NEXTECH NT-TPMS100 TPMS MODULE User Manual EMISSION TEST REPORT
NEXTECH CO., LTD. TPMS MODULE EMISSION TEST REPORT
NEXTECH >
Users Manual
Order Number : GETEC-C1-11-077 FCC Part 15 subpart C Test Report Number : GETEC-E3-11-031 Page 1 / 1 APPENDIX H : USERâS MANUAL EUT Type: TPMS Module FCC ID.: TBJNT-TPMS100 Federal Communication Commission Interference Statement Warning! Changes or modifications not expressly approved by the manufacturer could void the user's authority to operate the equipment. *Note: The manufacturer is not responsible for any Radio or TV interference caused by unauthorized modifications to this equipment. Such modifications could void the user's authority to operate the equipment. FCC Caution This device complies with Part 15 of the FCC Rules. Operation is subject to the following two conditions: (1) this device may not cause harmful interference, and (2) this device must accept any interference received, including interference that may cause undesired operation. Any changes or modifications not expressly approved by the party responsible for compliance could void the authority to operate equipment. The antenna(s) used for this transmitter must not be collocated or operating in conjunction with any other antenna or transmitter. 730602'8/( 86(5Ä6*8,'( +/2146#06016+%'5 2TGECWVKQPU 7KLVXVHUÄVJXLGHGHVFULEHVKRZWRXVHIRUXVHUVWRXVHPRUHVDIHDQGHDV\ ,QFDVHXVHUVGRQRWXVHWKHWRROSURSHUO\LWPD\FDXVHWKHWRROZRUNZURQJDQGDIIHFWWR ,QFDVH\RXRSHUDWHWKHWRROZURQJWKHVDIHW\RIXVHUVDQGWRROPD\QRWEHJXDUDQWHHG ČG 7KHVSHFLILFDWLRQDQGDOOGHWDLOVLQFOXGLQJLQWKLVXVHUÄVJXGHPD\EHFKDQJHGZLWKRXWDQ\ QRWLFHWRDSSURYHLWVTXDOLW\DQGGHVLJQLQIXWXUH 9JGPVJGVQQNKUGSWKRRGFVQ%#4/#05%#00'1DGUWTG%#4/#05%#00'1 UJQWNFDGÄ1((Ä XVHUÄVVDIHW\%HVXUHWRUHDGWKLVXVHUÄVJXLGHZHOODQGNHHSWREHXVHGWRKRZWRRSHUDWHZHOO $GUWTGVQWUGVQ%#4/#05%#00'1RTQFWEVQPN[ $GUWTGVQOCKPVCKPCFGSWCVGENGCTCPEGCTQWPFVJGVQQN 0GXGTFTQRKVCPFFKUCUUGODNGKVYKVJQWVOCPWHCEVWTGTÄUKPUVTWEVKQP %QORQPGPVCPF5RGEKHKECVKQP +PUVCNNCVKQP %HVXUHWRRII&$50$16&$11(2EHIRUH\RXLQVWDOO730602'8/( %QORQPGPV 2KE ,QVWDOO7306PRGXOHWRWKHGLUHFWLRQDVEHORZ7KHODEHOÄ7306ÄVKRXOGEHXSSHUSRVLWLRQ DVEHORZDQGLWPD\QRWEHLQVWDOOHGLIWKHGLUHFWLRQLVRSSRVLWH 62/5/1&7.'/CKP7PKV $ERYHPDUNHGDUHDLVWKHVSDFHWRLQVWDOO7306PRGXOHDQGWKHFDSVKRXOGEHRSHQHGWRॢ ĚŐ˝ LQVWDOO730602'8/( 5RGEKHKECVKQP +VGO 5RGEKHKECVKQP %27 670)$50ELW&RUWH[0&38 /GOQT[ .E\WH)/$6+0(025< 0+]$6.)6. 4(4'%'+8'4 0+]$6.)6. .(64#05/+66'4 .+] 1RGTCVKPI6GORGTCVWTG Â&aÂ& 1RGTCVKPI8QNVCIG '&9ROWa9ROW 5+<' PP[PP[PP WARRANTY CARD Warranty Policy 1. The manufacturer warrants this product to be defect free in material and workmanship for a period of one (1) year from the date of purchase. Defective products may be returned by the original purchaser within the warranty period, postage pre-paid together with proof of purchase date to Nextech Co. LTD. Defective products will be repaired at manufacturerâs discretion, replaced at no charge. 2. The warranty does not apply to any units that have been tampered with, or to damages incurred through improper use and care, defects caused by abuse or through the usage for purposes other than the intended use, used in a manner inconsistent with the instructions regarding use, and faulty packing or mishandling by any common carrier. 3. Repairs not covered by this warranty will be performed at the current cost for parts and labor. In no event will Nextech Co. Ltdâs liability exceed the price paid for the product from direct, indirect, special, incidental or, consequential damages resulting from the use of this product, its accompanying software, or its documentation without obligation to notify any individual or entity. Warranties hereunder extend only to customers and are not transferable. Warranty Period & Software update ,QVWDOO730602'8/(DVDERYH 1. Warranty period for Nextech products and theseâs accessories including software card is one (1) year from the date of sale to the original consumer. 2. Free Software update for Nextech products is one (1) year from date of purchase. After one (1) year from purchase date, software updates will be optional and will require separate payment per request. Repair Service 1. If you suspect that you have a problem with this product, please read the operation manual (guide) carefully to ensure that you are operating this product properly. 2. If you conclude that a real problem exists, check your product according to the procedures on the âTrouble Shooting Cardâ and mark your trial records in the blank. 3. Please return the main body or the troubled parts along with the âTrouble Shooting Cardâ to the repair service center listed below. Be sure to return them in freight prepaid as we donât accept freight collect. Nextech Service Center Nextech Co. Ltd. rd E&C Venture Dream Tower(the 3 ) 13F Guro-dong, 197-33 Guro-Gu, Seoul, Korea Tel : (822)3140-1489 Fax : (822)3140-1449 Email : sales@nex-tek.com kkanggri@nex-tek.com 3XVKWRWKHHQGWREHLQVWDOOHGWLJKW :KHQVHSDUDWHGSXVKWKHSDUWODEHOHGÄ386+ÄDQGVHSDUDWH730602'8/( 1RGTCVKQP 5HIHUWRXVHUÄVJXLGH&KDSWHU7306DQGRSHUDWHLW North America Customer Service Center Nextech America Inc. 17581 Irvine Blvd suite 100 Tustin CA, 92780 USA Tel: (714)832-0100 Fax: (714)832-0123 Email: csh@nex-tek.com Website: www.nex-tech.com/carman WARRANTY CARD Warranty Registration Upon receiving the product, please fill out the following registration form and return either by fax or separate mail to Nextech Service Center or North America Customer Service Center (only USA customer) according to your area. IMPORTANT: Any delay or missing of your warranty registration may cause disadvantage or inconvenience to your warranty repair service. CUSTOMER NAME _______________________________________________________________ COMPANY NAME ADDRESS _______________________________________________________________ _____________________________________________________________________ COUNTRY/STATE ________________________________________ TEL No _____________________________ EMAIL ADDRESS FAX No ZIP __________________ _________________________________ _______________________________________________________________ SERIAL No ___________________________ SOFTWARE VERSION LOT No _______________________________ ___________________________________________________________ DEALERSHIP ____________________________________________________________________ DATE OF PURCHASE MONTH _____________ DAY ____________ YEAR _____________ ___________________________________ __________________________________ SIGNATURE DATE G CARMAN SCAN NEO User Guide Table of ContentsG Cautions in Use ...................................................................................4 Chapter 1 General Descriptions.........................................................5 1. Product Features............................................................................................. 5 2. 3. 4. 5. 6. Product Specifications.................................................................................... 6 Rechargeable Battery ..................................................................................... 7 Name and function of each part ..................................................................... 8 Component Figures and Descriptions ........................................................ 11 Power Supply................................................................................................. 22 Chapter 2 Menu Configuration .........................................................23 1. Before Getting Started .................................................................................. 23 2. Menu Description .......................................................................................... 24 3. Icons...............................................................................................................25 Chapter 3 Configuration ...................................................................26 1. Information..................................................................................................... 26 2. System Display Unit...................................................................................... 28 3. Graph.............................................................................................................. 30 4. Maker..............................................................................................................32 5. Display ........................................................................................................... 33 Chapter 4 Utility...... ...........................................................................34 Ver. 110324 Safety Cautions This information is essential to protect your safety and prevent property damage. Make sure to read this thoroughly before using CARMAN SCAN NEO. 1. Flight Record ................................................................................................. 34 2. Text Shot ........................................................................................................ 39 3. Screen Capture.............................................................................................. 41 4. Gas Analyzer.................................................................................................. 43 Chapter 5 TPMS .................................................................................45 CARMAN SCAN NEO User Guide G Table of contentsG Cautions in useG Chapter 6 Diagnosis Menu ...............................................................46 1. How To Connect Self-Diagnostic Connector and Select Diagnosis Program ....................................................................................... 46 Chapter 7 Vehicle Diagnosis ............................................................49 1. Diagnostic Trouble Codes ............................................................................ 49 2. Current Data................................................................................................... 52 3. Actuation........................................................................................................ 60 Safety InstructionG G Cautions in Use CARMAN SCAN NEO mentioned in this User's Guide is designed for those who have basic qualifications for using this system. Users should follow the safety instructions for safe and efficient use of the product. The cautions of use are as follows: Chapter 8 Osilloscope.......................................................................62 Do not drop CARMAN SCAN NEO. 1. Main Menu...................................................................................................... 62 2. Scope environment setup............................................................................. 63 Always use it in the rubber shroud to product it. 3. Description of scope environment setup icons...........................................65 Do not place CARMAN SCAN NEO on the power distributor. Although CARMAN SCAN NEO is manufactured to internally prevent the interference from the electromagnetic waves, the strong interference Q & A....................................................................................................66 by excessive electromagnetic waves may damage the product. WARRANTY CARD..............................................................................67 Excessive surge or electric shock fed by a power cable may damage the power supply system of CARMAN SCAN NEO. So, do not use the product while the power supply is unstable. The voltage rating of the AC/DC adapter is 12V DC. Be sure to use an AC/DC adaptor with the rated voltage. Be careful not to let water or oil get into the product. The product can be severely damaged. Be sure to use the USB cable supplied by Our Company only. Otherwise, your PC or product can be damaged. CARMAN SCAN NEO User GuideG CARMAN SCAN NEO User GuideG G Chapter 1: General Descriptions Chapter 1: General Descriptions 1. Product Features 2. Product Specifications CARMAN SCAN NEO can check vehicle ECU information and malfunction status through Item the OBD-I, OBD-II and CAN communication. You can connect CARMAN SCAN NEO to the vehicle diagnostic connector with a Detail Specifications CPU PXA-320 806MHz steering and other devices has an error, view current data and use actuator drive features. O.S Window CE 5.0 CARMAN SCAN NEO has the following features: LCD 5.7 inch (Color / Touch Screen) ŕś Diagnoses Korean, Japanese and European vehicles. Connectivity USB (USB 2.0 / Compliant) Operating Temperature -10ŕ ~ 60ŕ Operating Voltage 8 ~ 32V Function TPMS / VIDEO(Composite) / Input(PAL,NTSC) User Interface Touch Screen & Multi Keyboard diagnosis cable to check if any of the engine, automatic transmission, ABS, air bag, power - OBD-I , OBD-II, MOBD(ISO 9141-2, SAE-J1850, KWP-2000, CAN, SAE J1587) ŕś Supports vehicle troubleshooting and current data search. - You can diagnose vehicles with their sensors and switches, and save and reload the current data. ŕś Supports automatic actuator inspection. - This function runs/stops the actuator and switches forcibly in order to check if the corresponding active device is normal. ŕś You can save data and upgrade the diagnosis program by connecting the product to your PC. KWP 2000, ISO 9141-2, J1850(VPW,PWM) ŕś You can change the sound effects and display unit of the CARMAN SCAN NEO. Dual Wire CAN(2.0A, 2.0B) J1587, Protocol ŕś Provides the LCD brightness adjustment function. Single Wire CAN, Hi Speed Serial ŕś With the built-in battery, you can perform diagnosis without an additional power supply. (for vehicles without DLC power) Maximum Sample Rate 25[MHz/S] per Channel Volt / division 10m[V] to 100[V] in a 1, 2.5, 5 Sequence Scope Time Setting 1[ŕź] ~ 10[S] Input Impedance 1[M] Battery Li-Polymer 7.4[V] 4200[mA] CARMAN SCAN NEO User GuideG CARMAN SCAN NEO User GuideG G Chapter 1: General Descriptions 3. Rechargeable Battery * The rechargeable battery pack has the following features Chapter 1: General Descriptions 4. Name and function of each part ŕś Front View of Main Body Voltage of the rechargeable battery pack gradually decreases even when the system does not run. Before using the product for the first time, be sure to fully charge the battery. Always use the rechargeable battery pack provided by Our Company. - Using a 3rd party product may cause explosion. (7.4V 2200 mAh lithium ion battery pack) Do not heat the rechargeable battery pack. - It may cause explosion. Do not short the battery pack terminal. - It may cause explosion. Do not place the battery pack on or near hot material over 60ÂşC. Fig. 1.1 Main Body - It may cause explosion. Touch screen LCD panel Keep the battery pack away from touch of children or an animal. - It may cause a fire or injury. To prevent the battery pack from being discharged, always connect the power source before using the system. Screen captures, flight Touch a button or others on the LCD screen with a touch pen or finger to activate a function. Function keys (F1~F6) You can use these keys to clear trouble codes, view help, fix Current Data selection, etc. record and other information can be erased due to the discharged battery pack. ENTER key & Arrow key The rechargeable battery pack is a consumable product and is Use this key to execute the command you have chosen. Use this key to move cursor to the left/right/upper/lower sides. under warranty for 6 months after purchase.G Numeric key (0~9) Use this key to enter cylinder serial number when you replace the injector or to enter numbers such as immobilizer password. CARMAN SCAN NEO User GuideG CARMAN SCAN NEO User GuideG Chapter 1: General Descriptions Chapter 1: General Descriptions ŕś Right Side of Main Body ŕś Upper part of Main Body Fig. 1.3 Upper part of Main Body 1) Scope Cable Terminal - 1 ~ 4 CH : terminal to measure waveform, ignition, and other options (temperature, 56 pressure, electric current, etc) - EXT CH : terminal to use Multimeter, Simulator, Actuator, and EXT Trigger Fig. 1.2 Right Side of Main Body 2) TPMS 1) Power Connector A connector for connection to AC/DC POWER adaptor. ŕś Low part of Main Body 2) J2534 Reprogram port 3) RS 232 Connector A connector for RS 232 cable on gas analyzer 4) , 5) Fig. 1.4 Low part of Main Body USB Connector This is used when you connect CARMAN SCAN NEO to a PC to download the 1) DLC Communication Cable Connector diagnosis program. A connector for connection to the DLC communication cable for vehicle diagnosis. Always use DLC communication cable provided with this product. 6) Endoscope CAM Connector CARMAN SCAN NEO User GuideG CARMAN SCAN NEO User GuideG 10 G Chapter 1: General Descriptions 5. Component Figures and Descriptions Chapter 1: General Descriptions ŕś USB CableG ŕś User Guide GG Fig. 1.7 USB CableG Figure 1.5 CARMAN SCAN NEO User Guide The USB cable connects the USB ports of CARMAN SCAN NEO and your PC to download the diagnosis software or save captured files to your PC.G ŕś Carrying Case G Be sure to use the USB cable supplied by Our Company only. Otherwise, your PC or product can be damaged.G GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG Fig. 1.6 CARMAN SCAN NEO Carrying CaseG CARMAN SCAN NEO includes a number of adaptors and cables for diagnosing vehicles.G When the product is not in use, store it in the supplied carrying case to prevent damage and loss.G CARMAN SCAN NEO User GuideG 11 CARMAN SCAN NEO User GuideG 12 G Chapter 1: General Descriptions Chapter 1: General Descriptions ŕś Cigarette Lighter Power CableG ŕśGDLC CableG Fig. 1.8 Cigarette Lighter Power CableG The cigarette lighter power cable connects CARMAN SCAN NEO with the cigarette lighter jack in your vehicle to feed power to CARMAN SCAN NEO.G Fig. 1.10 DLC CableG The DLC cable is also called the OBD-II cable. All vehicles released recently have built-in OBD-II connectors compatible to the OBD-II specification.G It is possible to diagnose new model vehicles by directly connecting the DLC cable. It is not CARMAN SCAN NEO has a built-in battery so that you can use it without an additional power supply. When the battery power is weak or the battery is not charged, you can feed power by connecting the main necessary to connect any additional power source as power is feed through the diagnostic connector.G Old model vehicles should be diagnosed by connecting an additional module to the vehicle power source through the cigarette lighter power adapter.G cable.G ŕśâŤŮťâŹAC electrical power cord / adapterG ŕśâŤŮťâŹBattery Extension CableG Fig. 1.9 Battery Extension CableG The battery extension cable is used to feed power to CARMAN SCAN NEO directly from a vehicle battery through the cigarette lighter power cable.G CARMAN SCAN NEO User GuideG 13 Fig 1.11 AC electrical power cord / adapterG When you want to download the diagnosis program or search flight record, you can use this AC/DC electrical power adapter to feed power.G Also, can charge the battery built in the product.G CARMAN SCAN NEO User GuideG 14 G Chapter 1: General Descriptions Chapter 1: General Descriptions ŕś Oscilloscope DLC AdapterG The DLC adapter is used to diagnose vehicles by connecting it to the DLC main connector. As there are similar shaped adapters, make sure to check the vehicle manufacturer name on the adapter before use.G Also, there can be various adapters for one manufacturer. Therefore, be sure to check the shape and pin numbers of the diagnostic connector in the vehicle.G Some vehicles do not supply power through the diagnostic connector. Do not connect any power supply if power can be supplied through the diagnostic connector.G 1) Korean kit Fig 1.12 SCOPE PROBE SET (2-CHANNEL+ EXT) Figure 1.14 Hyundai/Mitsubishi Cable (12P) Figure 1.15 Kia/Mazda Adapter (6+1P) Fig 1.13 TRIGGER PICK UPG ŕś Optional Items [To see pictures of optional items please refer to the attached optional components or visit the website of Nextek Mall www.nex-tek.com.] Figure 1.16 Kia Adapter (20P, blue) Figure 1.17 Daewoo, GM Adapter (12P) Figure 1.18 Ssangyong Adapter (14P) GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG CARMAN SCAN NEO User GuideG 15 Figure 1.19 Ssangyong Adapter (20P) CARMAN SCAN NEO User GuideG 16 G Chapter 1: General Descriptions Chapter 1: General Descriptions 2) Japanese kitG Figure 1.20 Samsung Adapter (14P)G Figure 1.21 Toyota Adapter (17R) Figure 1.22 Toyota Adapter (17C)G Figure 1.23 Honda Adapter (3P) Figure 1.24 Honda Adapter (5P)G Figure 1.25 Mitsubishi Cable (12+16P) Figure 1.26 Subaru Adapter (9P)G GGGGG Figure 1.27 Mazda Adapter (17C) Figure 1.28 Mazda Adapter (6+1P)G CARMAN SCAN NEO User GuideG 17 CARMAN SCAN NEO User GuideG 18 G Chapter 1: General Descriptions Chapter 1: General Descriptions 3) European kitG Figure 1.29 Mitsubishi Adapter (12P) Figure 1.30 Nissan/Infiniti Adapter (14P)G Figure 1.31 PSA Cable (30P) Figure 1.32 PSA Cable (2P)G Figure 1.33 Fiat Adapter (3P) Figure 1.34 Renault Cable (12P)G GG Figure 1.35 Mercedes Benz pin board (38P) Figure 1.36 Opel Adapter (10P)G Figure 1.37 Audi/VW Cable (2+2P) CARMAN SCAN NEO User GuideG 19 Figure 1.38 Mercedes Benz Cable (3 liners)G CARMAN SCAN NEO User GuideG 20 G Chapter 1: General Descriptions Chapter 1: General Descriptions 6. Power Supply 1. Cigarette Lighter Power CableG Power is fed through the cigarette lighter power cable.G G However, when the vehicle ignition switch is in the âOFFâ position or upon starting a vehicle, power is not supplied to the cigarette lighter socket.G 2. Vehicle BatteryG Figure 1.39 BMW Adapter (New Model)G Connect the red clip of the battery extension cable to the (+) battery terminal, and black clip to the (-) terminal. Connect the cigarette lighter power cable between the battery extension cable and the product.G 4) Usa/ Australian kitG In this case, power is supplied anytime regardless of the ignition switch status or vehicle starting. (Be careful no to discharge the battery.)G Be careful when connecting the cable, as incorrect polarity may damage the main module.G 3. DLC CableG Where the vehicle satisfies the OBD-II communication convention and uses a certain manufacturer's diagnostic connector, the DLC main cable can supply power Figure 1.40 Holden Adapter (6P) to the product directly without a separate power supply.G Figure 1.41 Ford Cable (20P)G 4. Rechargeable Battery PackG If the built-in battery is used, you can use the system for 3 to 4 hours without any separate power supply.G The available time may change based on use and environment.G How to charge:GWhen the product is not in use, connect it to the power source by the AC/DC power adapter that came with the product to charge the built-in battery.G 5. AC/DC Power AdapterG If the AC/DC adaptor is used for power supply, the battery will be automatically recharged depending on programs and it is also used for power supply to the main module.G CARMAN SCAN NEO User GuideG 21 CARMAN SCAN NEO User GuideG 22 G Chapter 2: Menu Configuration Chapter 2: Menu Configuration 1. Before Getting Started 1. Before using the system, check whether or not the battery is fully charged. If it is not charged, then connect external power supply or recharge the battery before using the system.G - If you use the system by connecting it to a vehicle, you can also feed power to it through the vehicle diagnostic connector. 2. Menu DescriptionG When turning ON CARMAN SCAN NEO, the main screen with the menu is displayed as follow. If power is not feed by the vehicle diagnostic connector, you need to connect the cigarette lighter power cable to feed power before you start communication with the vehicle. Voltage mismatch between the ECU and CARMAN SCAN NEO may cause a communication error.G 2. Before using the system, make sure to download the diagnosis program.G The diagnosis program will be stored in the system memory.G - Before using the system, check if the diagnosis program matches the option you have purchased.G GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG Figure 2.1 Main ScreenG 1) TPMS TPMS should be supported with TPMS module which is optional.G 2) VEHICLE DIAGNOSIS This menu provides scanner's own functionality such as vehicle diagnosis, service data search, actuator activation, etc. 3) CONFIGURATION In this menu, you can check the system display unit, graph, background color, favorite setting, screen setting, time setting and system information. 4) DOWNLOAD In this menu, you can connect to the download program to update the software in CARMAN SCAN NEO. 5) OSCILLOSCOPE It can measure desired sensor waveform and ignition waveform with 4 channels, and use meter & simulator function. 6) UTILITY You can check flight record, text shot and screen capture and use gas analyzer function. CARMAN SCAN NEO User GuideG 23 CARMAN SCAN NEO User GuideG 24 G Chapter 3: Configuration Chapter 2: Menu Configuration 3. IconsG 1. Information When turning ON CARMAN SCAN NEO, the main screen with the menu is displayed as In this menu, you can check and enter user and system information.G follow:G XG G G G G G G G G G G G G G G YG G G G G G G G G G G G G G G ZG G G G G G G G [G G G G G G G G G G G G G \G G G G G ]G G G G G ^G G G G G Figure 2.2 IconsG 1. HOME Pressing this button returns to the main screen in the initial booted status. 2. Path Box This displays the path of the currently running function. 3. Text Shot 4. Screen Capture Figure 3.1 Information > User Info.G Pressing this icon can store all current data values of a system being diagnosed. 1. Select Information from the Configuration menu.G The screen being displayed on the LCD can be taken and stored. 2. My Profile is displayed and this information can be edited.G 5. Text Mode 6. Battery Charging Status This shows the charging status of the built-in battery. : The status of an external DC power is supplied and at the same time indicates When the cursor blinks on the desired text, click the EDIT button.G the status of being charged. : Displays the battery status After charging the battery, use AT in order to avoid discharging. 7. Back Pressing this button returns to the previous screen. CARMAN SCAN NEO User GuideG 25 CARMAN SCAN NEO User GuideG 26 G Chapter 3: Configuration 3. When information is modified after clicking the EDIT button, click the Save button to save the modified information.G Chapter 3: Configuration 2. System Display Unit In this menu, you can change the display unit of data which are sent from a vehicle.G The units of various information, such as speed, temperature, pressure, angle, G air flow and sound, can be checked and modified.G Figure 3.2 Information > Editing âMy ProfileâG 4. Clicking the Information button on the left pane displays the system and program information.G Figure 3.4 System Display UnitG GGG 1. It is possible to change the display units all at once according to the region that uses âMetricâ or âYard-Poundâ system.G 2. After changing the display unit, click the Save button to save your modification.G Figure 3.3 Information > System InformationG CARMAN SCAN NEO User GuideG 27 CARMAN SCAN NEO User GuideG 28 ÂG ÂG ÂÂG Chapter 3: Configuration Chapter 3: Configuration 3. Graph In this menu, you can configure graphs that are displayed for data from sensors.G SPEED : You can change between Km/h and MPH.G TEMPERATURE : You can change between ŕ and ŕś.G PRESSURE : You can change among mbar, kPa, inHg and psi.G ANGLE : You can change between ° and %.G AIR FLOW : You can change between gm/s and lb/m.G SOUND : It can be turned ON or OFF.G The graph line color, background color and graph line thickness can be set.G Figure 3.5 Graph > Init 1G : Pressing this button displays the graph in its initial status as shown in the figure 3.5. : Pressing this button displays the graph in its initial status in the white background. : When making a change to the setting, click the Save button to save the modified setting. Then, the graph is displayed in the modified status. CARMAN SCAN NEO User GuideG 29 CARMAN SCAN NEO User GuideG 30 G Chapter 3: Configuration : Press this button to change the background color as desired. Chapter 3: Configuration 4. MakerG It is possible to select your favorite vehicle maker to be displayed on top in the diagnosis : Press this button to change the color of the vertical line on the grid. menu.G This function can save time to search for the desired vehicle maker whenever the diagnosis is made.G : Press this button to change the color of the horizontal line on the grid. : Press this button to change the color of the cursor which appears on which the screen is touched. : Press this button to change the color of each graph for up to 8 channels. Up to 8 channels can be displayed on the screen at once. : Press this button to select the color of the channel graph. : Press this button to adjust the thickness of the graph line. Figure 3.7 MakerG G G G G G G G G G G G G G G : Press this button to check the list of the diagnosis programs that are stored in the internal memory. You can erase the diagnosis data (version, vehicle maker) by a vehicle maker.G G G G G G G G G G G G G G : Press this button to initialize your favorites.G G G G G G G G G G G G G G : Press this button to store the selected favorites.G G The selected favorite items are deselected.G G This favorites are displayed as icons in order in the diagnosis menu.G Figure 3.6 CH. Color screenG CARMAN SCAN NEO User GuideG 31 The favorite list displayed in this menu can also include makers of diagnosis programs that are not downloaded.G CARMAN SCAN NEO User GuideG 32 G Chapter 3: Configuration 5. DisplayG In this menu, you can align the touch screen coordinates, setup the language and adjust the LCD brightness.G Chapter 4: Utility If the touch screen coordinates are not accurate, they can be corrected through the In this menu, you can check the flight record, text shots and screen captures and utilizes the gas analyzer function.G 1. Flight Record calibration function. Also, the brightness of the LCD can be adjusted so that the In this menu, you can save the service data for your vehicle for analysis.G product can be fit both in dark and bright places.G - You can save the desired service data. Also, the system language can be selected and set by a user.G - This function is useful when data should be saved to diagnose an intermittent symptom.G Figure 3.8 DisplayG G G G G G G G G G G G G G G G : Pressing this button displays the touch screen calibration panel. Press the (+) symbols shown on the screen to correct the coordinates automatically.G G G G G G G G G G G G G G G G : Press this button to check if the coordinates are calibrated correctly through the calibration function. Figure 4.1 Flight RecordG G G G G G G G G G G G G G G G : Click this button to display the data only selected by the user.G G G G G G G G G G G G G G G G : Click this button to delete the file selected by the user.G G G G G G G G G G G G G G G G : Click this button to rename the file that was temporarily set when saving the file (only in English).G System Language : The language of the operating system and diagnostic program can be set among the languages that are stored in the internal memory. LCD Screen Brightness : Press the â-â and â+â buttons to adjust the screen brightness. CARMAN SCAN NEO User GuideG 33 CARMAN SCAN NEO User GuideG 34 G Chapter 4: Utility Chapter 4: UtilityG Text View: Click this button to check the saved data in numbers.G -GGraph View: Click this button to switch to the graph screen for tendency analysis.G GGGGGGGGGGGGGGGGGG GGGGGG1 GGGGGG2 Figure 4.2 Data_Text ViewG Figure 4.3 Data_Text ViewG G 1. G G G G G G G G G G G G G G G : Press this button to switch the graph screen to the text screen.G Maker >> Diagnostic program version >> Language version >> System >> Diagnostic connector G G G G G G G G G G G G G G G : Press this button to configure the displayed graph.G 2. Total time >> Interval >> Selected time G G G G G G G G G G G G G G G G : In the graph screen, up to 8 current data are displayed at once. If more than 8 current data are saved, click the channel and keys : Press this button to switch to the graph screen from the text screen. to scroll the current data. Total time: The total time of the saved flight record is displayed. GGGGGGGGGGGGGGGG Interval: This indicates the time from the initial clicked position of the bar on top to the point that the bar is dragged and released. Selected time: This indicates the time of the currently clicked position of the bar in GGGGGGGGGGGGGGGGG the total time. CARMAN SCAN NEO User GuideG 35 CARMAN SCAN NEO User GuideG 36 G Chapter 4: UtilityG Chapter 4: UtilityG - Graph config: Press this button to set the channel, current value and max./min. values of graphsG G G G G G G G G G G G G G G G G G : Press this button to show or hide the maximum and minimum values for each sensor on the right side of the screen.G G G G G G G G G G G G G G G G G G : Press this button to show or hide the sensor names.G G G G G G G G G G G G G G G G G G G : Press these buttons, you can increase or decrease the maximum value for each channel to increase or decrease the graph values.G Figure 4.4 Data_Graph config (CH Config)G G G G G G G G G G G G G G G G G G : Clicking this button displays the panel on the right to setup each displayed graph by a channel.G G G G G G G G G G G G G G G G G G : Pressing this button extends the horizontal axis on the grid for more precise graph analysis.G GGGGGGGG : Pressing this button shortens the horizontal axis on the grid to display more data on the screen at once.G G G G G G G G G G G G G G G G G G G : 5 current data are displayed on the screen at once by default. The number of data displayed on the screen can be set from 1 to 8.G G G G G G G G G G G G G G G G G G : Press this button to show or hide the current value of the sensor.G CARMAN SCAN NEO User GuideG 37 CARMAN SCAN NEO User GuideG 38 G Chapter 4: UtilityG Chapter 4: UtilityG 2. Text Shot G G G G -GFull Screen: As all current data are saved for the selected system, you can utilize the full screen function to check the vehicle condition conveniently.G This function is to save all values of the current data for the selected moment from a system being diagnosed. This is used to save data at a certain moment and analyze them.G - As all data can be saved at once, you can diagnose your vehicle conveniently.G Figure 4.6 Text Shot > Full ScreenG Figure 4.5 Text Shot > Item selectionG G G G G G G G G G G G G G G G G G : Press this button to return to the Text Shot list.G G G G G G G G G G G G G G G G G G : Press this button to display all saved data for the selected item(s).G G G G G G G G G G G G G G G G G G : Press this button to delete the selected item.G G G G G G G G G G G G G G G G G G : Press this button to rename the selected file from the temporarily set name.G CARMAN SCAN NEO User GuideG 39 CARMAN SCAN NEO User GuideG 40 G Chapter 4: UtilityG Chapter 4: UtilityG 3. Screen Capture You can take a screen capture and save it when necessary.G Full Screen: The red marker function can be used in the full screen. You can make or edit a note onto a saved screen capture.G As you can take a screen capture with a simple action, this function is very convenient and useful for your diagnosis.G Figure 4.8 Full Screen > Red MarkerG Figure 4.7 Screen CaptureG G G G G G G G G G G G : Press this button to activate the red marker function. Then, click on the screen and drag it to make a mark.G G G G G G G G G G G G G G G G G : Press this button to show the saved files on a full screen.G G G G G G G G G G G G G G G G G : Select several files and press this button to display them in a slide show.G G G G G G G G G G G G G G G G G : Press this button to set the number of repetition and the display time of each file in a slide show and to adjust the color and thickness of the GGGGGGGGG G G G G G G G G G G G : Press this button to edit the contents written with the red marker function.G G G G G G G G G G G G : Press this button to save the written contents.G G G G G G G G G G G G G G G G G G G G : If several data are selected in the Image list (Figure 4.7), you can red marker in a full screen.G G G G G G G G G G G G G G G G G : Press this button to rename the file.G switch between images and use the red marker function.G : Press this button to deactivate the function. G G G G G G G G G G G G G G G G : Press this button to delete a file.G CARMAN SCAN NEO User GuideG 41 CARMAN SCAN NEO User GuideG 42 G Chapter 4: UtilityG Chapter 4: UtilityG 4. Gas Analyzer CARMAN SCAN NEO can measure and analyzer the emitted gas with Gas analyzer. How to connectG 1. PreparationG NGA 6000 module, RS232C cable and CARMAN SCAN NEOG 2. ConnectionG - Connect the NGA 6000 module to CARMAN SCAN NEO with the RS232C cable. - Click on the Gas Analyzer button. G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G G ŕ˝G Figure 4.9 Gas AnalyzerG G G G G G G G G G G G G G G G : Press this button to print the test result.G : Press this button to set the measurement to 0.G GGGGGGGGGGGG : Press this button to purge the remaining gas from the measurement probe with clean air.G : Press this button to start the function (measurement).G Figure 4.9 NGA 6000 GAS ANALYZERG G G G G G G G G G G G G G G G G: Press this button to cancel the function and return to the previous screen.G G G G G G G G G G G G G G G G G G : Press this button to switch to the bar graph. G G G G G G G G G G G G G G G G G : Press this button to setup the test items and criteria.G G ŕžGIf the measurement is over the value specified in the SETUP menu, it is displayed in red.G CARMAN SCAN NEO User GuideG 43 CARMAN SCAN NEO User GuideG 44 G Chapter 5: TPMSG Chapter 6: Diagnosis Menu 1. TPMS TPMS should be supported with TPMS module which is optional.G Using TPMS product function please. Register ID after the replacement and repair of tire or 1. How To Connect Self-Diagnostic Connector and Select Diagnosis Program (for Korean, Japanese and European vehicles) wheel.G(But, it can be used with only TPMS system.)G 1. Locate the diagnostic connector in the vehicle.G Most vehicles released after year 2002 conform to the OBD-II Protocol and have OBD-II diagnostic connectors.G Most OBD-II vehicles have their diagnostic connectors on the section over the brake pedal under the steering wheel.G(Figure 6.1)G If an additional adaptor is required, the scanner display shows the type of the necessary adaptor and the location of the diagnostic connector. (Figure 6.2)G GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG Figure 5.1 TPMS .G Figure 6.1 Location of OBD-II diagnostic connector Figure 6.2 Adapter and DLC location guide screenG G 2. Use the diagnosis cable to connect the vehicle's diagnostic connector and CARMAN SCAN NEO.G 3. Turn on CARMAN SCAN NEO.G If power is not feed through the diagnostic connector and the CARMAN SCAN NEO battery is not fully charged, you need to connect an additional power supply (vehicle battery or cigarette lighter power cable, etc).G 4. Select the [VEHICLE DIAGNOSIS] menu.G Figure 5.2 TPMS ID REGISTRATION CARMAN SCAN NEO User GuideG 45 CARMAN SCAN NEO User GuideG 46 G Chapter 6: Diagnosis Menu 5. Select the maker of the vehicle to be diagnose.G Chapter 6: Diagnosis Menu 7. Select the vehicle model to be diagnose.G Figure 6.3 Vehicle maker selectionG Figure 6.5 Vehicle model selection 6. If there are several diagnostic data versions in the internal memory of G CARMAN SCAN NEO, select the desired diagnosis data version.G 8. Select the system to be diagnose.G Figure 6.4 Diagnosis program version selection CARMAN SCAN NEO User GuideG 47 Figure 6.6 System selection CARMAN SCAN NEO User GuideG 48 G Chapter 7: Vehicle Diagnosis Chapter 7: Vehicle DiagnosisG 1. Diagnostic Trouble Codes G - In this menu, it is possible to check for any malfunction of the selected vehicle system through the communication with the ECU in the vehicle. As CARMAN SCAN NEO displays DTCs (Diagnostic Trouble Codes), you can easily check where malfunction occurs.GAlso, the description for DTCs is displayed as well to help you service your vehicle.G In order to check for DTCs, you need to connect CARMAN SCAN NEO to the vehicle diagnostic connector correctly. Refer to Chapter 6 âDiagnosis Menuâ for correct connection. Also, recheck the specifications, such as the vehicle maker, vehicle model, displacement, etc.G Figure 7.2 DTC 1G 2. The DTC search screen appears. Now, you can check current and old DTCs and erase them.G Old DTCs are not activated unless there is no corresponding fault history. Diagnostic Trouble Codes detected only when the text shot can be saved. 3. Press the Current DTC button to check if there is any current DTC.G Figure 7.1 DTC selectionG NOTE) The menu for DTC selection, shown in the figure 7.1, can differ by vehicle makers and models.G 1. When selecting the correct vehicle model and system from the menu and communication with the vehicle is properly established, the menu appears as the figure 7.1. Select DIAGNOSTIC TROUBLE CODES and press the ENTER key.G If the message indicating a communication error is displayed instead of the menu like the figure 7.1 or communication cannot be established, check the vehicle condition and the connection status of the diagnostic CARMAN SCAN NEO User GuideG 49 Figure 7.3 DTC 2G G G G G G G G G G G G G G G G G G G G G G CARMAN SCAN NEO User GuideG 50 G Chapter 7: Vehicle DiagnosisG G G G G G G G G G G G G G G : Press this button to check for DTCs again.G GG G G The module checks the ECU information again for DTCs.G Chapter 7: Vehicle DiagnosisG 2. Current Data -G GIn the CURRENT DATA menu, the module can communicate with the vehicle ECU to check data and control values of each sensor of the selected system and to check G G G G G G G G G G G G G G : Press this button to display detailed information for DTCs.G conditions of various switches and actuators. It is important to select the vehicle specifications correctly for accurate G G G G G G G G G G G G G G : Press this button to check Freeze Frame data for malfunction.G sensor data measurement. Make sure to set the vehicle displacement, manufactured year, fuel, etc. correctly.G The current data list can differ even with the same vehicle models.G G G G G G G G G G G G G G G : Press this button to check the DTC list for malfunction if the vehicle is equipped with MIL.G GGGGGGGGGGGGGG : Press this button to clear DTC.G Figure 7.5 Current data item selectionG NOTE) The menu for current data selection, shown in the figure 7.5, can differ by vehicle makers and models.G Figure 7.4 DTC 3G 1. When selecting the correct vehicle model and system from the menu and communication There are current and old DTCs. When trying to clear old DTCs, they are cleared immediately and they are not set again. However, when trying to clear current DTCs, they are cleared for a short period of time but they are activated again. In this case, clear DTCs again after checking and repairing malfunction parts for the corresponding DTCs.G with the vehicle is properly established, the menu appears as the figure 7.5.G Select CURRENT DATA and press the ENTER key.G If the message indicating a communication error is displayed instead of the menu like the figure 7.5 or communication cannot be established, check the vehicle condition and the connection status of the diagnostic connector again. CARMAN SCAN NEO User GuideG 51 CARMAN SCAN NEO User GuideG 52 G GG Chapter 7: Vehicle DiagnosisG 2. The current data list is displayed as shown in the figure 7.6.G Chapter 7: Vehicle DiagnosisG GGGGGG analysis.G GGGGGG GGGGGGG Figure 7.6 CURRENT DATA 1G Figure 7.7 CURRENT 2G G G G G G G G G G G : Press this button to switch to the text view mode.G G G G G G G G G G G G G G G G G : Press this button to check current data in graphs.G It is helpful to convert the current vehicle data to graphs for tendency analysis. (Up to 30 items can be selected while up to 8 graphs can be displayed at a time.) To convert current data to graphs, such data are need to be fixed. Then, only these fixed data change.G G G G G G G : Press this button to switch to the graph view mode and display the maximum G G G G G G G : Press this button to save sensor data or check the saved files.G and minimum values of the measured sensor data.G Graph View: This function is to check current data in graph forms for tendency programmed into the ECU and these programmed values are displayed.G : Press this button to deactivate the automatic mode. Then, the maximum Data are stored in the internal memory and they can be stored synchronized with your PC.G G G G G G G G : Press this button to display DTCs at once.G G G G G G G G : If the selected system has help information, this button is activated. In the normal mode, the maximum and minimum values of each sensor are and minimum values are displayed in the normal mode.G GG G G G G G G G G G G G G G : In the graph view mode, up to 8 current data can be displayed at a time. If the number of sensor data displayed on the screen at a time Then, press this button to display information.G is set to less than 8, the remaining current data are displayed in the When fixing only certain items, values of only these items change. list on the bottom. (Adjust the number with the up/down buttons.)G Therefore, the data change measurement is performed faster and more precise diagnosis can be achieved.G CARMAN SCAN NEO User GuideG 53 CARMAN SCAN NEO User GuideG 54 GGG Chapter 7: Vehicle DiagnosisG GGGGGG File: Press this button to save data or check the saved data.G Chapter 7: Vehicle DiagnosisG 1. The screen displays the Record Data menu pane where you can check the saved data through the flight record list.G 2. For the flight record, text shot, screen capture and gas analyzer functions, refer to Chapter 4. Record Data.G GGGGGGGGGGGGGGGGGGG Figure 7.8 Flight Record DataG G G G G G G G G G G G G G G G G G : Press this button to start to record the selected sensor data.G The data can be recorded for up to 1 hour and the recording time can vary depending on the number of the selected current data.G (When the recording operation is performed for 1 hour, it stops automatically.)G G G G G G G G G G G G G G G G G G : Press this button to check or search for the stored file(s) or retrieve and display data as necessary.G Figure 7.9 Record Data ViewerG CARMAN SCAN NEO User GuideG 55 CARMAN SCAN NEO User GuideG 56 G Chapter 7: Vehicle DiagnosisG Graph Config: Press this button to set the channel, current value and max./min. values of graphs.G Chapter 7: Vehicle DiagnosisG G G G G G G G G G G G G G G G G : Press this button to show or hide the max and min values for each sensor on the right side of the screen.G G G G G G G G G G G G G G G G G : Press this button to show or hide the sensor names.G : Press this button to increase/decrease the max value range to zoom in and out the displayed graphs.G : Press this button to stop the screen while checking current data. Press this button again starts the screen.G Figure 7.10 Graph ConfigG G G G G G G G G G G G G G G G G G : Press this button displays the panel on the right to setup each displayed graph by a channel.G G G G G G G G G G G G G G G G G G : Press this button extends the horizontal axis on the grid for more precise graph analysis.G GGGGGGGG G G G G G G G G G G G G G G G G G : Press this button shortens the horizontal axis on the grid for more Precise graph analysis.G G G G G G G G G G G G G G G G G G G : 5 current data are displayed on the screen at once by default. The number of data displayed on the screen can be set from 1 to 8.G GGG : Press this button to show or hide the current value of the sensor.G CARMAN SCAN NEO User GuideG 57 CARMAN SCAN NEO User GuideG 58 G Chapter 7: Vehicle DiagnosisG G G G G G -GShow DTC: The upper half of the screen displays the current data while the lower half of the screen displays the DTC list.G If there is any DTC, the corresponding sensor data can be checked for comparison.G Chapter 7: Vehicle DiagnosisG 3. Actuation In this menu, you can start and stop actuators and switches forcibly to diagnose them.G The actuation function is available depending on vehicle makers and models.G GGGG Figure 7.12 ACTUATION > SelectionG Figure7.11 Current data & DTCG 1. When selecting the correct vehicle model and system from the menu and G G G G G G G G G G G G G G G G G : Press this button to exit the dual display mode and return to the communication with the vehicle is properly established, the menu appears as the Record Data Viewer.G figure 7.12.G Select an item to actuate.G If the message indicating a communication error is displayed instead of the menu like the figure 7.12 or communication cannot be established, check the vehicle condition and the connection status of the diagnostic connector again.G 2. The screen Figure 7.13 ACTUATION > 1 appears.G CARMAN SCAN NEO User GuideG 59 CARMAN SCAN NEO User GuideG 60 G Chapter 7: Vehicle DiagnosisG 3. Press the Start button starts the actuation function. Chapter 8: OSCILLOSCOPE The user can choose from 2 channel scope modes and ignition waveform measurement inspect the system in the proper condition. 1. Main Menu Before starting actuation, make sure to check the operating condition to mode. (Guidelines in the menu may vary according to function improvementUP The actuation time differs by the actuated items. GGG GGG Figure 7.13 ACTUATION > 1 Fig. 8.1 Oscilloscope Main Menu 4. Press the Stop button stops the actuation function. Press this button to stop the actuation function during diagnosis. Press the ESC button on the main module or the arrow button on the right top corner of the screen also stops the actuation function. : Press this button to switch from the text view mode to the graph view mode. The actuation result is judged by noise from the running actuator or switch and vehicle RPM change. Therefore, it is recommended to perform the actuation test in a quiet area and use current data values as a reference. Fig. 8.2 Oscilloscope Main Menu CARMAN SCAN NEO User GuideG 61 CARMAN SCAN NEO User GuideG 62 G Chapter 8: OSCILLOSCOPE Chapter 8: OSCILLOSCOPE 2. Scope environment setup 1) Waveform display window When [scope] is selected in [Fig. 8.2], the screen in [Fig. 8.3] appears Fig. 8.5 Waveform display window ŕś It consists of 4 channels in the middle of the screen and displays waveforms. 2) Environment setup / Measured value window Fig. 8.3 Measurement main screen When icon is clicked in [Fig. 8.3], the screen in [Fig. 8.4] appears Fig. 8.6 Environment setup / Measured value window ŕś It is consisted of 4 channels on the right side of the screen, which circulates ŕž by icon.. 3) Menu window ŕž ŕž Fig. 8.3 Measurement main screenŕž Fig. 8.4 Measurement environment setup screen CARMAN SCAN NEO User GuideG 63 Fig. 8.7 Menu window ŕś Area at the bottom of the screen, where the user can choose from various scope CARMAN SCAN NEO User GuideG 64 G Chapter 8: OSCILLOSCOPE Q&A 3. Description of scope environment setup icons ŕžâŤŮťâŹ ŕž ŕž ŕž ŕž ŕžĄ ྠྠྠྡྷ Q) Communication cannot be established. A) 1. Check the connection of the diagnostic cable. - Communication cannot be established if the diagnostic cable is not properly connected. 2. Check if power is properly supplied to the main module. - Vehicle diagnosis can be affected by unstable power source. * If this symptom continues to occur, the hardware of the main module or ྣ Fig. 8.8 Environment setup a component of the vehicle may malfunction. * If this symptom continues to occur, contact your Dealer for service. 3. Through the power supply from the vehicle diagnostic cables if you do 1) Channel Setting : The user can choose or cancel each channel. not connect the cable supplying power to the Cigarette Lighter Power Cable. - AT batteries and vehicle batteries in electric potential difference does not communicate 2) Record name : The user can enter a name of each channel test item. Q) I cannot turn on the module. 3) Automatic voltage setting : Voltage of the applicable channel is automatically set according to input waveform. It is not executable in overlay mode. 4) Selection of Options : Options for channel (pressure, vacuum, low current, high current, temperature, etc) can be selected. 5) ,6) A) 1. Check if the battery in the module is charged. - The built-in battery may not be charged. 2. The battery may not be able to function due to the ambient temperature. - Avoid excessively hot or cold areas. ,7) Voltage adjustment : Click up and down arrow keys to adjust voltage from minimum of 10mV to maximum of 100V. 8) Peak OFF / ON : Peak of each channel can be set or cancelled. Q) The touch screen does not function properly. A) 1. The touch screen coordinates may not be correctly aligned. - It is possible to test the touch screen coordinates by selecting the CONFIGURATION from the main menu and then selecting DISPLAY and Test 9) Selection of Filter : Noise filter for each channel can be set or cancelled. Touch Coordinate menus in order. If the coordinates are not correct, correct them using the Calibrate Touch Screen function. 10) Selection of Coupling : DC/AC coupling for each channel can be selected. * If this symptom continues to occur, contact your Dealer for service. 11) Selection of Uni / Bi Mode : Ground level of each channel can be set at the bottom/in the middle. Uni places the ground level at the bottom while Bi in the middle. When a measurement signal displays both positive(+) electric potential and negative(â) electric potential, using Bi mode is more convenient. CARMAN SCAN NEO User GuideG 65 CARMAN SCAN NEO User GuideG 66 G kkanggri@nex-tek.com WARRANTY CARD Website: www.nex-tech.com/carman WARRANTY CARD Warranty Policy Warranty Registration 1. The manufacturer warrants this product to be defect free in material and workmanship for a period of one (1) year from the date of purchase. Defective products may be returned by the original purchaser Upon receiving the product, please fill out the following registration form and return either by fax or within the warranty period, postage pre-paid together with proof of purchase date to Nextech Co. LTD. separate mail to Nextech Service Center or North America Customer Service Center (only USA Defective products will be repaired at manufacturerâs discretion, replaced at no charge. customer) according to your area. 2. The warranty does not apply to any units that have been tampered with, or to damages incurred through improper use and care, defects caused by abuse or through the usage for purposes other than the IMPORTANT: Any delay or missing of your warranty registration may cause disadvantage or intended use, used in a manner inconsistent with the instructions regarding use, and faulty packing or inconvenience to your warranty repair service. mishandling by any common carrier. 3. Repairs not covered by this warranty will be performed at the current cost for parts and labor. In no event will Nextech Co. Ltdâs liability exceed the price paid for the product from direct, indirect, special, incidental or, consequential damages resulting from the use of this product, its accompanying software, CUSTOMER NAME _______________________________________________________________ or its documentation without obligation to notify any individual or entity. Warranties hereunder extend COMPANY NAME _______________________________________________________________ only to customers and are not transferable. Warranty Period & Software update ADDRESS _____________________________________________________________________ 1. Warranty period for Nextech products and theseâs accessories including software card is one (1) year from the date of sale to the original consumer. COUNTRY/STATE ________________________________________ ZIP __________________ 2. Free Software update for Nextech products is one (1) year from date of purchase. After one (1) year from purchase date, software updates will be optional and will require separate payment per request. Repair Service 1. If you suspect that you have a problem with this product, please read the operation manual (guide) TEL No _____________________________ EMAIL ADDRESS FAX No _________________________________ _______________________________________________________________ carefully to ensure that you are operating this product properly. 2. If you conclude that a real problem exists, check your product according to the procedures on the SERIAL No ___________________________ LOT No _______________________________ âTrouble Shooting Cardâ and mark your trial records in the blank. 3. Please return the main body or the troubled parts along with the âTrouble Shooting Cardâ to the repair SOFTWARE VERSION ___________________________________________________________ service center listed below. Be sure to return them in freight prepaid as we donât accept freight collect. DEALERSHIP ____________________________________________________________________ Nextech Service Center North America Customer Service Center Nextech Co. Ltd. Nextech America Inc. E&C Venture Dream Tower(the 3rd) 13F DATE OF PURCHASE MONTH _____________ DAY ____________ YEAR _____________ 17581 Irvine Blvd suite 100 Guro-dong, 197-33 Guro-Gu, Seoul, Korea Tustin CA, 92780 USA Tel : (822)3140-1489 Fax : (822)3140-1449 Tel: (714)832-0100 Fax: (714)832-0123 Email : sales@nex-tek.com Email: csh@nex-tek.com 67 ___________________________________ __________________________________ SIGNATURE DATE 68
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.6 Linearized : No Author : 최선미 Create Date : 2011:04:19 10:50:06Z Modify Date : 2011:04:20 15:44:13+09:00 Language : ko-KR Tagged PDF : No XMP Toolkit : Adobe XMP Core 4.2.1-c043 52.372728, 2009/01/18-15:08:04 Format : application/pdf Creator : 최선미 Title : EMISSION TEST REPORT Creator Tool : Microsoft® Office Word 2007 Metadata Date : 2011:04:20 15:44:13+09:00 Producer : Microsoft® Office Word 2007 Document ID : uuid:6c707cd6-2417-43a9-9c4b-2d4ea60dac79 Instance ID : uuid:ec2c78a0-2a7d-465a-9362-2c5b86621ecd Page Count : 40EXIF Metadata provided by EXIF.tools