eResearchTechnology SPS001 SpiroSphere is a diagnostic compact device to measure inspiratory and expiratory lung function parameters User Manual
eResearchTechnology GmbH SpiroSphere is a diagnostic compact device to measure inspiratory and expiratory lung function parameters
2AAUFSPS001 UserMan
Instructions for Use SpiroSphereÂŽ 781235 Version 00.16 SpiroSphereÂŽ Instructions for Use Product names or services are trademarks of their respective companies. All rights, including those of translations, are reserved. Written permission of eResearchTechnology (ERT) shall be obtained for the reproduction of this manual or any excerpt WKHUHRIE\DQ\PHDQVLQFOXGLQJSULQWLQJSKRWRVWDWLFGXSOLFDWLRQPLFURÂżOPVRUDQ\RWKHU processes. eResearchTechnology GmbH Sieboldstrasse 3 97230 Estenfeld, Germany Tel: +49 9305 720-9891 Fax: +49 9305 720-7891 www.ert.com Š 2017 eResearchTechnology GmbH. All rights reserved. Indications for Use The SpiroSphere is a diagnostic compact device to measure inspiratory and expiratory lung function parameters in adults and children. In addition the SpiroSphere can collect, store and transfer vital data from other external devices. ,WFDQEHXVHGE\SK\VLFLDQVLQWKHRIÂżFHRUKRVSLWDODQGLQRFFXSDWLRQDOPHGLFLQH Federal U.S. law restricts this device to sale by or on the order of a physician. (Rx only) Page 2/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Table of Contents Indications for Use ...........................................................................................................2 Notes on Safety in this Instruction Manual ......................................................................4 Declaration of Conformity ................................................................................................4 Device Description...........................................................................................................5 Unpacking and Starting Operation ..................................................................................5 The SpiroSphere ............................................................................................................6 Start-Up ...........................................................................................................................7 Troubleshooting ...............................................................................................................9 LED Status SpiroSphere .................................................................................................9 LED Status SpiroSphere Sensor .....................................................................................9 Sensor insert .................................................................................................................10 Setup .......................................................................................................................... 11 The Home Screen .........................................................................................................13 Sensor Check ...............................................................................................................14 Calibration Check ..........................................................................................................14 Linearity Check ..............................................................................................................16 Add Patient ....................................................................................................................17 Search Patient ...............................................................................................................19 Actions ..........................................................................................................................21 Preparing a Measurement .............................................................................................22 Perform a Forced Spirometry Measurement .................................................................23 Perform a Slow Spirometry Measurement.....................................................................28 Dosing ..........................................................................................................................31 Perform a Post Spirometry Measurement .....................................................................32 Adhoc Test .....................................................................................................................34 Perform an Adhoc Test ..................................................................................................34 Assign Adhoc Test now..................................................................................................35 Assign Adhoc Test later .................................................................................................36 Show, Edit, Delete and Print Tests ................................................................................37 Print Recorded Results..................................................................................................40 Settings and Tools .........................................................................................................41 User Management .........................................................................................................54 Update ..........................................................................................................................69 About Device .................................................................................................................69 Restore Default Settings................................................................................................69 Factory reset..................................................................................................................69 Cleaning/Hygiene ..........................................................................................................70 General Safety Precautions...........................................................................................72 Graphical Symbols ........................................................................................................77 Notes on EMC according to EN60601-1-2 ..................................................................80 Technical Data ...............................................................................................................81 Item Numbers of Disposables and Accessories ............................................................83 9HUVLRQÂ0$< Page 3/84 SpiroSphereÂŽ Instructions for Use Notes on Safety in this Instruction Manual Following the ANSI (American National Standards Institute) recommendations for safety notes, VSHFLÂżFSDVVDJHVRIWKLVLQVWUXFWLRQPDQXDODUHFOHDUO\PDUNHGDVVDIHW\QRWHV Degree of Danger Injury to persons Damages to property Meaning of Indicator DANGER indicates an immediate hazardous situation, which, if not avoided, may result in serious injury or death. Limited to extremely dangerous situations. WARNING indicates a potential hazardous situation, which, if not avoided, may result in serious injury or death. (X) Caution indicates a potential hazardous situation, which, if not avoided, may result in minor or slight injury. Also used to indicate precarious procedures. Additional icons used in this manual: Important information on operation and other useful information. Does not warn of dangerous or harmful situations. Tips, general information and information on operation. Declaration of Conformity The original Declaration of Conformity document can be obtained from ERT. Page 4/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Device Description The SpiroSphere is a compact spirometry device. Its Sensor Unit is battery-powered. The Main Unit can be powered by battery or power supply. The SpiroSphere is used to measure inspiratory and expiratory lung function parameters in adults and children. The measured data is saved into the device and can be read out at any time. The disposable easy-to-exchange, high-quality pneumotach guarantees a high degree of patient safety and provides precise recording results. The Main Unit is equipped with a graphical LCD touch display, providing a state of the art solution for selection of menu functions and the navigation throughout the menu. The SpiroSphere Sensor is paired via Bluetooth with the Main Unit. A printer can be connected with the SpiroSphere and all needed data can be printed. Moreover, it is possible to transfer data via USB, WiFi, 3G and Ethernet. 7KHGHYLFHFDQEHXVHGE\SK\VLFLDQVLQWKHRIÂżFHRUKRVSLWDODVZHOODVLQRFFXSDWLRQDOPHGLFLQH Unpacking and Starting Operation SpiroSphere is delivered with the following accessories*: Main Unit SpiroSphere Sensor Power Supply ERT PT with Mouthpiece Nose clips and Pads Instruction manual 7KH5HWXUQRI*RRGVLQ0HGLFDO,QVWLWXWLRQ&HUWLÂżFDWHRI+\JLHQHLVSURYLGHGDVDVHSDUDWH GRFXPHQWĂ\HU Death due to suffocation may occur if packing material is swallowed. Store packing material out of reach of children and dispose of properly! Use only ERT approved accessories and spare parts for this medical device. Depending on the type of equipment either included in the delivery or available as an option 9HUVLRQÂ0$< Page 5/84 SpiroSphereÂŽ Instructions for Use The SpiroSphere Main Unit: Front view: Power On/Off SpiroSphere Sensor Fingerprint Sensor Main Unit LCD touch display Rear view: Speaker Charging Cradle LAN Power USB USB SpiroSphere Sensor: LED Status Indicator ERT PT with Mouthpiece Page 6/84 Power On/Off 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Power supply: Mains adapter Start-Up 1. Connect the SpiroSphere to a power source complying with local regulations. LAN 2. Put the SpiroSphere Sensor into the slot of the main unit as shown below. Power Supply Connection 3. Use the Power On switch located at the front of the main unit to switch on the SpiroSphere Main Unit. The operating status of the device is indicated via an LED on the main unit and on the SpiroSphere Sensor. 9HUVLRQÂ0$< Page 7/84 SpiroSphereÂŽ Instructions for Use 3ULRUWRWKHÂżUVWXVDJHVZLWFKRQWKH6SLUR6SKHUH6HQVRUE\SUHVVLQJWKHPower On" switch located at the back side of the SpiroSphere Sensor. 5. Ensure an ERT PT is inserted into the SpiroSphere Sensor. ERT PT with mouthpiece ERT PT is only for single use. Do not reuse the ERT PT due to risk of cross contamination. Do not remove the mouthpiece from the ERT PT. Only use the ERT PT with connected mouthpiece. 3ULRUWRWKHÂżUVWXVHPDNHVXUHWKDWWKH6SLUR6SKHUH6HQVRULVIXOO\FKDUJHG The maximum temperature of the SpiroSphere Sensor Unit can get up to 47°C. Spirometry should only be performed by patients who can cooperate in the performance. Shut down 1. To switch off the SpiroSphere Main Unit, press the Power On/Off switch located at the front of the main unit. Disconnect the main unit from the power source. 2. Switch on the SpiroSphere Sensor by pressing the "Power Off" switch located at the back side of the SpiroSphere Sensor. Disconnect the SpiroSphere Sensor from the main unit. 'RQRWSRVLWLRQWKH3RZHU6XSSO\DQGWKH6SLUR6SKHUHVRWKDWLWLVGLIÂżFXOW to operate the disconnection of the device from the mains supply. Page 8/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Troubleshooting LED Status SpiroSphere To do: Blue LED On Main Unit powered on N/A Blue LED Off Main Unit powered off N/A Blue LED Pulse Main Unit Standby N/A Orange LED On Charging Orange LED Off Not charging/ charging complete Orange LED blinking Low battery Connect Main Unit to a power socket LED Status SpiroSphere Sensor Only the highest priority LED at a time is turned on (LED priority: Orange - Blue). Orange LED On Charging in cradle Orange LED Off No charging/ charging complete in cradle Orange LED blinking slowly Low battery Orange LED blinking fast Put the SpiroSphere Sensor into the cradle of the Main Unit Indicates an error in the SpiroSphere Sensor Blue LED blinking slowly SpiroSphere Sensor is actively transferring data to the Main Unit Blue LED Off Device in sleep mode Blue LED blinking fast Device powered on and paired with Main Unit Put the device into the charging dock or press the Power On switch Error Messages 9HUVLRQÂ0$< Page 9/84 SpiroSphereÂŽ Instructions for Use Sensor insert Take care that you have aligned the rail with the sensor holes of the PT tube with the grooved edge of the SpiroSphere Sensor (as below) when inserting the ERT PT into the SpiroSphere Sensor: rail with sensor holes The ERT PT should be inserted fully without force. Page 10/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Setup 3ULRUWRWKHÂżUVWXVHDV\VWHPVHWXSQHHGVWREHSHUIRUPHG $IWHUVZLWFKLQJRQWKH6SLUR6SKHUHIRUWKHÂżUVWWLPHIROORZLQJVFUHHQDSSHDUV Enter the Global Password and press. (The preset global password is "691982".) The System Setup wizard starts automatically. Follow the system setup steps (step 1 - 6) and enter or select the appropriate settings. Tap on . 2. Date & Time Settings Select the appropriate settings DQGFRQÂżUPZLWKNext>. 9HUVLRQÂ0$< Page 11/84 SpiroSphereÂŽ Instructions for Use 3. Sensor Settings Tap on to scan for available sensors. Tap on the sensor you want to pair the SpiroSphere with and select from the dropdown menu. &RQÂżUPZLWKNext>. 4. Ethernet Settings Choose the appropriate settings DQGFRQÂżUPZLWKNext>. (Refer to chapter "Communication".) 5. WiFi Settings Choose the appropriate settings DQGFRQÂżUPZLWKNext>. (Refer to chapter "Communication".) 6. User Management Settings Choose the appropriate settings DQGFRQÂżUPZLWKNext>. Complete the initial setup of the device by tapping on . Page 12/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use The Home Screen After the SpiroSphere has been set up, upon powering on the device the following screen appears: Here, you can select the submenus "Add Patient", "Search Patient", "Sensor Check", "Adhoc Test" as well as "Settings and Tools" by tapping on the respective button. Add Patient Enter patient data for a new patient into your patient directory and start a test. Search Patient 6HDUFKIRUDVSHFLÂżFSDWLHQWLQ\RXUSDWLHQWGLUHFWRU\6HOHFWDVSHFLÂżF patient from the list to perform a test or to edit his/her data. Sensor Check Perform a volume or linearity check. Adhoc Test Immediately perform a test without entering patient data or searching for a VSHFLÂżFSDWLHQWÂżUVW Settings & Tools Change settings. 9HUVLRQÂ0$< Page 13/84 SpiroSphereÂŽ Instructions for Use Sensor Check The ERT PTs included with the delivery are pre-calibrated as part of manufacture. $VHQVRUFKHFNFDQEHSHUIRUPHGWRFRQÂżUPDFFXUDWHPHDVXUHPHQWGDWD Tap to perform a sensor check. The sensor check consists of a calibration check as well as a linearity check. Tapping on the "i"- symbol will display information on the respectively selected check type. Calibration Check In order to perform a calibration check, tap on . Following screen appears: Ensure a new ERT PT (with mouthpiece removed) is connected to the 3 L calibration syringe via an adapter (as shown). Proceed by tapping . A zero adjustment of the connected SpiroSphere Sensor will be performed automatically. Page 14/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use The calibration checkLVXVHGWRFKHFNWKHYROXPHDFFXUDF\ZLWKLQGLIIHUHQWĂRZUDQJHV With each syringe stroke, the volume accuracy should be within Âą 3 %. High Ex Mid Ex Low Ex Low In Mid In High In Âą3% ,WLVLPSRUWDQWWRSXPSZLWKRXWLQWHUUXSWLRQIURPLPSDFWWRLPSDFW7KHÂżUVWSXPSVWURNH is not relevant and will be discarded. There should be one pump stroke in each of the IROORZLQJĂRZUDQJHVORZPLGDQGKLJKUDQJH 1 syringe stroke = pump twice, i.e. from impact to impact. Screen display after a total of three syringe strokes: better than Âą 3 % X worse than Âą 3 % End the calibration check by tapping on . 9HUVLRQÂ0$< Page 15/84 SpiroSphereÂŽ Instructions for Use Linearity Check In order to perform a linearity check, tap on . Proceed as described in the "Calibration Check" section. 'XULQJDOLQHDULW\FKHFNYROXPHDFFXUDF\DWGLIIHUHQWĂRZVLVWHVWHG7KUHHV\ULQJHVWURNHVDWD ORZWKUHHDWDPLGUDQJHĂRZDQGWKUHHDWDKLJKĂRZDUHUHTXLUHG With each syringe stroke, the volume accuracy should be within Âą 3 %. ,WLVLPSRUWDQWWRSXPSZLWKRXWLQWHUUXSWLRQIURPLPSDFWWRLPSDFW7KHÂżUVWSXPSVWURNH is not relevant and will be discarded. Three pump strokes are required in each of the IROORZLQJĂRZOHYHOVORZPLGDQGKLJKUDQJH 1 syringe stroke = pump twice, i.e. from impact to impact. Screen display after a total of 9 syringe strokes: better than Âą 3 % X worse than Âą 3 % End the linearity check by tapping on . Page 16/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Add Patient %HIRUHPHDVXULQJDSDWLHQWIRUWKHÂżUVWWLPHWKHSDWLHQW VSHUVRQDOGDWDKDVWREH entered. Predicted values are calculated from patient data, so verify that the entered data are correct. Incorrect patient data produces incorrect predicted values! To add a new patient to your patient directory, tap on the "Add Patient" button on the Home Screen. The following screen appears: Return to the Home Screen (QWU\ÂżHOGVZLWK instructions on entering Touchscreen Keyboard Hide Keyboard Enter (QWHUWKHDSSURSULDWHSDWLHQWGDWDXVLQJWKHWRXFKVFUHHQNH\ERDUGDQGFRQÂżUPZLWK . 9HUVLRQÂ0$< Page 17/84 SpiroSphereÂŽ Instructions for Use Age: The Patient's age will be calculated automatically from the entered date of birth Gender: Select appropriate gender Height: Enter the Patient's height Weight: Enter the Patient's weight Ethnicity: Select the appropriate ethnicity Additionally, there is an option to enter: Technician: Enter the Technician's name Physician: Enter the Physician's name Set A Name 1: Set A Name 2: As soon as all required patient data is entered, tap on to save the patient to your patient directory. If you want to discard all data just entered, tap on . All ENTRYÂlELDSÂWILLÂBEÂCLEARED Screen display after patient data input: Patient data Page 18/84 Available Actions (Type), and list of tests already performed (Previous Tests) 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Search Patient When a patient whose data is already stored in the database comes for another visit, you can reload his/her data from the patient directory. You do not have to enter the data again. Tap on the "Search Patient" button on the Home Screen to open the list of all patient data saved in the database. The following screen appears: List of all patients data of a new Patient can be entered Display all tested patients Display all Patients tested today Display all Patients tested yesterday Display all Patients tested this week Display all Patients tested this month 6HDUFKIRUVSHFLÂżF3DWLHQWVE\HQWHULQJKLVKHUODVWQDPHRU,'(QWHULQJWKH ÂżUVWOHWWHURUWKHÂżUVWFKDUDFWHURIWKHSDWLHQW V,'LVVXIÂżFLHQWDVZHOO,IHJ6 is entered, all patients whose last names start with "S" are displayed. 9HUVLRQÂ0$< Page 19/84 SpiroSphereÂŽ Instructions for Use ,IDOLVWHGSDWLHQWLVVHOHFWHGWKHIROORZLQJĂ\RXWPHQXDSSHDUV Tap on to display the patient's personal data on the left. In the "Actions"section, all conductable actions are listed. The "Previous Actions" section shows the actions already performed for the VSHFLÂżFSDWLHQW Tap on to display the patient's demographic information. If incorrect patient data was entered or if the patient data need to be updated (e.g. due to weight or height change in children), the respective data can be edited and will be used for future tests. Page 20/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Each patient can be completely deleted from the patient directory by tapping . A "Warning" appears: Tapping on "Yes" will irrevocably delete the selected patient including all saved measurements performed for that patient! Actions SpiroSphere is capable of performing different types of measurements. The different options are displayed on the screen. Forced Pre Spirometry Forced Spirometry (Flow/Volume loop) pre bronchospasmolysis Forced Post Spirometry Forced Spirometry (Flow/Volume loop) post bronchospasmolysis Slow Pre Spirometry Slow Spirometry pre bronchospasmolysis Slow Post Spirometry Slow Spirometry post bronchospasmolysis Dosing Input Medication, Medication time and Technican 9HUVLRQÂ0$< Page 21/84 SpiroSphereÂŽ Instructions for Use Preparing a Measurement Please observe the instructions for hygiene of your system. Verify that a new ERT PT with mouthpiece is attached in the SpiroSphere Sensor. Select a measurement (e.g. ) via tapping. The measurement is started by tapping on . The "Ambient Conditions" window appears: The patient must not interact with the SpiroSphere Main Unit. Current room temperature (°C) Current relative humidity (%) Current barometric pressure (hPa) When the test is started, an automatic zero adjustment of the connected ERT PT is performed. Hold the SpiroSphere Sensor still and wait for the zero adjustment to be completed before approaching the mouthpiece. As soon as the zero adjustment is completed, the patient should close his/her nose with the nose-clip, take the mouthpiece between his/her teeth and seal his/her lips tightly around the mouthpiece. Check the correct position of the mouthpiece! Page 22/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use 7KH$73%736FRUUHFWLRQIDFWRUVIRULQVSLUDWRU\DQGH[SLUDWRU\ĂRZVDQGYROXPHVZLOOEH determined from the ambient data. Therefore, ambient data must be updated at regular intervals. Incorrect or imprecise ambient data will result in incorrect measurement results. The SpiroSphere must not be exposed to direct sunlight nor positioned immediately near heating elements. The current ambient conditions are to be entered manually. In this case, the ambient data should be updated if the room temperature changed by more than 2°C or if relative humidity changed by more than 10%. Tap on to apply the ambient data entered. Perform a Forced Spirometry Measurement Make the proper preparations according to ATS/ERS guidance. Please note: During the whole examination the patient must stay on the mouthpiece. 7KHSDWLHQWEUHDWKHVQRUPDOO\ ÂżJXUH 1 ) until a steady tidal breathing is shown. From tidal EUHDWKLQJWKHSDWLHQWLVLQVWUXFWHGWRLQKDOHDVGHHSO\DVSRVVLEOH LQKDOHWR7/&ÂżJXUH 2 ). to TLC 9HUVLRQÂ0$< Page 23/84 SpiroSphereÂŽ Instructions for Use Screen display: Tapping on the "i"-symbol will display information on the measurement procedure. 6s FVCin FEV1/FVC Screen display: Without interruption, the patient should immediately exhale as fast and as much (FEV1) and as ORQJ )9& DVSRVVLEOH ÂżJXUH 3 ). According to the ATS/ERS guidelines, exhalation should be for a minimum of 6 sec for adults, and 3 sec for children. The maneuver is usually completed by an inhalation ÂżJXUH 4 ). Tap . Screen display after three efforts: The "Best" column displays the best value out of all valid efforts. 'HÂżQLWLRQRIWKHEHVWHIIRUWGHSHQGV on the Settings selected (see: >Settings Spirometry >Forced Spirometry >Measurement). Scroll down to display further parameters (if applicable) Literature: MR Miller et al. Series âATS/ERS Task Force: Standardisation of Lung Function Testingâ, StandardisationRI6SLURPHWU\(XU5HVSLU-&RS\ULJKWÂ(56-RXUQDOV/WG 9HUVLRQÂ0$< Page 25/84 SpiroSphereÂŽ Instructions for Use Change View: 6FUHHQGLVSOD\ĂRZYROXPHDQG tiffaneau curve: Screen display volume-time curve: Curves superimposed: Return to Home Screen Return to Patient Details Print Report The lower section displays the quality assessment according to ATS/ERS 2005 guidelines: = no acceptability errors Tap on the curve you want to be displayed. = minor errors present = major errors present Individual parameter Repeatability = Parameter repeatability criteria not met = Parameter repeatability criteria met Overall Repeatability = Not enough effort performed = Enough efforts, but one or more repeatability criteria are not met = Enough efforts and all repeatability criteria are met Page 26/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Deactivate/reactivate efforts ,IVHYHUDOHIIRUWVZHUHSHUIRUPHGLQGLYLGXDOHIIRUWV HJHIIRUWVZLWKLQVXIÂżFLHQWSDWLHQWFRRSHUDWLRQ can be deactivated. The system can also automatically deactivate efforts as a result of system detected ATS/ERS acceptability errors. Behaviour FDQEHFRQÂżJXUHGLQ6HWWLQJV Procedure: Mark the effort to be deactivated (in our example Effort 4). Following window appears: Tap on . Tapping on will deactivate the selected effort. Successfully deactivated efforts will appear as a dashed line at the top of the column. Deactivated trial An effort deactivated by mistake can be reactivated again by tapping on the respective effort again. Tap on"Reactivate"in the following window to reactivate the effort. Deactivated efforts will not be taken into consideration when calculating the Best Effort and Predicted Calculations. End and save the test by tapping on . 9HUVLRQÂ0$< Page 27/84 SpiroSphereÂŽ Instructions for Use Perform a Slow Spirometry Measurement Make the proper preparations according to ATS/ERS guidance. When the test is started, an automatic zero adjustment of the connected ERT PT is performed. Hold the SpiroSphere Sensor still and wait for the zero adjustment to be completed before approaching the mouthpiece. As soon as the zero adjustment is completed, the patient should close his/her nose with the nose-clip, take the mouthpiece between his/her teeth and seal his/her lips tightly around the mouthpiece. Check the correct position of the mouthpiece! Performance of an "ERV Maneuver": Tidal breathing should be continued for a longer period of time ÂżJXUH 1 ). A stable breathing baseline is absolutely required to determine the lung volumes ERV and IC correctly. Tidal breathing Tapping on the "i"-symbol will display information on the measurement procedure. The two columns displayed show how constantly the patient is EUHDWKLQJRYHUWKHODVWÂżYHEUHDWKLQJF\FOHV G97 YDULDWLRQ FRHIÂżFLHQWRIYDULDWLRQ RIWKHWLGDOYROXPH dFRC = variation of the breathing baseline The lower the variation the more regular the breathing. As soon as the display changes from "red" to "green", a stable breathing baseline has been reached. Page 28/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use 7KHSDWLHQWVKRXOGH[KDOHVORZO\ VHH1RWHEHORZ DQGFRPSOHWHO\ (59ÂżJXUH 2 ) followed by DVORZDQGFRPSOHWHLQKDODWLRQ 9&LQÂżJXUH 3 ). Then, continue to breathe normally. 6s VCin ERV ERV/VCin In order to reach the end-expiratory level the following two criteria must be complied with according to ATS/ERS. 1. Duration of expiration (ERV) Patients must exhale for at least 6 seconds. 2. End of Test Criteria (ERV) Towards the end of the expiration it is important to motivate the patient to try hard. Within the last second of expiration the exhaled volume must not exceed 25 mL. Tap on to start the next maneuver. Screen display after two efforts: The lower section of the screen displays the predicted values calculated from the patient data and the actual values measured during the test. Pred = Predicted value Best = Best values from all efforts %Pred = Best value in % of predicted values Scroll down to display further parameters (if applicable) The "Best" column displays the best value out of all valid efforts. 'HÂżQLWLRQRIWKHEHVWHIIRUW KLJKHVW9&PD[ (see: >Settings Spirometry >Slow Spirometry> Measurement) Page 30/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Dosing Before the post-measurement is started you can input Medication, the Medication time and the Technician name. Tap . Tap on The following data can be entered: Medication: Enter the Medication, e. g. Albuterol/Salbutamol Medication time: Enter the time the Medication was given, hh:mm Technician: Enter the Technician name Tap on to save the dosing to your patient directory. 9HUVLRQÂ0$< Page 31/84 SpiroSphereÂŽ Instructions for Use Perform a Post Spirometry Measurement The Flow-Volume curve shows the immediate bronchospasmolytic effect. The expiratory portion of the Flow9ROXPHFXUYHDQGFRQVHTXHQWO\PD[LPDOSHDNĂRZ 3() forced expiratory volume after 1 sec (FEV1) as well as forced vital capacity (FVC) changes. Screen display after the "Pre Measurement": Screen display after the "Post Measurement": Post Measurement (purple) Pre Measurement (green) Page 32/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use 3UH3RVW Report: 9HUVLRQÂ0$< Page 33/84 SpiroSphereÂŽ Instructions for Use Adhoc Test With the Adhoc Test application it is possible to perform a Spirometry measurement without having to register the patient beforehand. For example: An Adhoc test can be performed if a prompt measurement of a patient is urgently required (e.g. in an emergency situation). It is possible to assign the measurements performed to a patient after the measurement has been completed or at some point later. Perform an Adhoc Test Tap on the "Adhoc TestÂżHOGRQWKH+RPH6FUHHQ The "Ambient Conditions" window appears and zeroing occurs: Tap on to apply the ambient data entered and perform three successive "Forced Spirometry" maneuvers as described. Once the test is completed, the following window appears: Page 34/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Assign Adhoc Test now Tap on . The "Patient Directory" is displayed: Tap on and enter the respective patient data (see chapter "Add Patient" for details). Following window appears: Finish by tapping . 9HUVLRQÂ0$< Page 35/84 SpiroSphereÂŽ Instructions for Use Assign Adhoc Test later Tap on . The patient which is not registered yet will appear as "Adhoc Patient" in the "Patient Directory". In order to assign a patient to the Adhoc test performed, tap on "Adhoc Patient". Tap on to enter the appropriate patient data. Page 36/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Show, Edit, Delete and Print Tests 6HOHFWDFRPSOHWHGWHVW7KHIROORZLQJĂ\RXWPHQXDSSHDUV Tap on to display the results of the selected test on the screen: 9HUVLRQÂ0$< Page 37/84 SpiroSphereÂŽ Instructions for Use Existing patient data can be edited (if e.g. the patient's body weight or height (e.g. in children) has changed in the meantime) by tapping on . The selected test can be deleted with : Tapping on will irrevocably delete the selected test! Tap on to print the selected test or send a PDF-report to a designated e-mail address. For more detailed information, see chapter "Print Recorded Results". Page 38/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use The selected patient including all measurements performed with the respective patient can be deleted by tapping on : Tapping on will irrevocably delete the selected patient and all respective tests! Tap on to delete all measurements performed with the selected patient: Tapping on will irrevocably delete all tests assigned to the selected patient! 9HUVLRQÂ0$< Page 39/84 SpiroSphereÂŽ Instructions for Use Print Recorded Results As soon as a measurement is completed, the results can be printed by means of a connected USB*1 SULQWHU,WLVDOVRSRVVLEOHWRFUHDWHD3')ÂżOHZKLFKFDQEHVHQWWRDSUHGHÂżQHGHPDLO address*2 or saved to an USB stick. Preset: send PDF to an e-mail address (see >Setting Report & Printing) Tap on the Printer icon. 7DSRQWKH5HSRUW6HOHFWLRQÂżHOG Best Effort Report a report displaying the best effort is created All Effort Report a report displaying all efforts is created Screen Capture Report a screen capture report is created Tap on to create the report. The "Print Result" window appears: Tap on to send the report to WKHSUHGHÂżQHGHPDLODGGUHVV 7KHUHSRUWZLOOEHVHQWWRWKHHPDLODGGUHVVGHÂżQHGRQ\RXU6SLUR6SKHUH7KHUHSRUW ODEHOZLOOLQFOXGHWKHGDWHDQGLGHQWLÂżFDWLRQQXPEHU7KHÂżOHZLOOEHSDVVZRUGSURWHFWHG DVGHÂżQHG SpiroSphere Report: BestEffortReport_20160815_155247+0200.zip *1 *2 *3 For this option, an USB printer needs to be connected to the SpiroSphere For this option, the SpiroSphere needs to be connected to the network See chapter "Settings and Tools > Report & Printing" Page 40/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Settings and Tools The following includes a short description of settings which are not required for daily routine work. Tap on the "Settings & Tools" button on the Home Screen. The following will appear: General Tap on "General" Timezone Date & Time 2SWLRQV 'HÂżQLWLRQ &KRRVH3UHVHW select actual Country select timezone City ON/OFF ON 24h/12h 24h YYYY.MM.DD 2016.08.16 set actual Time DD.MM.YYYY 16.08.2016 DD-MM-YYYY DD-MMM-YYYY 16-AUG-2016 MM/DD/YYYY 08/16/2018 set actual Date 9HUVLRQÂ0$< Page 41/84 SpiroSphereÂŽ Instructions for Use Regional Setting options: Preset: English (US), German English (US) cm. in cm kg. lb kg Setting options: Preset: select 50% select 100% select 100% select 5 min select 2 min select 10 min select 5 min select 20 min select 20 min Sound Power Management Preset: 7KHVHVHWWLQJVLQĂXHQFHWKHEDWWHU\OLIHRIWKH6SLUR6SKHUH Page 42/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Spirometry Settings Tap on "Spirometry Settings" Spirometry Settings - Sensor Sensor Connection Active: The SpiroSphere Sensor is connected to the SpiroSphere via Bluetooth Not paired: The SpiroSphere Sensor is not connected to the SpiroSphere Battery: Indicates the battery status of the SpiroSphere Sensor 9HUVLRQÂ0$< Page 43/84 SpiroSphereÂŽ Instructions for Use Spirometry Settings - General Predicted Values Setting options: Preset: None GLI 2012 GLI 2012 NHANES III ECCS/Zapletal Knudson/Crapo Extrapolate Limits from Author Limits from Author No calculation outside limits Module Age range Height range Differentiation acc. to Race GLI 2012 3-95 years no limitation Ethnicity NHANES III 8-80 years 110-200 cm African-Descent Mexican-American all other groups ECCS/Zapletal 5-17 years (Zapletal) 18-70 years (ECCS 93) 107-182 cm (for Zapletal only) African-Descent 0.87 for volume (18 - Â) Knudson/Grapo 6-90 years no limitation African-Descent 0.88 for volume all other groups For an age between 19 and 25, the calculation is based on the age of 25 Page 44/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Sensor Check Setting options: Preset: 1, 2, 3 1, 2, 3, 4 2, 3, 4, 5, 6, 7, 8 ON, OFF ON 2))&RQÂżUP(QIRUFH &RQÂżUP 2))&RQÂżUP(QIRUFH &RQÂżUP Setting options: Preset: °C, °F hPa, mmHg °C hPa Setting options: Preset: mL, L mL, L L/s, mL/s, L/min L/s, mL/s, L/min L/min s, ms s, ms 1, % L*L/s, mL*L/s mL L/s L/s L/min ms L*L/s Ambient Conditions Unit Groups 9HUVLRQÂ0$< Page 45/84 SpiroSphereÂŽ Instructions for Use Decimals Setting options: Preset: 0, 1, 2, 3, 4 0, 1, 2, 3, 4 0, 1, 2, 3, 4 0, 1, 2, 3, 4 0, 1, 2, 3, 4 0, 1, 2, 3, 4 0, 1, 2, 3, 4 0, 1, 2, 3, 4 0, 1, 2, 3, 4 Example: Preset 0: Preset 1: Preset 2: FVC [L] 5 5,1 5,10 Spirometry Settings - Forced Spirometry Measurement Scroll down to display further settings (if applicable) Page 46/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Diagram Scaling Adult Diagram Scaling Child Setting options: Preset: Automatic Automatic 16 L/s, 12 L/s, 8 L/s , 4 L/s If âAutomaticÂłLVVHOHFWHGDQGWKHEUHDWKLQJĂRZLVJUHDWHURUOHVV WKDQWKHSUHVHWĂRZD[LVWKLVD[LVZLOOEHUHVFDOHGDXWRPDWLFDOO\ &KRRVH FVC as FEV2 FVC as FEV3 FVC as FEV6 3UHVHW ON, OFF OFF ON, OFF OFF ON, OFF OFF If âONâ is selected, the value for the respective parameter is used as the FVC value. Setting options: Preset: Expiratory Back Extrapolation Always, Never Always Inspiratory Back Extrapolation Why Back Extrapolation? A delayed start of the expiration in the forced expiration breathing maneuver provides incorrect results for various parameters. Back extrapolation means that in case of a delayed expiration the system determines the correct start of expiration. correct incorrect Example: 4.6 liters Example: 3.8 liters Volume Start of expiration calculated by extrapolation Criterion 5% of FVC Expiration curve Time Why inspiratory back extrapolation? In case of a delayed inspiration during the FIV1 breathing maneuver and if âalwaysâ is preset, the computer determines the correct start of inspiration. 9HUVLRQÂ0$< Page 47/84 SpiroSphereÂŽ Instructions for Use FEF calculation Base FIF calculation Base Setting options: Preset: individual FVC individual FVC VC max If âindividual FVCâ is selected, the FEF or the FIF values will be calculated based on FVC. Best Expiration Setting options: Preset: FEV1 + FVC FEV1 + FVC FEV1 FVC FVC + FERV1 + 1/3*PEF FEV0.5 + FVC FEV0.5 Best Inspiration Setting options: Preset: FVCin + PIF FVCin + PIF FVCin + 0.1*PIF FVCin + FIV1 FVCin FIV1 Use best EX If several breathing maneuvers are performed within one test cycle, the software determines the best breathing maneuver within this trial according to preset criteria. Summary default View Setting options: Preset: Flow/Volume Flow/Volume Tiffenau Spirogram If âFlow/VolumeÂłLVVHOHFWHGWKHUHVXOWVFUHHQZLOOGLVSOD\WKHĂRZ volume curve. If "Tiffeneau" is selected, the tiffenau curve will be displayed. Page 48/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Display Inspiratory Setting options: Preset: ON, OFF ON ON means: the inspiratory portion of the Flow-Volume curve is displayed. OFF means: the inspiratory portion of the curve will not be displayed. The setting can be changed during the measurement. Inspiratory Position Setting options: Preset: TLC, RV TLC The inspiratory and expiratory phase of the Flow-Volume curve can be referred to TLC or RV. TLC Display Predicted Curve RV Setting options: Preset: ON, OFF ON If activated (ON), a predicted curve will be displayed in the diagram as reference. Pred 9HUVLRQÂ0$< Page 49/84 SpiroSphereÂŽ Instructions for Use Spirometry Settings - Forced Spirometry Quality Feedback Setting options: Preset: ON, OFF ON ON, OFF ON, OFF Error Error OFF Warning &RQÂżUPDWLRQ As the quality of a spirometry measurement strongly depends on the patient's FRRSHUDWLRQWKHFULWHULDGHÂżQHGE\WKH$76PXVWEHPHW,IWKHUHVSHFWLYHFULWHULDDUHQRW PHWWKH\ZLOOEHGLVSOD\HGLQWKHUHVXOWVVFUHHQDQGÂżQDOO\GRFXPHQWHGLQWKHUHSRUW Quality Feedback documented in an "Example" report: ATS error codes Page 50/84 ABG means: errors A, B, G are present 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Spirometry Settings - Slow Spirometry Measurement Setting options: Preset: Automatic, 12, 9, 6, 4 L Automatic Automatic, 12, 9, 6, 4 L Automatic VCin, VCex, VCmax, IC, ERV VCmax ERV VC-, IC VC-Maneuver ERV VC-Maneuver Quality Feedback Setting options: Preset: Error Error OFF Warning &RQÂżUPDWLRQ Quality Feedback documented in an "Example" report: ATS error codes 9HUVLRQÂ0$< N means: the criteria N are not met Page 51/84 SpiroSphereÂŽ Instructions for Use Parameter Selection Forced Spirometry - Displayed Parameters The"Shown Parameters" column displays the parameters shown in the result screen of the forced spirometry measurement. Preset: FEV1 FEV1/FVC FVC MMEF Scroll down to display further parameters (if applicable) FVCin The"Not active parameters" column displays all parameters which can be selected to be shown during a measurement. Add a parameter to the "Shown Parameters" column: Double-tap on the required parameter in the "Not active parameters" column. The parameter will immediately be added to the "Shown Parameter" list. Remove a parameter from the "Shown Parameters" column: Double-tap on the parameter you want to delete. Tap on in order to undo the recent changes. Forced Spirometry - Printed Parameters "see above" Page 52/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Slow Spirometry - Displayed Parameters The "Shown Parameters" column displays the parameters shown in the result screen of the slow spirometry measurement. Preset: VCin IC VCmax VT Scroll down to display further parameters (if applicable) BF The "Not active parameters" column displays all parameters which can be selected to be shown during a measurement. Add a parameter to the "Shown Parameters" column: Double-tap on the required parameter in the "Not active parameters" column. The parameter will immediately be added to the "Shown Parameter" list. Remove a parameter from the "Shown Parameters" column: Double-tap on the parameter you want to delete. Tap on in order to undo the recent changes. Slow Spirometry - Printed Parameters "see above" 9HUVLRQÂ0$< Page 53/84 SpiroSphereÂŽ Instructions for Use User Management This tool enables an authorized person to create an Administrator account. The newly created administrator will then be able to create additional accounts for individuals authorized to work with the SpiroSphere. Additionally, it is possible to register your ÂżQJHUSULQWVLQRUGHUWRXWLOLVHWKHÂżQJHUSULQWUHDGHUIRUV\VWHPDFFHVV From "Settings" select "User Management" Tap the switch to activate User Management The following screen appears: Enter the Global Password (â691982â) and tap . Page 54/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use The following screen appears: Options for role type: Administator User Support (QWHUWKHGHWDLOVIRUWKHXVHU IRUÂżUVWXVHUWKLVPXVWEH$GPLQLVWUDWRUUROH 2SWLRQDOO\\RXFDQFKRRVHWRUHJLVWHU\RXUÂżQJHUSULQWVLQRUGHUWRXWLOLVHWKHÂżQJHUSULQWUHDGHUIRU system access. Patients Administrator User Support New patient Search patient View patient details Change patient demographics View measurements Perform measurements Print reports Calibration Check Linearity Check Calibration CheckLog Linearity CheckLog Create backup View system info Sensor Check Tools 9HUVLRQÂ0$< Page 55/84 SpiroSphereÂŽ Instructions for Use System Administration Add or change user Deactivate/activate user Recover Change date and time settings Update software Select to register ÂżQJHUSULQWV Tap . The following screen appears: Tap . Make the appropriate entries and, if GHVLUHGUHJLVWHUÂżQJHUSULQWV VHHDERYH Change Password 7DSSLQJWKHFXUUHQWO\ORJJHGLQXVHULQWKHGLUHFWRU\ZLOORSHQDĂ\RXWPHQX Access to the User details, and Change password function is available To set a new password, tap . The following screen appears: Make the appropriate entries and tap to save the new password. Page 60/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Edit User To edit the currently selected user, tap to deactivate the selected user. 9HUVLRQÂ0$< Page 61/84 SpiroSphereÂŽ Instructions for Use To reset the password for another user, tap . The following screen appears: The user will be required to change their password upon their login. Change Security Question From "User Management SettingsD6HFXULW\4XHVWLRQDQG$QVZHUFDQEHGHÂżQHGIRUWKH current user. Make the appropriate entries and tap to save the Security Question. Page 62/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Backup & Recover A backup of all saved patient- and test data should be performed and saved to a USBStick on a regular basis. Tap on "Backup & Recover". Alternatively, tap on the "No backup performedÂżHOGRQWKH Home Screen. If âPerform Backupâ is selected, the message "Please ensure a Backup USB Stick is Inserted" appears. Backup Insert USB stick Tap on âStart BackupÂłWRFUHDWHDEDFNXSÂżOH and save it to the USB stick! 9HUVLRQÂ0$< Page 63/84 SpiroSphereÂŽ Instructions for Use If âPerform Recoverâ is selected, the message "Please ensure USB Stick for Recover is Inserted" appears. Recover Insert Backup USB stick Tap on âAll Dataâ to reload all data into the patient directory of your SpiroSphere. Page 64/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Communication Tap on "Communication" ,WLVSRVVLEOHWRFRQÂżJXUHWKH&RPPXQLFDWLRQVHWWLQJVIURPWKH&RPPXQLFDWLRQPHQXZLWKLQ Settings. 6HOHFWWKH&RPPXQLFDWLRQPHWKRGWRRSHQWKHUHVSHFWLYHFRQÂżJXUDWLRQVHWWLQJV Network Requirements WiFi Tap on the desired WiFi network. 7KHIROORZLQJĂ\RXWPHQXDSSHDUV Tap to initiate the connection. 9HUVLRQÂ0$< Page 65/84 SpiroSphereÂŽ Instructions for Use Enter the password as applicable and tap . Ethernet Choose the appropriate settings. If DHCP is set on "Off", then you can manually enter the appropriate settings. Page 66/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Report & Printing SpiroSphere allows for reports to be printed with an external printer. In addition, 6SLUR6SKHUHZLOODOORZWKHXVHUWRJHQHUDWHUHSRUWVDVD3')ÂżOHZKLFKFDQEH WUDQVIHUUHGWRDQH[WHUQDOGHYLFH LHYLDD86%VWLFN RUHPDLOHGWRDVSHFLÂżHG recipient. Tap on "Report & Printing" Printer Setting options: Preset: Printer, PDF via Email, PDF via USB PDF via Email ON, OFF OFF see below see below Color, Black & White Color A4, Letter A4 Send test page to Default Printer Email Address: Enter the Email address of the person the reports should be sent to. Zip File Password: Set the password the recipient is required to enter in order to open the "zip" folder. See chapter "Print Recorded Results". 9HUVLRQÂ0$< Page 67/84 SpiroSphereÂŽ Instructions for Use Reports Setting options: Preset: Input Customer Name Input Customer Address Best Effort Report Best Effort Report All Efforts Report Email Input Username Input Password Input Email Address Input Server Name Input Port Input SSL Print Job Print jobs state Page 68/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Update Tap on . The device will search for updates on the connected USB stick. Tap on to begin the update process. List of available updates About Device Restore Default Settings Factory reset A detailed description of this tool is not part of this Instructions for Use. 9HUVLRQÂ0$< Page 69/84 SpiroSphereÂŽ Instructions for Use Cleaning/Hygiene In the course of lung function testing, certain parts of the equipment can be contaminated by germs, which creates the risk that these germs can be transferred to the next test subject. For cross-contamination to occur, the test subject would need to be in direct contact with the contaminated object or transport media such as droplets or aerosols. Contaminated aerosols may EHWUDQVSRUWHGWKURXJKWKHUHVSLUDWRU\ĂRZDQGPD\DIIHFWWKHQH[WWHVWVXEMHFW Always be sure to disconnect the devices/systems from the mains power before cleaning or disinfecting. The possible risk of infection can only be avoided if all of the contaminated parts are thoroughly disinfected! Hygiene Regulations: In case of normal contamination all single-use items can be disposed of with the regular waste. In case of dangerous infectious diseases (e.g. tuberculosis, blood...) single-use items must be disposed of through hazardous waste. How often should contaminated parts be exchanged? 6LQJOH8VH(5737ZLWKPRXWKSLHFH Dispose after every patient Reuse may lead to patient infections. 6LQJOHSDWLHQWXVH1RVHFOLS Dispose nose clips after every patient Reuse may lead to patient infections. ERT PT and mouthpiece are parts for single use only. These parts must be disposed after each single use. If reused, infection may occur. Reprocessing may deteriorate the part, resulting in reduced stability and leakage through micro cracks or releasing micro particles that could be inhaled. Should any of these parts be recycled and misused intentionally, ERT takes no responsibility nor can be made liable for the consequences arising from reusing these parts. Wiping disinfection Surface Cleaning and Disinfection The surface disinfection of the Main unit and other contaminated surfaces, such as the SpiroSphere Sensor, must be performed on a regular basis (e.g. Main Unit daily). If there has been direct contact with the skin or if the case history/diagnosis of the patient requires it, a surface disinfection has to be performed directly after the application. Page 70/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use If the patient's history shows a dangerous infectious disease (e.g. tuberculosis), all parts which had been in direct or indirect contact with the patients must be disinfected. Do not clean or disinfect the Main Unit or the SpiroSphere Sensor while the devices are in operation. Precleaning and Disinfection $WKRURXJKSUHWUHDWPHQWFOHDQLQJLVDSUHFRQGLWLRQIRUDQHIÂżFLHQWGLVLQIHFWLRQRIFRQWDPLQDWHG parts. Protein residue on these parts might prevent an effective disinfection. ERT recommends the following disinfectants: Precleaning and Disinfection: Product Manufacturer Concentration/Reaction time mikrozidÂŽsensitive wipes CaviWipes Schuelke & Mayr GmbH 1 minute Metrex 1 minute 3URFHGXUH8VHWKHÂżUVWFOHDQLQJZLSHWRFRYHUDOOVXUIDFHVZLWKWKHGHWHUJHQW5HSHDWWKH procedure with a second wipe for disinfection. Let the surface dry. Protein residue on parts which are to be disinfected prevents effective disinfection. Therefore all protein residue must be removed prior to disinfection. In case of persistent residues please use an appropriate tool (e.g. soft brush) to remove the residues. Please observe the instructions with regard to concentration and reaction time! If a different substance is used, please follow the manufacturer's instructions. The use of detergents and disinfectants which have not been recommended by the manufacturer might damage the products. The manufacturer's information on the cleaning of accessories provided separately must be observed! With suspected tuberculosis or other resistant germs, the use of an appropriate disinfectant (CaviWipes, Reaction time >3 minutes) is required. $YRLGFRQWDPLQDWHGĂXLGV HJEORRG WRJHWLQWRWKH6HQVRU8QLW,QFDVHRI LQJUHVVRIFRQWDPLQDWHGĂXLGVGRQRWXVHWKH6HQVRU8QLW Disposal of single use items / damaged reusable items Take precautions to avoid contaminating yourself (e.g. use gloves). All single patient use items can be disposed of as domestic waste if there is a normal degree of contamination. In case of dangerous infectious diseases (e.g. tuberculosis) it is necessary to dispose of the single patient use items in special designated containers. ,QDGGLWLRQSOHDVHQRWHFRXQWU\VSHFLÂżFGLVSRVDOUHJXODWLRQV. 9HUVLRQÂ0$< Page 71/84 SpiroSphereÂŽ Instructions for Use General Safety Precautions The Instructions for Use is regarded as part of the instrument, and should always be kept on hand. The Instructions for Use describes the present state of the device/system, including software and accessories, with regard to the fundamental requirements of the MDD 93/42/EEC. Exact adherence to the instructions issued is a prerequisite for perfect and intended functioning of ERT instruments. Deviation from Intended Use Any non-observance of the procedures (such as preparation for a measurement and methods, disinfection procedures, use of accessories and replacement parts etc.) described in the Instructions for Use results in a deviation from intended use. In case of a deviation from intended use, the operator/user has to supply proof of meeting all corresponding fundamental requirements. The operator/user is responsible for performing the conformity assessment correctly and is also completely liable for defective products - i.e. the operator/ XVHULVOLDEOHIRUKLVKHUPRGLÂżFDWLRQRIWKHPHGLFDOSURGXFW ERT only guarantees for the safety, reliability and functionality of the instrument if LQVWDOODWLRQH[WHQVLRQPRGLÂżFDWLRQVDQGUHSDLUVDUHH[FOXVLYHO\FDUULHGRXWE\ personnel authorized for these tasks by ERT. WKHURRPLQZKLFKWKHHTXLSPHQWLVRSHUDWHGFRPSOLHVZLWKWKHFRXQWU\VSHFLÂżF installation standard. the unit can be plugged into a socket with protective conductor system. the ambient conditions at the place of installation are suitable for the unit. the unit is used according to the Instructions for Use. Unpack your medical device. Please check if the unit is damaged. If so, do not use it and return it for a replacement. 3DWLHQW6DIHW\DFFRUGLQJWR(1 This medical device safely insulates the subject from the mains power supply as required in the safety regulations on leakage current according to EN 60601-1, Type BF. Nevertheless, a VXEMHFWHQYLURQPHQWPXVWEHGHÂżQHG7KHVXEMHFWKDVWRNHHSDGLVWDQFHRIDWOHDVWPIURPDOO open interfaces and connectors of the SpiroSphere Main Unit to avoid any contact with electrical voltage. The physician/operator must not touch any voltage-carrying parts (e.g. USB Plug, Ethernet Plug) and the subject at the same time. Page 72/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use The connection of further power-operated units to your ERT unit may cause all the leakage currents to add-up and the safety of the subject is reduced. Due to this, the connection of further units may only be carried out on consultation with the ERT Customer Care. $FFHVVRU\HTXLSPHQWFRQQHFWHGWRWKHLQWHUIDFHVPXVWEHFHUWLÂżHGDFFRUGLQJWR the respective EN standards (e.g. EN 60950 or EN 60601-1). Everybody who connects additional equipment to the signal input part or signal RXWSXWSDUWFRQÂżJXUHVDPHGLFDOV\VWHPDQGLVWKHUHIRUHUHVSRQVLEOHWKDW the system complies with the requirements of the valid version of the system standard (IEC 60601-1). If in doubt, consult the technical service department or your local representative. 8VHRI0XOWL3OXJ6RFNHWV Medical devices/systems must only be connected to multi-plug sockets if all regulatory requirements are met. - Additional mobile multi-plug sockets must not be connected to power sockets of medical devices/systems. - Mobile multi-plug sockets of medical devices/systems must not be placed RQWKHĂRRU - Equipment (for example vacuum cleaner, radio, etc.) and devices which are not part of the medical device/system must not be connected to the multiplug sockets. Radiated Interference The ERT device meets the regulations according to EN 60601-1-2 (CISPR 11 Group 1 class B) regarding the interference radiated and received. The device should not be installed in the vicinity of high-frequency devices, X-ray equipment, motors or transformers with high installed power rating since electric RUPDJQHWLFLQWHUIHUHQFHÂżHOGVPD\IDOVLI\WKHUHVXOWRIPHDVXUHPHQWVRUPDNH taking measurements impossible. Due to this, the vicinity of power lines is to be avoided as well. Existing environmental interferences may cause deviations of the measurement values without impairing the deviceâs function. Therefore, it is recommended to keep a distance of about 2 meters from possible error sources when using the device. This device should not be operated in immediate vicinity to or stacked with other devices since this could lead to an incorrect operation. However, if an operation in the described manner is necessary, this device as well as the other devices should be carefully observed to ascertain a proper operation. Using other accessories, other transformers and other cables than those VSHFLÂżHGRUSURYLGHGE\WKHGHYLFH VPDQXIDFWXUHUFDQUHVXOWLQLQFUHDVHG electromagnetic radiation or reduced electromagnetic immunity of the device and can lead to an incorrect operation. Portable RF communications equipment (transmitters) (including appropriate accessories such as aerial wires and external antennas) should be operated with a minimum distance of 30 cm (21 inch) to the SpiroSphere's components DQGFDEOHVVSHFLÂżHGE\WKHPDQXIDFWXUHU1RQREVHUYDQFHPD\OHDGWRD reduction of the device's performance. 9HUVLRQÂ0$< Page 73/84 SpiroSphereÂŽ Instructions for Use Ambient Conditions The medical device must not be operated in rooms with the presence of ĂDPPDEOHDQDHVWKHWLFPL[WXUHZLWKDLURUĂDPPDEOHDQDHVWKHWLFPL[WXUH with oxygen or nitrous oxide. The medical device must be operated in rooms ZKHUHRQO\QRQFRQGXFWLYHSROOXWLRQRFFXUVKRZHYHURFFDVLRQDOWHPSRUDU\ conductivity due to condensation is to be expected. The medical device is designed for operation in medically used rooms. The medical device has to be effectively protected against moisture. Ventilation slots must be kept free of obstructions in order to enable air circulation. Putting the Unit into Operation Temperature changes may give rise to condensation in the device. Consequently, the device has to adapt to the ambient temperature before putting it into operation. Always consult the nameplate on the device/system for compliance of the unitâs own data with those of the local power supply system (mains voltage and mains frequency) before actually connecting the unit. Connect only if all data comply! Inspect the mains connection cable, plug, and receptacle for visible damages prior to establishing the connection. Damaged cables or plugs must be replaced immediately. Installation and assembly of the device must be done only in compliance with this Instructions for Use. $IWHUWKHÂżUVWVHWXSRULIWKHVHWXSKDVEHHQFKDQJHG HJH[FKDQJLQJRIWKH SpiroSphere Sensor), a function test (e.g. calibration check) has to be performed. The Main Unit must be placed outside the patient environment during measurement. Medical Supervision 'XULQJWKHPHDVXUHPHQWWKHSDWLHQWPXVWQRWEHXQDWWHQGHG$TXDOLÂżHG physician must reassess all measurements. An interpretation by the medical GHYLFHLVVLJQLÂżFDQWRQO\ZKHQFRQVLGHUHGWRJHWKHUZLWKRWKHUFOLQLFDOÂżQGLQJV The performance of the spirometer can be affected by the patient spitting or coughing into the spirometer during expiration or by extremes of temperature, humidity and altitude. Contraindications According to ââATS/ERS TASK FORCE: STANDARDISATION OF LUNG FUNCTION TESTINGââ (ERS Journals Ltd 2005) performing lung function tests can be physically demanding for a minority of patients. It is recommended that patients should not be tested within 1 month of a myocardial infarction. In rare cases spirometry testing can lead to syncope due to extensive exhalation. In the S2 guideline "Spirometry" (German Airway League, German Respiratory Society and German Society of Occupational and Environmental Medicine, 2015), contraindications of spirometry are divided into absolute and relative contraindications: Absolute contraindications for Forced Maneuvers Acute, life threatening diseases of every description, e.g.  $FXWH0\RFDUGLDO,QIDUFWLRQ  $FXWH)XOPLQDQW3XOPRQDU\(PEROLVP Page 74/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use  /DUJH$VFHQGLQJ$RUWLF$QHXU\VP  7HQVLRQ3QHXPRWKRUD[ Relative contraindications for Forced Maneuvers  0DVVLYH3QHXPRWKRUD[ ZLWKLQWKHÂżUVWZHHNV  $EGRPLQDORU7KRUDFLF6XUJHU\ GHSHQGLQJRQWKHÂżQGLQJVWRZHHNV post-operatively)  6XUJHU\RIWKH(\HV%UDLQRU(DUV YDULDEOHFRQVXOWDWLRQZLWKWKH surgeon)  6SHFLDOFDUHPXVWEHWDNHQZKHQGHDOLQJZLWK+HPRSW\VLVRIXQNQRZQ origin Cleaning and Hygiene Prior to every application, all parts which come in contact with the patient and which are intended for reuse must be cleaned or disinfected (unless otherwise instructed). Prior to taking measurements of a patient, his/her medical history is to be checked in order to avoid a contamination of the device and a resulting crosscontamination of the next patient. While performing a calibration check, a new disposable Pneumotach must be used to prevent cross-contamination between the calibration syringe and the parts. This will prevent contamination of the syringe and allow for its reuse. Always be sure to disconnect the devices/systems from the mains power before cleaning or disinfecting. The Main Unit corresponds to protection class IP21, the SpiroSphere Sensor to class IP20. The device may not be soaked in liquid of any kind. Liquid inside the device/ system may lead to harm of the user and can destroy the device. The device can be cleaned with a damp (but not soaked) cloth, which does not produce lint. More detailed information can be found under âHygieneâ in this Instructions for Use. Detergents and chemicals required for cleaning and disinfection must always be stored in specially marked containers to prevent any accidental improper use. Biocompatibility Component Material Mouth piece Styrolution PS 454N HIPS Biocompatibility of the material has EHHQFRQÂżUPHG Housing parts of the sensor unit and the main unit PT-tube 9HUVLRQÂ0$< Cycoloy CX2244ME Biocompatibility of the material has EHHQFRQÂżUPHG Styrolution PS 454N HIPS Page 75/84 SpiroSphereÂŽ Instructions for Use Maintenance No part of the medical device may be replaced by the customer. Use only ERT approved accessories and spare parts for this medical device. If applied parts (e.g. SpiroSphere Sensor) have been exposed to extreme mechanical stress, a function test (e.g. volume calibration check) has to be performed. If function is lost, the defective part is to be replaced. Damaged parts, e.g. frayed plugs, receptacles, a damaged handle, and defective cables should be replaced immediately by an authorized specialist or engineers from ERT Customer Care. The device must not be opened. If it is opened without authorization the guarantee entitlement expires. ERT Customer Care is always at your disposal with help and assistance in case of problems. Before turning on the device/system you should always check whether the power cable, power plug, outlet and power input of the device are free from defects. Before turning on the device/ system the following issues have to be checked visually on a daily basis: - the display glass is undamaged - the unit has not been mechanically stressed in the extreme (e.g. damage to the housing, the cable is made defective by running over it with a heavy object or dragging it) - no liquid got inside the unit - the SpiroSphere Sensor is not damaged - cables and/or multiple connectors are not defective - coverings are not broken An unattended child should not get into contact with disposables, accessories and packing material as well as cleaning and disinfection substances. Recurrent Test Medical Electrical equipment needs a recurrent testing after repair of the equipment according to IEC 62353. The calibration syringe itself has to be calibrated at regular intervals as determined by the manufacturer and as indicated on the syringe. The calibration syringe must be checked for an accuracy of Âą 12 mL. Recycling Adhere to the national law of the country when disposing the medical device and its accessories. Improper disposal of the device and/or its accessories can result in serious environmental hazards. Page 76/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Graphical Symbols Alternating current Attention! ON/OFF (device connected to/disconnected from the power supply system) The typeplate can be found at the rear side of the Main Unit. The typeplate on the SpiroSphere sensor is positioned at the left side. Follow the instructions for Use! Year of Production Manufacturer Applied part of Type BF Single use Disposal of electronic devices in compliance with WEEE Barometric pressure limits Rx only CAUTION: FEDERAL U.S. LAW RESTRICTS THIS DEVICE TO SALE BY OR ON THE ORDER OF A PHYSICIAN. Packaging can be recycled Temperature limit Serial number Reference number IP20 3URWHFWLRQDJDLQVWLQWUXVLRQRIVROLGVÂPPGLDPHWHUQRSURWHFWLRQDJDLQVWLQJUHVVRIOLTXLGV IP21 3URWHFWLRQDJDLQVWLQWUXVLRQRIVROLGVÂPPGLDPHWHUSURWHFWLRQDJDLQVWFRQGHQVDWLRQ &(VLJQZLWKFRGHQXPEHURIWKH1RWLÂżHG%RG\ 7KHFHUWLÂżHGTXDOLW\PDQDJHPHQWV\VWHPRIeResearchTechnology GmbH corresponds to the international standard of ISO 13485. Possible source of interference 9HUVLRQÂ0$< Page 77/84 SpiroSphereÂŽ Instructions for Use Parts of the software are developed under the GPL software license. The source code of these parts can be obtained from ERT. The conditions and a copy of the GPL can be obtained at: "http://www.fsf.org/licenses/gpl.html" or from: Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA This product is based in part on Evas, CopyrightŠ 2000 - 2005 by Carsten Haitzler and various contributors, and on the work of the FreeType team. The safety precautions and operational procedures indicated in this chapter refer to Germany. Different regulations and standards may apply to other countries. Safety Precautions for Lithium Ion Rechargeable Batteries The SpiroSphere Sensor is powered by an internal Lithium-Ion Polymer battery. The SpiroSphere Main Unit can also be powered by an internal Litihium-Ion Polymer battery. The following safety precautions are valid for Lithium-Ion batteries: - Dispose of Lithium-Ion batteries according to local regulations. - Do not shortcut the battery. - Protect the battery against excessive heat! - Protect the battery against direct sun light! 3URWHFWWKHEDWWHU\DJDLQVWÂżUH - Do not dismantle or manipulate the battery. 'RQRWUHSODFHWKHEDWWHU\,PSURSHUUHSODFHPHQWFDQOHDGWRÂżUHH[FHVVLYHKHDWRUH[SORVLRQ 7KHĂXLGLQWKHEDWWHU\LVWR[LFDQGĂDPPDEOHOHDN\EDWWHULHVRUEDWWHULHVZLWKGHQWVPXVWQRW be used any longer! 'RQRWFRPHLQFRQWDFWZLWKWKHĂXLGLQWKHEDWWHU\,IWKHĂXLGFRPHVLQFRQWDFWZLWK\RXUVNLQ immediately rinse the affected part with water and contact a doctor! - To charge the SpiroSphere Sensor, use only the Main Unit Cradle and observe the instructions in the manual! - To charge the Main Unit, use only the provided power supply. Page 78/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use USA âThis device complies with Part 15 of the FCC Rules. Operation is subjected to the following two conditions: (1) this device may not cause harmful interference, and (2) this device must accept any interference received, including that may cause undesired operation.â SpiroSphere - Main Unit: FCC-ID: 2AAUFSPS001 SpiroSphere - Sensor Unit: FCC-ID: 2AAUFSPS002 Canada This device complies with Industry Canada licence-exempt RSS standard(s). Operation is subject to the following two conditions: (1) this device may not cause interference, and (2) this device must accept any interference, including interference that may cause undesired operation of the device. Le prĂŠsent appareil est conforme aux CNR dâIndustrie Canada applicables aux appareils radio exempts de licence. Lâexploitation est autorisĂŠe aux deux conditions suivantes : (1) lâappareil ne doit pas produire de brouillage, et (2) lâutilisateur de lâappareil doit accepter tout brouillage radioĂŠlectrique subi, mĂŞme si le brouillage est susceptible dâen compromettre le fonctionnement. SpiroSphere - Main Unit: IC: 11335A-SPS001 SpiroSphere - Sensor Unit: IC: 11335A-SPS002 Frequency Band Transmission Frequency Range Maximum Output Power Gain UMTS B1 1922 to 1978 MHz 23 dBm (+/- 2dBm) Class 3bis -1.74 dBi UMTS B2 1852 to 1908 MHz 23 dBm (+/- 2dBm) Class 3bis -1.1 dBi UMTS B5 826 to 847 MHz 23 dBm (+/- 2 dBm) Class 3bis UMTS B6 832 to 838 MHz 23 dBm (+/- 2 dBm) Class 3bis UMTS B8 882 to 913 MHz 23 dBm (+/- 2 dBm) Class 3bis UMTS B19 832.4 to 842.6 MHz 23 dBm (+/- 2 dBm) Class 3bis GSM 850 824 to 849 MHz 2 Watts GSM, GPRS and EDGE E-GSM 900 880 to 915 MHz 2 Watts GSM, GPRS and EDGE DCS 1800 1710 to 1785 MHz 1 Watt GSM, GPRS and EDGE PCS 1900 1850 to 1910 MHz 1 Watt GSM, GPRS and EDGE -3.31 dBi -1.1dBi ERT complies with EMC guidelines according to EN60601-1-2. ERT can provide further information on EMC properties on request. 9HUVLRQÂ0$< Page 79/84 SpiroSphereÂŽ Instructions for Use Notes on EMC according to EN60601-1-2 The use of accessories not recommended by ERT may result in an increased electromagentic radiation or a reduced interference immunity of the SpiroSphere. *XLGDQFHDQG0DQXIDFWXUHUÂľV'HFODUDWLRQÂą(OHFWURPDJQHWLF(PLVVLRQVDQG,PPXQLW\ The SpiroSphere uses RF energy for internal function. Therefore, its RF emissions are very low and are not likely to cause any interference to nearby electronic equipment. The SpiroSphere is suitable for use in all establishments including domestic and those directly connected to the public low-voltage power supply network that supplies buildings used for domestic purposes. IEC 60601 directive Compliance level RF emissions CISPR 11 Group 1 Class B Electrostatic discharge (ESD) IEC 61000-4-2 Âą 8 kV indirect contact Âą 15 kV direct air direct contact not possible Radiated RF IEC 61000-4-3 10 V/m from 80 MHz to 2700 MHz applied to 4 devices orientations each with vertical and horizontal antenna polarisation Electrical fast transient/burst IEC 61000-4-4 Âą 2 kV for power supply lines Âą 1 kV for input/output lines Surge IEC 61000-4-5 0.5 kV differential mode 1 kV differential mode Conducted RF IEC 61000-4-6 3 V(rms) from 150 kHz to 80 MHz 6 V(rms) in ISM bands Voltage dips IEC 61000-4-11 tested at 100 and 240 V power supply input lines < 5% @ 0.5 cycles and 45 degree sync angle steps < 5% @ 1 cycle <70% @ 25 cycles and 50 Hz <70% @ 30 cycles and 60 Hz Short interruptions and voltage variations IEC 61000-4-11 tested at 100 and 240 V power supply input lines < 5% @ 250 cycles and 50 Hz < 5% @ 300 cycles and 60 Hz Page 80/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Technical Data Dimension 31.5 x 19.5 cm x 7.5 (L x W x H ) Weight 1.5 kg Screen Display 16.2 x 12.2 cm Medical Model: GTM91099-3009-4.0-T2 Power Supply Input: 100 - 240 Vac, 50/60 Hz, 1.5 A Output: 5 V, 6 A Cable length: 1200 mm Frequency 50 - 60 Hz Battery Main Unit Built-in rechargeable lithium-ion battery 3.7 V, 5000 mAh. Battery will last under standard operating conditions for about 3 h. Full charging: 2 h Cycle life: 70% of rated capacity after 350 cycles SpiroSphere Sensor Built-in rechargeable lithium-ion battery 3.7 V, 640 mAh. Battery will last under standard operating conditions for about 3 days in standby and 2.5 h operation. Full charging: 2 h Cycle life: 70% of rated capacity after 500 cycles Protection class Power Supply Class II SpiroSphere Sensor Internally powered Mode of operation Moisture protection continuous Power Supply IP42 Main unit IP21 SpiroSphere Sensor IP20 Applied parts ERT PT, SpiroSphere Sensor Application Measuring Pulmonary Function Interface Measuring Principle Operating Ambient USB Data transfer Bluetooth Data transfer WiFi Data transfer Ethernet Data Transfer 3G Data transfer Type BF high-quality pneumotach Temperature: +10 °C to +35 °C Relative humidity: 15 % to 90 % Barometric pressure: 700 to 1070 hPa 9HUVLRQÂ0$< Page 81/84 SpiroSphereÂŽ Instructions for Use Transport/Storage Temperature: -10 °C to +50 °C Relative humidity: 0 % to 90 % Barometric pressure: 600 to 1200 hPa Ambient unit Measuring range Barometric pressure: 500 to 1100 hPa Accuracy Âą 2.5 hPa at 700 - 1060 hPa Technical Data Flow Sensor Measuring range: PEF: 0.1 to Âą 16 L/s FEV1 and FVC: 0.1 to 8 L Resolution: PEF: Accuracy: PEF: < 5 mL/s FEV1 and FVC: 1 mL 0.1 to 16 L/s: FEV1 and FVC: 0.1 to 8 L: Resistance Spirometer max. 135 Pa/L/s at 14 L/s Instantaneous Flow 0.1 â 14 L/s: +/- 5% or 0.2 L/s Âą 10% of reading or Âą 0.3 L/s Âą 3% of reading or Âą 0.050 L The expected operational lifetime of the SpiroSphere is 7 years. Page 82/84 9HUVLRQÂ0$< SpiroSphereÂŽ Instructions for Use Item Numbers of Disposables and Accessories Use ERT accessories and spare parts only! 720254 Manual calibration syringe, 3 L 852740 Syringe Adapter D 28 mm, L 60 mm 892120 Plastic nose clip 892121 Nose clip pad "foam material", disposable, 100 pieces per pack 706000 ERT PT, incl. mouthpiece 706002 ERT PT, incl. mouthpiece (box of 10) 706002 ERT PT, incl. mouthpiece (box of 10) 706003 ERT PT, incl. mouthpiece (box of 50) eResearchTechnology GmbH Sieboldstrasse 3 97230 Estenfeld, Germany Tel. +49 9305 720-9891 Fax +49 9305 720-7891 CustomerCare@ert.com 9HUVLRQÂ0$< Page 83/84 ÂH5HVHDUFK7HFKQRORJ\*PE+RURQHRILWVDIÂżOLDWHV All rights reserved eResearchTechnology GmbH Sieboldstrasse 3 97230 Estenfeld, Germany +49 9305 720-9891 tel +49 9305 720-7891 fax
Source Exif Data:
File Type : PDF File Type Extension : pdf MIME Type : application/pdf PDF Version : 1.5 Linearized : Yes Create Date : 2017:05:30 11:30:59+02:00 Creator : Adobe InDesign CS5.5 (7.5.3) Modify Date : 2017:05:30 11:30:59+02:00 XMP Toolkit : Adobe XMP Core 5.4-c005 78.147326, 2012/08/23-13:03:03 Metadata Date : 2017:05:18 15:26:55+02:00 Creator Tool : Adobe InDesign CS5.5 (7.5.3) Page Image Page Number : 1, 2 Page Image Format : JPEG, JPEG Page Image Width : 256, 256 Page Image Height : 256, 256 Page Image : (Binary data 6682 bytes, use -b option to extract), (Binary data 5595 bytes, use -b option to extract) Instance ID : uuid:14b8ad26-629b-452b-8e6f-72bbfcfd0865 Document ID : xmp.did:9D69270EE3F8E211B9F3E9EEA7AFBFCF Original Document ID : xmp.did:93846FB1D314E111A2C6842E6BE7BE36 Rendition Class : proof:pdf History Action : created, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved, saved History Instance ID : xmp.iid:93846FB1D314E111A2C6842E6BE7BE36, xmp.iid:94846FB1D314E111A2C6842E6BE7BE36, xmp.iid:95846FB1D314E111A2C6842E6BE7BE36, xmp.iid:96846FB1D314E111A2C6842E6BE7BE36, xmp.iid:97846FB1D314E111A2C6842E6BE7BE36, xmp.iid:98846FB1D314E111A2C6842E6BE7BE36, xmp.iid:99846FB1D314E111A2C6842E6BE7BE36, xmp.iid:9A846FB1D314E111A2C6842E6BE7BE36, xmp.iid:9C846FB1D314E111A2C6842E6BE7BE36, xmp.iid:4E72B31AD114E111BD10C29E5587B8CE, xmp.iid:8A5F4A10F214E111BD10C29E5587B8CE, xmp.iid:8C5F4A10F214E111BD10C29E5587B8CE, xmp.iid:8D5F4A10F214E111BD10C29E5587B8CE, xmp.iid:8E5F4A10F214E111BD10C29E5587B8CE, xmp.iid:8F5F4A10F214E111BD10C29E5587B8CE, xmp.iid:B8E154686916E11198A6FDBF08B35CFF, xmp.iid:B9E154686916E11198A6FDBF08B35CFF, xmp.iid:0C9740808716E11198A6FDBF08B35CFF, xmp.iid:0D9740808716E11198A6FDBF08B35CFF, xmp.iid:0E9740808716E11198A6FDBF08B35CFF, xmp.iid:149740808716E11198A6FDBF08B35CFF, xmp.iid:159740808716E11198A6FDBF08B35CFF, xmp.iid:169740808716E11198A6FDBF08B35CFF, xmp.iid:949D87839A16E11198A6FDBF08B35CFF, xmp.iid:959D87839A16E11198A6FDBF08B35CFF, xmp.iid:969D87839A16E11198A6FDBF08B35CFF, xmp.iid:979D87839A16E11198A6FDBF08B35CFF, xmp.iid:989D87839A16E11198A6FDBF08B35CFF, xmp.iid:999D87839A16E11198A6FDBF08B35CFF, xmp.iid:9A9D87839A16E11198A6FDBF08B35CFF, xmp.iid:9B9D87839A16E11198A6FDBF08B35CFF, xmp.iid:9C9D87839A16E11198A6FDBF08B35CFF, xmp.iid:BF45A118A316E11198A6FDBF08B35CFF, xmp.iid:C045A118A316E11198A6FDBF08B35CFF, xmp.iid:10DF97FA2C17E111ADF1940397EE4DB4, xmp.iid:11DF97FA2C17E111ADF1940397EE4DB4, xmp.iid:12DF97FA2C17E111ADF1940397EE4DB4, xmp.iid:13DF97FA2C17E111ADF1940397EE4DB4, xmp.iid:14DF97FA2C17E111ADF1940397EE4DB4, xmp.iid:186126A0BA27E1119CD1EF2B8336DC2C, xmp.iid:196126A0BA27E1119CD1EF2B8336DC2C, xmp.iid:1A6126A0BA27E1119CD1EF2B8336DC2C, xmp.iid:62D27EC64C40E1119C91FAA54300DE11, xmp.iid:63D27EC64C40E1119C91FAA54300DE11, xmp.iid:64D27EC64C40E1119C91FAA54300DE11, xmp.iid:A141A8AEA766E111A8C2FE5E8026C11D, xmp.iid:A241A8AEA766E111A8C2FE5E8026C11D, xmp.iid:A341A8AEA766E111A8C2FE5E8026C11D, xmp.iid:A441A8AEA766E111A8C2FE5E8026C11D, xmp.iid:E347EECCC366E111A8C2FE5E8026C11D, xmp.iid:E447EECCC366E111A8C2FE5E8026C11D, xmp.iid:E547EECCC366E111A8C2FE5E8026C11D, xmp.iid:E647EECCC366E111A8C2FE5E8026C11D, xmp.iid:E747EECCC366E111A8C2FE5E8026C11D, xmp.iid:E847EECCC366E111A8C2FE5E8026C11D, xmp.iid:E947EECCC366E111A8C2FE5E8026C11D, xmp.iid:EA47EECCC366E111A8C2FE5E8026C11D, xmp.iid:EC47EECCC366E111A8C2FE5E8026C11D, xmp.iid:ED47EECCC366E111A8C2FE5E8026C11D, xmp.iid:CB729DD2CA66E111A8C2FE5E8026C11D, xmp.iid:CD729DD2CA66E111A8C2FE5E8026C11D, xmp.iid:CE729DD2CA66E111A8C2FE5E8026C11D, xmp.iid:CF729DD2CA66E111A8C2FE5E8026C11D, xmp.iid:6B3C52B0A995E111B137ED4FEA0BE0E7, xmp.iid:6C3C52B0A995E111B137ED4FEA0BE0E7, xmp.iid:6D3C52B0A995E111B137ED4FEA0BE0E7, xmp.iid:6E3C52B0A995E111B137ED4FEA0BE0E7, xmp.iid:1F2318D325AAE111ADB1F4FDBC8D3BAC, xmp.iid:202318D325AAE111ADB1F4FDBC8D3BAC, xmp.iid:212318D325AAE111ADB1F4FDBC8D3BAC, xmp.iid:222318D325AAE111ADB1F4FDBC8D3BAC, xmp.iid:232318D325AAE111ADB1F4FDBC8D3BAC, xmp.iid:242318D325AAE111ADB1F4FDBC8D3BAC, xmp.iid:E679C7EEDEAAE111A6079B7884D3BFA5, xmp.iid:3A69375B18ABE111A6079B7884D3BFA5, xmp.iid:41D325C1CCABE111BC7A95CA8A7296DF, xmp.iid:42D325C1CCABE111BC7A95CA8A7296DF, xmp.iid:CCA641EA4BB4E111A755C3C4225552D9, xmp.iid:CDA641EA4BB4E111A755C3C4225552D9, xmp.iid:CEA641EA4BB4E111A755C3C4225552D9, xmp.iid:CFA641EA4BB4E111A755C3C4225552D9, xmp.iid:D0A641EA4BB4E111A755C3C4225552D9, xmp.iid:C01B4B80956EE211AE00E7D01840CC29, xmp.iid:C11B4B80956EE211AE00E7D01840CC29, xmp.iid:C21B4B80956EE211AE00E7D01840CC29, xmp.iid:C31B4B80956EE211AE00E7D01840CC29, xmp.iid:D12D2EB9AE6EE211AE00E7D01840CC29, xmp.iid:D22D2EB9AE6EE211AE00E7D01840CC29, xmp.iid:1CAD4E2151F8E211BD6BADD17B603622, xmp.iid:AE9DC31155F8E211BD6BADD17B603622, xmp.iid:AF9DC31155F8E211BD6BADD17B603622, xmp.iid:B19DC31155F8E211BD6BADD17B603622, xmp.iid:47EEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:48EEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:49EEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:4AEEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:4BEEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:4CEEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:4DEEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:4EEEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:4FEEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:50EEAFF9D8F8E211B9F3E9EEA7AFBFCF, xmp.iid:9569270EE3F8E211B9F3E9EEA7AFBFCF, xmp.iid:9869270EE3F8E211B9F3E9EEA7AFBFCF, xmp.iid:9969270EE3F8E211B9F3E9EEA7AFBFCF, xmp.iid:9A69270EE3F8E211B9F3E9EEA7AFBFCF, xmp.iid:9B69270EE3F8E211B9F3E9EEA7AFBFCF, xmp.iid:9C69270EE3F8E211B9F3E9EEA7AFBFCF, xmp.iid:9D69270EE3F8E211B9F3E9EEA7AFBFCF, xmp.iid:8BE856E0D4F9E211A815D5B6ECA072AD, xmp.iid:D5A9AFD95424E3119127E5C0A0B0989E, xmp.iid:D6A9AFD95424E3119127E5C0A0B0989E, xmp.iid:D7A9AFD95424E3119127E5C0A0B0989E, xmp.iid:F69FBBFAEC4EE4118D68C5BB9C1053B1, xmp.iid:F79FBBFAEC4EE4118D68C5BB9C1053B1, xmp.iid:25B7136EF34EE4118D68C5BB9C1053B1, xmp.iid:E20ADBA2754FE411957F9BC1C8D2A8A0, xmp.iid:367A64EF754FE411957F9BC1C8D2A8A0, xmp.iid:377A64EF754FE411957F9BC1C8D2A8A0, xmp.iid:387A64EF754FE411957F9BC1C8D2A8A0, xmp.iid:397A64EF754FE411957F9BC1C8D2A8A0, xmp.iid:A5207A7D794FE411957F9BC1C8D2A8A0, xmp.iid:A6207A7D794FE411957F9BC1C8D2A8A0, xmp.iid:23C28C533C55E4118A43AF7342E734BD, xmp.iid:A2DA9ACADA55E41182D9E5051162BAC8, xmp.iid:25C6E615BB5DE411852DF2B8F86FAC4E, xmp.iid:4E1B32E3BB5DE411852DF2B8F86FAC4E, xmp.iid:F8A9F0C1396AE411A073BB1DC5EF2E2D, xmp.iid:00EF79E1EAC3E4119EDDF009A29A1DAA, xmp.iid:4C4F97F622F3E411ADEB9E747AC836F2, xmp.iid:204DE7646159E6119651EA460E8A136F, xmp.iid:BBD669B0375AE61199A2C187DACB6849, xmp.iid:CE27240E3C5AE61199A2C187DACB6849, xmp.iid:56B058AE405AE61199A2C187DACB6849, xmp.iid:24BB0AC7435AE61199A2C187DACB6849, xmp.iid:003FCE1D515AE611AD76B79ACA6EC944, xmp.iid:A226DD52545AE611AB47E238A1F33FCD, xmp.iid:BCBDC08ACA5AE611AABDE070E87482DE, xmp.iid:FF03E5FECB5AE611AABDE070E87482DE, xmp.iid:BBB68566CD5AE611AABDE070E87482DE, xmp.iid:2BB827B3CE5AE611AABDE070E87482DE, xmp.iid:A3D637A1E95AE6119508F15307DD0C40, xmp.iid:7E33D6BBEF5AE6119508F15307DD0C40, xmp.iid:DDDFCC05FA5AE6119508F15307DD0C40, xmp.iid:C49D0085265DE611925FBCA6B603AF77, xmp.iid:C52FF36A4F5DE611830CCBAD4229CFC2, xmp.iid:04B99FCA625DE611830CCBAD4229CFC2, xmp.iid:98F64535645DE611AE6BAFC4805D4C48, xmp.iid:467FC4276C5DE611AE6BAFC4805D4C48, xmp.iid:E2E8D0EA705DE611AE6BAFC4805D4C48, xmp.iid:13082079725DE611AE6BAFC4805D4C48, xmp.iid:00AE53AE725DE611AE6BAFC4805D4C48, xmp.iid:CC7BFE46755DE611830CCBAD4229CFC2, xmp.iid:D6BA1BC1EE5DE611951894CEE0318999, xmp.iid:BF91CE67EF5DE611951894CEE0318999, xmp.iid:ADFDD6A7EF5DE611951894CEE0318999, xmp.iid:56866880055EE611951894CEE0318999, xmp.iid:64F1EB89115EE611951894CEE0318999, xmp.iid:96780DA82C5EE611951894CEE0318999, xmp.iid:A7C6586D2F5EE611951894CEE0318999, xmp.iid:348D8E4D335EE611951894CEE0318999, xmp.iid:F66F2A7E335EE611951894CEE0318999, xmp.iid:D47963F23A5EE611951894CEE0318999, xmp.iid:BB5754683B5EE611951894CEE0318999, xmp.iid:C1967C693E5EE611951894CEE0318999, xmp.iid:A7184E42BC5EE61195579827FEB4A73D, xmp.iid:87518B70CE5EE61195579827FEB4A73D, xmp.iid:BC1B770DD85EE61195579827FEB4A73D, xmp.iid:64E4E4B5DC5EE61195579827FEB4A73D, xmp.iid:F47EC253E15EE61195579827FEB4A73D, xmp.iid:11A2C2BDEA5EE61195579827FEB4A73D, xmp.iid:67B12C5FEB5EE61195579827FEB4A73D, xmp.iid:DE9523D3065FE611A7ED8782C08ACA6A, xmp.iid:A70ACD7C855FE6118B16863FDDE9C176, xmp.iid:3584EC25915FE6118B16863FDDE9C176, xmp.iid:60B9EFE6935FE6118B16863FDDE9C176, xmp.iid:C5993185965FE6118B16863FDDE9C176, xmp.iid:9FD94B1E995FE6118B16863FDDE9C176, xmp.iid:78D09271B55FE6118B16863FDDE9C176, xmp.iid:E839DA24B85FE6118B16863FDDE9C176, xmp.iid:DFF0B930BF5FE611BFB59D066847386E, xmp.iid:A7567838C35FE611BB02D6D905CCD063, xmp.iid:0D5AA3DECF5FE611BB02D6D905CCD063, xmp.iid:049F554CD05FE611BB02D6D905CCD063, xmp.iid:3132B173D05FE611BB02D6D905CCD063, xmp.iid:7370F593D05FE611BB02D6D905CCD063, xmp.iid:7E8628BC6F60E611B645F4A689F3447C, xmp.iid:1EAB3CF56F63E61192C9DD1C64B724DB, xmp.iid:1FAB3CF56F63E61192C9DD1C64B724DB, xmp.iid:E060E3B3A663E611B9FEF832B04806B8, xmp.iid:A44C0714AF63E611B9FEF832B04806B8, xmp.iid:F7062CD9B563E611B8E2B4916813AD56, xmp.iid:25DD8FC6B863E6118B2FB9F24820804C, xmp.iid:9AB7E506B963E6118B2FB9F24820804C, xmp.iid:DF7C16DE4464E6118BA7CDCA007FA70D, xmp.iid:3FCEB3D54964E6118BA7CDCA007FA70D, xmp.iid:9F52E43D5064E6118BA7CDCA007FA70D, xmp.iid:9C7B0AB35764E6118BA7CDCA007FA70D, xmp.iid:B6DF291B5964E6118BA7CDCA007FA70D, xmp.iid:E603C3865A64E6118BA7CDCA007FA70D, xmp.iid:5517D4B75D64E6118BA7CDCA007FA70D, xmp.iid:AC19BB766164E6118BA7CDCA007FA70D, xmp.iid:857C48176664E6118BA7CDCA007FA70D, xmp.iid:5B0B4B427B64E6118BA7CDCA007FA70D, xmp.iid:C813F18B7D64E611BEC281BAF98DA339, xmp.iid:16365D1E7F64E611BEC281BAF98DA339, xmp.iid:8E1AB3938364E611BEC281BAF98DA339, xmp.iid:9D09F2028664E611BEC281BAF98DA339, xmp.iid:85CE412F0B65E611BCFADBF2B789647A, xmp.iid:2C6228421A65E611BCFADBF2B789647A, xmp.iid:A6C411842065E611BCFADBF2B789647A, xmp.iid:F314BE6F2365E611BCFADBF2B789647A, xmp.iid:3FC055942B65E611AC7DB24A250B9382, xmp.iid:9E10C4663265E611AC7DB24A250B9382, xmp.iid:0668B7363465E611978D96E9162233BB, xmp.iid:C694AAA63765E611978D96E9162233BB, xmp.iid:B7F528F93B65E611978D96E9162233BB, xmp.iid:08F7D9643C65E611978D96E9162233BB, xmp.iid:6FF7FC6B3D65E611978D96E9162233BB, xmp.iid:70F7FC6B3D65E611978D96E9162233BB, xmp.iid:71F7FC6B3D65E611978D96E9162233BB, xmp.iid:65EE422C4265E611978D96E9162233BB, xmp.iid:0484D8934265E611978D96E9162233BB, xmp.iid:BDE49D5A4D65E611B13DA3CE89098294, xmp.iid:018E57475165E611BC68ABBA6FE8DFD2, xmp.iid:D7B5407ECD65E6119C60B4AB960BB925, xmp.iid:CF1C949AD465E6118B1B83FBA835DF41, xmp.iid:66CE006DDB65E6118209992A0313CC58, xmp.iid:72BA2B693668E6119387CFB31808515D, xmp.iid:86FEE23F3C68E6119387CFB31808515D, xmp.iid:7CE5D9304168E6119387CFB31808515D, xmp.iid:D4764CF14F68E6119387CFB31808515D, xmp.iid:9E2231835068E6119387CFB31808515D, xmp.iid:268F246D6B68E6119387CFB31808515D, xmp.iid:701F67B86C68E6119387CFB31808515D, xmp.iid:2FE99A0E7468E6118581CCE6C3AE491A, xmp.iid:7835647E7568E611B3BE985BC194B2FC, xmp.iid:2FA353B47568E611B3BE985BC194B2FC, xmp.iid:7B071ED2FF68E6118789EB33BDFB0D70, xmp.iid:785F909F0269E6118789EB33BDFB0D70, xmp.iid:F04CC8240369E6118789EB33BDFB0D70, xmp.iid:1BEF636A0369E6118789EB33BDFB0D70, xmp.iid:3EB9A58A0369E6118789EB33BDFB0D70, xmp.iid:3FB9A58A0369E6118789EB33BDFB0D70, xmp.iid:456563641669E611A289C4E224A3A074, xmp.iid:EBC9EC2C1769E611A289C4E224A3A074, xmp.iid:ECC9EC2C1769E611A289C4E224A3A074, xmp.iid:C7F584461869E611A289C4E224A3A074, xmp.iid:C8F584461869E611A289C4E224A3A074, xmp.iid:D4F7CE9B2C69E6119B9180DD00893AF5, xmp.iid:E26F40D42E69E6119B9180DD00893AF5, xmp.iid:3B12E1B03069E6119B9180DD00893AF5, xmp.iid:352CBE743969E611B68DC5B02E8FC979, xmp.iid:2E7BCE953A69E611BDA6CBD407F69719, xmp.iid:068001BD3A69E611BDA6CBD407F69719, xmp.iid:078001BD3A69E611BDA6CBD407F69719, xmp.iid:088001BD3A69E611BDA6CBD407F69719, xmp.iid:393687A7D469E6119909E3F68B0FC634, xmp.iid:BCC23125D569E6119909E3F68B0FC634, xmp.iid:4187AB40D569E6119909E3F68B0FC634, xmp.iid:4287AB40D569E6119909E3F68B0FC634, xmp.iid:A1E86D5EFE69E6118F3CE411611753CD, xmp.iid:BA3E0AF2976AE6119B54C714F7CFA2CA, xmp.iid:310D8D9B9A6AE6119B54C714F7CFA2CA, xmp.iid:B3BBF0679E6AE6119B54C714F7CFA2CA, xmp.iid:26AB76959E6AE6119B54C714F7CFA2CA, xmp.iid:17E145644C6BE611A060E861A0CD5DEA, xmp.iid:46A54CD54D6BE611A060E861A0CD5DEA, xmp.iid:C6A0E33E506BE611A060E861A0CD5DEA, xmp.iid:ADC22CB9B06DE611A2A0F4B50AB5A2EE, xmp.iid:EC535739B16DE611A2A0F4B50AB5A2EE, xmp.iid:D289E8E2B56DE611A491FE79763214C6, xmp.iid:6418E0CBBD6DE611A491FE79763214C6, xmp.iid:FBE0A248BE6DE611A491FE79763214C6, xmp.iid:D3B3CA8EBE6DE611A491FE79763214C6, xmp.iid:56ACCDAAC16DE611BF90EDCDC8844BB9, xmp.iid:783C8C4CC56DE611B50EA29631E35AC6, xmp.iid:8616F4CBC56DE611B50EA29631E35AC6, xmp.iid:136FD214C86DE611B50EA29631E35AC6, xmp.iid:A22AC94EC96DE611B50EA29631E35AC6, xmp.iid:00FD2C46E16DE6118043FF1FF74A52D4, xmp.iid:62360925E26DE6118043FF1FF74A52D4, xmp.iid:6D7AED3E706EE611B8C9B8389E7F936B, xmp.iid:CBB5CBFA706EE611A948B082FF7220BA, xmp.iid:CCA8F0C2736EE611A948B082FF7220BA, xmp.iid:9DAF3268A96EE6118F1BB84526D9579F, xmp.iid:9EAF3268A96EE6118F1BB84526D9579F, xmp.iid:7B179DC8A96EE6118F1BB84526D9579F, xmp.iid:4080398B466FE611B6E2CD2746A0E9D9, xmp.iid:7E1BA5FC466FE611B6E2CD2746A0E9D9, xmp.iid:90BB159F476FE611B6E2CD2746A0E9D9, xmp.iid:7A887493496FE611B6E2CD2746A0E9D9, xmp.iid:B01F0D9C4A6FE6119168E3FD12E2D0E8, xmp.iid:FA3537AB4A6FE6119168E3FD12E2D0E8, xmp.iid:FB3537AB4A6FE6119168E3FD12E2D0E8, xmp.iid:396C3DC94A6FE6119168E3FD12E2D0E8, xmp.iid:6D2F86EB4A6FE6119168E3FD12E2D0E8, xmp.iid:AE8CDA374B6FE6119168E3FD12E2D0E8, xmp.iid:AF8CDA374B6FE6119168E3FD12E2D0E8, xmp.iid:EEFEA583556FE611A2D3FF1F60717E08, xmp.iid:77B4042A6D6FE6119D3D9E88C05767D0, xmp.iid:F1A75432097FE611A5B9CC4FEF9B3877, xmp.iid:0156CBF2107FE61191BCD984EB833062, xmp.iid:6A0497A0147FE611A5B9CC4FEF9B3877, xmp.iid:58AF6BF03A7FE61191BCD984EB833062, xmp.iid:BF52B6F7D77FE611B394ACCAE5B39FF0, xmp.iid:96EDCA0FE07FE61191AC97044ED35D49, xmp.iid:CD085E209DB0E611A1089CC71C7071A8, xmp.iid:D5365CB9C8B0E611A1089CC71C7071A8, xmp.iid:92DE96FB6DB1E6119BDDA90A208DB634, xmp.iid:1BAEACCD89B1E6119BDDA90A208DB634, xmp.iid:7B2F9E588DB1E6119BDDA90A208DB634, xmp.iid:01B5579C8EB1E6119BDDA90A208DB634, xmp.iid:06194B1757B2E611BB11DB1AB7697645, xmp.iid:871A4207EBB2E611BD0A8E3E7FD60676, xmp.iid:D7B70CA6F8B2E611BD0A8E3E7FD60676, xmp.iid:0DCCD8934CB5E6118B8AA58F2B7573F4, xmp.iid:E058F1C44CB5E6118B8AA58F2B7573F4, xmp.iid:B445DEBB59B5E6118B8AA58F2B7573F4, xmp.iid:8A0625CA7EB5E611BDA4BED5049E5001, xmp.iid:464CCF1C7FB5E61195DACA48DD14FC7E, xmp.iid:35A66DAAFCB5E611A9CCD224E33F8A50, xmp.iid:046F4810FDB5E611A9CCD224E33F8A50, xmp.iid:056F4810FDB5E611A9CCD224E33F8A50, xmp.iid:67111199FFB5E611B0F9D04482E89695, xmp.iid:D772C60F00B6E611B0F9D04482E89695, xmp.iid:55ABCC6AECB6E6119E12CA074E843F2F, xmp.iid:E1707AB4FEB6E6119E12CA074E843F2F, xmp.iid:90D64F94FFB6E6119E12CA074E843F2F, xmp.iid:767E02C19EB7E611AC1092458954820F, xmp.iid:CE29A32B7FC0E611B4DAAEB984D90184, xmp.iid:398FABE308C1E611A23C938378BBAC57, xmp.iid:AC4524A009C1E611A23C938378BBAC57, xmp.iid:D4C6E24C3FE2E611B813845B5AE048DA, xmp.iid:7BBABBADE8E2E611A2A492E1A8402718, xmp.iid:4CC88740FBE2E611B9C0BA3E90F193A2, xmp.iid:C165538B16E3E611992EDAFEC116CC57, xmp.iid:D083DEA75EE8E611B677BD1F05CC4D27, xmp.iid:499C184261E8E611B677BD1F05CC4D27, xmp.iid:26F600DD5CF4E611A67AC6B27DC6D700, xmp.iid:35F7BC3EE1F4E611B7269216F0599EEA, xmp.iid:7C2EE531FDF4E611B7269216F0599EEA, xmp.iid:BC79CEF602F5E611B7269216F0599EEA, xmp.iid:647898FF58F7E611B603B1BB37E9A843, xmp.iid:FC874E1C5CF7E611B603B1BB37E9A843, xmp.iid:BAD9785567F7E611B603B1BB37E9A843, xmp.iid:8E136E9C10F8E6119AB2DFF0EB4CCCC5, xmp.iid:AD16193F16F8E6119AB2DFF0EB4CCCC5, xmp.iid:F1987A4642F8E6119AB2DFF0EB4CCCC5, xmp.iid:8E618CE8D0F8E611A426E70CFC76CEF9, xmp.iid:23D8F6F4D5F8E611A426E70CFC76CEF9, xmp.iid:EF26B7F25FFEE611B4F3DA000234B424, xmp.iid:4EC3FE1883FEE6118C02F04E54AB3282, xmp.iid:EDDCB72A87FEE6118C02F04E54AB3282, xmp.iid:8F7CA5B78FFEE6118C02F04E54AB3282, xmp.iid:9E57F1D257FFE611ABACB11B350383C4, xmp.iid:C37F7F3BF2FFE6119296B189399A9EBE, xmp.iid:3728E3AC4A03E711A8DBA78EC71E64C5, xmp.iid:2DA7D097EF03E7118600E79E56F96848, xmp.iid:CC6BBD1D1304E7118600E79E56F96848, xmp.iid:3119C4FEB504E711A32FA30FC9BB74E8, xmp.iid:C2412128D107E711B3E9802A7B2C1FD7, xmp.iid:8B55C621D307E711B3E9802A7B2C1FD7, xmp.iid:EC0BB89A7D09E711BF10DF195EB2F4E2, xmp.iid:14D6AE5E450DE711BA54C0378F70557C, xmp.iid:D57BE77E320EE7119B3EA2DF83B00B68, xmp.iid:855FC9B2FC2FE71187F0DBF5ED86F372, xmp.iid:08D69E007C31E71186218ECB4C34B17B, xmp.iid:B7B196B1C933E711AE17FE2D671D1D90, xmp.iid:B8B196B1C933E711AE17FE2D671D1D90, xmp.iid:B9B196B1C933E711AE17FE2D671D1D90, xmp.iid:E39ED65EEB33E71196B189932F87FC3F History When : 2011:11:22 07:32:04+01:00, 2011:11:22 07:34:09+01:00, 2011:11:22 07:34:09+01:00, 2011:11:22 07:40:36+01:00, 2011:11:22 07:46:28+01:00, 2011:11:22 07:47:29+01:00, 2011:11:22 07:47:29+01:00, 2011:11:22 07:49:01+01:00, 2011:11:22 07:55:28+01:00, 2011:11:22 10:32:21+01:00, 2011:11:22 11:09:28+01:00, 2011:11:22 12:12:37+01:00, 2011:11:22 14:11:19+01:00, 2011:11:22 15:39:10+01:00, 2011:11:22 15:54:45+01:00, 2011:11:24 10:12:09+01:00, 2011:11:24 10:36:53+01:00, 2011:11:24 11:31:42+01:00, 2011:11:24 11:57:16+01:00, 2011:11:24 12:31:17+01:00, 2011:11:24 13:45:50+01:00, 2011:11:24 13:46:34+01:00, 2011:11:24 13:47:13+01:00, 2011:11:24 13:47:48+01:00, 2011:11:24 13:57:15+01:00, 2011:11:24 14:02:35+01:00, 2011:11:24 14:06:50+01:00, 2011:11:24 14:09:13+01:00, 2011:11:24 14:11:54+01:00, 2011:11:24 14:12:41+01:00, 2011:11:24 14:13:49+01:00, 2011:11:24 14:13:49+01:00, 2011:11:24 15:59:18+01:00, 2011:11:24 16:00:28+01:00, 2011:11:25 07:16:14+01:00, 2011:11:25 08:09:23+01:00, 2011:11:25 08:36:02+01:00, 2011:11:25 08:36:37+01:00, 2011:11:25 08:36:37+01:00, 2011:12:16 09:26:48+01:00, 2011:12:16 09:26:50+01:00, 2011:12:16 09:41:36+01:00, 2012:01:16 15:28:30+01:00, 2012:01:16 15:32:11+01:00, 2012:01:16 15:33:07+01:00, 2012:03:05 11:22:13+01:00, 2012:03:05 11:22:14+01:00, 2012:03:05 11:40:52+01:00, 2012:03:05 13:54:33+01:00, 2012:03:05 14:04:54+01:00, 2012:03:05 14:16+01:00, 2012:03:05 14:18:02+01:00, 2012:03:05 14:19:32+01:00, 2012:03:05 14:29:51+01:00, 2012:03:05 14:32:17+01:00, 2012:03:05 14:32:33+01:00, 2012:03:05 14:32:33+01:00, 2012:03:05 14:46:15+01:00, 2012:03:05 14:49:48+01:00, 2012:03:05 14:55:10+01:00, 2012:03:05 15:02:50+01:00, 2012:03:05 15:03+01:00, 2012:03:05 15:03+01:00, 2012:05:04 07:26:23+02:00, 2012:05:04 07:31:54+02:00, 2012:05:04 07:31:54+02:00, 2012:05:04 07:39:52+02:00, 2012:05:30 11:34:17+02:00, 2012:05:30 11:43:54+02:00, 2012:05:30 11:44:10+02:00, 2012:05:30 11:44:11+02:00, 2012:05:30 11:59:14+02:00, 2012:05:30 11:59:14+02:00, 2012:05:31 13:58:53+02:00, 2012:05:31 14:01:29+02:00, 2012:06:01 11:50:45+02:00, 2012:06:01 12:03:29+02:00, 2012:06:12 07:03:14+02:00, 2012:06:12 07:04:39+02:00, 2012:06:12 07:13:43+02:00, 2012:06:12 07:13:43+02:00, 2012:06:12 07:18:19+02:00, 2013:02:04 10:22:10+01:00, 2013:02:04 10:28:31+01:00, 2013:02:04 10:30:44+01:00, 2013:02:04 10:34:12+01:00, 2013:02:04 10:40:41+01:00, 2013:02:04 10:40:41+01:00, 2013:07:29 15:44:27+02:00, 2013:07:29 15:45:02+02:00, 2013:07:29 15:54:16+02:00, 2013:07:29 16:25:31+02:00, 2013:07:30 07:29:16+02:00, 2013:07:30 07:37:05+02:00, 2013:07:30 07:37:05+02:00, 2013:07:30 07:47:10+02:00, 2013:07:30 08:06:28+02:00, 2013:07:30 08:06:28+02:00, 2013:07:30 08:21:42+02:00, 2013:07:30 08:22:35+02:00, 2013:07:30 08:22:35+02:00, 2013:07:30 08:41:25+02:00, 2013:07:30 08:41:25+02:00, 2013:07:30 08:51:51+02:00, 2013:07:30 08:58:29+02:00, 2013:07:30 09:01:05+02:00, 2013:07:30 09:01:51+02:00, 2013:07:30 09:05:47+02:00, 2013:07:30 09:05:47+02:00, 2013:07:31 15:08:18+02:00, 2013:09:23 15:42:25+02:00, 2013:09:23 15:48:49+02:00, 2013:09:23 15:51:57+02:00, 2014:10:08 15:14:05+02:00, 2014:10:08 15:14:05+02:00, 2014:10:08 16:00:15+02:00, 2014:10:09 07:32:19+02:00, 2014:10:09 07:34:27+02:00, 2014:10:09 07:34:27+02:00, 2014:10:09 07:42:21+02:00, 2014:10:09 07:59:44+02:00, 2014:10:09 07:59:54+02:00, 2014:10:09 07:59:54+02:00, 2014:10:16 15:57:11+02:00, 2014:10:17 10:51:31+02:00, 2014:10:27 10:24:43+01:00, 2014:10:27 10:30:27+01:00, 2014:11:12 08:01:42+01:00, 2015:03:06 11:23:50+01:00, 2015:05:05 14:33:42+02:00, 2016:08:03 12:02:32+02:00, 2016:08:04 13:36:31+02:00, 2016:08:04 14:07:46+02:00, 2016:08:04 14:40:53+02:00, 2016:08:04 15:03:03+02:00, 2016:08:04 16:38:32+02:00, 2016:08:04 17:01:29+02:00, 2016:08:05 07:07:43+02:00, 2016:08:05 07:18:08+02:00, 2016:08:05 07:28:11+02:00, 2016:08:05 07:37:29+02:00, 2016:08:05 10:50:16+02:00, 2016:08:05 11:33:57+02:00, 2016:08:05 12:47:36+02:00, 2016:08:08 07:11:10+02:00, 2016:08:08 12:03:55+02:00, 2016:08:08 14:22:36+02:00, 2016:08:08 14:32:45+02:00, 2016:08:08 15:29:38+02:00, 2016:08:08 16:03:43+02:00, 2016:08:08 16:14:52+02:00, 2016:08:08 16:16:21+02:00, 2016:08:08 16:34:56+02:00, 2016:08:09 07:04:30+02:00, 2016:08:09 07:09:10+02:00, 2016:08:09 07:10:57+02:00, 2016:08:09 09:47:20+02:00, 2016:08:09 11:13:30+02:00, 2016:08:09 14:27:37+02:00, 2016:08:09 14:47:27+02:00, 2016:08:09 15:15:11+02:00, 2016:08:09 15:16:33+02:00, 2016:08:09 16:09:54+02:00, 2016:08:09 16:13:12+02:00, 2016:08:09 16:34:43+02:00, 2016:08:10 07:35:34+02:00, 2016:08:10 09:45:42+02:00, 2016:08:10 10:54:31+02:00, 2016:08:10 11:27:51+02:00, 2016:08:10 12:00:54+02:00, 2016:08:10 13:08:18+02:00, 2016:08:10 13:12:48+02:00, 2016:08:10 16:29:19+02:00, 2016:08:11 07:36:01+02:00, 2016:08:11 08:59:29+02:00, 2016:08:11 09:19:12+02:00, 2016:08:11 09:37:56+02:00, 2016:08:11 09:56:32+02:00, 2016:08:11 13:19:18+02:00, 2016:08:11 13:38:37+02:00, 2016:08:11 14:29:04+02:00, 2016:08:11 14:57:55+02:00, 2016:08:11 16:28:27+02:00, 2016:08:11 16:31:32+02:00, 2016:08:11 16:32:38+02:00, 2016:08:11 16:33:32+02:00, 2016:08:12 11:32:49+02:00, 2016:08:16 07:11:58+02:00, 2016:08:16 07:15:18+02:00, 2016:08:16 13:43:51+02:00, 2016:08:16 14:43:48+02:00, 2016:08:16 15:32:16+02:00, 2016:08:16 15:53:13+02:00, 2016:08:16 15:55:01+02:00, 2016:08:17 08:36:02+02:00, 2016:08:17 09:11:36+02:00, 2016:08:17 09:57:28+02:00, 2016:08:17 10:50:51+02:00, 2016:08:17 11:00:55+02:00, 2016:08:17 11:11:05+02:00, 2016:08:17 11:33:56+02:00, 2016:08:17 12:00:44+02:00, 2016:08:17 12:33:52+02:00, 2016:08:17 15:05:23+02:00, 2016:08:17 15:21:46+02:00, 2016:08:17 15:33:01+02:00, 2016:08:17 16:04:56+02:00, 2016:08:17 16:22:21+02:00, 2016:08:18 08:15:39+02:00, 2016:08:18 10:03:33+02:00, 2016:08:18 10:48:21+02:00, 2016:08:18 11:09:15+02:00, 2016:08:18 12:07:32+02:00, 2016:08:18 12:56:22+02:00, 2016:08:18 13:09:21+02:00, 2016:08:18 13:33:57+02:00, 2016:08:18 14:04:53+02:00, 2016:08:18 14:07:54+02:00, 2016:08:18 14:15:16+02:00, 2016:08:18 14:16:37+02:00, 2016:08:18 14:28:05+02:00, 2016:08:18 14:49:16+02:00, 2016:08:18 14:52:10+02:00, 2016:08:18 16:09:18+02:00, 2016:08:18 16:37:24+02:00, 2016:08:19 07:26:34+02:00, 2016:08:19 08:17:28+02:00, 2016:08:19 09:06:18+02:00, 2016:08:22 09:02:38+02:00, 2016:08:22 09:44:26+02:00, 2016:08:22 10:19:48+02:00, 2016:08:22 12:05:24+02:00, 2016:08:22 12:09:28+02:00, 2016:08:22 15:22:08+02:00, 2016:08:22 15:31:24+02:00, 2016:08:22 16:23:55+02:00, 2016:08:22 16:34:12+02:00, 2016:08:22 16:35:42+02:00, 2016:08:23 09:04:23+02:00, 2016:08:23 09:24:26+02:00, 2016:08:23 09:28:10+02:00, 2016:08:23 09:30:07+02:00, 2016:08:23 09:31:01+02:00, 2016:08:23 10:28:24+02:00, 2016:08:23 11:45:57+02:00, 2016:08:23 11:51:34+02:00, 2016:08:23 11:58:25+02:00, 2016:08:23 11:59:26+02:00, 2016:08:23 12:02:51+02:00, 2016:08:23 14:24:59+02:00, 2016:08:23 14:40:53+02:00, 2016:08:23 14:54:12+02:00, 2016:08:23 15:56:57+02:00, 2016:08:23 16:05:02+02:00, 2016:08:23 16:06:08+02:00, 2016:08:23 16:07:05+02:00, 2016:08:23 16:07:05+02:00, 2016:08:24 10:27:54+02:00, 2016:08:24 10:31:25+02:00, 2016:08:24 10:32:11+02:00, 2016:08:24 10:37:07+02:00, 2016:08:24 15:26:30+02:00, 2016:08:25 09:45:51+02:00, 2016:08:25 10:04:54+02:00, 2016:08:25 10:32:06+02:00, 2016:08:25 10:33:22+02:00, 2016:08:26 07:17:32+02:00, 2016:08:26 07:27:51+02:00, 2016:08:26 07:45:07+02:00, 2016:08:29 08:20:47+02:00, 2016:08:29 08:24:22+02:00, 2016:08:29 08:57:44+02:00, 2016:08:29 09:54:21+02:00, 2016:08:29 09:57:51+02:00, 2016:08:29 09:59:48+02:00, 2016:08:29 10:22:04+02:00, 2016:08:29 10:48:04+02:00, 2016:08:29 10:51:37+02:00, 2016:08:29 11:07:59+02:00, 2016:08:29 11:16:45+02:00, 2016:08:29 14:08:19+02:00, 2016:08:29 14:14:33+02:00, 2016:08:30 07:11:45+02:00, 2016:08:30 07:17+02:00, 2016:08:30 07:36:55+02:00, 2016:08:30 14:00:55+02:00, 2016:08:30 14:03:37+02:00, 2016:08:30 14:03:37+02:00, 2016:08:31 08:45:45+02:00, 2016:08:31 08:48:55+02:00, 2016:08:31 08:53:28+02:00, 2016:08:31 09:07:27+02:00, 2016:08:31 09:14:51+02:00, 2016:08:31 09:15:17+02:00, 2016:08:31 09:15:38+02:00, 2016:08:31 09:16:07+02:00, 2016:08:31 09:17:05+02:00, 2016:08:31 09:19:13+02:00, 2016:08:31 09:22:20+02:00, 2016:08:31 10:32:55+02:00, 2016:08:31 13:22:12+02:00, 2016:09:20 10:06:55+02:00, 2016:09:20 11:02:25+02:00, 2016:09:20 11:28:45+02:00, 2016:09:20 16:03+02:00, 2016:09:21 10:47:03+02:00, 2016:09:21 11:44:59+02:00, 2016:11:22 11:19:18+01:00, 2016:11:22 16:31:23+01:00, 2016:11:23 12:14:21+01:00, 2016:11:23 15:33:30+01:00, 2016:11:23 15:58:51+01:00, 2016:11:23 16:07:54+01:00, 2016:11:24 16:03+01:00, 2016:11:25 09:41:59+01:00, 2016:11:25 11:19:28+01:00, 2016:11:28 10:25:18+01:00, 2016:11:28 10:26:40+01:00, 2016:11:28 11:59:29+01:00, 2016:11:28 16:24:44+01:00, 2016:11:28 16:27:03+01:00, 2016:11:29 07:25:47+01:00, 2016:11:29 07:28:38+01:00, 2016:11:29 07:28:38+01:00, 2016:11:29 07:46:47+01:00, 2016:11:29 07:50:06+01:00, 2016:11:30 12:02+01:00, 2016:11:30 14:12:54+01:00, 2016:11:30 14:19:10+01:00, 2016:12:01 09:18:35+01:00, 2016:12:12 16:25:10+01:00, 2016:12:13 08:51+01:00, 2016:12:13 08:56:16+01:00, 2017:01:24 15:13:38+01:00, 2017:01:25 11:26:05+01:00, 2017:01:25 13:39:02+01:00, 2017:01:25 16:54:24+01:00, 2017:02:01 10:13:12+01:00, 2017:02:01 10:31:49+01:00, 2017:02:16 16:30:36+01:00, 2017:02:17 08:18:13+01:00, 2017:02:17 11:38:18+01:00, 2017:02:17 12:19:36+01:00, 2017:02:20 11:40:29+01:00, 2017:02:20 12:02:46+01:00, 2017:02:20 13:23:06+01:00, 2017:02:21 09:34:50+01:00, 2017:02:21 10:15:11+01:00, 2017:02:21 15:30:21+01:00, 2017:02:22 08:31:22+01:00, 2017:02:22 09:07:30+01:00, 2017:03:01 10:17:52+01:00, 2017:03:01 14:29:29+01:00, 2017:03:01 14:58:37+01:00, 2017:03:01 15:59:49+01:00, 2017:03:02 15:52:14+01:00, 2017:03:03 10:17:32+01:00, 2017:03:07 16:28:12+01:00, 2017:03:08 12:08:43+01:00, 2017:03:08 16:23+01:00, 2017:03:09 11:48:56+01:00, 2017:03:13 10:40:56+01:00, 2017:03:13 10:55:04+01:00, 2017:03:15 13:47:52+01:00, 2017:03:20 09:15:25+01:00, 2017:03:21 13:32:49+01:00, 2017:05:03 14:33:23+02:00, 2017:05:05 12:17:11+02:00, 2017:05:08 10:38:21+02:00, 2017:05:08 10:39:58+02:00, 2017:05:08 10:39:58+02:00, 2017:05:08 14:39:25+02:00 History Software Agent : Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 6.0, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5, Adobe InDesign 7.5 History Changed : /, /metadata, /, /, /metadata, /;/metadata, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /, /metadata, /;/metadata, /, /, /, /, /, /metadata, /;/metadata, /metadata, /;/metadata, /, /, /, /, /metadata, /;/metadata, /, /, /, /, /, /, /, /, /metadata, /, /, /, /, /, /metadata, /, /, /metadata, /;/metadata, /, /, /, /metadata, /;/metadata, /metadata, /, /, /, /, /, /, /, /metadata, /;/metadata, /, /, /, /, /, /metadata, /, /metadata, /;/metadata, /, /, /, /metadata, /;/metadata, /, /metadata, /;/metadata, /, /metadata, /, /metadata, /;/metadata, /, /, /, /, /metadata, /;/metadata, /, /, /, /, /;/metadata, /metadata, /;/metadata, /;/metadata, /;/metadata, /metadata, /;/metadata, /;/metadata, /;/metadata, /metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /;/metadata, /metadata, /;/metadata Derived From Instance ID : xmp.iid:9C69270EE3F8E211B9F3E9EEA7AFBFCF Derived From Document ID : xmp.did:9569270EE3F8E211B9F3E9EEA7AFBFCF Derived From Original Document ID: xmp.did:93846FB1D314E111A2C6842E6BE7BE36 Derived From Rendition Class : default Doc Change Count : 71899 Format : application/pdf Title : untitled Producer : Acrobat Distiller 11.0 (Windows) Trapped : False Page Count : 84EXIF Metadata provided by EXIF.tools