Telefield 2-5255D 1.9GHz DECT 2 Lines Corded and Cordless Phone User Manual 1
Telefield Ltd. 1.9GHz DECT 2 Lines Corded and Cordless Phone 1
User Manual
| Download: |  |
| Mirror Download [FCC.gov] | |
| Document ID | 2435681 |
| Application ID | 8dDDRe9vCxHajohpqnY/Zg== |
| Document Description | User Manual |
| Short Term Confidential | No |
| Permanent Confidential | No |
| Supercede | No |
| Document Type | User Manual |
| Display Format | Adobe Acrobat PDF - pdf |
| Filesize | 413.91kB (5173830 bits) |
| Date Submitted | 2014-11-04 00:00:00 |
| Date Available | 2014-11-04 00:00:00 |
| Creation Date | 2014-11-05 09:57:37 |
| Producing Software | Acrobat Distiller 9.5.5 (Windows) |
| Document Lastmod | 2014-11-05 09:58:57 |
| Document Title | 1 |
| Document Creator | Adobe Illustrator CS4 |
| Document Author: | SZ000094 |
US number, Ringer Equivalence Number (REN), a product identifier in the format US:AAAEQ##TXXXX. The changes or modifications to this unit not expressly approved by the party responsible for FCC RF Radiation Exposure Statement base unit cordless handset Information for DECT Product Table of Contents Equipment Approval Information Interference Information Licensing Hearing Aid Compatibility FCC RF Radiation Exposure Statement Information for DECT Product Introduction Parts Checklist -Telephone Jack Requirements Installation -Digital Security System Important Installation Guidelines Handset Layout Base Layout Installing the Phone Telephone Operation -Making calls with the cordless handset -Making calls with the corded handset (from the base) -Making calls in the speakerphone mode (from the base) -Making calls in the speakerphone mode (from the handset) -Making calls with the optional headset -Pre-dialing -Answering a Call -Switching between the speakerphone, handset & headset mode -Mute -Do not disturb -Flash -Inserting a pause in the dialing sequence -Redial -Reviewing the Redial Numbers -Storing a Redial Record in Directory -Transferring a call to another extension -Receiving a transferred call from another extension -Ringer on/off and ringer volume -Speakerphone, handset and headset volume -Hold -Conference calls 10 11 -Installing the handset battery 11 -Base Station 12-14 Programming the Phone 15 -Standby Screen 15 -Programming Functions 15 -Phone Setting 15 -Date/Time 16 -Auto Answer 16 Intercom Calls -One-touch /memory log -Auto Answer Intercom 16 -Answering an intercom call -Dial Mode 17 -Page -Area Code 17 -Auto Standby -Registration 17 -Register 18 Caller ID (CID) -Remove Handset 18 -Receiving and storing CID records -De-Register 18 -Reviewing CID records -Add Headset 18 -Saving a CID record to the phone directory -2nd Call Alert 19 -Deleting a CID record -Handset Name 19 -Deleting all call records -Update Handset List 19 -Dialing back -Display Setting 19 -Call waiting caller ID -Contrast 20 -Backlight 20 Directory & One-Touch Memory -Adding directory entries -Sound Setting 20 -Storing a record in the one-touch/memory buttons -VOICE MAIL 21 -Reviewing directory records -Answering System 21 -On/Off Status 21 -Editing a name or number stored in the one-touch/ memory log -Outgoing Message (OGA) Playback 22 -Set Office Time 22 -Reviewing record in the one-touch/memory -Set Work Hours 23 -Editing a directory record -Set After Hours 23 -Copying a directory record -Ring Delay 24 -Deleting a directory record -Message Length 24 -Deleting all directory records -Call Screening 24 -Deleting a one-touch/memory -Message Alert 24 -Dialing a directory record -Remote Password 25 -Dialing a one-touch memory/record -Restore Setting 25 25 25 25 26 26 26 27 27 27 28 28 28 28 29 29 29 30 30 30 30 31 31 32 32 32 32 32 33 33 33 34 34 34 34 35 36 36 36 37 37 37 37 38 38 38 39 39 39 Table of Contents Cont. Answering System Operation -Answering system on/off -Recording incoming messages -Monitoring incoming calls -Memo record -Memo recording -Message/memo playback -Erasing messages -Remote access from remote party -Memory full Changing the Battery Battery Safety Precautions Display Messages Handset Sound Signals -Backup battery operation Troubleshooting Guide -Telephone solutions -Caller ID solutions -Battery General Product Care Causes of Poor Reception Warranty Assistance Limited Warranty 40 40 40 40 41 41 41 42 42 43 43 43 44 45 45 46 46 47 47 48 48 49 50-51 Introduction CAUTION: When using telephone equipment, there are basic safety instructions that should always be followed. Refer to the IMPORTANT SAFETY INSTRUCTIONS provided with this product and save them for future reference. IMPORTANT: Because cordless phones operate on electricity, you should have at least one phone in your home that isnât cordless, in case the power in your home goes out. Parts Checklist Coiled Handset Cord Corded Handset Belt Clip Telephone 2- Line cords AC power adaptor (for base) AC power adaptor (for charging cradle) Handset battery pack Telephone Jack Requirements Charging Cradle Short Line Cord Wall plate ďŹ ďŹ Cordless Handset Modular telephone line jack Installation Digital Security System Your cordless phone uses a digital security system to protect against false ringing, unauthorized access, and charges to your phone line. INSTALLATION NOTE: Some cordless telephones operate at frequencies that may cause or receive interference with nearby TVs, microwave ovens, and VCRs. To minimize or prevent such interference, the base of the cordless telephone should not be placed near or on top of a TV, microwave ovens, or VCR. If such interference continues, move the cordless telephone farther away from these appliances. Certain other communications devices may also use the 1.9 GHz frequency for communication, and, if not properly set, these devices may interfere with each other and/or your new telephone. If you are concerned with interference, please refer to the ownerâs manual for these devices on how to properly set channels to avoid interference. Typical devices that may use the 1.9 GHz frequency for communication include wireless audio/video senders, wireless computer networks, multi-handset cordless telephone systems, and some longrange cordless telephone systems. Important Installation Guidelines f $YRLGVRXUFHVRIQRLVHDQGKHDWVXFKDVPRWRUVflXRUHVFHQWOLJKWLQJPLFURZDYH RYHQVKHDWLQJDSSOLDQFHVDQGGLUHFWVXQOLJKW f $YRLGDUHDVRIH[FHVVLYHGXVWPRLVWXUHDQGORZWHPSHUDWXUH f $YRLGRWKHUFRUGOHVVWHOHSKRQHVRUSHUVRQDOFRPSXWHUV f 1HYHULQVWDOOWHOHSKRQHZLULQJGXULQJDOLJKWQLQJVWRUP f 1HYHULQVWDOOWHOHSKRQHMDFNVLQZHWORFDWLRQVXQOHVVWKHMDFNLVVSHFLfiFDOO\GHVLJQHGIRU ZHWORFDWLRQV f 1HYHUWRXFKQRQLQVXODWHGWHOHSKRQHZLUHVRUWHUPLQDOVXQOHVVWKHWHOHSKRQHOLQHKDV EHHQGLVFRQQHFWHGDWWKHQHWZRUNLQWHUIDFH f 8VHFDXWLRQZKHQLQVWDOOLQJRUPRGLI\LQJWHOHSKRQHOLQHV Handset Layout Visual Indicator 3 Soft keys Display DND/ Privacy (button) Exit (button) Spk (Speaker button) Headset Jack CID (button) VOL +/(buttons) End (button) DIR (button) Talk (button) * Tone (button) # Pause (button) Redial (button) Mute/ Del (button) Int/ Hold (button) Menu/ Flash (button) Base Layout Vol +/(buttons) Display DND/ Privacy (button) Ans Sys (button) CID / Next (button) DIR / Prev (button) One Touch/ Memory Log (1- 10) buttons 3 Soft Keys Exit (button) Play/ Stop (button) Memo (button) Delete (button) Headset Jack * Tone (button) Headset (button) Speaker (button) Redial (button) # Pause (button) Hold (button) Mute (button) Flash (button) Page (button) Intercom (button) Line 1 & 2 (buttons) 10 T-T104 (GP, 2.4V, 550mAh), Base Station 7KHSKRQHPD\EHFRQQHFWHGWRWZROLQH 5-& ZDOOMDFNVWRDFFRPPRGDWHDOOWZROLQHV &KRRVHDQDUHDQHDUDQHOHFWULFDORXWOHWDQGDWHOHSKRQHZDOOMDFN 5-& DQGSODFH \RXUFRUGOHVVWHOHSKRQHRQDOHYHOVXUIDFHVXFKDVDGHVNWRSRUWDEOHWRSRU\RXPD\ PRXQWLWRQWKHZDOO ,QVWDOO$$$VL]HDONDOLQHEDWWHULHV QRWLQFOXGHG IRUEDFNXSSRZHULQWKHHYHQWRID SRZHUIDLOXUH f ,QVHUWDďŹDWKHDGVFUHZGULYHURU VLPLODUREMHFWLQWRWKHEDWWHU\GRRUODWFKDQGJHQWO\ SU\XSZDUGWRUHOHDVHWKHEDWWHU\GRRUIURPWKHEDVH f ,QVHUWWKHEDWWHULHVLQVLGHWKHEDWWHU\FRPSDUWPHQWDVVKRZQRQWKHGLDJUDP f 6QDSWKHEDWWHU\FRPSDUWPHQWGRRUEDFNLQWRSODFH NOTE: If the low battery icon appears in the display, you need to replace the batteries. It is important that you replace them as soon as possible to maintain unit operation when electrical power is off. As a precaution, you may want to write down any stored information you do not want erased. IMPORTANT: If you are not going to use the telephone for more than 30 days, remove the batteries because they can leak and damage the unit. 3OXJWKHSRZHUVXSSO\FRUGLQWRWKHSRZHUMDFNRQWKHEDFNRIWKHEDVHDQGWKHRWKHU HQGLQWRDQHOHFWULFDORXWOHW CAUTION: To reduce risk of personal injury, ďŹre, or damage use only the T-2757 (base) power adaptor listed in the userâs guide. This power adaptor is intended to be correctly orientated in a vertical or ďŹoor mount position. &RQQHFWWKHWHOHSKRQHOLQHFRUGV ,I\RXKDYHVLQJOHOLQHZDOOMDFNVLQVWDOOHGLQ\RXUKRPHRURIďŹFH\RXFDQXVH DGDSWRUVFRXSOHUV QRWLQFOXGHG WRFRPELQHWKHVLQJOHWHOHSKRQHOLQHVLQWRGXDO OLQHV7KHDGDSWRUFRXSOHUPD\ORRNVLPLODUWRWKHRQHSLFWXUHGKHUHDQGFDQEH SXUFKDVHGIURP\RXUORFDOWHOHSKRQHSURGXFWVUHWDLOHU Line 2 12 Line 1 2U\RXFDQXVHWKHVLQJOHWHOHSKRQHOLQHVSOXJLQWRWKHMDFNVRQWKHEDFNRIWKH WHOHSKRQH Line 1 Line 2 ,I\RXKDYH/LQHDQG/LQHZLUHGLQWRRQHZDOOMDFNLQ\RXUKRPHRURIfiFH\RXFDQ XVHRQHRIWKHVXSSOLHGWHOHSKRQHOLQHFRUGVWRFRQQHFWIURPWKHZDOOMDFNWRWKH /LQHMDFNRQWKHEDFNRIWKHSKRQHDVVKRZQEHORZ Line 1 + 2 ,I\RXZDQWWRPRXQWWKHWHOHSKRQHRQWKHZDOO\RXFDQSOXJWKHOLQHVVXFKDVWKH EHORZGUDZLQJ Line 2 Line 1 25 13 Line 2 Line 1 25 Line 1 & 2 &RQQHFWWKHKDQGVHWFRUG 14 &RQQHFWRQHHQGRIWKHFRLOHGKDQGVHWFRUGWRWKHMDFNRQWKHVLGHRIWKHEDVHDQGWKH RWKHUHQGLQWRWKHMDFNLQWKHKDQGVHWDQGSODFHWKHKDQGVHWLQWKHFUDGOH Programming the Phone Standby Screen NOTE: The Soft keys will change according to the status of the unit. NOTE: The base LCD has a dedicated âSET CLOCKâ icon ďŹashing when the clock is not set. Please go to menu âPhone Setting- Date /Timeâ to set the clock. Programming Functions Answering SYS., Voice Mail and Restore Setting. NOTE: During programming, you may press the BACK Soft key (left) at any time to exit the sub-menu and return to the main menu, or press exit key to exit programming and return to standby screen. NOTE: If no key is pressed for 30 seconds, the handset or base will automatically exit programming and return to standby screen. Phone Setting OFF menu MENU VOL SELECT ďŹ Add Headset (base only) 15 Date/Time From the Phone Setting Menu: VOL Date/Time 2. Press SELECT Soft key. 3. LCD will display last-set time (or, if the device is new or has been reset to default, the LCD will display 12:00AM 01/01/11) 4. Use the dial-pad to enter digits for the current time and date. Note: Use DIR/CID button to move the cursor and the AM/PM softkey to set the time AM or PM. 5. Press SAVE softkey to confirm the setting, a confirmation tone will indicate that your selection has been saved. NOTE: If you subscribe to Caller ID service, the current Date/Time is set automatically when you receive your ďŹrst CID record and will override manually set Date/Time. However the Year must still be set manually. The Year information is not in the CID record. NOTE: The Date/Time setting item only exists in base menu, handset Date/Time should update automatically after it is set in the base. Auto Answer (only applicable for cordless handset) Talk/Spk/L1/L2 From the Phone Setting Menu: VOL SELECT Auto Answer VOL SELECT Auto Answer Intercom (applicable for base and cordless handset) From the Phone Setting Menu: VOL SELECT Off SELECT 16 Auto Answer Int. VOL Dial Mode (only applicable for base) From the Phone Setting Menu: vol Dial Mode SELECT 3. Use the VOL (- or +) button to toggle between L1 and L2 and press Select soft key to confirm, then use the VOL (- or +) button to scroll to Tone or Pulse. SELECT NOTE: The Dial mode only can be set in the base menu. Area Code (only applicable for base) From the Phone setting Menu: vol Area code SELECT SAVE Registration (only applicable to handset) NOTE: If a handset has not been registered to the base, then the display will show PRESS REG TO INITIATE REGISTRATION once the handset has been activated. Press the REG Soft key to start the registration. NOTE: If an optional cordless headset has been registered to the base , up to 9 cordless handset can be registered to one base . From the Phone Setting Menu: VOL Registration SELECT 17 Register From the Phone Setting Menu: VOL Register SELECT Register HS Registering.... page about 3 seconds Registering Registration complete ďŹ REGISTRATION FAILED! Remove Handset WARNING: It is not recommended that a handset be deregistered unless absolutely necessary because once a handset is deregistered, that handsetâs telephone features cannot be used until the handset is re-registered. From the Phone Setting Menu: VOL Remove handset SELECT Remove handset? YES ďŹ Press REG to initiate registration NOTE: You can press the REG Soft key to enter the registation mode again. De-Register (only applicable for base) From the Phone Setting Menu: vol Deregistration SELECT vol SELECT Remove handset? YES ďŹ Press REG to initiate registration base emit a confirm tone Add Headset (only applicable for base) Note: This wireless headset option is only compatible with the RCA 25065RE1. From the Phone Setting Menu: Talk On/Off Note: Only one cordless Headset may pair with a base unit. 18 2nd Call Alert From the Phone Setting Menu: VOL SELECT On 2ND Call Alert VOL SELECT Handset Name (only applicable for handset) From the Phone Setting Menu: VOL SELECT Handset name Handset NOTE: If you make a mistake, press DIR/CID button to move the cursor forward or backward, and then use the mute/del button to backspace and delete one character at a time. SAVE Update Handset List (only applicable for base) From the Phone Setting Menu: vol Update HS List SELECT Display Setting OFF menu VOL MENU Display Setting SELECT 19 Language From the Display Setting Menu: VOL Language SELECT VOL English , Francais Espa|ol English SELECT Contrast From the Display Setting Menu: VOL Contrast SELECT VOL VOL SELECT Backlight (only applicable for base) From the Display Setting Menu: vol Backlight SELECT vol Always On Automatic SELECT Sound Setting OFF menu MENU VOL SELECT Sound Setting ďŹ Ring Tone From the Sound Setting Menu: VOL Ring Tone SELECT 3. Use the VOL (- or +) button to toggle between L1 and L2 and use the VOL (- or +) button to scroll to your selection.The default setting is Melody 1 for Line1 and Melody 2 for Line 2. SELECT 20 Ring Volume From the Sound Settings Menu: VOL Ring Volume SELECT 3. Use the VOL (- or +) button to toggle between L1 and L2 and use the VOL (- or +) button to scroll to your selection.The default setting is VOL 3. SELECT Key Tone From the Sound Settings Menu: VOL SELECT Key Tone VOL On Off SELECT Voice Mail From the Main Menu: This feature is used to conveniently access the voicemail feature offered by your telephone service provider. NOTE: You must subscribe to telephone service provider-offered voicemail on at least one phone line in order for this feature to operate. 1. Make sure your phone is in idle mode. (not in Talk mode) 2. Press the MENU Soft key (left) to go to the main menu. 3. Press VOL (- or +) button to scroll to Voice Mail. 4. Press SELECT Soft key (right) to confirm and you may program the following items: Call VM Settings Call VM From the Voice Mail Menu: 1. Press VOL (- or +) button to scroll to Call VM. 2. Press SELECT Soft key 3. Use the VOL (- or +) button to toggle between Line 1 and Line 2 and press SELECT soft key to select. 4. The phone will dial your voicemail access number. You may proceed to access your voicemail per your service providerâs instructions. Settings From the Voice Mail Menu: 1. Press VOL (- or +) button to scroll to Settings. 2. Press SELECT Soft key 3. Use the VOL (- or +) button to toggle between Line 1 and Line 2 and press SELECT soft key to select. 4. Use the dial pad to enter the call-in access number for your voicemail. Press Delete button to backspace and delete numbers, if necessary. 5. Press SAVE Soft key. 6. A confirmation tone will indicate that your selection has been saved. Answering System (only applicable for base) OFF 21 MENU VOL SELECT Answering Sys. fi fi On/Off Status From the Answering Sys Menu: VOL On/Off Status SELECT VOL Line1 or Line2, press select softkey and then use Vol(- or +) button to select On or Off. SELECT Outgoing Message (OGA) Playback From the Answering Sys Menu: VOL OGA Playback SELECT Use VOL(- or+) to select Line1 or Line2, press select softkey and then use Vol(- or +) button to select the direct OGA record. SELECT EMPTY Outgoing Message (OGA) Record From the Answering Sys Menu: 1. VOL 2. OGA Record SELECT 3. Use VOL(- or+) to select Line1 or Line2, press select softkey and then use Vol(- or +) button to select the direct OGA. 4. SELECT 5. FINISH 6. Set Outgoing Message (OGA) From the Answering Sys Menu: VOL 1. 2. Set OGA SELECT 3. Use VOL(- or+) to select Line1 or Line2, press select softkey and then use Vol(- or +) button to select the direct OGA record. 4. SELECT EMPTY an error tone will be emit. 22 NOTE: If you select the option âTIMEDâ, the âWork Hoursâ OGA and âAfter Hoursâ OGA MUST berecorded first. When there is an incoming call, the âWork Hoursâ OGA or âAfter Hoursâ OGA will be played to the caller according to the office time you set. Set OfďŹce Time From the Answering Sys Menu: VOL Set Office Time SELECT Set Work Hours From the Set OfďŹce Time Menu: VOL Set Work Hours SELECT AM/PM AM PM SAVE 5. Use the Yes or No Soft key for Announce Only. NOTE: If you select Yes for Announce Only, the âWork Hoursâ OGA and âAfter Hoursâ OGA The unit will hang up the call after announcing the greeting when answering the call is in the answering mode. Set After Hours From the Set OfďŹce Time Menu: VOL Set After Hours SELECT AM/PM AM PM SAVE 5. Use the Yes or No Soft key for Announce Only. NOTE: If you select Yes for Announce Only, the âWork Hoursâ OGA and âAfter Hoursâ OGA . The unit will hang up the call after announcing the greeting when answering the call is in the answering mode. 23 Ring Delay From the Answering Sys Menu: VOL Ring Delay SELECT Use VOL(- or+) to select Line1 or Line2, press select softkey and then use Vol(- or +) button to select from 2 rings to 6 rings or toll saver. SELECT NOTE: When the Toll saver is selected, the unit will answer the incoming call after 3 rings if there is new message. Otherwise, the unit will answer the incoming call after 5 rings. Message Length From the Answering Sys Menu: VOL Message Length SELECT Use VOL(- or+) to select Line1 or Line2, press select softkey and then use VOL(- or +) button to select from 1 to 3 minutes. SELECT Call Screening From the Answering Sys Menu: VOL SELECT Call Screening VOL On Off On Off SELECT Message Alert From the Answering Sys Menu: VOL SELECT SELECT 24 Message Alert VOL Off Remote Password From the Answering Sys Menu: VOL Remote Password 000. SELECT 3. Use the Clear Soft key to delete the current Remode password,then use the touch-tone pad to enter your desired 3-digit security code. SAVE NOTE: Use the Clear soft key or Delete button can delete the exist numbers and then enter the new password. Restore Setting From the Standby or Idle Mode (not in Talk mode) : menu MENU VOL Restore Setting SELECT LOAD TO DEFAULT? YES fi then reset the unit automatically after the base shows " please wait..." in the display for about 3 seconds. NO Telephone Operation Making Calls with the Cordless Handset Talk line 1 fi line 2 end fi Making Calls with the Corded Handset (from the base) fi line 1 line 2 fi 25 Making Calls in the Speakerphone Mode (from the base) speaker line 1 ďŹ line 2 One-Touch/Memory Log ďŹ speaker NOTE: After pick the line, the call timer starts to run until all the calls are hung up. The timer serves for both 2 lines. Making Call in the Speakerphone Mode (from the handset) ďŹ Spk Press the Line1 or Line2 Softkey to select a specific line. The Handset will activate the ear piece. Then press the SPK button to switch to the speakerphone mode. 2. 3. end ďŹ Making Calls with the RCA Wireless Headset Please refer to the Instruction Booklet for your RCA Wireless Headset for instructions on setup and use. Making Calls with a Wired Headset headset ďŹ Talk ďŹ headset end Note: Although this device will accept a variety of standard 2.5mm telephone headsets, RCA does not guarantee compatibility with 3rd party devices. Performance may vary depending on the quality of the headset. 26
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.5 Linearized : Yes Page Count : 26 Has XFA : No XMP Toolkit : XMP toolkit 2.9.1-13, framework 1.6 About : uuid:06e4bb77-3b7f-4aac-91ea-c6edcf6662bf Modify Date : 2014:11:05 09:58:57+08:00 Create Date : 2014:11:05 09:57:37+08:00 Metadata Date : 2014:11:05 09:58:57+08:00 Document ID : uuid:a63cc0ba-a1c3-4c22-b6e1-c02aed85a994 Format : application/pdf Title : 1 Creator : Adobe Illustrator CS4 Author : SZ000094 Producer : Acrobat Distiller 9.5.5 (Windows)EXIF Metadata provided by EXIF.tools