D-Link DCS-2332L User Manual
44
Section 3: Configuration
Time and Date
This section allows you to automatically or manually configure, update, and maintain the internal system clock for your camera. After making any
changes, click the Save Settings button to save your changes.
Time Zone: Select your time zone from the drop-down menu.
Enable Daylight Saving: Select this to enable Daylight Saving Time.
DCS-2332L
Auto Daylight Saving: Select this option to allow your camera to configure the
Daylight Saving settings automatically.
Set Date and Time Manually: Selecting this option allows you to configure the Daylight
Saving date and time manually.
Offset: Sets the amount of time to be added or removed when
Daylight Saving is enabled.
Synchronize with NTP Server: Enable this feature to obtain time automatically from an
NTP server.
NTP Server: Network Time Protocol (NTP) synchronizes the DCS2332L with an Internet time server. Choose the one that
is closest to your location.
Set the Date and Time Manually: This option allows you to set the time and date manually.
Copy Your Computer's Time This will synchronize the time information from your PC.
Settings:
D-Link DCS-2332L User Manual
45
Section 3: Configuration
Event Setup
In a typical application, when motion is detected, the DCS-2332L sends images to a FTP server or via e-mail as notifications. As shown in the
illustration below, an event can be triggered by many sources, such as motion detection or external digital input devices. When an event is
triggered, a specified action will be performed. You can configure the Network Camera to send snapshots or videos to your e-mail address or FTP
site.
$FWLRQ
(YHQW&RQGLWLRQ
H[
0RWLRQGHWHFWLRQ
3HULRGLFDOO\'LJLWDOLQSXW
6\VWHPUHERRW
0HGLD
ZKDWWRVHQG
H[
6QDSVKRW9LGHR&OLSV
6HUYHU
ZKHUHWRVHQG
H[
(PDLO)73
To start plotting an event, it is suggested to configure server and media columns first so that the Network Camera will know what action shall be
performed when a trigger is activated.
D-Link DCS-2332L User Manual
46
Section 3: Configuration
The Event Setup page includes 4 different sections.
• Event
• Server
• Media
• Recording
DCS-2332L
1. To add a new item - "event, server or media," click Add. A screen will appear and allow you
to update the fields accordingly.
2. To delete the selected item from the pull-down menu of event, server or media, click Delete.
3. Click on the item name to pop up a window for modifying.
D-Link DCS-2332L User Manual
47
Section 3: Configuration
Add Server
You can configure up to 5 servers to save snapshots and/or video to. After making any
changes, click the Save Settings button to save your changes.
DCS-2332L
Server Name: Enter the unique name of your server.
E-mail: Enter the configuration for the target e-mail server
account.
FTP: Enter the configuration for the target FTP server account.
Network Storage: Specify a network storage device. Only one network
storage device is supported.
SD Card: Use the camera's onboard SD card storage.
D-Link DCS-2332L User Manual
48
Section 3: Configuration
Add Media
There are three types of media, Snapshot, Video Clip, and System Log. After making any
changes, click the Save Settings button to save your changes.
DCS-2332L
Media Name: Enter a unique name for media type you want to create.
Snapshot: Select this option to set the media type to snapshots.
Source: Set the video profile to use as the media source. Refer
to "Audio and Video" on page 40 for more information on
video profiles.
Send pre-event image(s) [0~4]: Set the number of pre-event images to take. Pre-event
images are images taken before the main event snapshot
is taken.
Send post-event image(s) [0~7]: Set the number of post-event images to take. Post-event
images are images taken after the main event snapshot
is taken. You can set up to 7 post-event images to be
taken.
File name prefix: The prefix name will be added on the file name.
Add date and time suffix to file Check it to add timing information as file name suffix.
name:
D-Link DCS-2332L User Manual
49
Section 3: Configuration
Video clip: Select this option to set the media type to video clips.
Source: Set the video profile to use as the media source. Refer to
"Audio and Video" on page 46 for more information on
video profiles.
DCS-2332L
Pre-event recording: This sets how many seconds to record before the main
event video clip starts. You can record up to 4 seconds of
pre-event video.
Maximum duration: Set the maximum length of video to record for your
video clips.
Maximum file size: Set the maximum file size to record for your video clips.
File name prefix: This is the prefix that will be added to the filename of
saved video clips.
System log: Select this option to set the media type to system logs.
This will save the event to the camera system log, but
will not record any snapshots or video.
D-Link DCS-2332L User Manual
50
Section 3: Configuration
Add Event
Create and schedule up to 2 events with their own settings here. After making any changes,
click the Save Settings button to save your changes.
DCS-2332L
Event name: Enter a name for the event.
Enable this event: Select this box to activate this event.
Priority: Set the priority for this event. The event with higher
priority will be executed first.
Delay: Select the delay time before checking the next event. It
is being used for both events of motion detection and
digital input trigger.
Trigger: Specify the input type that triggers the event.
Video Motion Detection: Motion is detected during live video monitoring. Select
the windows that need to be monitored.
Periodic: The event is triggered in specified intervals. The trigger
interval unit is in minutes.
System Boot: Triggers an event when the system boots up.
Network Lost: Triggers an event when the network connection is lost.
Passive Infrared Sensor: Triggers an event when the PIR sensor is activated by
moving infrared objects even in dark environment.
D-Link DCS-2332L User Manual
51
Section 3: Configuration
Time: Select Always or enter the time interval.
Server: Specify the location where the event information should
be saved to.
D-Link DCS-2332L User Manual
DCS-2332L
52
Section 3: Configuration
Add Recording
Here you can configure and schedule the recording settings. After making any changes,
click the Save Settings button to save your changes.
DCS-2332L
Recording entry name: The unique name of the entry.
Enable this recording: Select this to enable the recording function.
Priority: Set the priority for this entry. The entry with a higher
priority value will be executed first.
Source: The source of the stream.
Recording schedule: Scheduling the recording entry.
Recording settings: Configuring the setting for the recording.
Destination: Select the folder where the recording file will be stored.
Total cycling recording size: Please input a HDD volume between 1MB and 2TB for
recording space. The recording data will replace the
oldest record when the total recording size exceeds this
value. For example, if each recording file is 6MB, and the
total cyclical recording size is 600MB, then the camera
will record 100 files in the specified location (folder) and
then will delete the oldest file and create new file for
cyclical recording.
Please note that if the free HDD space is not enough, the
recording will stop. Before you set up this option please
make sure your HDD has enough space, and it is better to
not save other files in the same folder as recording files.
D-Link DCS-2332L User Manual
53
Section 3: Configuration
Size of each file for recording: If this is selected, files will be separated based on the file
size you specify.
DCS-2332L
Time of each file for recording: If this is selected, files will be separated based on the
maximum length you specify.
File Name Prefix: The prefix name will be added on the file name of the
recording file(s).
D-Link DCS-2332L User Manual
54
Section 3: Configuration
SD Card
Here you may browse and manage the recorded files which are stored on the SD card.
Format SD Card: Click this icon to automatically format the SD card and
create "picture" & "video" folders.
DCS-2332L
View Recorded Picture: If the picture files are stored on the SD card, click on the
picture folder and choose the picture file you would like
to view.
Playback Recorded Video: If video files are stored on the SD card, click on the video
folder and choose the video file you would like to view.
Refresh: Reloads the file and folder information from the SD card.
D-Link DCS-2332L User Manual
55
Section 3: Configuration
Advanced
ICR and IR
Here you can configure the ICR and IR settings. An IR(Infrared) Cut-Removable(ICR) filter can be disengaged for increased sensitivity in low light
environments.
Automatic: The Day/Night mode is set automatically. Generally, the
camera uses Day mode and switches to Night mode
when needed.
DCS-2332L
Day Mode: Day mode enables the IR Cut Filter.
Night Mode: Night mode disables the IR Cut Filter.
Schedule Mode: Set up the Day/Night mode using a schedule. The camera
will enter Day mode at the starting time and return to
Night mode at the ending time.
IR Light Control: The camera can enable or disable the IR (infrared) light
according to your preferences. This setting provides
additional controls depending on your specific application.
Off: The IR light will always be off.
On: The IR light will always be on.
Sync: The IR light will turn on when the ICR sensor is on.
Schedule: The IR light will turn on or off according to the schedule
that you specify below.
D-Link DCS-2332L User Manual
56
Section 3: Configuration
HTTPS
This page allows you to install and activate an HTTPS certificate for secure access to your camera. After making any changes, click the Save Settings
button to save your changes.
Enable HTTPS Secure Connection: Enable the HTTPS service.
DCS-2332L
Create Certificate Method: Choose the way the certificate should be created. Three
options are available:
Create a self-signed certificate automatically
Create a self-signed certificate manually
Create a certificate request and install
Status: Displays the status of the certificate.
Note: The certificate cannot be removed while the HTTPS is
still enabled. To remove the certificate, you must first
uncheck Enable HTTPS secure connection.
D-Link DCS-2332L User Manual
57
Section 3: Configuration
Access List
Here you can set access permissions for users to view your DCS-2332L.
Allow list: The list of IP addresses that have the access right to the
camera.
DCS-2332L
Start IP address: The starting IP Address of the devices (such as a computer)
that have permission to access the video of the camera.
Click Add to save the changes made.
Note: A total of seven lists can be configured for both
columns.
End IP address: The ending IP Address of the devices (such as a computer)
that have permission to access the video of the camera.
Delete allow list: Remove the customized setting from the Allow List.
Deny list: The list of IP addresses that have no access rights to the
camera.
Delete deny list: Remove the customized setting from the Delete List.
For example:
When the range of the Allowed List is set from 1.1.1.0
to 192.255.255.255 and the range of the Denied List is
set from 1.1.1.0 to 170.255.255.255. Only users with IPs
located between 171.0.0.0 and 192.255.255.255 can
access the Network Camera.
D-Link DCS-2332L User Manual
$ORZHG
/LVW
'HQLHG
/LVW
58
Section 3: Configuration
System
In this section, you may backup, restore and reset the camera configuration, or reboot the camera.
Save To Local Hard Drive: You may save your current camera configuration as a file
on your computer.
DCS-2332L
Local From Local Hard Drive: Locate a pre-saved configuration by clicking Browse and
then restore the pre-defined settings to your camera by
clicking Load Configuration.
Restore to Factory Default: You may reset your camera and restore the factory
settings by clicking Restore Factory Defaults.
Reboot Device: This will restart your camera.
D-Link DCS-2332L User Manual
59
Section 3: Configuration
Maintenance
Device Management
You may modify the name and administrator’s password of your camera, as well as add and manage the user accounts for accessing the camera.
You may also use this section to create a unique name and configure the OSD settings for your camera.
Admin Password Setting: Set a new password for the administrator’s account.
Add User Account: Add new user account.
DCS-2332L
User Name: The user name for the new account.
Password: The password for the new account.
User List: All the existing user accounts will be displayed here. You
may delete accounts included in the list, but you may
want to reserve at least one as a guest account.
Camera Name: Create a unique name for your camera that will be added
to the file name prefix when creating a snapshot or a
video clip.
Enable OSD: Select this option to enable the On-Screen Display
feature for your camera.
Label: Enter a label for the camera, which will be shown on the
OSD when it is enabled.
Show Time: Select this option to enable the time-stamp display on
the video screen.
D-Link DCS-2332L User Manual
60
Section 3: Configuration
Firmware Upgrade
The camera's current firmware version will be displayed on this screen. You may visit the D-Link Support Website to check for the latest available
firmware version.
To upgrade the firmware on your DCS-2332L, please download and save the latest firmware version from the D-Link Support Page to your local
hard drive. Locate the file on your local hard drive by clicking the Browse button. Select the file and click the Upload button to start upgrading the
firmware.
Current Firmware Version: Displays the detected firmware version.
Current Product Name: Displays the camera model name.
DCS-2332L
File Path: Locate the file (upgraded firmware) on your hard drive
by clicking Browse.
Upload: Uploads the new firmware to your camera.
D-Link DCS-2332L User Manual
61
Section 3: Configuration
Status
Device Info
This page displays detailed information about your device and network connection.
DCS-2332L
DCS-2332L
D-Link DCS-2332L User Manual
62
Section 3: Configuration
Logs
This page displays the log information of your camera. You may download the information by clicking Download. You may also click Clear to delete
the saved log information.
DCS-2332L
D-Link DCS-2332L User Manual
63
Section 3: Configuration
Help
This page provides helpful information regarding camera operation.
DCS-2332L
D-Link DCS-2332L User Manual
64
Appendix A: Technical Specifications
Technical Specifications
Camera
Network
Camera Hardware
Profile
ƒ
ƒ
ƒ
ƒ
ƒ
ƒ
Image Features
ƒ Configurable image size, quality, frame rate, and bit rate
ƒ Time stamp and text overlays
ƒ Configurable motion detection windows
ƒ Configurable privacy mask zones
ƒ Configurable shutter speed, brightness, saturation, contrast,
and sharpness
Video Compression
ƒ Simultaneous H.264/MPEG-4/MJPEG format compression
ƒ H.264/MPEG-4 multicast streaming
ƒ JPEG for still images
Video Resolution
16:9 - 1280 x 800, 1280 x 720, 800 x 450, 640 x 360, 480 x 270, 320 4:3 - 1024 x 768, 800 x 600, 640 x 480, 480 x 360, 320 x 240, 176 x
x 176, 176 x 144
144
Audio Support
G.726, G.711
External Device
Interface
ƒ 10/100 BASE-TX Fast Ethernet port
ƒ IEEE 802.11n 2.4GHz single band wireless
ƒ MicroSD/SDHC card slot
Network Protocols
IEEE 802.11n 2.4GHz single band wireless
IPv6
IPv4
TCP/IP
UDP
ICMP
DHCP client
NTP client (D-Link)
DNS client
DDNS client (D-Link)
SMTP client
FTP client
HTTP / HTTPS
Samba Client
PPPoE
UPnP port forwarding
RTP / RTSP/ RTCP
IP filtering
QoS
CoS
Multicast
IGMP
ONVIF compliant
Security
ƒ Administrator and user group protection
ƒ Password authentication
ƒ HTTP and RTSP digest encryption
D-Link DCS-2332L User Manual
1/4” Megapixel progressive CMOS sensor
5 meter IR illumination distance
Minimum illumination: 0 lux with IR LED on
Built-in Infrared-Cut Removable (ICR) Filter module
Built-in PIR sensor (5 meter)
Built-in microphone and speaker
ƒ
ƒ
ƒ
ƒ
10x digital zoom
Focal length: 3.45 mm
Aperture: F2.0
Angle of view:
ƒ (H) 57.8°
ƒ (V) 37.8°
ƒ (D) 66°
65
Appendix A: Technical Specifications
System
System
Management Requirements for
Web Interface
ƒ Operating System: Microsoft Windows 7/Vista/XP/2000
ƒ Browser: Internet Explorer, Firefox, Chrome, Safari
Event Management
ƒ Motion detection
ƒ Event notification and uploading of snapshots/video clips via
e-mail or FTP
ƒ Supports multiple SMTP and FTP servers
ƒ Multiple event notifications
ƒ Multiple recording methods for easy backup
Remote
Management
ƒ Take snapshots/video clips and save to local hard drive or NAS
via web browser
ƒ Configuration interface accessible via web browser
Mobile Support
Windows 7/Vista/XP system, Pocket PC, or mobile phone
mydlink mobile app for iOS and Android mobile devices
D-ViewCam™ System ƒ Operating System: Microsoft Windows 7/Vista/XP
Requirements
ƒ Web Browser: Internet Explorer 7 or higher
General
D-ViewCam™
Software Functions
ƒ Remote management/control of up to 32 cameras
ƒ Viewing of up to 32 cameras on one screen
Weight
255 g
External Power
Adaptor
Input: 100 to 240 V AC, 50/60 Hz
ƒ Protocol: Standard TCP/IP
ƒ Supports all management functions provided in web interface
ƒ Scheduled motion triggered, or manual recording options
Output: 5 V DC, 1.2 A
Power Consumption 5.5 Watts
Temperature
Operating: -25 to 50 °C (-13 to 122 °F)
Storage: -20 to 70 °C (-4 to 158 °F)
Humidity
Operating: 20% to 80% non-condensing
Storage: 5% to 95% non-condensing
Certifications
CE
CE LVD
FCC
C-Tick
IP65
IC
D-Link DCS-2332L User Manual
66
Appendix A: Technical Specifications
Dimensions








D-Link DCS-2332L User Manual
67
Transmitters shall display the following notice in a conspicuous
location:
Under Industry Canada regulations, this radio transmitter may only
operate using an antenna of a type and maximum (or lesser) gain
approved for the transmitter by Industry Canada. To reduce
potential radio interference to other users, the antenna type and its
gain should be so chosen that the equivalent isotropically radiated
power (e.i.r.p.) is not more than that necessary for successful
communication.
This radio transmitter (identify the device by certification number, or
model number if Category II) has been approved by Industry
Canada to operate with the antenna types listed below with the
maximum permissible gain and required antenna impedance for
each antenna type indicated. Antenna types not included in this list,
having a gain greater than the maximum gain indicated for that type,
are strictly prohibited for use with this device.
)&&1RWLFHV
This device complies with Part 15 of the FCC Rules. Operation is subject to the following
two conditions: (1) this device may not cause harmful interference, and (2) this device
must accept any interference received, including interference that may cause undesired
operation.
CAUTION: Change or modification not expressly approved by the party responsible
for compliance could void the user’s authority to operate this equipment.
This equipment has been tested and found to comply with the limits for a Class B
digital device, pursuant to Part 15 of the FCC Rules. These limits are designed to provide
reasonable protection against harmful interference in a residential installation. This
equipment generates, uses and can radiate radio frequency energy and, if not installed
and used in accordance with the instructions, may cause harmful interference to radio
communications. However, there is no guarantee that interference will not occur in a
particular installation. If this equipment does cause harmful interference to radio or
television reception, which can be determined by turning the equipment off and on, the
user is encouraged to try to correct the interference by one or more of the following
measures:
--Reorient or relocate the receiving antenna.
--Increase the separation between the equipment and receiver.
--Connect the equipment into an outlet on a circuit different from that to which the receiver
is connected.
--Consult the dealer or an experienced radio/TV technician for help.
CAUTION:
Any changes or modifications not expressly approved by the grantee of this device could
void the user's authority to operate the equipment.
RF exposure warning
This equipment must be installed and operated in accordance with provided instructions
and the antenna(s) used for this transmitter must be installed to provide a separation
distance of at least 20 cm from all persons and must not be co-located or operating in
conjunction with any other antenna or transmitter. End-users and installers must be
provide with antenna installation instructions and transmitter operating conditions for
satisfying RF exposure compliance."
Canada Notices
,QGXVWU\&DQDGDUHJXODWRU\LQIRUPDWLRQ
7KLVGHYLFHFRPSOLHVZLWK,QGXVWU\&DQDGDOLFHQFHH[HPSW566VWDQGDUG V 
2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQV  WKLVGHYLFHPD\QRWFDXVH
LQWHUIHUHQFHDQG  WKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHLQFOXGLQJLQWHUIHUHQFH
WKDWPD\FDXVHXQGHVLUHGRSHUDWLRQRIWKHGHYLFH
7KHXVHULVFDXWLRQHGWKDWWKLVGHYLFHVKRXOGEHXVHGRQO\DVVSHFLILHGZLWKLQWKLV
PDQXDOWRPHHW5)H[SRVXUHUHTXLUHPHQWV8VHRIWKLVGHYLFHLQDPDQQHU
LQFRQVLVWHQWZLWKWKLVPDQXDOFRXOGOHDGWRH[FHVVLYH5)H[SRVXUHFRQGLWLRQV
Le prĂŠsent appareil est conforme aux CNR d'Industrie Canada
applicables aux appareils radio exempts de licence. L'exploitation est
autorisĂŠe aux deux conditions suivantes : (1) l'appareil ne doit pas
produire de brouillage, et (2) l'utilisateur de l'appareil doit accepter tout
brouillage radioĂŠlectrique subi, mĂŞme si le brouillage est susceptible
d'en compromettre le fonctionnement.
5)H[SRVXUHZDUQLQJ
7KLVHTXLSPHQWPXVWEHLQVWDOOHGDQGRSHUDWHGLQDFFRUGDQFHZLWK
SURYLGHGLQVWUXFWLRQVDQGWKHDQWHQQD V XVHGIRUWKLVWUDQVPLWWHUPXVW
EHLQVWDOOHGWRSURYLGHDVHSDUDWLRQGLVWDQFHRIDWOHDVWFPIURPDOO
SHUVRQVDQGPXVWQRWEHFRORFDWHGRURSHUDWLQJLQFRQMXQFWLRQZLWKDQ\
RWKHUDQWHQQDRUWUDQVPLWWHU(QGXVHUVDQGLQVWDOOHUVPXVWEHSURYLGH
ZLWKDQWHQQDLQVWDOODWLRQLQVWUXFWLRQVDQGWUDQVPLWWHURSHUDWLQJ
FRQGLWLRQVIRUVDWLVI\LQJ5)H[SRVXUHFRPSOLDQFH
&HWpTXLSHPHQWGRLWrWUHLQVWDOOpHWXWLOLVpFRQIRUPpPHQWDX[
LQVWUXFWLRQVIRXUQLHVHWGHO DQWHQQH V XWLOLVpSRXUFHWpPHWWHXUGRLWrWUH
LQVWDOOpSRXUIRXUQLUXQHGLVWDQFHGHVpSDUDWLRQG DXPRLQVFPGH
WRXWHSHUVRQQHHWQHGRLWSDVrWUHFRORFDOLVpVRXIRQFWLRQQDQWHQ
FRQMRQFWLRQDYHFXQHDXWUHDQWHQQHRXWUDQVPHWWHXU/HVXWLOLVDWHXUV
ILQDX[HWLQVWDOODWHXUVGRLYHQWrWUHIRXUQLUGHVLQVWUXFWLRQVG LQVWDOODWLRQ
GHO DQWHQQHHWGHVFRQGLWLRQVGHIRQFWLRQQHPHQWGXWUDQVPHWWHXUGHOD
FRQIRUPLWpVXUO H[SRVLWLRQDX[5)

---

Source Exif Data:

File Type                       : PDF
File Type Extension             : pdf
MIME Type                       : application/pdf
PDF Version                     : 1.3
Linearized                      : Yes
Create Date                     : 2013:01:11 19:16:01+08:00
Modify Date                     : 2013:01:11 19:16:01+08:00
Page Count                      : 70
Creation Date                   : 2013:01:11 11:16:01Z
Mod Date                        : 2013:01:11 11:16:01Z
Producer                        : Acrobat Distiller 5.0.5 (Windows)
Author                          : kosame.lin
Metadata Date                   : 2013:01:11 11:16:01Z
Creator                         : kosame.lin
Title                           : DCS-2332L_A1_Manual_v1.00(WW)-01.11.pdf

EXIF Metadata provided by EXIF.tools